1VLTA

Ligand binding domain of the wild-type aspartate receptor with aspartate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
142
structure length
142
Chain Sequence
GFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE RECEPTOR
publication title High-resolution structures of the ligand binding domain of the wild-type bacterial aspartate receptor.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Complex (chemotaxis/peptide)
total genus 55
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1vltA00
2ASRA 1LIHA 2D4UA 3ATPA 4H54A 4Z9HA 4Z9JA 1VLSA 1WASA 1JMWA 2LIGA 1WATA 4Z9IA 3T9OA 1VLTA
chains in the Genus database with same CATH superfamily
2LQGA 3TJ5A 2IOQA 1OCZC 1EI7A 2Q00A 3HNIA 3KL4A 3WAQA 1WWPA 1QZXA 5B3IA 4U5BE 2LIGA 1ZHXA 2CNWD 1NU7D 2PNOA 2Y3DA 3E70C 3PCVA 3ABMC 2X51A 4PK4A 4XEKA 3TQOA 3U5SA 2I8BA 3US6A 3FXHA 3T6BA 4Q4ZF 3G4ZA 4JVSA 3M15A 1ZW2A 4JE9A 4YL0A 4Z9IA 5T3WA 3RW0A 1FMVA 256BA 2Q9AA 4JZAA 5A6BD 2KQ9A 4YL3A 3N2ZB 4LDQA 2PP4A 5JLIA 1MMGA 1CGOA 3S28A 3U3FA 3U9JA 3S90A 5DS4A 2EPOA 5EK0A 2P6VA 1WN0A 3NYLA 2OOCA 3MYIA 5KYUA 2HFIA 5L0GA 1EKYA 3AG1C 1Z63A 3OEOA 3T6GB 1J8MF 3NMKA 3OA1A 4O6YA 3LJBA 2ASRA 4LDRA 3V5YA 2XLWA 5B3SC 3KKBA 2IXMA 3JRTA 2LD6A 2XSEA 4AE4B 2EILC 4O6NA 3ZG1A 3GWNA 2WVNA 4DRIB 4KI2A 1UG7A 1JPJA 3Q6NA 1HMDA 2WVQA 3IQTA 4KC9A 1BR2A 4OIQF 2WL8A 1LIHA 1D0YA 2EPMX 1QSPA 5DQZA 3HKKA 4NQFA 1IW7F 4EBBA 1E85A 2B0HA 1L7CA 1D1BA 2LSEA 2MHRA 3L8IA 3U2MA 1BZ4A 4QDLA 4J32B 1OW8A 2UUHA 4BJ5A 5A69A 1G8XA 2AWYA 2CW0F 3EGXA 1RJ9A 2M64A 5F5HA 4Q7CA 4K0DA 3K33A 5L0IA 4GYTA 3EH2A 2GAQA 1MQVA 1HE9A 1YYXA 2KW3C 2PF4E 4J30B 1FMWA 3TULA 2YRFA 1A7EA 2QLAA 1CPRA 4JJGA 4E18A 4J7YA 4DBRA 4B6IA 3DD7A 1EQ1A 1ZHTA 2HMZA 4U5CE 2R7WA 4MVMA 3UGOA 2H7OA 5B1BC 5L0FA 3DZAA 2XXAA 5JT4A 4IRUA 2ZPAA 3QW1A 3DWWA 4ULVA 3MLGA 2WZGA 5BQGA 1YZCA 3G4XA 1APCA 1T01A 2XLDA 3K7DA 3TOLA 4OIOF 2KK1A 2IXPA 2P7VA 4JIOA 4NCQA 4CSAA 3ZC4A 2YVKA 1YARO 3A9CA 1NG1A 2EINC 3AQBA 2VCAA 2O9XA 3K66A 4JEAA 1A7VA 3V5XA 3S0XA 4J7TA 5AGFA 1QKRA 1WASA 2OKUA 1SMYF 4MNDA 2ZXRA 1GGQA 4DBQA 4AL1A 2OEVA 2WZFA 3HNKA 4E0HA 2NUPA 1LKXA 1O5HA 1U89A 1YLMA 4YJWA 2Y3HA 1JOGA 4RBNA 1OW6A 5KYXA 3B9QA 1ZHWA 3C8GA 3JZ0A 1M2OA 1LVKA 2L6GA 5EHHA 3UGPA 2YEVA 1NBBA 1M57C 1VB5A 4BPMA 2A68F 2H8AA 3EH1A 1WOLA 2KNHA 2NPUA 5F5FA 4ANJA 3EGDB 4N06A 3NKEA 2QTVA 1D0XA 2AU5A 3ASNC 2J9VA 1D1AA 2HJMA 1OR3A 2XL8A 3ZTZA 2V26A 