1VLTA

Ligand binding domain of the wild-type aspartate receptor with aspartate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
142
structure length
142
Chain Sequence
b'GFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE RECEPTOR
molecule tags Complex (chemotaxis/peptide)
source organism Salmonella typhimurium
publication title High-resolution structures of the ligand binding domain of the wild-type bacterial aspartate receptor.
pubmed doi rcsb
total genus 55
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1vltA00
4Z9HA 3ATPA 3T9OA 2LIGA 1WATA 2D4UA 4Z9JA 1VLTA 2ASRA 1JMWA 4H54A 4Z9IA 1WASA 1VLSA 1LIHA
chains in the Genus database with same CATH superfamily
3U0CA 3MYIA 5JSLA 5A6KA 2CNWD 2FGYA 2L9JA 4WGYA 2XLHA 1FNTc 4CSAC 3G4ZA 2PFDA 3MX3A 2VCBA 2KK1A 4HE8D 4B6IA 3EHMA 3O39A 2PBEA 3EZHA 3W8HA 1TWCA 3HNKA 3N24A 1HW1A 1TQGA 2IXMA 2P0NA 4OD5A 4AK9A 2KW3C 3TOMA 5E3AA 5EGYA 3FDQA 3UMIA 1RCPA 1FFTC 5BQIA 5KYYB 2IXNA 4XPWA 2LCHA 2GDCA 2HKVA 4AL0A 1AVOB 4GEHA 1ZW3A 1Z7Qc 3GODA 1NZEA 3ATPA 1NFNA 3M4CA 3ZWIA 3H65A 4PK4A 2R7RA 1NSGB 1OCCC 2X51A 2XS1A 1VLSA 2YZSA 2VH3A 3CAXA 1HE9A 3NRHA 2DGJA 3GANA 4YL1A 2OJED 2IBFA 4IRUA 4IB4A 4H4KC 5BQGA 5EHHA 2J9WA 1QPUA 2Q3TA 5CI9A 5B3SC 4JJFA 3DXJF 3W2WA 1YDIA 3O6XA 2Y69C 4QDLA 4YT4A 1T6UA 3OWTA 4Q5SF 1NG1A 3RVYA 2L7AA 4C3EA 1T6IA 1YA7O 4CBEA 3NKEA 1NU7D 1ZZPA 5D92A 1VYIA 1S05A 3RF3A 1MNDA 1YJGA 2EIKC 3TK0A 4FAPB 4JEBA 4DRHB 2HMQA 1ZHWA 1E84A 5KYNA 2XXAB 1Y4CA 3U5SA 2YWAA 3S27A 1DOVA 1G4WR 4EBJA 1RMVA 2NUPA 2MWQA 2EPMX 3GWNA 3WODF 2YEVA 3C8GA 5IY5C 4I1OB 5F5HA 2J0WA 3JZ0A 4H54A 2JPUA 4L6RA 1V4AA 1EKYA 2MYSA 3EZIA 2PX3A 4NTBA 4U5GA 1AEPA 2EPKX 1SZIA 2CNWA 2R02A 3ITFA 3NMIA 4JTDB 1YVIA 2A6HF 4JTAB 4FX5A 3RW0A 5K0IA 3K7DA 1H6GA 1Z63A 1LIHA 2XLWA 2IXOA 3N0TA 5KYUA 4EHPA 4PR9A 1BR1A 2H7VC 4CS7A 1C02A 4P6IC 1A0BA 5A6AA 2KJGA 2EPNA 2GAQA 4PJJA 3O10A 4GYTA 2Q7RA 1OKKD 3RQFA 4D4NA 4EBKA 4CIHA 3I5QA 3NYJA 3TOLA 2JD3A 1VMAA 4MVOA 4DJ9A 3GORA 4I3MA 3I5PA 2R7UA 1K04A 4ER9A 2QUPA 3VAYA 2AP3A 2AVKA 3OEOA 4YT5A 1U89A 2LD6A 3IQ5A 4YWQA 3EPVA 1MMGA 3POVA 4A4AA 3DKAA 3TQOA 3UNGC 2Y3DA 5A6JA 2YLGA 3ZSUA 5F5FA 3K1HA 3S9OA 1GQAA 1WATA 1Q0MA 3AOUA 3JSEO 4K7BA 4LERA 1ZHYA 2C04A 2LFFA 4YL3A 3GWLA 3RIPA 4C3BA 3QMKA 4E17A 4KI2A 2OCCC 3NKDA 4ANJA 4CDYA 3O55A 4EKWA 3L34A 5KYXA 1YYXA 1HE1A 2I15A 2J45A 3PDMP 5A6BA 2ZD9A 4JCHA 4WGZA 2F22A 2XLOA 4BEMJ 5DQTA 