1VLTA

Ligand binding domain of the wild-type aspartate receptor with aspartate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
142
structure length
142
Chain Sequence
b'GFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE RECEPTOR
publication title High-resolution structures of the ligand binding domain of the wild-type bacterial aspartate receptor.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Complex (chemotaxis/peptide)
total genus 55
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1vltA00
1WATA 4Z9IA 1LIHA 4H54A 1JMWA 3T9OA 2D4UA 1WASA 4Z9HA 1VLTA 4Z9JA 1VLSA 2LIGA 2ASRA 3ATPA
chains in the Genus database with same CATH superfamily
2CNWD 2NUPB 4Z9IA 1VTMP 1ZW3A 4JJFA 1W2WA 3JZ0A 3ZDLA 3CEXA 3QVZA 2GA0A 4MVRA 4YL1A 3L34A 2R7UA 5GPGB 4BEJA 2DI3A 1R4TA 4XPYA 1ZU4A 4DBRA 5A69A 5AGFA 3IQ5A 4QDLA 3VF0A 2R7VA 4ER9A 1G4US 1D1BA 2QUPA 4CJGA 3GM1A 1T5OA 1ZYRF 2Q9BA 2XXAA 1LPEA 4C3EA 4EBBA 1JPNA 3LLIA 4AE4B 2EPKX 1EKYA 4OIPF 4EUKB 2H7VC 2A0BA 4LDKA 4XPXA 1G5ZA 1O87A 4XLPF 3ECSA 3W2WA 2FGYA 3WG7C 4J30B 2LIGA 3Q6NA 1S05A 4MW8A 1A7EA 3UMIA 3ZC4A 2XSEA 2ZXWC 1LIHA 2OQMA 3NYMA 1AVOB 3AG3C 4BJ1A 1TWAA 3HTKC 3SNHA 3EGDB 3MLGA 3V7OA 1MMGA 1V54C 4NQFA 1AUEA 5DQZA 2DB4A 2XLMA 1K04A 3LEVA 4BEMJ 1PV3A 3EHMA 1ST6A 4B6IA 1VK5A 5BQIA 3KYJA 1NFNA 3O39A 4MVOA 4XEFA 1E86A 4NCQA 2IBFA 2NUTB 2H7BA 1CPRA 2RD9A 2EPMX 5L0DA 3T9OA 3RKOF 5BQHA 4CSAA 1ZHXA 4BG0A 1HY5A 2L6FA 4CS9C 2GDCA 2VCAA 1ZU5A 4XPWA 2EIMC 3HJCA 3SEOA 3RW0A 2CDQA 4OIOF 1LS4A 1M2VA 3N2ZB 2FFHA 1LKXA 1GQAA 2Y3GA 3DJNB 3M4CA 3EFOB 3NG1A 3NRHA 4R32A 4UDVA 4JCHA 3LLKA 2IOQA 4D4NA 4GQHA 3T6GB 2A69F 3WAQA 4YT5A 4NTFA 3UR3C 2D4UA 3O10A 2ZXRA 2R7XA 3M15A 2XL6A 5A6BD 3JSZA 3IEEA 1H6GA 4WGZA 4HFKB 5E3CA 2QY9A 2KYHA 2AWYA 3TQOA 4I1MA 4JW1A 3M1CB 5CIVA 3ZG1A 3DWWA 3QW1A 1VOMA 2NSGA 4AK9A 5A6JA 3DAGA 4IARA 1VMAA 4YJWA 5JP7A 2EPOA 2Z15A 4BJ5A 1BZ4A 4MVMA 4KNVA 4X0RA 2OG2A 2A1DD 4EHPA 1J8YF 4C7OA 3JRMO 3JCUQ 3S28A 2YLDA 1OKKD 3LNRA 3ZIBA 1SMYF 2VB6A 3W8IA 1YA9A 2EIJC 1JAFA 4WGYA 1A7DA 5KYWA 2FAPB 2P1AA 4PFOA 1EQ1A 5COMA 3B29A 4W8PA 3AQBA 4EBJA 1G4WR 1AEPA 4U5HA 2D5RB 4U5DE 2G3VA 2R7TA 3DXJF 1RKCA 2MYSA 4I1OB 4FX5A 4LLEA 1ZHYA 3OEOA 2XL4A 4FAPB 1D1AA 2XXAB 1YVIA 4JE9A 4A4AA 2L6HA 2Y3BA 1M56C 3NKDA 3ZQYA 1PCXA 3CSKA 4PJNA 4AL1A 2HV7A 3K66A 5DS6A 2YQYA 4MVZA 4U5GA 5T3TA 2X0CA 1E2XA 1G8XA 1OR3A 3C8GD 4Z9HA 3K1IA 1QZXA 5KYYA 