2XRHA 2IM8A 4E17A 1Q0KA 4IB4A 1ZHZA 2R25A 2W4MA 5BQIA 4YT2A 4MVSA 2XM0A 3I5QA 2IXNA 1U0BB 2R05A 4HFKB 1JAFA 1R4TA 1S05A 4XQ1A 3W2VA 1G4US 1RCPA 1Z6AA 2LP4A 3O6XA 4G7HF 2RD9A 2ICWG 3L34A 3B0VC 2GFHA 2QNLA 1K05A 3ATPA 1V4AA 2KJGA 3ZDLA 2HV7A 2JPUA 4JTCB 3C7JA 4JW1A 1ORSC 5KYYB 2NUTA 4XLNF 3X2QC 2VC9A 2PX0A 1YAUO 3CZ6A 2J0WA 1PD1A 1R5ID 1V54C 2YL7A 3LAYA 3MYFA 4JTAB 3EZIA 4U5FE 4YN0B 4OIRF 2X0CA 1QPUA 3VRCA 4FWVA 1T6QA 1T5OA 2YL3A 1LS4A 1JPNA 3GEIA 3IEEA 1TFOB 2JD3A 3RFYA 4XLPF 2YL1A 2NSFA 5IY5C 1RKEB 1AEPA 4WGYA 1SZIA 2YL0A 3LESA 2A1DD 2FGYA 2OJQA 2R7QA 1ORJA 3UNGC 4HEAJ 4LLEA 2PFDA 1HE1A 3FOOA 3LEVA 1Z5ZA 3RQGA 3FVYA 4HFFB 1BR1A 3JYHA 4I1OB 3WODF 4E7ZA 1K04A 4WABA 4CSAC 3LS1A 4BEJA 1J8YF 1QQ3A 4BJ6A 3AOUA 4PR9A 2HS5A 4LACB 4ER9A 3M4BA 1M2VA 1GS9A 2XM4A 3T9OA 1N1CA 1D0ZA 1OR2A 2XLOA 4KNVA 1VYKA 3VAYA 4R32A 1Q0MA 4CJOA 4CS9C 2G3KA 2W9YA 3M4CA 2KYHA 3FHDA 1SR2A 3L8JA 1PCXA 3GM3A 3IHUA 2YLIA 1Z3IX 4PFOA 3EG9B 3LLKA 4W8PA 5FCLA 1ZVZA 3JTLO 1G5ZA 3N24A 1F1MA 3QW0A 3KYJA 3AJMA 4O79A 3GWLA 4M63A 2I15A 1QLEC 1HMOA 1FAPB 2MYSA 5A6AA 3B0UX 5JSLA 2B0JA 2NG1A 1T6UA 4CS8A 2Y39A 1ZYRF 4YT5A 4DRJB 1G4WR 3ASOC 2Z15A 1OCRC 2XS8A 4JURI 4NTFA 5BQHA 3ABLC 2DYRC 1H7IA 1NSGB 2Y69C 4OD4A 5B1AC 1C02A 2D4UA 3AGTA 3Q7GA 1A7DA 2HJ3A 2J0XA 4U9DA 4D4XA 1A41A 3UR3C 4N4WA 4OIPF 4ZLDA 1QVXA 1IZMA 2J7PA 1FTSA 3QMKA 1NZEA 3DAGA 2KGOA 3C8GD 2XL6A 5KYUB 3GM1A 1CPQA 1EA8A 3DE9A 2J9UA 4NC3A 3ZQVA 2YWAA 1FR0A 4E7SA 1E86A 1MMAA 3IQ5A 1CGNA 3PDMP 4I1MA 4CDVA 2Q9BA 3GODA 3FAPB 2QY9A 5F28E 5CI8A 5EGYA 1JRAA 3SXYA 3OWTA 2R7XA 1C03A 1VK5A 2J9WA 1NU9C 3FMSA 3NYMA 1TQGA 1SYQA 1E2XA 4DOZA 1KU2A 3PMRA 5HV9A 5JUAA 3C63A 2YQYA 1OW7A 5L0DA 3RIPA 4P6IC 4XWJA 4JC7A 1TKNA 2OCCC 3JT1A 3FDQA 1KTMA 2R02A 1MMDA 1B68A 1TWAA 1ST6A 5JS5A 3K1IC 3DM5A 4DVYP 4DXWA 3BRJA 5L3QA 4MVQA 4HE8D 3ZWIA 2ZXPA 3EGXB 1RJ9B 3B29A 2XLMA 4PJLA 2A6EF 1GQAA 4BEMJ 2L6HA 2W45A 1Y6DA 4JEBA 4BJ1A 3EQLF 1LI5A 3TD7A 2L9JA 3IQCA 3I4UA 4BJ6C 4CX9A 1BR4A 2A6HF 3UMIA 3BEHA 3K1HA 4IAOA 2EIJC 3LEOA 3GEEA 4GEHA 4EWCA 4U5DE 2LFFA 2OQMA 3ZQYA 1TWGA 1ZHYA 3L1MA 2YLGA 2LFDA 2HUJA 3S84A 4XPYA 2XXAB 3U3BA 4ONSA 3RH3A 2NSGA 4I44A 4MTFA 4MTGA 1PV3A 5CIVA 2GA0A 2WB7A 5DS5A 4PJJA 1OKKA 2J8WA 2L7AA 3CQZA 3B71A 3RF3A 2M4EA 4JCZA 2R7RA 1LI7A 2HSBA 3NYJA 2VCBA 4DRHB 3U2LA 5DS6A 2HV6A 4GQHA 1FFHA 1T6IA 3QVYA 2Y3GA 3S9OA 3DI5A 3SXKA 2CDQA 2DB4A 3TK0A 4DJ9A 3SXMA 2QUPA 3POVA 