1VLTA

Ligand binding domain of the wild-type aspartate receptor with aspartate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
142
structure length
142
Chain Sequence
GFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (chemotaxis/peptide)
molecule keywords ASPARTATE RECEPTOR
publication title High-resolution structures of the ligand binding domain of the wild-type bacterial aspartate receptor.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 55
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1vltA00
4H54A 3T9OA 4Z9HA 1VLSA 2ASRA 4Z9JA 3ATPA 1WASA 1VLTA 2LIGA 1JMWA 2D4UA 1LIHA 4Z9IA 1WATA
chains in the Genus database with same CATH superfamily
3KPHA 2ZXOA 4AK9A 1UG7A 1YZCA 3KYJA 3U5SA 2KQ9A 4QI0A 4N6CA 3EZIA 1A0BA 4MVOA 1NSGB 2M4EA 3HKKA 2GAQA 1BZ4A 1Z3IX 5L0HA 3HJCA 3R2PA 1H6GA 2EPKX 3TJ6A 2NSFA 2KC3A 2OEVA 3JZ0A 4A2NB 1ZHZA 3CZ6A 3N0TA 5KYUB 4QI2A 1OXBA 3C18A 3M4BA 1QVXA 1EI7A 3LEVA 1CGME 4HFFB 1E2XA 4I1OB 4MVZA 3WAQA 2B0HA 3IQCA 3NDBB 2HSBA 2NUPA 2Q4FA 4W8PA 2EILC 2NUTA 4GYTA 4YT5A 5B3SC 3PDMP 1U0BB 5A6AA 2RSEB 1HE1A 2ASRA 1I4YA 2Y3HA 2ZXWC 2YEVA 2YLDA 5A69A 4G78A 2HKVA 3ZTZA 1HE9A 2GFHA 3AQBA 4H54A 3ZQYA 1IW7F 4K0DA 1Q0DA 1YLMA 1SYQA 5CI8A 3WODF 3VAYA 4Z9JA 4C3EA 3ATPA 3MBGA 1U89A 2Q7RA 4CJOA 2H7VC 1SZIA 2FAPB 2Q3TA 3SNHA 1TQGA 5F5FA 3IHUA 5T1DB 3HNKA 3L1MA 4ER9A 4EKWA 4IJJA 2Y3GA 1J8YF 1XZPA 4XWJA 5JVEA 3EJNA 1KNYA 3FDQA 1H9GA 5L3VA 4IB4A 5FZTA 2V26A 1TR2A 4XPYA 3C62A 3DZAA 4YL0A 4CS9C 1LS1A 1M2OA 3EHMA 3GM3A 3ABKC 4U9DA 2WB7A 3US6A 3V5ZA 3M15A 4YWQA 4PFOA 4ZLCA 1J8MF 4NC3A 4EIYA 3RKOF 1AVOB 4PJNA 1TFOB 1RJ9B 1TFKB 1TKNA 3EHNA 3OEOA 3JYYA 4CS8C 4DBRA 5HV9A 3DM9B 3SP1A 4Q5SF 5B3IA 3IQTA 3IQ6A 2ETSA 1ORJA 4U5EE 1TWHA 2XSEA 4LACB 3QVYA 3U2LA 5L3QA 3U8PA 1E83A 1NG1A 1V55C 1OW6A 5DVWA 1QPUA 1T01A 2JX0A 1ZU5A 2XXAB 1NU7D 2KSFA 3O39A 3L8JA 3S90A 3X1OA 2XL6A 2J0XA 4JE9A 3U3FA 2I15A 4OIOF 3O10A 4RBNA 2H7OA 2H8AA 2VH3A 4U5BE 3SYNA 2I8BA 3K1HA 3VF0A 1ZW3A 2VB6A 3GM2A 3K66A 4XEFA 1LIHA 4O6YA 4LDQA 1NZEA 1T9KA 4HEAJ 4EBJA 2R7OA 2R7VA 1M56C 3C8GA 4JC7A 4FESA 5BQGA 3Q6MA 2LD6A 2P0NA 3OWTA 3VYWA 1OKKD 4MQ9F 2KGOA 5JS5A 3W8IA 