2YWAA 1OCCC 2XS1A 3FAPB 2R25A 2R7WA 5F28E 4JTDB 3BEHA 3K1HA 1L3PA 5JS5A 1C17M 1TWHA 3ZWIA 1TQGA 1Z23A 1OQCA 3SP1A 1YARO 4IJJA 3RH3A 4DOZA 2O9XA 1BR1A 1EA8A 2WB7A 1YZAA 3I5PA 1U89A 4O6YA 5T3WA 2BE5F 2HJ3A 2MHRA 2HMQA 4O6NA 4PR9A 1MQVA 2ASRA 3FVYA 4ULWA 5B3SC 2V3CC 1QSPA 1V4AA 3IPMO 2XLDA 4Q4ZF 5L3VA 4YL3A 2KNHA 3U8VA 3LESA 4FESA 2A0UA 3QMKA 1NBBA 1RJ9A 4P9TA 3F46A 2ETSA 4RD9A 1QQ3A 1RCPA 2P0NA 3H2VA 4IWBA 3VRCA 3TJ6A 3NKEA 1M2VB 1SYQA 1TFKB 2HMZA 1K40A 4Z9JA 4MW3A 1U6HA 2C03A 1OW7A 2CYDA 3H2UA 1M6TA 1RKEA 4PK4A 1VLSA 3KKBA 4PFPA 3JYHA 4C3BA 1OCRC 4EWCA 1N1CA 2PX0A 3B9QA 3G4XA 2CCYA 4I3MA 3R7CA 3RYLA 2J9UA 3AG1C 3S0XA 5COGA 2ZXOA 5E2QA 3I4UA 3JYYA 1M2OA 2NPUA 5A6BA 1HMDA 1YDIA 2J46A 3EG9A 1A0BA 3AQCA 5K0IA 4N06A 4KNWA 4YK5A 1ORSC 2IXPA 4CIHA 4IB4A 4PACA 4JEAA 3SZRA 3FDQA 1QVXA 3C8ZA 2H7OA 2GAQA 2L7AA 2WZLA 3UMHA 3B0UX 4C7OB 2I8BA 2IXNA 2L81A 4YL0A 2JD3A 5B1AC 3U9MA 1KU2A 2W4BA 1CGNA 1I4YA 2BL2A 2P6VA 5KYWB 4MTGA 1OR2A 4HE8D 4LACB 3KPHA 4YT8A 4G7ZF 5KYXA 1QKRA 1SF8A 1BR4A 1UFBA 2I15A 4XWJA 5AC4A 2W45A 1SZIA 2YVKA 1YZCA 4MVUA 4U5FE 4OIRF 1MMNA 3UNGC 3FXHA 4A2NB 5DQTA 5A6KA 2R7RA 5F5FA 1R5ID 1IW7F 1NZEA 2J8WA 5JLIA 1C02A 1XWJA 2XL8A 3G50A 2A68F 1LI5A 2R7QA 2J7PD 1OW6A 2ZPAA 2LD6A 2KQ9A 2LQGA 4K1OA 1APCA 4N6HA 3C63A 2HSQA 1E83A 2YL3A 3TOMA 5BUOA 2PBEA 3SXKA 3EH1A 4DJ9A 5JVEA 2KK1A 3EHNA 1OXBA 5KYUA 1NLXA 4CJOA 1RMVA 4XQ1A 2XLEA 1YAUO 2PFDA 3M4BA 5DS5A 1K05A 5KYYB 4EBKA 4JRZA 3UGPA 3ASOC 1HW2A 2M4EA 1JR8A 4MNDA 1TR2A 5FZTA 5B3IA 2HFIA 2KSFA 2OU6A 3C8GA 3C7JA 3W4YA 5DS4A 2LFDA 3HNLA 4LDQA 3UGOA 2OEXA 4HEAJ 5HV9A 2XLVA 2PNOA 2VH3A 4ZLCA 2EILC 1T6UA 1T01A 1T6IA 4BJTA 3DD7A 1ZHTA 3ABKC 2UUIA 1KNYA 3AG2C 2OKUA 1GS9A 5L0FA 2M64A 1LM3B 1I5NA 1TFOB 2NG1A 3AOUA 1OCOC 2AP3A 2YL0A 2F22A 3K33A 3SXMA 1RJ9B 4BPMA 3NMKA 2Q4FA 4DRIB 3LJBA 3V5XA 5L0JA 4JVSA 1IZMA 4GEHA 1D0XA 1UG7A 1Z3IX 2HKVA 3SYNA 1LI7A 2VASA 3K6BA 2YL1A 2HS5A 2KJGA 3A11A 1VLTA 3A9CA 4ONSA 2QE9A 2QTVA 1Y4CA 4PJLA 1VYKA 1I4ZA 4PJMA 3VYWA 3KYIA 4YN0B 3WHNA 1WATA 4NY3A 1RKEB 1D0YA 2NUPA 2YL7A 3OWTA 1QLEC 2Q00A 4JURI 1GGQA 2W4MA 2W9YA 2CNWA 4AX2A 1NG1A 2IXMA 1ZZPA 4OIQF 1U0BB 2HUJA 3JRTA 2PP4A 4JTCB 3R2PA 3IQ6A 3GWNA 3QTHA 2IM8A 3DMDA 3U2LA 3EG9B 2CGEA 2P7VA 4E7SA 2NSFA 4EKWA 3MX3A 3GWLA 2GWWA 2YZSA 3FMSA 2E87A 3MYFA 5A6AA 5HSWA 2J0XA 1XZPA 4XLNF 4AE4A 5AC5A 3X1OA 4JEBA 3DE9A 3ZTZA 3PDMP 1FFHA 1YJGA 3BRJA 3GM2A 3S90A 2B0JA 2R05A 