1NFNA 1LM3B 4P9FA 2NUPB 1LPEA 1M56C 1NLXA 1VLSA 2AP3A 2VCCA 4QI0A 4W8KA 3EHNA 2J45A 2IBFA 4NTAA 5KYXB 1MNDA 5D92A 2ZXOA 3C8GB 2P0NA 2Q3TA 2A69F 3UMKA 2P1AA 3CEXA 5KYWA 3DXJF 1D1CA 2IYLD 4BJ5C 4G7ZF 3KMIA 1HY5A 2FFHA 3C18A 5E3CA 4YT8A 4QI2A 4OINF 2AWCA 5TJ5E 4C7OA 3R2PA 3HTKC 5L0HA 3IQ6A 5AC5A 2Q9CA 2ETSA 5K0IA 3GANA 2CCYA 5COFA 3W4YA 4C3BA 5L0CA 3DE8A 3O39A 1H9GA 4CIHA 3NDBB 1Z23A 4EBJA 2TMVP 1TWHA 2YZSA 3WG7C 1VLTA 2E87A 4MW8A 3W8HA 2ZXWC 3LS0A 1Y4CA 4JJFA 1JR8A 4PACA 3C8ZA 4A4AA 4IAQA 2H7BA 4H4KC 3SZRA 4AL0A 3DMDA 4KBLA 4CBEA 4U5GA 4LERA 5E2QA 3VF0A 1ZU5A 3A11A 3TJ6A 3LNMB 4FESA 4JRZA 2GDCA 2J7PD 2V3CC 4Z9HA 1NFOA 3RQEA 4RD9A 2XLVA 2WVOA 2C04A 1WTYA 4JCHA 4OD5A 4CJGA 2NUTB 1KNYA 1MMNA 4D4NA 4FAPB 3H2UA 3GORA 2HMQA 2R7VA 1VYIA 4MTOA 3T6JA 2R7TA 1DOWA 1I4ZA 2ZD9A 3O55A 4U5HA 3H2VA 1ZZPA 2OJED 2XLEA 5T1DB 2YKZA 3RKOF 1Q0FA 3EHMA 4AX2A 2HSQA 1JMWA 3F46A 2HKVA 4MVOA 1K40A 2IXOA 2G62A 3ITFA 4MW3A 1PD0A 4CDAA 1I4YA 4MVRA 4O6MA 4PJMA 5CI9A 4F4BA 2H7VC 3AGUA 4KNWA 4LLCA 4JTDB 4P9TA 4ULWA 4AE4A 3LLIA 4JKVA 2BE5F 1ZW3A 2DI3A 2OEXA 3I5PA 4WGZA 1LE2A 2QE9A 3M79A 3QTHA 4XPXA 3V5ZA 1XZQA 4UDVA 1C17M 4Z9JA 3GM2A 3TOMA 3W2WA 2CGEA 2CYDA 3HLZA 3ABKC 3KPHA 5JP7A 5L0JA 2HZ8A 2BC5A 5A6KA 3DJNB 3Q7LA 2Q4FA 4LDKA 3SNHA 3C62A 3RVZA 2D5RB 1M2VB 1A0BA 1FFTC 1V74B 1SF8A 1XWJA 2XL4A 2VB6A 3DKAA 3F47A 4IARA 3U0CA 1Q0DA 2EPLX 3Q6MA 4N6CA 2FAPB 3DJUB 4ZLCA 4I3MA 2KC3A 4C3DA 3AG3C 1HW1A 1MNEA 1YJGA 2W4BA 4X0RA 2XS1A 1YA7O 3H65A 2J46A 2J9BA 1ZU4A 1DOVA 1FNTc 4U9EA 2P61A 3O10A 5JRAA 1RXQA 1WGWA 1RKCA 3QZCA 3JSZA 1Q0GA 2OG2A 3CSKA 2RSEB 3ECSA 2R7SA 4CIPA 4MQ9F 5T3TA 1OKKD 3ZIBA 2XLHA 1I5NA 3HNLA 3KH2A 1VOMA 4XEVA 4U5EE 4MVZA 1V55C 3MFNA 5E33A 4IJJA 3UMHA 5E3AA 1ORYA 3IPMO 4O7GA 5FZTA 2DYSC 2EPKX 1OXBA 2BL2A 3LNRA 1OQCA 2JX0A 2A0UA 3SP1A 2CNWA 2UUIA 2WZLA 4XEFA 4G78A 5HSWA 4YK5A 4H54A 3ZSUA 2LK4A 4FX5A 4E0IA 4BG0A 4L6RA 5BUOA 2R9RB 2AVKA 2KSFA 1AVOB 4PFPA 2MWQA 3HNJA 3W8IA 5A6BA 4DVZA 1E83A 1VMAA 2OU6A 2G3VA 4A2NB 4XPWA 3AG4C 1HW2A 4EUKB 3G50A 3FAJA 1H6GA 1XZPA 2VASA 2A0BA 3EPVA 4PJNA 2R7UA 1RMVA 1TWCA 3SEOA 3M1CB 4WJ0A 2Q7RA 3RQFA 4AK9A 3B0PA 3FOPA 4EBKA 5A6JA 3QVZA 2F22A 2EIKC 4K7BA 4Q5SF 3EGDA 2YHSA 3R7CA 5JVEA 3SXZA 1YZAA 3AQCA 1TR2A 3U8VA 3E9VA 4NY3A 3S29A 1YYJA 3GEHA 3CAXA 3NRHA 1H9TA 3DAFA 3NKDA 3EFOA 1GM5A 3EZHA 1CGME 2EPNA 3JYYA 4CS9A 4CS8C 3RYLA 3PHF2 3L0IA 3T4RA 4CS7A 1OCCC 3KYIA 3V7OA 