2AU5A 1MMAA 1LE4A 3QMKA 1WWPA 2OG2A 2WVQA 4DVZA 1GM5A 2OU6A 4AE4A 2EIJC 1N1CA 3EGXB 1QQ3A 2P6VA 1D0XA 2CCYA 3NMIA 4NTFA 4YL3A 1NFNA 4BEMJ 4LLEA 3C8GB 4G7HF 2HJMA 1RKEA 2UUIA 2R03A 3DD7A 4XLNF 4IWBA 4O6NA 2AWYA 4Q7CA 1MMDA 3UMIA 1QKRA 1DOWA 2Y3BA 4JRZA 2R7UA 4HFKB 1SR2A 1VB5A 4PR9A 3DI5A 4WGZA 4JIOA 1YJGA 3EGDB 3GEIA 3HNJA 5KYWA 2R7SA 1MMNA 5AC5A 3M1CB 3TOLA 3R7CA 4BG0A 3CSKA 4YT4A 5CI9A 5A6JA 3T4RA 5KYYB 2L6FA 3EPVA 2QUPA 3EFOA 2R7QA 1H7IA 2OJED 5E3AA 3RF3A 1CGOA 1DOVA 3O55A 1I5NA 2YL0A 4I1MA 2WZLA 4U5CE 3RH3A 5CIVA 3RW0A 1UFBA 5L0CA 1VYKA 1HMDA 3B71A 3LNMB 4MNDA 4M63A 1Z7Qc 2AWCA 4G0HA 4E0HA 4G7OF 1EQ1A 3K7DA 3AQCA 4L6RA 1K40A 5D91A 1OXKA 3RQFA 2A68F 1OW7A 3NKEA 5JUAA 4P9FA 3EQLF 1H9TA 5BUOA 5FCLA 256BA 4OD4A 4ULVA 4DVYP 4XPWA 4UDVA 2OQMA 4KC9A 2UUHA 2TMVP 2LSEA 2L81A 2Q9AA 2YQYA 4MVRA 5KYUA 3UR3C 2FFHA 3DKAA 1EA8A 1LS4A 2EPMX 4R32A 2G62A 1D0ZA 4RD9A 3RFYA 2PFDA 5A6BD 4JW1A 5DQTA 4BJ5A 2IM8A 3PCVA 4Q4ZF 1RMVA 2DB4A 1G5ZA 2BC5A 2P61A 3JT1A 2Q9BA 3CQZA 3FOOA 2NG1A 2VASA 4MVQA 4DRHB 2JD3A 4G7ZF 3NMKA 2YLIA 3QZCA 1Z6AA 2XLMA 3GANA 3K1IA 3RIPA 4JTDB 2P1AA 3AG4C 1O87A 3MYIA 4CDVA 2J0WA 5AC4A 5EGYA 5HSWA 4I44A 3JRTA 4PJLA 4WABA 1K04A 4CBEA 4IAOA 4JURI 4N6HA 3UNGC 2EPNA 3W2WA 3EH2A 1ZW2A 2DGJA 2FGYA 5L0JA 4CSAA 3FXHA 1JMWA 2J9UA 3LEOA 3ZVRA 3ASNC 4MTOA 4JVSA 3E9VA 4FX5A 1YDIA 4WGYA 3JRMO 4KBLA 4CIHA 1OR2A 1VYIA 2R7XA 3S29A 2R7WA 2A0UA 2J9VA 1CPRA 2WVNA 2YL1A 4JTAB 2PX3A 3Q6NA 4JJGA 5JP7A 2OKUA 5AGFA 5IY5C 1LVKA 1QLEC 2LFDA 3GORA 1RJ9A 3QVZA 4BJ5C 3K33A 3U9JA 2XLWA 4YJWA 1E86A 1FMWA 2QY9A 4P9TA 3W4YA 2EIKC 1FR0A 3V5YA 2YKZA 3KKBA 3LLKA 4F4BA 3S84A 1AUEA 3C63A 4U5DE 5F5HA 4P6IC 1ZHWA 2W9YA 4OIPF 2J9BA 5D92A 3DAFA 1V54C 4AL1A 4XPXA 1Z63A 4U9EA 1A7EA 2XXAA 4E0IA 2EINC 3SXMA 3GEEA 4MW3A 2D4UA 2XLHA 1VLSA 4ZLDA 1TWAA 3EG9A 1M2VB 4CSAC 1ZU4A 3TK0A 4XLPF 5KYXA 2OCCC 3LUTB 3SXYA 3F46A 2YZSA 5GPGB 1O5HA 4PACA 5T3TA 2GWWA 4OIRF 4CX9A 4E17A 3TD7A 2XS1A 1I4ZA 3GM1A 1SMYF 4LDRA 2QE9A 3DE8A 4LDKA 1ORSC 2XL8A 3S0XA 2J8WA 4CJGA 2HS5A 4FWVA 3B0UX 3NYMA 3EG9B 1LPEA 2CW0F 2Y39A 1PD0A 4D4NA 4E18A 3ZDLA 4CDYA 2HZ8A 2GA0A 3L0IA 4BJ6A 4E7SA 3RQEA 1MNDA 3EGXA 1OCCC 