4E0HA 3T6JA 2A6HF 3GORA 4P9FA 5F5HA 3RF3A 1E85A 3E70C 3RQEA 1Q0FA 3RFYA 2IYLD 2YRFA 1WGWA 4U5CE 4JCZA 3FHDA 4MS2A 2H8AA 1TWCA 2L9JA 3AJMA 3CAXA 1Q0KA 3O6XA 2A6EF 3EGDA 4N6CA 1GM5A 4NTBA 1Z7Qc 1H7IA 1KTMA 5EHHA 4JZAA 4AL0A 2XLWA 2JX0A 1CGOA 2QNLA 3G4ZA 1BDJB 1NU9C 2LP4A 4YT2A 1Y6DA 4NC3A 5BQGA 5KYUB 1JPJA 4CS9A 1E84A 1Q0GA 3LAYA 2PX3A 5E33A 5L0GA 4ULVA 3ZQVA 4CSAC 1V55C 1WASA 3DZAA 3GEHA 4L6RA 2YKZA 3C8GB 4O79A 2J0WA 5L0HA 3GM3A 4O7GA 2LCHA 4P6IC 2J45A 2B0HA 5D91A 3EFOA 3T4RA 1O3UA 3LUTB 1H9TA 2Q9CA 1MNEA 1HE9A 2IXOA 4OD4A 3F47A 3L1MA 1J8MF 4YWQA 4Q5SF 2OJQA 2G62A 1JRAA 3JTLO 1A41A 4U9EA 4JKVA 2BC5A 2XS8A 1SR2A 256BA 1ORJA 3RIPA 3C62A 1M57C 3EZHA 3HKKA 3ZSUA 1T9KA 3JSEO 2Y69C 2HJMA 2DYSC 3PMRA 1S7ZA 5B1BC 1XZQA 3ZVRA 4G7HF 3DE8A 3AGUA 3EQLF 3RVYA 3TJ5A 1OCZC 2RSEB 2XLOA 3EZIA 4WJ0A 3U3BA 2Y39A 3KH2A 3U0CA 1PD0A 1PD1A 2AVKA 2KW3C 2LFFA 1VYIA 3HNIA 4J7TA 4MVSA 4CDAA 2XRHA 1MMAA 5CI8A 5CI9A 1OKKA 3W8HA 3T6BA 5JUAA 1ZHZA 1FTSA 2DYRC 4OINF 4MTFA 3WODF 2OCCC 3V5ZA 2GFHA 3CZ6A 3TULA 4CDVA 3UMKA 2EINC 2C04A 1H9GA 2YLIA 3CQZA 4KC9A 4MVQA 2Q3TA 2Q7RA 2EIKC 3TOLA 5EK0A 4J32B 1L7CA 1OW8A 4DXWA 1LVKA 3E9VA 1ZHWA 2HSBA 2EPNA 2OEVA 3I5QA 3HLZA 3U2MA 3IQCA 2WZGA 4XTKA 1LE2A 3PHF2 2YEVA 2OJED 4HFFB 1QPUA 3DM5A 2AWCA 3RVZA 5IY5C 3J06A 4DVZA 3EGXA 3DI5A 3GEIA 3V5YA 3POVA 1CGME 1TKNA 4BJ6C 1NFOA 5D92A 3JT1A 3K1IC 4U9DA 2WVNA 5T1DB 2AU5A 2LSEA 2J9BA 3L8JA 4RDAA 1Q0DA 2VC9A 4C3DA 2TMVP 2JPUA 3US6A 3QZCA 3IHUA 4FWVA 5JSLA 3X2QC 4RBNA 1EI7A 3LNMB 4IRUA 4PJJA 1YYXA 2XM0A 4JIOA 3U3FA 4LLCA 3LS1A 1DOWA 4F4BA 3KMIA 4G78A 2ZXPA 3DM9B 4CIPA 4G7OF 3DKAA 1NU7D 2VCBA 3KL4A 2Y3DA 3M79A 4K0DA 5DLJA 2HV6A 2WL8A 4ANJA 3S84A 1A7VA 1MNDA 3MYIA 1TWGA 3SXYA 4CS8C 2R03A 1NSGB 5KYNA 1Z5ZA 1D1CA 2PF4E 4IAQA 1HMOA 1LS1A 3U8PA 3RQGA 3NDBB 4IAOA 1FR0A 5JT4A 1C03A 2Y3HA 4N4WA 3GANA 1WWPA 3C18A 1MMDA 1Z6AA 1FMWA 2EPLX 3OA1A 4H54A 4QI0A 3VM6A 4IGGA 1BBHA 3U9JA 3S9OA 4LDRA 1WTYA 2DGJA 2HZ8A 2YLGA 1OXKA 1YLMA 3FOOA 4CS7A 5TJ5E 1FNTc 1Q0MA 1YYJA 4KI2A 2R7SA 1FMVA 3VAYA 1YA7O 3DJUB 3RQFA 1V74B 3GEEA 2WVQA 2WVOA 4I44A 3B0PA 1B68A 2WZFA 1WOLA 5KYXB 1FAPB 3NYJA 4NTAA 1T6QA 4W8KA 1BR2A 1FFTC 1JOGA 2Q9AA 4KBLA 3TD7A 3EJNA 4ZLDA 1DOVA 2KC3A 3AG4C 3NMJA 4JJGA 4J7YA 4E17A 3LS0A 4LERA 3ATPA 2LK4A 4WABA 3LEOA 2XM4A 3NMIA 3NYLA 5DVWA 3S27A 3SXZA 4XEKA 4DRHB 2QLAA 4JTAB 5L3QA 4DBQA 1ZVZA 3QW0A 4OD5A 2J9VA 5COFA 4DVYP 2NUTA 3EH2A 