1YA9A 3LUTB 3S27A 3DM9B 3SYNA 5GPGB 4G0HA 1AUEA 1L3PA 4RDAA 4CDYA 4EIYA 4BJTA 1E84A 4G7OF 2L81A 3JRMO 1OCOC 5DLJA 4EKWA 5KYYA 1Z7Qc 5KYNA 4YT4A 2R03A 4K1OA 2LCHA 5DQTA 2DGJA 1O3UA 2Y3BA 1OXKA 4N6HA 1TFKB 3MBGA 3U8PA 5AC4A 2GWWA 1RKEA 1O87A 3EFOB 3JCUQ 1VTMP 2EIMC 2L6FA 1LE4A 3VM6A 3MX3A 3VYWA 5DVWA 1M6TA 5COMA 2R7OA 2YLDA 3J06A 1UFBA 3JSEO 4EHPA 3ZTMA 2PX3A 1BBHA 5COGA 3K6BA 5L3VA 5D91A 3X1OA 2PBEA 4IWBA 1W2WA 1WATA 3NMIA 4IGGA 5KYWB 1S7ZA 3ZVRA 4C3EA 4NTBA 4YWQA 4YL1A 3U9MA 1BDJB 3NG1A 1YVIA 2C03A 1LS1A 3AG2C 3EJNA 3WHNA 4C7OB 3RVYA 1T9KA 4MS2A 3NMJA 2VH3A 1YDIA 1U6HA 3EG9A 3N0TA 4MVUA 3HJCA 3K1IA 4XTKA
chains in the Genus database with same CATH topology
2ASRA 1LIHA 2D4UA 3ATPA 4H54A 4Z9HA 4Z9JA 1VLSA 1WASA 1JMWA 2LIGA 1WATA 4Z9IA 3T9OA 1VLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ASR A;  1LIH A;  2D4U A;  3ATP A;  4H54 A;  4Z9H A;  4Z9J A;  1VLS A;  1WAS A;  1JMW A;  2LIG A;  1WAT A;  4Z9I A;  3T9O A;  1VLT A; 
#chains in the Genus database with same CATH topology
 2LQG A;  3TJ5 A;  2IOQ A;  1OCZ C;  1EI7 A;  2Q00 A;  3HNI A;  3KL4 A;  3WAQ A;  1WWP A;  1QZX A;  5B3I A;  4U5B E;  2LIG A;  1ZHX A;  2CNW D;  1NU7 D;  2PNO A;  2Y3D A;  3E70 C;  3PCV A;  3ABM C;  2X51 A;  4PK4 A;  4XEK A;  3TQO A;  3U5S A;  2I8B A;  3US6 A;  3FXH A;  3T6B A;  4Q4Z F;  3G4Z A;  4JVS A;  3M15 A;  1ZW2 A;  4JE9 A;  4YL0 A;  4Z9I A;  5T3W A;  3RW0 A;  1FMV A;  256B A;  2Q9A A;  4JZA A;  5A6B D;  2KQ9 A;  4YL3 A;  3N2Z B;  4LDQ A;  2PP4 A;  5JLI A;  1MMG A;  1CGO A;  3S28 A;  3U3F A;  3U9J A;  3S90 A;  5DS4 A;  2EPO A;  5EK0 A;  2P6V A;  1WN0 A;  3NYL A;  2OOC A;  3MYI A;  5KYU A;  2HFI A;  5L0G A;  1EKY A;  3AG1 C;  1Z63 A;  3OEO A;  3T6G B;  1J8M F;  3NMK A;  3OA1 A;  4O6Y A;  3LJB A;  2ASR A;  4LDR A;  3V5Y A;  2XLW A;  5B3S C;  3KKB A;  2IXM A;  3JRT A;  2LD6 A;  2XSE A;  4AE4 B;  2EIL C;  4O6N A;  3ZG1 A;  3GWN A;  2WVN A;  4DRI B;  4KI2 A;  1UG7 A;  1JPJ A;  3Q6N A;  1HMD A;  2WVQ A;  3IQT A;  4KC9 A;  1BR2 A;  4OIQ F;  2WL8 A;  1LIH A;  1D0Y A;  2EPM X;  1QSP A;  5DQZ A;  3HKK A;  4NQF A;  1IW7 F;  4EBB A;  1E85 A;  2B0H A;  1L7C A;  1D1B A;  2LSE A;  2MHR A;  3L8I A;  3U2M A;  1BZ4 A;  4QDL A;  4J32 B;  1OW8 A;  2UUH A;  4BJ5 A;  5A69 A;  1G8X A;  2AWY A;  2CW0 F;  3EGX A;  1RJ9 A;  2M64 A;  5F5H A;  4Q7C A;  4K0D A;  3K33 A;  5L0I A;  4GYT A;  3EH2 A;  2GAQ A;  1MQV A;  