1A7DA 1CGNA 3QTHA 3SZRA 4D4XA 2QLAA 3GM1A 3C18A 1C17M 4YT8A 4XLNF 2A0BA 3A11A 1RKCA 2HFIA 3CEXA 3B9QA 1H9TA 3LS0A 3U8PA 3KKBA 3VYWA 1D0ZA 2UUHA 4K0DA 1ST6A 2G3KA 3HNJA 1YAUO 5COFA 2OG2A 2L81A 2HV6A 1XZQA 3W4YA 1B68A 2XLVA 1H7IA 3K1IA 1K05A 1OKKA 2HV7A 3IHUA 3UR3C 1M57C 1EI7A 2DYSC 2P61A 3DM5A 2HJMA 1TWGA 4U5DE 3WAQA 2Y3GA 1TFKB 4KC9A 5L0CA 3SXYA 2CYDA 4XLPF 2ZXWC 5JLIA 2J9VA 1RKEB 1T9KA 1SYQA 4MTOA 4JE9A 3HKKA 1QLEC 4E7ZA 4A2NB 1YA9A 3HNIA 3LLIA 4CS9C 1D0XA 1VK5A 3RKOF 2WVQA 1PD0A 2QTVA 2R7XA 3EHNA 4N6CA 4C7OA 1OCZC 2AWCA 4FESA 4XEFA 5JS5A 1G8XA 2J0XA 1OR3A 2PP4A 2J9UA 3DE8A 1WTYA 3HLZA 1YZAA 2ICWG 1XZPA 4OD4A 4ONSA 2V26A 4U5HA 1U6HA 4CJOA 4JC7A 1SMYF 4PFOA 1J8YF 3M1CB 3E9VA 3W8IA 3K1IC 3BRJA 5JT4A 3NDBB 3TJ6A 5JUAA 4YL0A 4E18A 3EJNA 3U8VA 3ZIBA 3EH1A 2H8AA 4P9TA 1G5ZA 3FXHA 3PCVA 2YL1A 4FWVA 4PJNA 1BR4A 4BJ5C 3UGOA 1YZCA 5E2QA 2R7SA 3AG1C 5B3IA 2HS5A 4CIPA 2YL7A 1PV3A 1W2WA 4O6MA 1U0BB 4JZAA 2OQMA 4CS9A 1JPNA 3JRTA 3MBGA 1D0YA 2W4BA 1HY5A 2C03A 1ORSC 3NMJA 3EGXB 3FAPB 3WHNA 2NSGA 2ZXRA 1WASA 5DS6A 2EPOA 1FTSA 4IAQA 3DZAA 3JYYA 4KBLA 2LIGA 1ZVZA 1LI7A 4JURI 3N2ZB 4UDVA 1OCRC 3LLKA 4JRZA 4QI0A 2IXPA 2RD9A 3IQCA 1SR2A 2A0UA 2XRHA 5A69A 4BJ5A 1Q0KA 4XTKA 2A6EF 5L0JA 4MVSA 2Q4FA 3HNLA 2QY9A 3NG1A 4AX2A 5T1DB 2QNLA 1FFHA 3FAJA 4PACA 4ZLDA 1OW6A 4WJ0A 3SYNA 4EIYA 1A41A 4O6NA 3EGDA 4MW8A 5TJ5E 3AQBA 1K40A 1ZHTA 4MVQA 3TJ5A 4DBRA 3K6BA 4Q7CA 3U9JA 3GEHA 3U2LA 3L8JA 2LK4A 3ECSA 3NYLA 2HJ3A 2HUJA 5JRAA 4RD9A 3F46A 4J7TA 1APCA 3SP1A 5KYUB 4G7HF 2CDQA 4OIQF 1FR0A 2LP4A 2DB4A 1LE4A 5L0IA 1M2VB 2XL8A 1FAPB 4U5BE 4JVSA 5L3QA 1VB5A 2IOQA 2R25A 4Z9IA 1Q0FA 4JTCB 4X0RA 4BJTA 3UMHA 2TMVP 4HFKB 4XEVA 3EFOB 3DWWA 3KPHA 3X1OA 4CS8A 2R05A 2L6HA 4DRJB 1HW2A 2G3VA 1M2OA 3EH2A 1G4US 3PMRA 1L7CA 2M4EA 2KYHA 5A6BD 5T3WA 2WZGA 3V5YA 3FVYA 4W8KA 2GWWA 2NUTA 1V54C 4AE4A 3R2PA 1GM5A 1LI5A 4NQFA 3GM2A 4CX9A 3SEOA 3ZG1A 1TKNA 3JYHA 3QW1A 1Y6DA 4U5EE 4U5FE 4CDVA 5BQHA 4C3DA 1KTMA 3SXMA 1YARO 1GGQA 1DOWA 1CGOA 1KNYA 2O9XA 2YL3A 2AWYA 3CZ6A 4I1MA 4JKVA 1BZ4A 3C63A 1O5HA 2CCYA 2GFHA 1V55C 3MFNA 2V3CC 4RBNA 3ZVRA 3FOOA 2YL0A 5HSWA 5CIVA 4DVZA 5KYWB 1SF8A 3AG4C 2KNHA 2X0CA 1AUEA 1D1BA 3DMDA 1I4YA 3QZCA 4N4WA 4G7ZF 1VOMA 3GM3A 1MMAA 1IZMA 3AGTA 4KNVA 4NTFA 5L0FA 2WL8A 3TULA 1C03A 5L0HA 4DOZA 4NC3A 3LEOA 2BL2A 2OEVA 4MVUA 3EGXA 2YVKA 1I5NA 2RSEB 2XM4A 2VCAA 4ZLCA 4CS8C 3T6GB 1J8MF 1EQ1A 5FCLA 2A69F 2WB7A 2YQYA 