1YAUO 2PX0A 4U5FE 5COFA 2L6GA 2NSGA 1U6HA 3NKDA 1D1CA 2CNWA 3RYLA 4XQ1A 3FHDA 1T5OA 2X0CA 1YYXA 2R02A 3I5QA 1HW2A 3EH1A 2KJGA 2L6HA 3W2VA 1VOMA 1S7ZA 4MTFA 3NRHA 2IXNA 1Q0GA 4JCZA 4BJ1A 1QZXA 3QTHA 5B1AC 4CDAA 5F28E 3EGDA 4PJJA 2RD9A 5E2QA 2YLGA 2J7PA 5JSLA 2YRFA 3DWWA 5KYYA 3B0VC 1V4AA 3X2QC 2W45A 3AG3C 4JTCB 1Z23A 1SF8A 2L9JA 1XWJA 3DM5A 4OIQF 2MYSA 1RXQA 1A7DA 3N24A 3B9QA 4BEJA 3PMRA 4A4AA 3AOUA 2Q9CA 2KK1A 5TJ5E 1MMGA 2YHSA 1D1BA 5E3CA 3SXZA 4O7GA 4BJ6C 3U9MA 4YK5A 1WGWA 3F47A 1EKYA 1HW1A 5KYXB 3GWNA 1OCZC 2Y3DA 3NYLA 1GGQA 1G8XA 2DYSC 2E87A 3GODA 5E33A 3MYFA 2YWAA 2XS8A 4NTAA 4H4KC 2XM0A 3EZHA 5L0GA 1NLXA 3GEHA 1PCXA 3ZTMA 3PHF2 1MNEA 4JEBA 3ITFA 4Z9HA 2IXOA 1GS9A 3N2ZB 1L3PA 1ZHTA 3AGTA 3LS0A 5JLIA 1YA7O 2HSQA 2WVOA 3G4XA 3OA1A 3U8VA 3C8ZA 2A1DD 2B0JA 3WHNA 3WG7C 5BQHA 4MW8A 1VTMP 3ABMC 2OOCA 1Y6DA 3DJUB 1K05A 3LLIA 3L34A 4EWCA 1W2WA 2PNOA 3JTLO 3T6BA 1LI5A 4DXWA 4EHPA 2XM4A 1VMAA 3HTKC 1HMOA 4JJFA 3U0CA 3TQOA 1G4US 1M57C 3JSZA 2ZXRA 4J32B 2H7BA 3LAYA 4U5GA 1V74B 3B29A 3AG1C 3RVZA 1OCOC 3NYJA 3T6GB 3ZSUA 3AG2C 3SXKA 1A41A 1M6TA 4U5HA 1ZHYA 1FAPB 3FVYA 1C02A 2EIMC 4MVMA 5EK0A 3S9OA 3ZIBA 3ZQVA 2P7VA 3HLZA 1E85A 4MVUA 1BR4A 3ZWIA 1OQCA 3ZC4A 4BPMA 3G50A 4DRIB 1KTMA 3DMDA 3ASOC 2HV7A 1LE2A 1D0YA 1VLTA 1WOLA 4O79A 4PFPA 4IARA 1O3UA 4NTBA 1T6IA 3ABLC 2HFIA 3IEEA 3KMIA 4YT8A 3LJBA 1LI7A 3UGOA 3KH2A 4XEVA 2YL7A 3H65A 4Z9IA 1ST6A 2EPOA 3A11A 3VRCA 1Q0MA 3IQ5A 1F1MA 1XZQA 2CDQA 3SZRA 2PF4E 4MTGA 5A6KA 1YZAA 1OCRC 2A6EF 1QSPA 2LP4A 1YYJA 3JSEO 1FFTC 3I4UA 2QNLA 2VC9A 4MVSA 1R4TA 4NQFA 4EBBA 1JPJA 1MQVA 2HJ3A 2DI3A 3I5PA 5COMA 3T6JA 4CS9A 1JRAA 2KNHA 2VCCA 2XLVA 3W8HA 3BRJA 4J7YA 2XL4A 4WJ0A 2V3CC 1M2VA 4JCHA 1JPNA 4CS8A 5L0FA 3KYIA 2LIGA 4NCQA 4FAPB 4CS7A 3CEXA 5KYNA 2PP4A 4PK4A 3T9OA 3K1IC 2ZXPA 2R7TA 2BE5F 4RDAA 2IXPA 1HY5A 3FMSA 3M4CA 2MHRA 5DS6A 2XRHA 4YL1A 4CIPA 2IOQA 1Q0FA 1WTYA 3NMJA 1ZZPA 2A69F 2NUPB 1ZVZA 2KW3C 2NUTB 2YL3A 3HNLA 3HNIA 3MLGA 2R05A 5DQZA 4YT2A 3QW0A 4AX2A 3FOPA 2C04A 2OJQA 3QW1A 1IZMA 4B6IA 4IAQA 3MX3A 1RCPA 4YN0B 3ZG1A 3RVYA 1Y4CA 1L7CA 4HE8D 4EBKA 2G3KA 3V7OA 4DOZA 4DBQA 2EPLX 1NBBA 3B0PA 3LNRA 2QTVA 2A6HF 1B68A 