1HE9 A;  1YYX A;  2KW3 C;  2PF4 E;  4J30 B;  1FMW A;  3TUL A;  2YRF A;  1A7E A;  2QLA A;  1CPR A;  4JJG A;  4E18 A;  4J7Y A;  4DBR A;  4B6I A;  3DD7 A;  1EQ1 A;  1ZHT A;  2HMZ A;  4U5C E;  2R7W A;  4MVM A;  3UGO A;  2H7O A;  5B1B C;  5L0F A;  3DZA A;  2XXA A;  5JT4 A;  4IRU A;  2ZPA A;  3QW1 A;  3DWW A;  4ULV A;  3MLG A;  2WZG A;  5BQG A;  1YZC A;  3G4X A;  1APC A;  1T01 A;  2XLD A;  3K7D A;  3TOL A;  4OIO F;  2KK1 A;  2IXP A;  2P7V A;  4JIO A;  4NCQ A;  4CSA A;  3ZC4 A;  2YVK A;  1YAR O;  3A9C A;  1NG1 A;  2EIN C;  3AQB A;  2VCA A;  2O9X A;  3K66 A;  4JEA A;  1A7V A;  3V5X A;  3S0X A;  4J7T A;  5AGF A;  1QKR A;  1WAS A;  2OKU A;  1SMY F;  4MND A;  2ZXR A;  1GGQ A;  4DBQ A;  4AL1 A;  2OEV A;  2WZF A;  3HNK A;  4E0H A;  2NUP A;  1LKX A;  1O5H A;  1U89 A;  1YLM A;  4YJW A;  2Y3H A;  1JOG A;  4RBN A;  1OW6 A;  5KYX A;  3B9Q A;  1ZHW A;  3C8G A;  3JZ0 A;  1M2O A;  1LVK A;  2L6G A;  5EHH A;  3UGP A;  2YEV A;  1NBB A;  1M57 C;  1VB5 A;  4BPM A;  2A68 F;  2H8A A;  3EH1 A;  1WOL A;  2KNH A;  2NPU A;  5F5F A;  4ANJ A;  3EGD B;  4N06 A;  3NKE A;  2QTV A;  1D0X A;  2AU5 A;  3ASN C;  2J9V A;  1D1A A;  2HJM A;  1OR3 A;  2XL8 A;  3ZTZ A;  2V26 A;  2XRH A;  2IM8 A;  4E17 A;  1Q0K A;  4IB4 A;  1ZHZ A;  2R25 A;  2W4M A;  5BQI A;  4YT2 A;  4MVS A;  2XM0 A;  3I5Q A;  2IXN A;  1U0B B;  2R05 A;  4HFK B;  1JAF A;  1R4T A;  1S05 A;  4XQ1 A;  3W2V A;  1G4U S;  1RCP A;  1Z6A A;  2LP4 A;  3O6X A;  4G7H F;  2RD9 A;  2ICW G;  3L34 A;  3B0V C;  2GFH A;  2QNL A;  1K05 A;  3ATP A;  1V4A A;  2KJG A;  3ZDL A;  2HV7 A;  2JPU A;  4JTC B;  3C7J A;  4JW1 A;  1ORS C;  5KYY B;  2NUT A;  4XLN F;  3X2Q C;  2VC9 A;  2PX0 A;  1YAU O;  3CZ6 A;  2J0W A;  1PD1 A;  1R5I D;  1V54 C;  2YL7 A;  3LAY A;  3MYF A;  4JTA B;  3EZI A;  4U5F E;  4YN0 B;  4OIR F;  2X0C A;  1QPU A;  3VRC A;  4FWV A;  1T6Q A;  1T5O A;  2YL3 A;  1LS4 A;  1JPN A;  3GEI A;  3IEE A;  1TFO B;  2JD3 A;  3RFY A;  4XLP F;  2YL1 A;  2NSF A;  5IY5 C;  1RKE B;  1AEP A;  4WGY A;  1SZI A;  2YL0 A;  3LES A;  2A1D D;  2FGY A;  2OJQ A;  2R7Q A;  1ORJ A;  3UNG C;  4HEA J;  4LLE A;  2PFD A;  1HE1 A;  3FOO A;  3LEV A;  1Z5Z A;  3RQG A;  3FVY A;  4HFF B;  1BR1 A;  3JYH A;  4I1O B;  3WOD F;  4E7Z A;  1K04 A;  4WAB A;  4CSA C;  3LS1 A;  4BEJ A;  1J8Y F;  1QQ3 A;  4BJ6 A;  3AOU A;  4PR9 A;  2HS5 A;  4LAC B;  4ER9 A;  3M4B A;  1M2V A;  1GS9 A;  2XM4 A;  3T9O A;  