3ABLC 3EPVA 2J7PA 3IQTA 3N24A 5JRAA 5L0IA 3B0VC 3MFNA 4YT4A 1HE1A 3EGXB 4MTOA 3U5SA 4E0IA 2UUHA 3Q7GA 1Z63A 3QVYA 2J9WA 4BJ6A 4E18A 3ZTMA 4CBEA 2OOCA 1D0ZA 4XEVA 3DAFA 3MBGA 4CX9A 3ITFA 1WN0A 1VB5A 4JC7A 2R7OA 5EGYA 1ORYA 2L6GA 3Q6MA 3W2VA 2KGOA 4CDYA 3HNKA 3L0IA 1LE4A 2R02A 3FAJA 5FCLA 3O55A 2V26A 5E3AA 4E7ZA 3HNJA 2G3KA 2CW0F 3TK0A 4U5EE 1HW1A 2MWQA 2YHSA 3PCVA 4O6MA 2ICWG 4M63A 4K7BA 1F1MA 3L8IA 4U5BE 1CPQA 3S29A 3K7DA 4QI2A 2P61A 2R9RB 4G0HA 2ZD9A 3AGTA 3FOPA 4D4XA 3Q7LA 3B71A 2X51A 2XLHA 1ZW2A 2VCCA 3H65A 3N0TA 4H4KC 4CS8A 5L0CA 1JMWA 3GODA 4GYTA 4DRJB 1O5HA 4Q7CA 1RXQA 4MQ9F 3ASNC 4EIYA 3ABMC 4BJ5C
chains in the Genus database with same CATH topology
1WATA 4Z9IA 1LIHA 4H54A 1JMWA 3T9OA 2D4UA 1WASA 4Z9HA 1VLTA 4Z9JA 1VLSA 2LIGA 2ASRA 3ATPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAT A;  4Z9I A;  1LIH A;  4H54 A;  1JMW A;  3T9O A;  2D4U A;  1WAS A;  4Z9H A;  1VLT A;  4Z9J A;  1VLS A;  2LIG A;  2ASR A;  3ATP A; 
#chains in the Genus database with same CATH topology
 2CNW D;  2NUP B;  4Z9I A;  1VTM P;  1ZW3 A;  4JJF A;  1W2W A;  3JZ0 A;  3ZDL A;  3CEX A;  3QVZ A;  2GA0 A;  4MVR A;  4YL1 A;  3L34 A;  2R7U A;  5GPG B;  4BEJ A;  2DI3 A;  1R4T A;  4XPY A;  1ZU4 A;  4DBR A;  5A69 A;  5AGF A;  3IQ5 A;  4QDL A;  3VF0 A;  2R7V A;  4ER9 A;  1G4U S;  1D1B A;  2QUP A;  4CJG A;  3GM1 A;  1T5O A;  1ZYR F;  2Q9B A;  2XXA A;  1LPE A;  4C3E A;  4EBB A;  1JPN A;  3LLI A;  4AE4 B;  2EPK X;  1EKY A;  4OIP F;  4EUK B;  2H7V C;  2A0B A;  4LDK A;  4XPX A;  1G5Z A;  1O87 A;  4XLP F;  3ECS A;  3W2W A;  2FGY A;  3WG7 C;  4J30 B;  2LIG A;  3Q6N A;  1S05 A;  4MW8 A;  1A7E A;  3UMI A;  3ZC4 A;  2XSE A;  2ZXW C;  1LIH A;  2OQM A;  3NYM A;  1AVO B;  3AG3 C;  4BJ1 A;  1TWA A;  3HTK C;  3SNH A;  3EGD B;  3MLG A;  3V7O A;  1MMG A;  1V54 C;  4NQF A;  1AUE A;  5DQZ A;  2DB4 A;  2XLM A;  1K04 A;  3LEV A;  4BEM J;  1PV3 A;  3EHM A;  1ST6 A;  4B6I A;  1VK5 A;  5BQI A;  3KYJ A;  1NFN A;  3O39 A;  4MVO A;  4XEF A;  1E86 A;  4NCQ A;  2IBF A;  2NUT B;  2H7B A;  1CPR A;  2RD9 A;  2EPM X;  5L0D A;  3T9O A;  3RKO F;  5BQH A;  4CSA A;  1ZHX A;  4BG0 A;  1HY5 A;  2L6F A;  4CS9 C;  2GDC A;  2VCA A;  1ZU5 A;  4XPW A;  2EIM C;  3HJC A;  3SEO A;  3RW0 A;  2CDQ A;  4OIO F;  1LS4 A;  1M2V A;  3N2Z B;  2FFH A;  1LKX A;  1GQA A;  2Y3G A;  3DJN B;  3M4C A;  3EFO B;  3NG1 A;  3NRH A;  4R32 A;  4UDV A;  4JCH A;  