3FOPA 3KYJA 2NUPB 3MYFA 4J30B 4Q4ZF 2WZLA 4EBBA 1IW7F 2B0JA 2MHRA 2CW0F 3HTKC 4MVMA 3AQCA 3LNMB 1JMWA 2LSEA 3H2UA 1JOGA 2A1DD 2HSQA 1TWAA 2EILC 3S90A 1QVXA 3L8IA 4Z9HA 3SNHA 2Z15A 2P6VA 4NY3A 1LM3B 1ZW2A 4J7YA 4LLEA 1Q0DA 4R32A 3AJMA 3WG7C 4MW3A 3DD7A 4BJ6C 4OIOF 3IPMO 1S7ZA 3U3FA 4G7OF 4U9DA 1LE2A 2Q9AA 2Y3HA 2OOCA 3V7OA 2R7QA 4MNDA 5DQZA 1VLTA 4BJ6A 3C8GD 3EGDB 1UFBA 3V5ZA 3ZQVA 5AC4A 1OCOC 3M15A 4HFFB 5D91A 1LPEA 4MS2A 5FZTA 3R7CA 4OIPF 4BPMA 3L0IA 3ABKC 3ABMC 1CGME 4C7OB 2VCCA 2HMZA 4O6YA 2HZ8A 3S28A 1RJ9B 3C7JA 1BBHA 1RXQA 2ZXOA 1RKEA 3H2VA 5L3VA 1ZHXA 2R7TA 5JVEA 4PJLA 1TWHA 5DLJA 4BG0A 3ZDLA 3B0VC 2IYLD 1LS4A 3BEHA 3DJNB 3IEEA 1O87A 1MQVA 2EIMC 2J7PA 3QVYA 4IGGA 4PFPA 4E0HA 1QZXA 3T6BA 4U9EA 1XWJA 2IM8A 1QKRA 1R4TA 2OEXA 4DBQA 2H7OA 3U9MA 3V5XA 3ASNC 2YHSA 4U5CE 4LLCA 1CPRA 1Z23A 2XL4A 2DI3A 4AL1A 1Q0GA 3T6JA 3A9CA 4CDAA 5AC5A 2XSEA 3JT1A 3SXKA 1OXKA 2A68F 3DAGA 256BA 3NMKA 3K66A 3ZTZA 3RQEA 1N1CA 3DI5A 4CSAA 4IWBA 1QQ3A 1M6TA 1JAFA 3NYMA 3S29A 2G62A 3KYIA 1FMVA 2QE9A 3CSKA 2HSBA 4J32B 3S0XA 1HMDA 2Q9CA 4MVZA 1QSPA 3U3BA 5L0DA 4O79A 3S84A 4YJWA 5KYXB 2PX0A 4WABA 1TR2A 1JPJA 1YLMA 1I4ZA 2D5RB 2FFHA 3VF0A 5BUOA 2M64A 1HMOA 3LUTB 2H7BA 4MTGA 3Q6NA 4IAOA 4JEAA 3J06A 1T6QA 2ASRA 3C62A 3HJCA 3MLGA 4P9FA 2Y39A 3UMKA 3RH3A 5COMA 1LS1A 2J7PD 2KC3A 1FMWA 2CGEA 2NG1A 5B1BC 3FMSA 3JTLO 1GS9A 3SXZA 3DM9B 2EINC 2OU6A 2J46A 1T01A 2LQGA 2W9YA 3ZTMA 2D4UA 3UGPA 3LAYA 1NBBA 2FAPB 2L6GA 1PCXA 3M79A 2XL6A 2L6FA 4ULVA 1BR2A 2YLDA 3EG9A 4XEKA 4OINF 3VRCA 3W2VA 4BJ1A 5JP7A 4F4BA 4BEJA 2XLMA 2PNOA 1Z3IX 1ZU4A 4XQ1A 1MMNA 2EIJC 2WVNA 4KNWA 2J9BA 1WGWA 4DVYP 5DS4A 2VB6A 3Q6MA 1OW7A 3K33A 4O7GA 2R7VA 3B0PA 2XLEA 4XWJA 3FHDA 1WOLA 3GEEA 2UUIA 3AG2C 4LDRA 1UG7A 3B71A 1T5OA 4MQ9F 2OJQA 1CPQA 1OQCA 3GEIA 2AU5A 5T3TA 2WZFA 2KGOA 3JCUQ 2XM0A 1NU9C 2W45A 3EFOA 3JRMO 4GQHA 1ORYA 3F47A 1NLXA 3U2MA 2KQ9A 1ZYRF 5GPGB 1JRAA 3DAFA 3AG3C 1WWPA 5F28E 3T4RA 4JCZA 3C8ZA 4AE4B 3LNRA 3KMIA 5DS5A 4LDKA 3RFYA 2JX0A 2E87A 5KYYA 3DE9A 1E86A 4HEAJ 1MNEA 2BC5A 4LDQA 2P1AA 5AGFA 2W4MA 4JIOA 5E33A 4YT2A 3G50A 3OA1A 2YKZA 5CI8A 4OIRF 1A7VA 2DYRC 1F1MA 1YYJA 2KSFA 4PJMA 5B1AC 2R7WA 1A7EA 3KL4A 1R5ID 3B0UX 3L1MA 2GA0A 2NUTB 5KYWA 4I44A 2R7OA 1BDJB 3QVZA 1VYKA 4G78A 1E85A 2ZXPA 1ORJA 1L3PA 1LKXA 3IQ6A 4IJJA 3JSZA 1ZHZA 4W8PA 1NFOA 2BE5F 2VC9A 1TFOB 4N06A 2YLIA 1JR8A 3TD7A 3LEVA 2R9RB 3LS1A 2J8WA 2Q00A 4JW1A 4XPXA 