1N1C A;  1D0Z A;  1OR2 A;  2XLO A;  4KNV A;  1VYK A;  3VAY A;  4R32 A;  1Q0M A;  4CJO A;  4CS9 C;  2G3K A;  2W9Y A;  3M4C A;  2KYH A;  3FHD A;  1SR2 A;  3L8J A;  1PCX A;  3GM3 A;  3IHU A;  2YLI A;  1Z3I X;  4PFO A;  3EG9 B;  3LLK A;  4W8P A;  5FCL A;  1ZVZ A;  3JTL O;  1G5Z A;  3N24 A;  1F1M A;  3QW0 A;  3KYJ A;  3AJM A;  4O79 A;  3GWL A;  4M63 A;  2I15 A;  1QLE C;  1HMO A;  1FAP B;  2MYS A;  5A6A A;  3B0U X;  5JSL A;  2B0J A;  2NG1 A;  1T6U A;  4CS8 A;  2Y39 A;  1ZYR F;  4YT5 A;  4DRJ B;  1G4W R;  3ASO C;  2Z15 A;  1OCR C;  2XS8 A;  4JUR I;  4NTF A;  5BQH A;  3ABL C;  2DYR C;  1H7I A;  1NSG B;  2Y69 C;  4OD4 A;  5B1A C;  1C02 A;  2D4U A;  3AGT A;  3Q7G A;  1A7D A;  2HJ3 A;  2J0X A;  4U9D A;  4D4X A;  1A41 A;  3UR3 C;  4N4W A;  4OIP F;  4ZLD A;  1QVX A;  1IZM A;  2J7P A;  1FTS A;  3QMK A;  1NZE A;  3DAG A;  2KGO A;  3C8G D;  2XL6 A;  5KYU B;  3GM1 A;  1CPQ A;  1EA8 A;  3DE9 A;  2J9U A;  4NC3 A;  3ZQV A;  2YWA A;  1FR0 A;  4E7S A;  1E86 A;  1MMA A;  3IQ5 A;  1CGN A;  3PDM P;  4I1M A;  4CDV A;  2Q9B A;  3GOD A;  3FAP B;  2QY9 A;  5F28 E;  5CI8 A;  5EGY A;  1JRA A;  3SXY A;  3OWT A;  2R7X A;  1C03 A;  1VK5 A;  2J9W A;  1NU9 C;  3FMS A;  3NYM A;  1TQG A;  1SYQ A;  1E2X A;  4DOZ A;  1KU2 A;  3PMR A;  5HV9 A;  5JUA A;  3C63 A;  2YQY A;  1OW7 A;  5L0D A;  3RIP A;  4P6I C;  4XWJ A;  4JC7 A;  1TKN A;  2OCC C;  3JT1 A;  3FDQ A;  1KTM A;  2R02 A;  1MMD A;  1B68 A;  1TWA A;  1ST6 A;  5JS5 A;  3K1I C;  3DM5 A;  4DVY P;  4DXW A;  3BRJ A;  5L3Q A;  4MVQ A;  4HE8 D;  3ZWI A;  2ZXP A;  3EGX B;  1RJ9 B;  3B29 A;  2XLM A;  4PJL A;  2A6E F;  1GQA A;  4BEM J;  2L6H A;  2W45 A;  1Y6D A;  4JEB A;  4BJ1 A;  3EQL F;  1LI5 A;  3TD7 A;  2L9J A;  3IQC A;  3I4U A;  4BJ6 C;  4CX9 A;  1BR4 A;  2A6H F;  3UMI A;  3BEH A;  3K1H A;  4IAO A;  2EIJ C;  3LEO A;  3GEE A;  4GEH A;  4EWC A;  4U5D E;  2LFF A;  2OQM A;  3ZQY A;  1TWG A;  1ZHY A;  3L1M A;  2YLG A;  2LFD A;  2HUJ A;  3S84 A;  4XPY A;  2XXA B;  3U3B A;  4ONS A;  3RH3 A;  2NSG A;  4I44 A;  4MTF A;  4MTG A;  1PV3 A;  5CIV A;  2GA0 A;  2WB7 A;  5DS5 A;  4PJJ A;  1OKK A;  2J8W A;  2L7A A;  3CQZ A;  3B71 A;  3RF3 A;  2M4E A;  4JCZ A;  2R7R A;  1LI7 A;  2HSB A;  3NYJ A;  2VCB A;  4DRH B;  3U2L A;  5DS6 A;  2HV6 A;  4GQH A;  1FFH A;  1T6I A;  3QVY A;  2Y3G A;  3S9O A;  3DI5 A;  3SXK A;  2CDQ A;  2DB4 A;  3TK0 A;  4DJ9 A;  3SXM A;  2QUP A;  3POV A;  1NFN A;  1LM3 B;  4P9F A;  2NUP B;  1LPE A;  1M56 C;  1NLX A;  1VLS A;  2AP3 A;  2VCC A;  4QI0 A;  4W8K A;  3EHN A;  2J45 A;  2IBF A;  4NTA A;  5KYX B;  1MND A;  5D92 A;  2ZXO A;  3C8G B;  2P0N A;  2Q3T A;  2A69 F;  3UMK A;  2P1A A;  3CEX A;  5KYW A;  3DXJ F;  1D1C A;  2IYL D;  4BJ5 C;  4G7Z F;  3KMI A;  1HY5 A;  2FFH A;  3C18 A;  5E3C A;  4YT8 A;  4QI2 A;  4OIN F;  2AWC A;  5TJ5 E;  4C7O A;  3R2P A;  3HTK C;  5L0H A;  3IQ6 A;  5AC5 A;  2Q9C A;  2ETS A;  5K0I A;  3GAN A;  2CCY A;  5COF A;  3W4Y A;  4C3B A;  5L0C A;  3DE8 A;  3O39 A;  1H9G A;  4CIH A;  3NDB B;  1Z23 A;  4EBJ A;  2TMV P;  1TWH A;  2YZS A;  3WG7 C;  1VLT A;  2E87 A;  4MW8 A;  3W8H A;  2ZXW C;  3LS0 A;  1Y4C A;  4JJF A;  1JR8 A;  4PAC A;  3C8Z A;  4A4A A;  4IAQ A;  2H7B A;  4H4K C;  3SZR A;  4AL0 A;  3DMD A;  4KBL A;  4CBE A;  4U5G A;  4LER A;  5E2Q A;  3VF0 A;  1ZU5 A;  3A11 A;  3TJ6 A;  3LNM B;  4FES A;  4JRZ A;  2GDC A;  2J7P D;  2V3C C;  4Z9H A;  1NFO A;  3RQE A;  4RD9 A;  2XLV A;  2WVO A;  2C04 A;  1WTY A;  4JCH A;  4OD5 A;  4CJG A;  2NUT B;  1KNY A;  1MMN A;  4D4N A;  4FAP B;  3H2U A;  3GOR A;  2HMQ A;  2R7V A;  1VYI A;  4MTO A;  3T6J A;  2R7T A;  1DOW A;  1I4Z A;  2ZD9 A;  3O55 A;  4U5H A;  3H2V A;  1ZZP A;  2OJE D;  2XLE A;  5T1D B;  2YKZ A;  3RKO F;  1Q0F A;  3EHM A;  4AX2 A;  2HSQ A;  1JMW A;  3F46 A;  2HKV A;  4MVO A;  1K40 A;  2IXO A;  2G62 A;  3ITF A;  4MW3 A;  1PD0 A;  4CDA A;  1I4Y A;  4MVR A;  4O6M A;  4PJM A;  5CI9 A;  4F4B A;  2H7V C;  3AGU A;  4KNW A;  4LLC A;  4JTD B;  4P9T A;  4ULW A;  4AE4 A;  3LLI A;  4JKV A;  2BE5 F;  1ZW3 A;  2DI3 A;  2OEX A;  3I5P A;  4WGZ A;  1LE2 A;  2QE9 A;  3M79 A;  3QTH A;  4XPX A;  3V5Z A;  1XZQ A;  4UDV A;  1C17 M;  4Z9J A;  3GM2 A;  3TOM A;  3W2W A;  2CGE A;  2CYD A;  3HLZ A;  3ABK C;  3KPH A;  5JP7 A;  5L0J A;  2HZ8 A;  2BC5 A;  5A6K A;  3DJN B;  3Q7L A;  2Q4F A;  4LDK A;  3SNH A;  3C62 A;  3RVZ A;  2D5R B;  1M2V B;  1A0B A;  1FFT C;  1V74 B;  1SF8 A;  1XWJ A;  2XL4 A;  2VB6 A;  3DKA A;  3F47 A;  4IAR A;  3U0C A;  1Q0D A;  2EPL X;  3Q6M A;  4N6C A;  2FAP B;  3DJU B;  4ZLC A;  4I3M A;  2KC3 A;  4C3D A;  3AG3 C;  1HW1 A;  1MNE A;  1YJG A;  2W4B A;  4X0R A;  2XS1 A;  1YA7 O;  3H65 A;  2J46 A;  2J9B A;  1ZU4 A;  1DOV A;  1FNT c;  4U9E A;  2P61 A;  3O10 A;  5JRA A;  1RXQ A;  1WGW A;  1RKC A;  3QZC A;  3JSZ A;  1Q0G A;  2OG2 A;  3CSK A;  2RSE B;  3ECS A;  2R7S