3LLK A;  2IOQ A;  4D4N A;  4GQH A;  3T6G B;  2A69 F;  3WAQ A;  4YT5 A;  4NTF A;  3UR3 C;  2D4U A;  3O10 A;  2ZXR A;  2R7X A;  3M15 A;  2XL6 A;  5A6B D;  3JSZ A;  3IEE A;  1H6G A;  4WGZ A;  4HFK B;  5E3C A;  2QY9 A;  2KYH A;  2AWY A;  3TQO A;  4I1M A;  4JW1 A;  3M1C B;  5CIV A;  3ZG1 A;  3DWW A;  3QW1 A;  1VOM A;  2NSG A;  4AK9 A;  5A6J A;  3DAG A;  4IAR A;  1VMA A;  4YJW A;  5JP7 A;  2EPO A;  2Z15 A;  4BJ5 A;  1BZ4 A;  4MVM A;  4KNV A;  4X0R A;  2OG2 A;  2A1D D;  4EHP A;  1J8Y F;  4C7O A;  3JRM O;  3JCU Q;  3S28 A;  2YLD A;  1OKK D;  3LNR A;  3ZIB A;  1SMY F;  2VB6 A;  3W8I A;  1YA9 A;  2EIJ C;  1JAF A;  4WGY A;  1A7D A;  5KYW A;  2FAP B;  2P1A A;  4PFO A;  1EQ1 A;  5COM A;  3B29 A;  4W8P A;  3AQB A;  4EBJ A;  1G4W R;  1AEP A;  4U5H A;  2D5R B;  4U5D E;  2G3V A;  2R7T A;  3DXJ F;  1RKC A;  2MYS A;  4I1O B;  4FX5 A;  4LLE A;  1ZHY A;  3OEO A;  2XL4 A;  4FAP B;  1D1A A;  2XXA B;  1YVI A;  4JE9 A;  4A4A A;  2L6H A;  2Y3B A;  1M56 C;  3NKD A;  3ZQY A;  1PCX A;  3CSK A;  4PJN A;  4AL1 A;  2HV7 A;  3K66 A;  5DS6 A;  2YQY A;  4MVZ A;  4U5G A;  5T3T A;  2X0C A;  1E2X A;  1G8X A;  1OR3 A;  3C8G D;  4Z9H A;  3K1I A;  1QZX A;  5KYY A;  2YWA A;  1OCC C;  2XS1 A;  3FAP B;  2R25 A;  2R7W A;  5F28 E;  4JTD B;  3BEH A;  3K1H A;  1L3P A;  5JS5 A;  1C17 M;  1TWH A;  3ZWI A;  1TQG A;  1Z23 A;  1OQC A;  3SP1 A;  1YAR O;  4IJJ A;  3RH3 A;  4DOZ A;  2O9X A;  1BR1 A;  1EA8 A;  2WB7 A;  1YZA A;  3I5P A;  1U89 A;  4O6Y A;  5T3W A;  2BE5 F;  2HJ3 A;  2MHR A;  2HMQ A;  4O6N A;  4PR9 A;  1MQV A;  2ASR A;  3FVY A;  4ULW A;  5B3S C;  2V3C C;  1QSP A;  1V4A A;  3IPM O;  2XLD A;  4Q4Z F;  5L3V A;  4YL3 A;  2KNH A;  3U8V A;  3LES A;  4FES A;  2A0U A;  3QMK A;  1NBB A;  1RJ9 A;  4P9T A;  3F46 A;  2ETS A;  4RD9 A;  1QQ3 A;  1RCP A;  2P0N A;  3H2V A;  4IWB A;  3VRC A;  3TJ6 A;  3NKE A;  1M2V B;  1SYQ A;  1TFK B;  2HMZ A;  1K40 A;  4Z9J A;  4MW3 A;  1U6H A;  2C03 A;  1OW7 A;  2CYD A;  3H2U A;  1M6T A;  1RKE A;  4PK4 A;  1VLS A;  3KKB A;  4PFP A;  3JYH A;  4C3B A;  1OCR C;  4EWC A;  1N1C A;  2PX0 A;  3B9Q A;  3G4X A;  2CCY A;  4I3M A;  3R7C A;  3RYL A;  2J9U A;  3AG1 C;  3S0X A;  5COG A;  2ZXO A;  5E2Q A;  3I4U A;  3JYY A;  1M2O A;  2NPU A;  5A6B A;  1HMD A;  1YDI A;  2J46 A;  3EG9 A;  1A0B A;  3AQC A;  5K0I A;  4N06 A;  4KNW A;  4YK5 A;  1ORS C;  2IXP A;  4CIH A;  4IB4 A;  4PAC A;  4JEA A;  3SZR A;  