4JJGA 3X2QC 3ZC4A 3ZQYA 1OW8A 3Q7LA 4EUKB 4NCQA 1Z6AA 2I8BA 2XS8A 1WN0A 4IARA 3RVZA 2XXAA 4G0HA 2EPLX 3ASOC 1Z5ZA 4QI2A 4RDAA 1OXBA 3Q7GA 2ETSA 3C8GB 5DVWA 5EK0A 3KH2A 2PF4E 4E0IA 4ULWA 4Z9JA 2P7VA 3LESA 1M56C 5L0GA 3LJBA 3RYLA 2NPUA 2XLDA 4MVRA 3VM6A 2WVOA 3B29A 4DRIB 3RQGA 2OKUA 2Y3BA 1V74B 2R03A 1OR2A 2YRFA 3ABLC 4E7SA 4NTAA 3PHF2 1H9GA 2NSFA 3EG9B 3CQZA 4YK5A 4CJGA 3I4UA 1VTMP 2LFDA 4LACB 3IQTA 2ZPAA 1M2VA 3T9OA 5COGA 3G4XA 1PD1A 1ZU5A 3M4BA 4N6HA 1KU2A 1LVKA 3AGUA 1D1CA 1EA8A 3EQLF 4YN0B 1E83A 4XPYA 4M63A 4EWCA 4K1OA 1RJ9A 3DJUB 1O3UA 5E3CA 3E70C 1MMDA 4MTFA 3US6A 1D1AA 2Q9BA 2VASA 3QW0A 4DXWA 2B0HA 5HV9A 1E2XA
chains in the Genus database with same CATH topology
4Z9HA 3ATPA 3T9OA 2LIGA 1WATA 2D4UA 4Z9JA 1VLTA 2ASRA 1JMWA 4H54A 4Z9IA 1WASA 1VLSA 1LIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z9H A;  3ATP A;  3T9O A;  2LIG A;  1WAT A;  2D4U A;  4Z9J A;  1VLT A;  2ASR A;  1JMW A;  4H54 A;  4Z9I A;  1WAS A;  1VLS A;  1LIH A; 
#chains in the Genus database with same CATH topology
 3U0C A;  3MYI A;  5JSL A;  5A6K A;  2CNW D;  2FGY A;  2L9J A;  4WGY A;  2XLH A;  1FNT c;  4CSA C;  3G4Z A;  2PFD A;  3MX3 A;  2VCB A;  2KK1 A;  4HE8 D;  4B6I A;  3EHM A;  3O39 A;  2PBE A;  3EZH A;  3W8H A;  1TWC A;  3HNK A;  3N24 A;  1HW1 A;  1TQG A;  2IXM A;  2P0N A;  4OD5 A;  4AK9 A;  2KW3 C;  3TOM A;  5E3A A;  5EGY A;  3FDQ A;  3UMI A;  1RCP A;  1FFT C;  5BQI A;  5KYY B;  2IXN A;  4XPW A;  2LCH A;  2GDC A;  2HKV A;  4AL0 A;  1AVO B;  4GEH A;  1ZW3 A;  1Z7Q c;  3GOD A;  1NZE A;  3ATP A;  1NFN A;  3M4C A;  3ZWI A;  3H65 A;  4PK4 A;  2R7R A;  1NSG B;  1OCC C;  2X51 A;  2XS1 A;  1VLS A;  2YZS A;  2VH3 A;  3CAX A;  1HE9 A;  3NRH A;  2DGJ A;  3GAN A;  4YL1 A;  2OJE D;  2IBF A;  4IRU A;  4IB4 A;  4H4K C;  5BQG A;  5EHH A;  2J9W A;  1QPU A;  2Q3T A;  5CI9 A;  5B3S C;  4JJF A;  3DXJ F;  3W2W A;  1YDI A;  3O6X A;  2Y69 C;  4QDL A;  4YT4 A;  1T6U A;  3OWT A;  4Q5S F;  1NG1 A;  3RVY A;  2L7A A;  4C3E A;  1T6I A;  1YA7 O;  4CBE A;  3NKE A;  1NU7 D;  1ZZP A;  5D92 A;  1VYI A;  1S05 A;  3RF3 A;  1MND A;  1YJG A;  2EIK C;  3TK0 A;  4FAP B;  4JEB A;  4DRH B;  2HMQ A;  1ZHW A;  1E84 A;  5KYN A;  2XXA B;  1Y4C A;  3U5S A;  2YWA A;  3S27 A;  1DOV A;  1G4W R;  4EBJ A;  1RMV A;  2NUP A;  2MWQ A;  2EPM X;  3GWN A;  3WOD F;  2YEV A;  3C8G A;  5IY5 C;  4I1O B;  5F5H A;  2J0W A;  3JZ0 A;  4H54 A;  2JPU A;  