2W4BA 2ZPAA 3S28A 2JPUA 3ECSA 3DJNB 4I3MA 4IGGA 4JZAA 5EHHA 4K1OA 2R9RB 3RQGA 2WZGA 2OEXA 3DAGA 1C17M 2C03A 2J46A 1APCA 2YVKA 2CYDA 1OKKA 4KI2A 4E7ZA 1R5ID 2HV6A 1CGNA 1OW8A 1BR2A 3DXJF 2BL2A 3MFNA 4ONSA 2Q00A 2XLEA 4W8KA 1FTSA 5K0IA 4BJTA 1WN0A 2ZD9A 2AP3A 4D4XA 1FNTc 3LESA 3V5XA 4GEHA 1VK5A 2XLDA 2KYHA 4X0RA 1AEPA 3IPMO 1WASA 1YA9A 2LCHA 5COGA 2A0BA 3Q7GA 4GQHA 2VCBA 5DLJA 5DS4A 1BR1A 5JRAA 3K6BA 3CAXA 3UMHA 3DE9A 3SEOA 2W4MA 2O9XA 4LERA 1OR3A 4IRUA 1FMVA 4N4WA 4OD5A 3FAPB 4ULWA 1T6QA 1WATA 1PD1A 3U2MA 4C3BA 1YVIA 4DJ9A 1JR8A 1ZYRF 4N06A 4NY3A 3POVA 5DS5A 2MWQA 4O6MA 2J45A 3TULA 3JYHA 2G3VA 4PJMA 3S27A 1JAFA 1Q0KA 1A7VA 2NPUA 2CNWD 3C8GD 3G4ZA 4JKVA 2M64A 1NU9C 3GWLA 3M79A 4DRJB 3AGUA 2HUJA 2CGEA 1PV3A 1BDJB 4QDLA 4JEAA 4MS2A 5T3WA 4XEKA 3UMKA 2GDCA 2X51A 1LM3B 1S05A 3TJ5A 1G4WR 4C3DA 2F22A 2HMZA 2IBFA 2L7AA 2LK4A 2IYLD 5BQIA 2J7PD 4ANJA 3UGPA 5L0DA 4J7TA 3LS1A 1LKXA 1GQAA 1Z5ZA 4KNWA 5L0IA 2QLAA 1BBHA 3KL4A 3L8IA 2ICWG 1KU2A 1CPQA 1ORYA 4C7OA 1ZHXA 3BEHA 2R7RA 4AE4B 2HMQA 3VM6A 1D1AA 3A9CA 3O6XA 4J30B 2VCAA 2PBEA 3TOMA 1C03A 3JCUQ 2Y69C 4XTKA 1RKEB 4AL0A 2WL8A 4OINF 2AVKA 3H2VA 1JOGA 2D5RB 2J9WA 2XLOA 1FFHA 4K7BA 4LLCA 5B1BC 3U3BA 5A6BA 1E84A 4C7OB 3FAJA 3AJMA 3NG1A 1TWCA 3E70C 5KYWB 2LQGA 5JT4A 1T6UA 3J06A 1RKCA 2Z15A 4KNVA 2WZFA 3Q7LA 4EUKB 3EFOB 2DYRC 3C7JA 3H2UA 1NFOA 1TWGA 2R25A 2IXMA 1YARO 2LFFA
chains in the Genus database with same CATH topology
4H54A 3T9OA 4Z9HA 1VLSA 2ASRA 4Z9JA 3ATPA 1WASA 1VLTA 2LIGA 1JMWA 2D4UA 1LIHA 4Z9IA 1WATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H54 A;  3T9O A;  4Z9H A;  1VLS A;  2ASR A;  4Z9J A;  3ATP A;  1WAS A;  1VLT A;  2LIG A;  1JMW A;  2D4U A;  1LIH A;  4Z9I A;  1WAT A; 
#chains in the Genus database with same CATH topology
 3KPH A;  2ZXO A;  4AK9 A;  1UG7 A;  1YZC A;  3KYJ A;  3U5S A;  2KQ9 A;  4QI0 A;  4N6C A;  3EZI A;  1A0B A;  4MVO A;  1NSG B;  2M4E A;  3HKK A;  2GAQ A;  1BZ4 A;  1Z3I X;  5L0H A;  3HJC A;  3R2P A;  1H6G A;  2EPK X;  3TJ6 A;  2NSF A;  2KC3 A;  2OEV A;  3JZ0 A;  4A2N B;  1ZHZ A;  3CZ6 A;  3N0T A;  5KYU B;  4QI2 A;  1OXB A;  3C18 A;  3M4B A;  1QVX A;  1EI7 A;  3LEV