A;  4CIP A;  4MQ9 F;  5T3T A;  1OKK D;  3ZIB A;  2XLH A;  1I5N A;  3HNL A;  3KH2 A;  1VOM A;  4XEV A;  4U5E E;  4MVZ A;  1V55 C;  3MFN A;  5E33 A;  4IJJ A;  3UMH A;  5E3A A;  1ORY A;  3IPM O;  4O7G A;  5FZT A;  2DYS C;  2EPK X;  1OXB A;  2BL2 A;  3LNR A;  1OQC A;  2JX0 A;  2A0U A;  3SP1 A;  2CNW A;  2UUI A;  2WZL A;  4XEF A;  4G78 A;  5HSW A;  4YK5 A;  4H54 A;  3ZSU A;  2LK4 A;  4FX5 A;  4E0I A;  4BG0 A;  4L6R A;  5BUO A;  2R9R B;  2AVK A;  2KSF A;  1AVO B;  4PFP A;  2MWQ A;  3HNJ A;  3W8I A;  5A6B A;  4DVZ A;  1E83 A;  1VMA A;  2OU6 A;  2G3V A;  4A2N B;  4XPW A;  3AG4 C;  1HW2 A;  4EUK B;  3G50 A;  3FAJ A;  1H6G A;  1XZP A;  2VAS A;  2A0B A;  3EPV A;  4PJN A;  2R7U A;  1RMV A;  1TWC A;  3SEO A;  3M1C B;  4WJ0 A;  2Q7R A;  3RQF A;  4AK9 A;  3B0P A;  3FOP A;  4EBK A;  5A6J A;  3QVZ A;  2F22 A;  2EIK C;  4K7B A;  4Q5S F;  3EGD A;  2YHS A;  3R7C A;  5JVE A;  3SXZ A;  1YZA A;  3AQC A;  1TR2 A;  3U8V A;  3E9V A;  4NY3 A;  3S29 A;  1YYJ A;  3GEH A;  3CAX A;  3NRH A;  1H9T A;  3DAF A;  3NKD A;  3EFO A;  1GM5 A;  3EZH A;  1CGM E;  2EPN A;  3JYY A;  4CS9 A;  4CS8 C;  3RYL A;  3PHF 2;  3L0I A;  3T4R A;  4CS7 A;  1OCC C;  3KYI A;  3V7O A;  1YA9 A;  3LUT B;  3S27 A;  3DM9 B;  3SYN A;  5GPG B;  4G0H A;  1AUE A;  1L3P A;  4RDA A;  4CDY A;  4EIY A;  4BJT A;  1E84 A;  4G7O F;  2L81 A;  3JRM O;  1OCO C;  5DLJ A;  4EKW A;  5KYY A;  1Z7Q c;  5KYN A;  4YT4 A;  2R03 A;  4K1O A;  2LCH A;  5DQT A;  2DGJ A;  1O3U A;  2Y3B A;  1OXK A;  4N6H A;  1TFK B;  3MBG A;  3U8P A;  5AC4 A;  2GWW A;  1RKE A;  1O87 A;  3EFO B;  3JCU Q;  1VTM P;  2EIM C;  2L6F A;  1LE4 A;  3VM6 A;  3MX3 A;  3VYW A;  5DVW A;  1M6T A;  5COM A;  2R7O A;  2YLD A;  3J06 A;  1UFB A;  3JSE O;  4EHP A;  3ZTM A;  2PX3 A;  1BBH A;  5COG A;  3K6B A;  5L3V A;  5D91 A;  3X1O A;  2PBE A;  4IWB A;  1W2W A;  1WAT A;  3NMI A;  4IGG A;  5KYW B;  1S7Z A;  3ZVR A;  4C3E A;  4NTB A;  4YWQ A;  4YL1 A;  3U9M A;  1BDJ B;  3NG1 A;  1YVI A;  2C03 A;  1LS1 A;  3AG2 C;  3EJN A;  3WHN A;  4C7O B;  3RVY A;  1T9K A;  4MS2 A;  3NMJ A;  2VH3 A;  1YDI A;  1U6H A;  3EG9 A;  3N0T A;  4MVU A;  3HJC A;  3K1I A;  4XTK A; 
#chains in the Genus database with same CATH homology
 2ASR A;  1LIH A;  2D4U A;  3ATP A;  4H54 A;  4Z9H A;  4Z9J A;  1VLS A;  1WAS A;  1JMW A;  2LIG A;  1WAT A;  4Z9I A;  3T9O A;  1VLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...