4L6R A;  1V4A A;  1EKY A;  2MYS A;  3EZI A;  2PX3 A;  4NTB A;  4U5G A;  1AEP A;  2EPK X;  1SZI A;  2CNW A;  2R02 A;  3ITF A;  3NMI A;  4JTD B;  1YVI A;  2A6H F;  4JTA B;  4FX5 A;  3RW0 A;  5K0I A;  3K7D A;  1H6G A;  1Z63 A;  1LIH A;  2XLW A;  2IXO A;  3N0T A;  5KYU A;  4EHP A;  4PR9 A;  1BR1 A;  2H7V C;  4CS7 A;  1C02 A;  4P6I C;  1A0B A;  5A6A A;  2KJG A;  2EPN A;  2GAQ A;  4PJJ A;  3O10 A;  4GYT A;  2Q7R A;  1OKK D;  3RQF A;  4D4N A;  4EBK A;  4CIH A;  3I5Q A;  3NYJ A;  3TOL A;  2JD3 A;  1VMA A;  4MVO A;  4DJ9 A;  3GOR A;  4I3M A;  3I5P A;  2R7U A;  1K04 A;  4ER9 A;  2QUP A;  3VAY A;  2AP3 A;  2AVK A;  3OEO A;  4YT5 A;  1U89 A;  2LD6 A;  3IQ5 A;  4YWQ A;  3EPV A;  1MMG A;  3POV A;  4A4A A;  3DKA A;  3TQO A;  3UNG C;  2Y3D A;  5A6J A;  2YLG A;  3ZSU A;  5F5F A;  3K1H A;  3S9O A;  1GQA A;  1WAT A;  1Q0M A;  3AOU A;  3JSE O;  4K7B A;  4LER A;  1ZHY A;  2C04 A;  2LFF A;  4YL3 A;  3GWL A;  3RIP A;  4C3B A;  3QMK A;  4E17 A;  4KI2 A;  2OCC C;  3NKD A;  4ANJ A;  4CDY A;  3O55 A;  4EKW A;  3L34 A;  5KYX A;  1YYX A;  1HE1 A;  2I15 A;  2J45 A;  3PDM P;  5A6B A;  2ZD9 A;  4JCH A;  4WGZ A;  2F22 A;  2XLO A;  4BEM J;  5DQT A;  1A7D A;  1CGN A;  3QTH A;  3SZR A;  4D4X A;  2QLA A;  3GM1 A;  3C18 A;  1C17 M;  4YT8 A;  4XLN F;  2A0B A;  3A11 A;  1RKC A;  2HFI A;  3CEX A;  3B9Q A;  1H9T A;  3LS0 A;  3U8P A;  3KKB A;  3VYW A;  1D0Z A;  2UUH A;  4K0D A;  1ST6 A;  2G3K A;  3HNJ A;  1YAU O;  5COF A;  2OG2 A;  2L81 A;  2HV6 A;  1XZQ A;  3W4Y A;  1B68 A;  2XLV A;  1H7I A;  3K1I A;  1K05 A;  1OKK A;  2HV7 A;  3IHU A;  3UR3 C;  1M57 C;  1EI7 A;  2DYS C;  2P61 A;  3DM5 A;  2HJM A;  1TWG A;  4U5D E;  3WAQ A;  2Y3G A;  1TFK B;  4KC9 A;  5L0C A;  3SXY A;  2CYD A;  4XLP F;  2ZXW C;  5JLI A;  2J9V A;  1RKE B;  1T9K A;  1SYQ A;  4MTO A;  4JE9 A;  3HKK A;  1QLE C;  4E7Z A;  4A2N B;  1YA9 A;  3HNI A;  3LLI A;  4CS9 C;  1D0X A;  1VK5 A;  3RKO F;  2WVQ A;  1PD0 A;  2QTV A;  2R7X A;  3EHN A;  4N6C A;  4C7O A;  1OCZ C;  2AWC A;  4FES A;  4XEF A;  5JS5 A;  1G8X A;  2J0X A;  1OR3 A;  2PP4 A;  2J9U A;  3DE8 A;  1WTY A;  3HLZ A;  1YZA A;  2ICW G;  1XZP A;  4OD4 A;  4ONS A;  2V26 A;  4U5H A;  1U6H A;  4CJO A;  4JC7 A;  1SMY F;  4PFO A;  1J8Y F;  3M1C B;  3E9V A;  3W8I A;  3K1I C;  3BRJ A;  5JT4 A;  3NDB B;  3TJ6 A;  5JUA A;  4YL0 A;  4E18 A;  3EJN A;  3U8V A;  3ZIB A;  3EH1 A;  2H8A A;  4P9T A;  1G5Z A;  3FXH