3FDQ A;  1QVX A;  3C8Z A;  2H7O A;  2GAQ A;  2L7A A;  2WZL A;  3UMH A;  3B0U X;  4C7O B;  2I8B A;  2IXN A;  2L81 A;  4YL0 A;  2JD3 A;  5B1A C;  3U9M A;  1KU2 A;  2W4B A;  1CGN A;  1I4Y A;  2BL2 A;  2P6V A;  5KYW B;  4MTG A;  1OR2 A;  4HE8 D;  4LAC B;  3KPH A;  4YT8 A;  4G7Z F;  5KYX A;  1QKR A;  1SF8 A;  1BR4 A;  1UFB A;  2I15 A;  4XWJ A;  5AC4 A;  2W45 A;  1SZI A;  2YVK A;  1YZC A;  4MVU A;  4U5F E;  4OIR F;  1MMN A;  3UNG C;  3FXH A;  4A2N B;  5DQT A;  5A6K A;  2R7R A;  5F5F A;  1R5I D;  1IW7 F;  1NZE A;  2J8W A;  5JLI A;  1C02 A;  1XWJ A;  2XL8 A;  3G50 A;  2A68 F;  1LI5 A;  2R7Q A;  2J7P D;  1OW6 A;  2ZPA A;  2LD6 A;  2KQ9 A;  2LQG A;  4K1O A;  1APC A;  4N6H A;  3C63 A;  2HSQ A;  1E83 A;  2YL3 A;  3TOM A;  5BUO A;  2PBE A;  3SXK A;  3EH1 A;  4DJ9 A;  5JVE A;  2KK1 A;  3EHN A;  1OXB A;  5KYU A;  1NLX A;  4CJO A;  1RMV A;  4XQ1 A;  2XLE A;  1YAU O;  2PFD A;  3M4B A;  5DS5 A;  1K05 A;  5KYY B;  4EBK A;  4JRZ A;  3UGP A;  3ASO C;  1HW2 A;  2M4E A;  1JR8 A;  4MND A;  1TR2 A;  5FZT A;  5B3I A;  2HFI A;  2KSF A;  2OU6 A;  3C8G A;  3C7J A;  3W4Y A;  5DS4 A;  2LFD A;  3HNL A;  4LDQ A;  3UGO A;  2OEX A;  4HEA J;  5HV9 A;  2XLV A;  2PNO A;  2VH3 A;  4ZLC A;  2EIL C;  1T6U A;  1T01 A;  1T6I A;  4BJT A;  3DD7 A;  1ZHT A;  3ABK C;  2UUI A;  1KNY A;  3AG2 C;  2OKU A;  1GS9 A;  5L0F A;  2M64 A;  1LM3 B;  1I5N A;  1TFO B;  2NG1 A;  3AOU A;  1OCO C;  2AP3 A;  2YL0 A;  2F22 A;  3K33 A;  3SXM A;  1RJ9 B;  4BPM A;  3NMK A;  2Q4F A;  4DRI B;  3LJB A;  3V5X A;  5L0J A;  4JVS A;  1IZM A;  4GEH A;  1D0X A;  1UG7 A;  1Z3I X;  2HKV A;  3SYN A;  1LI7 A;  2VAS A;  3K6B A;  2YL1 A;  2HS5 A;  2KJG A;  3A11 A;  1VLT A;  3A9C A;  4ONS A;  2QE9 A;  2QTV A;  1Y4C A;  4PJL A;  1VYK A;  1I4Z A;  4PJM A;  3VYW A;  3KYI A;  4YN0 B;  3WHN A;  1WAT A;  4NY3 A;  1RKE B;  1D0Y A;  2NUP A;  2YL7 A;  3OWT A;  1QLE C;  2Q00 A;  4JUR I;  1GGQ A;  2W4M A;  2W9Y A;  2CNW A;  4AX2 A;  1NG1 A;  2IXM A;  1ZZP A;  4OIQ F;  1U0B B;  2HUJ A;  3JRT A;  2PP4 A;  4JTC B;  3R2P A;  3IQ6 A;  3GWN A;  3QTH A;  2IM8 A;  3DMD A;  3U2L A;  3EG9 B;  2CGE A;  2P7V A;  4E7S A;  2NSF A;  4EKW A;  3MX3 A;  3GWL A;  2GWW A;  2YZS A;  3FMS A;  2E87 A;  3MYF A;  5A6A A;  5HSW A;  2J0X A;  1XZP A;  4XLN F;  4AE4 A;  5AC5 A;  3X1O A;  4JEB A;  3DE9 A;  3ZTZ A;  3PDM P;  1FFH A;  1YJG A;  3BRJ A;  3GM2 A;  3S90 A;  2B0J A;  2R05 A;  4E0H