A;  1CGM E;  4HFF B;  1E2X A;  4I1O B;  4MVZ A;  3WAQ A;  2B0H A;  3IQC A;  3NDB B;  2HSB A;  2NUP A;  2Q4F A;  4W8P A;  2EIL C;  2NUT A;  4GYT A;  4YT5 A;  5B3S C;  3PDM P;  1U0B B;  5A6A A;  2RSE B;  1HE1 A;  2ASR A;  1I4Y A;  2Y3H A;  2ZXW C;  2YEV A;  2YLD A;  5A69 A;  4G78 A;  2HKV A;  3ZTZ A;  1HE9 A;  2GFH A;  3AQB A;  4H54 A;  3ZQY A;  1IW7 F;  4K0D A;  1Q0D A;  1YLM A;  1SYQ A;  5CI8 A;  3WOD F;  3VAY A;  4Z9J A;  4C3E A;  3ATP A;  3MBG A;  1U89 A;  2Q7R A;  4CJO A;  2H7V C;  1SZI A;  2FAP B;  2Q3T A;  3SNH A;  1TQG A;  5F5F A;  3IHU A;  5T1D B;  3HNK A;  3L1M A;  4ER9 A;  4EKW A;  4IJJ A;  2Y3G A;  1J8Y F;  1XZP A;  4XWJ A;  5JVE A;  3EJN A;  1KNY A;  3FDQ A;  1H9G A;  5L3V A;  4IB4 A;  5FZT A;  2V26 A;  1TR2 A;  4XPY A;  3C62 A;  3DZA A;  4YL0 A;  4CS9 C;  1LS1 A;  1M2O A;  3EHM A;  3GM3 A;  3ABK C;  4U9D A;  2WB7 A;  3US6 A;  3V5Z A;  3M15 A;  4YWQ A;  4PFO A;  4ZLC A;  1J8M F;  4NC3 A;  4EIY A;  3RKO F;  1AVO B;  4PJN A;  1TFO B;  1RJ9 B;  1TFK B;  1TKN A;  3EHN A;  3OEO A;  3JYY A;  4CS8 C;  4DBR A;  5HV9 A;  3DM9 B;  3SP1 A;  4Q5S F;  5B3I A;  3IQT A;  3IQ6 A;  2ETS A;  1ORJ A;  4U5E E;  1TWH A;  2XSE A;  4LAC B;  3QVY A;  3U2L A;  5L3Q A;  3U8P A;  1E83 A;  1NG1 A;  1V55 C;  1OW6 A;  5DVW A;  1QPU A;  1T01 A;  2JX0 A;  1ZU5 A;  2XXA B;  1NU7 D;  2KSF A;  3O39 A;  3L8J A;  3S90 A;  3X1O A;  2XL6 A;  2J0X A;  4JE9 A;  3U3F A;  2I15 A;  4OIO F;  3O10 A;  4RBN A;  2H7O A;  2H8A A;  2VH3 A;  4U5B E;  3SYN A;  2I8B A;  3K1H A;  3VF0 A;  1ZW3 A;  2VB6 A;  3GM2 A;  3K66 A;  4XEF A;  1LIH A;  4O6Y A;  4LDQ A;  1NZE A;  1T9K A;  4HEA J;  4EBJ A;  2R7O A;  2R7V A;  1M56 C;  3C8G A;  4JC7 A;  4FES A;  5BQG A;  3Q6M A;  2LD6 A;  2P0N A;  3OWT A;  3VYW A;  1OKK D;  4MQ9 F;  2KGO A;  5JS5 A;  3W8I A;  2AU5 A;  1MMA A;  1LE4 A;  3QMK A;  1WWP A;  2OG2 A;  2WVQ A;  4DVZ A;  1GM5 A;  2OU6 A;  4AE4 A;  2EIJ C;  1N1C A;  3EGX B;  1QQ3 A;  2P6V A;  1D0X A;  2CCY A;  3NMI A;  4NTF A;  4YL3 A;  1NFN A;  4BEM J;  4LLE A;  3C8G B;  4G7H F;  2HJM A;  1RKE A;  2UUI A;  2R03 A;  3DD7 A;  4XLN F;  4IWB A;  4O6N A;  2AWY A;  4Q7C A;  1MMD A;  3UMI