A;  3PCV A;  2YL1 A;  4FWV A;  4PJN A;  1BR4 A;  4BJ5 C;  3UGO A;  1YZC A;  5E2Q A;  2R7S A;  3AG1 C;  5B3I A;  2HS5 A;  4CIP A;  2YL7 A;  1PV3 A;  1W2W A;  4O6M A;  1U0B B;  4JZA A;  2OQM A;  4CS9 A;  1JPN A;  3JRT A;  3MBG A;  1D0Y A;  2W4B A;  1HY5 A;  2C03 A;  1ORS C;  3NMJ A;  3EGX B;  3FAP B;  3WHN A;  2NSG A;  2ZXR A;  1WAS A;  5DS6 A;  2EPO A;  1FTS A;  4IAQ A;  3DZA A;  3JYY A;  4KBL A;  2LIG A;  1ZVZ A;  1LI7 A;  4JUR I;  3N2Z B;  4UDV A;  1OCR C;  3LLK A;  4JRZ A;  4QI0 A;  2IXP A;  2RD9 A;  3IQC A;  1SR2 A;  2A0U A;  2XRH A;  5A69 A;  4BJ5 A;  1Q0K A;  4XTK A;  2A6E F;  5L0J A;  4MVS A;  2Q4F A;  3HNL A;  2QY9 A;  3NG1 A;  4AX2 A;  5T1D B;  2QNL A;  1FFH A;  3FAJ A;  4PAC A;  4ZLD A;  1OW6 A;  4WJ0 A;  3SYN A;  4EIY A;  1A41 A;  4O6N A;  3EGD A;  4MW8 A;  5TJ5 E;  3AQB A;  1K40 A;  1ZHT A;  4MVQ A;  3TJ5 A;  4DBR A;  3K6B A;  4Q7C A;  3U9J A;  3GEH A;  3U2L A;  3L8J A;  2LK4 A;  3ECS A;  3NYL A;  2HJ3 A;  2HUJ A;  5JRA A;  4RD9 A;  3F46 A;  4J7T A;  1APC A;  3SP1 A;  5KYU B;  4G7H F;  2CDQ A;  4OIQ F;  1FR0 A;  2LP4 A;  2DB4 A;  1LE4 A;  5L0I A;  1M2V B;  2XL8 A;  1FAP B;  4U5B E;  4JVS A;  5L3Q A;  1VB5 A;  2IOQ A;  2R25 A;  4Z9I A;  1Q0F A;  4JTC B;  4X0R A;  4BJT A;  3UMH A;  2TMV P;  4HFK B;  4XEV A;  3EFO B;  3DWW A;  3KPH A;  3X1O A;  4CS8 A;  2R05 A;  2L6H A;  4DRJ B;  1HW2 A;  2G3V A;  1M2O A;  3EH2 A;  1G4U S;  3PMR A;  1L7C A;  2M4E A;  2KYH A;  5A6B D;  5T3W A;  2WZG A;  3V5Y A;  3FVY A;  4W8K A;  2GWW A;  2NUT A;  1V54 C;  4AE4 A;  3R2P A;  1GM5 A;  1LI5 A;  4NQF A;  3GM2 A;  4CX9 A;  3SEO A;  3ZG1 A;  1TKN A;  3JYH A;  3QW1 A;  1Y6D A;  4U5E E;  4U5F E;  4CDV A;  5BQH A;  4C3D A;  1KTM A;  3SXM A;  1YAR O;  1GGQ A;  1DOW A;  1CGO A;  1KNY A;  2O9X A;  2YL3 A;  2AWY A;  3CZ6 A;  4I1M A;  4JKV A;  1BZ4 A;  3C63 A;  1O5H A;  2CCY A;  2GFH A;  1V55 C;  3MFN A;  2V3C C;  4RBN A;  3ZVR A;  3FOO A;  2YL0 A;  5HSW A;  5CIV A;  4DVZ A;  5KYW B;  1SF8 A;  3AG4 C;  2KNH A;  2X0C A;  1AUE A;  1D1B A;  3DMD A;  1I4Y A;  3QZC A;  4N4W A;  4G7Z F;  1VOM A;  3GM3 A;  1MMA A;  1IZM A;  3AGT A;  4KNV A;  4NTF A;  5L0F A;  2WL8 A;  3TUL A;  1C03 A;  5L0H A;  4DOZ A;  4NC3 A;  3LEO A;  2BL2 A;  2OEV A;  4MVU A;  3EGX A;  2YVK A;  1I5N A;  2RSE B;  2XM4 A;  2VCA A;  4ZLC A;  4CS8 C;  3T6G B;  1J8M F;  1EQ1 A;  5FCL A;  2A69 F;  2WB7 A;  2YQY A;  3FOP A;  3KYJ A;  2NUP B;  3MYF A;  4J30 B;  4Q4Z F;  2WZL A;  4EBB A;  1IW7 F;  2B0J A;  2MHR A;  2CW0 F;  3HTK C;  4MVM A;  3AQC A;  3LNM B;  1JMW A;  2LSE A;  3H2U A;  1JOG A;  2A1D D;  2HSQ A;  1TWA A;  2EIL C;  3S90 A;  1QVX A;  3L8I A;  4Z9H A;  3SNH A;  2Z15 A;  2P6V A;  4NY3 A;  1LM3 B;  1ZW2 A;  4J7Y A;  4LLE A;  1Q0D A;  4R32 A;  3AJM A;  3WG7 C;  4MW3 A;  3DD7 A;  4BJ6 C;  4OIO F;  3IPM O;  1S7Z A;  3U3F A;  4G7O F;  4U9D A;  1LE2 A;  2Q9A A;  2Y3H A;  2OOC A;  3V7O A;  2R7Q A;  4MND A;  5DQZ A;  1VLT A;  4BJ6 A;  3C8G D;  3EGD B;  1UFB A;  3V5Z A;  3ZQV A;  5AC4 A;  1OCO C;  3M15 A;  4HFF B;  5D91 A;  1LPE A;  4MS2 A;  5FZT A;  3R7C A;  4OIP F;  4BPM A;  3L0I A;  3ABK C;  3ABM C;  1CGM E;  4C7O B;  2VCC A;  2HMZ A;  4O6Y A;  2HZ8 A;  3S28 A;  1RJ9 B;  3C7J A;  1BBH A;  1RXQ A;  2ZXO A;  1RKE A;  3H2V A;  5L3V A;  1ZHX A;  2R7T A;  5JVE A;  4PJL A;  1TWH A;  5DLJ A;  4BG0 A;  3ZDL A;  3B0V C;  2IYL D;  1LS4 A;  3BEH A;  3DJN B;  3IEE A;  1O87 A;  1MQV A;  2EIM C;  2J7P A;  3QVY A;  4IGG A;  4PFP A;  4E0H A;  1QZX A;  3T6B A;  4U9E A;  1XWJ A;  2IM8 A;  1QKR A;  1R4T A;  2OEX A;  4DBQ A;  2H7O A;  3U9M A;  3V5X A;  3ASN C;  2YHS A;  4U5C E;  4LLC A;  1CPR A;  1Z23 A;  2XL4 A;  2DI3 A;  4AL1 A;  1Q0G A;  3T6J A;  3A9C A;  4CDA A;  5AC5 A;  2XSE A;  3JT1 A;  3SXK A;  1OXK A;  2A68 F;  3DAG A;  256B A;  3NMK A;  3K66 A;  3ZTZ A;  3RQE A;  1N1C A;  3DI5 A;  4CSA A;  4IWB A;  1QQ3 A;  1M6T A;  1JAF A;  3NYM A;  3S29 A;  2G62 A;  3KYI A;  1FMV A;  2QE9 A;  3CSK A;  2HSB A;  4J32 B;  3S0X A;  1HMD A;  2Q9C A;  4MVZ A;  1QSP A;  3U3B A;  5L0D A;  4O79 A;  3S84 A;  4YJW A;  5KYX B;  2PX0 A;  4WAB A;  1TR2 A;  1JPJ A;  1YLM A;  1I4Z A;  2D5R B;  2FFH A;  3VF0 A;  5BUO A;  2M64 A;  1HMO A;  3LUT B;  2H7B A;  4MTG A;  3Q6N A;  4IAO A;  4JEA A;  3J06 A;  1T6Q A;  2ASR A;  3C62 A;  3HJC A;  3MLG A;  4P9F A;  2Y39 A;  3UMK A;  3RH3 A;  5COM A;  1LS1 A;  2J7P D;  2KC3 A;  1FMW A;  2CGE A;  2NG1 A;  5B1B C;  3FMS A;  3JTL O;  1GS9 A;  3SXZ A;  3DM9 B;  2EIN C;  2OU6 A;  2J46 A;  1T01 A;  2LQG A;  2W9Y A;  3ZTM A;  2D4U A;  3UGP A;  3LAY A;  1NBB A;  2FAP B;  2L6G A;  1PCX A;  3M79 A;  2XL6 A;  2L6F A;  4ULV A;  1BR2 A;  2YLD A;  3EG9 A;  4XEK A;  4OIN F;  3VRC A;  3W2V A;  4BJ1 A;  5JP7 A;  4F4B A;  4BEJ A;  2XLM A;  2PNO A;  1Z3I X;  1ZU4 A;  4XQ1 A;  1MMN A;  2EIJ C;  2WVN A;  4KNW A;  