A;  3T6J A;  2A6H F;  3GOR A;  4P9F A;  5F5H A;  3RF3 A;  1E85 A;  3E70 C;  3RQE A;  1Q0F A;  3RFY A;  2IYL D;  2YRF A;  1WGW A;  4U5C E;  4JCZ A;  3FHD A;  4MS2 A;  2H8A A;  1TWC A;  2L9J A;  3AJM A;  3CAX A;  1Q0K A;  3O6X A;  2A6E F;  3EGD A;  4N6C A;  1GM5 A;  4NTB A;  1Z7Q c;  1H7I A;  1KTM A;  5EHH A;  4JZA A;  4AL0 A;  2XLW A;  2JX0 A;  1CGO A;  2QNL A;  3G4Z A;  1BDJ B;  1NU9 C;  2LP4 A;  4YT2 A;  1Y6D A;  4NC3 A;  5BQG A;  5KYU B;  1JPJ A;  4CS9 A;  1E84 A;  1Q0G A;  3LAY A;  2PX3 A;  5E33 A;  5L0G A;  4ULV A;  3ZQV A;  4CSA C;  1V55 C;  1WAS A;  3DZA A;  3GEH A;  4L6R A;  2YKZ A;  3C8G B;  4O79 A;  2J0W A;  5L0H A;  3GM3 A;  4O7G A;  2LCH A;  4P6I C;  2J45 A;  2B0H A;  5D91 A;  3EFO A;  3T4R A;  1O3U A;  3LUT B;  1H9T A;  2Q9C A;  1MNE A;  1HE9 A;  2IXO A;  4OD4 A;  3F47 A;  3L1M A;  1J8M F;  4YWQ A;  4Q5S F;  2OJQ A;  2G62 A;  1JRA A;  3JTL O;  1A41 A;  4U9E A;  4JKV A;  2BC5 A;  2XS8 A;  1SR2 A;  256B A;  1ORJ A;  3RIP A;  3C62 A;  1M57 C;  3EZH A;  3HKK A;  3ZSU A;  1T9K A;  3JSE O;  2Y69 C;  2HJM A;  2DYS C;  3PMR A;  1S7Z A;  5B1B C;  1XZQ A;  3ZVR A;  4G7H F;  3DE8 A;  3AGU A;  3EQL F;  3RVY A;  3TJ5 A;  1OCZ C;  2RSE B;  2XLO A;  3EZI A;  4WJ0 A;  3U3B A;  2Y39 A;  3KH2 A;  3U0C A;  1PD0 A;  1PD1 A;  2AVK A;  2KW3 C;  2LFF A;  1VYI A;  3HNI A;  4J7T A;  4MVS A;  4CDA A;  2XRH A;  1MMA A;  5CI8 A;  5CI9 A;  1OKK A;  3W8H A;  3T6B A;  5JUA A;  1ZHZ A;  1FTS A;  2DYR C;  4OIN F;  4MTF A;  3WOD F;  2OCC C;  3V5Z A;  2GFH A;  3CZ6 A;  3TUL A;  4CDV A;  3UMK A;  2EIN C;  2C04 A;  1H9G A;  2YLI A;  3CQZ A;  4KC9 A;  4MVQ A;  2Q3T A;  2Q7R A;  2EIK C;  3TOL A;  5EK0 A;  4J32 B;  1L7C A;  1OW8 A;  4DXW A;  1LVK A;  3E9V A;  1ZHW A;  2HSB A;  2EPN A;  2OEV A;  3I5Q A;  3HLZ A;  3U2M A;  3IQC A;  2WZG A;  4XTK A;  1LE2 A;  3PHF 2;  2YEV A;  2OJE D;  4HFF B;  1QPU A;  3DM5 A;  2AWC A;  3RVZ A;  5IY5 C;  3J06 A;  4DVZ A;  3EGX A;  3DI5 A;  3GEI A;  3V5Y A;  3POV A;  1CGM E;  1TKN A;  4BJ6 C;  1NFO A;  5D92 A;  3JT1 A;  3K1I C;  4U9D A;  2WVN A;  5T1D B;  2AU5 A;  2LSE A;  2J9B A;  3L8J A;  4RDA A;  1Q0D A;  2VC9 A;  4C3D A;  2TMV P;  2JPU A;  3US6 A;  3QZC A;  3IHU A;  4FWV A;  5JSL A;  3X2Q C;  4RBN A;  1EI7 A;  3LNM B;  4IRU A;  4PJJ A;  1YYX A;  2XM0 A;  4JIO A;  3U3F A;  4LLC A;  3LS1 A;  1DOW A;  4F4B A;  3KMI A;  4G78 A;  2ZXP A;  3DM9 B;  4CIP A;  4G7O