A;  1QKR A;  1DOW A;  2Y3B A;  4JRZ A;  2R7U A;  4HFK B;  1SR2 A;  1VB5 A;  4PR9 A;  3DI5 A;  4WGZ A;  4JIO A;  1YJG A;  3EGD B;  3GEI A;  3HNJ A;  5KYW A;  2R7S A;  1MMN A;  5AC5 A;  3M1C B;  3TOL A;  3R7C A;  4BG0 A;  3CSK A;  4YT4 A;  5CI9 A;  5A6J A;  3T4R A;  5KYY B;  2L6F A;  3EPV A;  2QUP A;  3EFO A;  2R7Q A;  1H7I A;  2OJE D;  5E3A A;  3RF3 A;  1CGO A;  1DOV A;  3O55 A;  1I5N A;  2YL0 A;  4I1M A;  2WZL A;  4U5C E;  3RH3 A;  5CIV A;  3RW0 A;  1UFB A;  5L0C A;  1VYK A;  1HMD A;  3B71 A;  3LNM B;  4MND A;  4M63 A;  1Z7Q c;  2AWC A;  4G0H A;  4E0H A;  4G7O F;  1EQ1 A;  3K7D A;  3AQC A;  4L6R A;  1K40 A;  5D91 A;  1OXK A;  3RQF A;  2A68 F;  1OW7 A;  3NKE A;  5JUA A;  4P9F A;  3EQL F;  1H9T A;  5BUO A;  5FCL A;  256B A;  4OD4 A;  4ULV A;  4DVY P;  4XPW A;  4UDV A;  2OQM A;  4KC9 A;  2UUH A;  2TMV P;  2LSE A;  2L81 A;  2Q9A A;  2YQY A;  4MVR A;  5KYU A;  3UR3 C;  2FFH A;  3DKA A;  1EA8 A;  1LS4 A;  2EPM X;  4R32 A;  2G62 A;  1D0Z A;  4RD9 A;  3RFY A;  2PFD A;  5A6B D;  4JW1 A;  5DQT A;  4BJ5 A;  2IM8 A;  3PCV A;  4Q4Z F;  1RMV A;  2DB4 A;  1G5Z A;  2BC5 A;  2P61 A;  3JT1 A;  2Q9B A;  3CQZ A;  3FOO A;  2NG1 A;  2VAS A;  4MVQ A;  4DRH B;  2JD3 A;  4G7Z F;  3NMK A;  2YLI A;  3QZC A;  1Z6A A;  2XLM A;  3GAN A;  3K1I A;  3RIP A;  4JTD B;  2P1A A;  3AG4 C;  1O87 A;  3MYI A;  4CDV A;  2J0W A;  5AC4 A;  5EGY A;  5HSW A;  4I44 A;  3JRT A;  4PJL A;  4WAB A;  1K04 A;  4CBE A;  4IAO A;  4JUR I;  4N6H A;  3UNG C;  2EPN A;  3W2W A;  3EH2 A;  1ZW2 A;  2DGJ A;  2FGY A;  5L0J A;  4CSA A;  3FXH A;  1JMW A;  2J9U A;  3LEO A;  3ZVR A;  3ASN C;  4MTO A;  4JVS A;  3E9V A;  4FX5 A;  1YDI A;  4WGY A;  3JRM O;  4KBL A;  4CIH A;  1OR2 A;  1VYI A;  2R7X A;  3S29 A;  2R7W A;  2A0U A;  2J9V A;  1CPR A;  2WVN A;  2YL1 A;  4JTA B;  2PX3 A;  3Q6N A;  4JJG A;  5JP7 A;  2OKU A;  5AGF A;  5IY5 C;  1LVK A;  1QLE C;  2LFD A;  3GOR A;  1RJ9 A;  3QVZ A;  4BJ5 C;  3K33 A;  3U9J A;  2XLW A;  4YJW A;  1E86 A;  1FMW A;  2QY9 A;  4P9T A;  3W4Y A;  2EIK C;  1FR0 A;  3V5Y A;  2YKZ A;  3KKB A;  3LLK A;  4F4B A;  3S84 A;  1AUE A;  3C63 A;  4U5D E;  5F5H A;  4P6I C;  1ZHW A;  2W9Y