2J9B A;  1WGW A;  4DVY P;  5DS4 A;  2VB6 A;  3Q6M A;  1OW7 A;  3K33 A;  4O7G A;  2R7V A;  3B0P A;  2XLE A;  4XWJ A;  3FHD A;  1WOL A;  3GEE A;  2UUI A;  3AG2 C;  4LDR A;  1UG7 A;  3B71 A;  1T5O A;  4MQ9 F;  2OJQ A;  1CPQ A;  1OQC A;  3GEI A;  2AU5 A;  5T3T A;  2WZF A;  2KGO A;  3JCU Q;  2XM0 A;  1NU9 C;  2W45 A;  3EFO A;  3JRM O;  4GQH A;  1ORY A;  3F47 A;  1NLX A;  3U2M A;  2KQ9 A;  1ZYR F;  5GPG B;  1JRA A;  3DAF A;  3AG3 C;  1WWP A;  5F28 E;  3T4R A;  4JCZ A;  3C8Z A;  4AE4 B;  3LNR A;  3KMI A;  5DS5 A;  4LDK A;  3RFY A;  2JX0 A;  2E87 A;  5KYY A;  3DE9 A;  1E86 A;  4HEA J;  1MNE A;  2BC5 A;  4LDQ A;  2P1A A;  5AGF A;  2W4M A;  4JIO A;  5E33 A;  4YT2 A;  3G50 A;  3OA1 A;  2YKZ A;  5CI8 A;  4OIR F;  1A7V A;  2DYR C;  1F1M A;  1YYJ A;  2KSF A;  4PJM A;  5B1A C;  2R7W A;  1A7E A;  3KL4 A;  1R5I D;  3B0U X;  3L1M A;  2GA0 A;  2NUT B;  5KYW A;  4I44 A;  2R7O A;  1BDJ B;  3QVZ A;  1VYK A;  4G78 A;  1E85 A;  2ZXP A;  1ORJ A;  1L3P A;  1LKX A;  3IQ6 A;  4IJJ A;  3JSZ A;  1ZHZ A;  4W8P A;  1NFO A;  2BE5 F;  2VC9 A;  1TFO B;  4N06 A;  2YLI A;  1JR8 A;  3TD7 A;  3LEV A;  2R9R B;  3LS1 A;  2J8W A;  2Q00 A;  4JW1 A;  4XPX A;  4JJG A;  3X2Q C;  3ZC4 A;  3ZQY A;  1OW8 A;  3Q7L A;  4EUK B;  4NCQ A;  1Z6A A;  2I8B A;  2XS8 A;  1WN0 A;  4IAR A;  3RVZ A;  2XXA A;  4G0H A;  2EPL X;  3ASO C;  1Z5Z A;  4QI2 A;  4RDA A;  1OXB A;  3Q7G A;  2ETS A;  3C8G B;  5DVW A;  5EK0 A;  3KH2 A;  2PF4 E;  4E0I A;  4ULW A;  4Z9J A;  2P7V A;  3LES A;  1M56 C;  5L0G A;  3LJB A;  3RYL A;  2NPU A;  2XLD A;  4MVR A;  3VM6 A;  2WVO A;  3B29 A;  4DRI B;  3RQG A;  2OKU A;  2Y3B A;  1V74 B;  2R03 A;  1OR2 A;  2YRF A;  3ABL C;  4E7S A;  4NTA A;  3PHF 2;  1H9G A;  2NSF A;  3EG9 B;  3CQZ A;  4YK5 A;  4CJG A;  3I4U A;  1VTM P;  2LFD A;  4LAC B;  3IQT A;  2ZPA A;  1M2V A;  3T9O A;  5COG A;  3G4X A;  1PD1 A;  1ZU5 A;  3M4B A;  4N6H A;  1KU2 A;  1LVK A;  3AGU A;  1D1C A;  1EA8 A;  3EQL F;  4YN0 B;  1E83 A;  4XPY A;  4M63 A;  4EWC A;  4K1O A;  1RJ9 A;  3DJU B;  1O3U A;  5E3C A;  3E70 C;  1MMD A;  4MTF A;  3US6 A;  1D1A A;  2Q9B A;  2VAS A;  3QW0 A;  4DXW A;  2B0H A;  5HV9 A;  1E2X A; 
#chains in the Genus database with same CATH homology
 4Z9H A;  3ATP A;  3T9O A;  2LIG A;  1WAT A;  2D4U A;  4Z9J A;  1VLT A;  2ASR A;  1JMW A;  4H54 A;  4Z9I A;  1WAS A;  1VLS A;  1LIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...