F;  3DKA A;  1NU7 D;  2VCB A;  3KL4 A;  2Y3D A;  3M79 A;  4K0D A;  5DLJ A;  2HV6 A;  2WL8 A;  4ANJ A;  3S84 A;  1A7V A;  1MND A;  3MYI A;  1TWG A;  3SXY A;  4CS8 C;  2R03 A;  1NSG B;  5KYN A;  1Z5Z A;  1D1C A;  2PF4 E;  4IAQ A;  1HMO A;  1LS1 A;  3U8P A;  3RQG A;  3NDB B;  4IAO A;  1FR0 A;  5JT4 A;  1C03 A;  2Y3H A;  4N4W A;  3GAN A;  1WWP A;  3C18 A;  1MMD A;  1Z6A A;  1FMW A;  2EPL X;  3OA1 A;  4H54 A;  4QI0 A;  3VM6 A;  4IGG A;  1BBH A;  3U9J A;  3S9O A;  4LDR A;  1WTY A;  2DGJ A;  2HZ8 A;  2YLG A;  1OXK A;  1YLM A;  3FOO A;  4CS7 A;  5TJ5 E;  1FNT c;  1Q0M A;  1YYJ A;  4KI2 A;  2R7S A;  1FMV A;  3VAY A;  1YA7 O;  3DJU B;  3RQF A;  1V74 B;  3GEE A;  2WVQ A;  2WVO A;  4I44 A;  3B0P A;  1B68 A;  2WZF A;  1WOL A;  5KYX B;  1FAP B;  3NYJ A;  4NTA A;  1T6Q A;  4W8K A;  1BR2 A;  1FFT C;  1JOG A;  2Q9A A;  4KBL A;  3TD7 A;  3EJN A;  4ZLD A;  1DOV A;  2KC3 A;  3AG4 C;  3NMJ A;  4JJG A;  4J7Y A;  4E17 A;  3LS0 A;  4LER A;  3ATP A;  2LK4 A;  4WAB A;  3LEO A;  2XM4 A;  3NMI A;  3NYL A;  5DVW A;  3S27 A;  3SXZ A;  4XEK A;  4DRH B;  2QLA A;  4JTA B;  5L3Q A;  4DBQ A;  1ZVZ A;  3QW0 A;  4OD5 A;  2J9V A;  5COF A;  4DVY P;  2NUT A;  3EH2 A;  3ABL C;  3EPV A;  2J7P A;  3IQT A;  3N24 A;  5JRA A;  5L0I A;  3B0V C;  3MFN A;  4YT4 A;  1HE1 A;  3EGX B;  4MTO A;  3U5S A;  4E0I A;  2UUH A;  3Q7G A;  1Z63 A;  3QVY A;  2J9W A;  4BJ6 A;  4E18 A;  3ZTM A;  4CBE A;  2OOC A;  1D0Z A;  4XEV A;  3DAF A;  3MBG A;  4CX9 A;  3ITF A;  1WN0 A;  1VB5 A;  4JC7 A;  2R7O A;  5EGY A;  1ORY A;  2L6G A;  3Q6M A;  3W2V A;  2KGO A;  4CDY A;  3HNK A;  3L0I A;  1LE4 A;  2R02 A;  3FAJ A;  5FCL A;  3O55 A;  2V26 A;  5E3A A;  4E7Z A;  3HNJ A;  2G3K A;  2CW0 F;  3TK0 A;  4U5E E;  1HW1 A;  2MWQ A;  2YHS A;  3PCV A;  4O6M A;  2ICW G;  4M63 A;  4K7B A;  1F1M A;  3L8I A;  4U5B E;  1CPQ A;  3S29 A;  3K7D A;  4QI2 A;  2P61 A;  2R9R B;  4G0H A;  2ZD9 A;  3AGT A;  3FOP A;  4D4X A;  3Q7L A;  3B71 A;  2X51 A;  2XLH A;  1ZW2 A;  2VCC A;  3H65 A;  3N0T A;  4H4K C;  4CS8 A;  5L0C A;  1JMW A;  3GOD A;  4GYT A;  4DRJ B;  1O5H A;  4Q7C A;  1RXQ A;  4MQ9 F;  3ASN C;  4EIY A;  3ABM C;  4BJ5 C; 
#chains in the Genus database with same CATH homology
 1WAT A;  4Z9I A;  1LIH A;  4H54 A;  1JMW A;  3T9O A;  2D4U A;  1WAS A;  4Z9H A;  1VLT A;  4Z9J A;  1VLS A;  2LIG A;  2ASR A;  3ATP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...