A;  4OIP F;  2J9B A;  5D92 A;  3DAF A;  1V54 C;  4AL1 A;  4XPX A;  1Z63 A;  4U9E A;  1A7E A;  2XXA A;  4E0I A;  2EIN C;  3SXM A;  3GEE A;  4MW3 A;  2D4U A;  2XLH A;  1VLS A;  4ZLD A;  1TWA A;  3EG9 A;  1M2V B;  4CSA C;  1ZU4 A;  3TK0 A;  4XLP F;  5KYX A;  2OCC C;  3LUT B;  3SXY A;  3F46 A;  2YZS A;  5GPG B;  1O5H A;  4PAC A;  5T3T A;  2GWW A;  4OIR F;  4CX9 A;  4E17 A;  3TD7 A;  2XS1 A;  1I4Z A;  3GM1 A;  1SMY F;  4LDR A;  2QE9 A;  3DE8 A;  4LDK A;  1ORS C;  2XL8 A;  3S0X A;  2J8W A;  4CJG A;  2HS5 A;  4FWV A;  3B0U X;  3NYM A;  3EG9 B;  1LPE A;  2CW0 F;  2Y39 A;  1PD0 A;  4D4N A;  4E18 A;  3ZDL A;  4CDY A;  2HZ8 A;  2GA0 A;  3L0I A;  4BJ6 A;  4E7S A;  3RQE A;  1MND A;  3EGX A;  1OCC C;  1YAU O;  2PX0 A;  4U5F E;  5COF A;  2L6G A;  2NSG A;  1U6H A;  3NKD A;  1D1C A;  2CNW A;  3RYL A;  4XQ1 A;  3FHD A;  1T5O A;  2X0C A;  1YYX A;  2R02 A;  3I5Q A;  1HW2 A;  3EH1 A;  2KJG A;  2L6H A;  3W2V A;  1VOM A;  1S7Z A;  4MTF A;  3NRH A;  2IXN A;  1Q0G A;  4JCZ A;  4BJ1 A;  1QZX A;  3QTH A;  5B1A C;  4CDA A;  5F28 E;  3EGD A;  4PJJ A;  2RD9 A;  5E2Q A;  2YLG A;  2J7P A;  5JSL A;  2YRF A;  3DWW A;  5KYY A;  3B0V C;  1V4A A;  3X2Q C;  2W45 A;  3AG3 C;  4JTC B;  1Z23 A;  1SF8 A;  2L9J A;  1XWJ A;  3DM5 A;  4OIQ F;  2MYS A;  1RXQ A;  1A7D A;  3N24 A;  3B9Q A;  4BEJ A;  3PMR A;  4A4A A;  3AOU A;  2Q9C A;  2KK1 A;  5TJ5 E;  1MMG A;  2YHS A;  1D1B A;  5E3C A;  3SXZ A;  4O7G A;  4BJ6 C;  3U9M A;  4YK5 A;  1WGW A;  3F47 A;  1EKY A;  1HW1 A;  5KYX B;  3GWN A;  1OCZ C;  2Y3D A;  3NYL A;  1GGQ A;  1G8X A;  2DYS C;  2E87 A;  3GOD A;  5E33 A;  3MYF A;  2YWA A;  2XS8 A;  4NTA A;  4H4K C;  2XM0 A;  3EZH A;  5L0G A;  1NLX A;  3GEH A;  1PCX A;  3ZTM A;  3PHF 2;  1MNE A;  4JEB A;  3ITF A;  4Z9H A;  2IXO A;  1GS9 A;  3N2Z B;  1L3P A;  1ZHT A;  3AGT A;  3LS0 A;  5JLI A;  1YA7 O;  2HSQ A;  2WVO A;  3G4X A;  3OA1 A;  3U8V A;  3C8Z A;  2A1D D;  2B0J A;  3WHN A;  3WG7 C;  5BQH A;  4MW8 A;  1VTM P;  3ABM C;  2OOC A;  1Y6D A;  3DJU B;  1K05 A;  3LLI A;  3L34 A;  4EWC A;  1W2W A;  2PNO A;  3JTL O;  3T6B A;  1LI5 A;  4DXW A;  4EHP A;  2XM4 A;  1VMA A;  3HTK C;  1HMO A;  4JJF A;  3U0C A;  3TQO A;  1G4U S;  1M57 C;  3JSZ A;  2ZXR A;  4J32 B;  2H7B A;  3LAY A;  4U5G A;  1V74 B;  3B29 A;  3AG1 C;  3RVZ A;  1OCO C;  3NYJ A;  3T6G B;  3ZSU A;  3AG2 C;  3SXK A;  1A41 A;  1M6T A;  4U5H A;  1ZHY A;  1FAP B;  3FVY A;  1C02 A;  2EIM C;  4MVM A;  5EK0 A;  3S9O A;  3ZIB A;  3ZQV A;  2P7V A;  3HLZ A;  1E85 A;  4MVU A;  1BR4 A;  3ZWI A;  1OQC A;  3ZC4 A;  4BPM A;  3G50 A;  4DRI B;  1KTM A;  3DMD A;  3ASO C;  2HV7 A;  1LE2 A;  1D0Y A;  1VLT A;  1WOL A;  4O79 A;  4PFP A;  4IAR A;  1O3U A;  4NTB A;  1T6I A;  3ABL C;  2HFI A;  3IEE A;  3KMI A;  4YT8 A;  3LJB A;  1LI7 A;  3UGO A;  3KH2 A;  4XEV A;  2YL7 A;  3H65 A;  4Z9I A;  1ST6 A;  2EPO A;  3A11 A;  3VRC A;  1Q0M A;  3IQ5 A;  1F1M A;  1XZQ A;  2CDQ A;  3SZR A;  2PF4 E;  4MTG A;  5A6K A;  1YZA A;  1OCR C;  2A6E F;  1QSP A;  2LP4 A;  1YYJ A;  3JSE O;  1FFT C;  3I4U A;  2QNL A;  2VC9 A;  4MVS A;  1R4T A;  4NQF A;  4EBB A;  1JPJ A;  1MQV A;  2HJ3 A;  2DI3 A;  3I5P A;  5COM A;  3T6J A;  4CS9 A;  1JRA A;  2KNH A;  2VCC A;  2XLV A;  3W8H A;  3BRJ A;  4J7Y A;  2XL4 A;  4WJ0 A;  2V3C C;  1M2V A;  4JCH A;  1JPN A;  4CS8 A;  5L0F A;  3KYI A;  2LIG A;  4NCQ A;  4FAP B;  4CS7 A;  3CEX A;  5KYN A;  2PP4 A;  4PK4 A;  3T9O A;  3K1I C;  2ZXP A;  2R7T A;  2BE5 F;  4RDA A;  2IXP A;  1HY5 A;  3FMS A;  3M4C A;  2MHR A;  5DS6 A;  2XRH A;  4YL1 A;  4CIP A;  2IOQ A;  1Q0F A;  1WTY A;  3NMJ A;  1ZZP A;  2A69 F;  2NUP B;  1ZVZ A;  2KW3 C;  2NUT B;  2YL3 A;  3HNL A;  3HNI A;  3MLG A;  2R05 A;  5DQZ A;  4YT2 A;  3QW0 A;  4AX2 A;  3FOP A;  2C04 A;  2OJQ A;  3QW1 A;  1IZM A;  4B6I A;  4IAQ A;  3MX3 A;  1RCP A;  4YN0 B;  3ZG1 A;  3RVY A;  1Y4C A;  1L7C A;  4HE8 D;  4EBK A;  2G3K A;  3V7O A;  4DOZ A;  4DBQ A;  2EPL X;  1NBB A;  3B0P A;  3LNR A;  2QTV A;  2A6H F;  1B68 A;  2W4B A;  2ZPA A;  3S28 A;  2JPU A;  3ECS A;  3DJN B;  4I3M A;  4IGG A;  4JZA A;  5EHH A;  4K1O A;  2R9R B;  3RQG A;  2WZG A;  2OEX A;  3DAG A;  1C17 M;  2C03 A;  2J46 A;  1APC A;  2YVK A;  2CYD A;  1OKK A;  4KI2 A;  4E7Z A;  1R5I D;  2HV6 A;  1CGN A;  1OW8 A;  1BR2 A;  3DXJ F;  2BL2 A;  3MFN A;  4ONS A;  2Q00 A;  2XLE A;  4W8K A;  1FTS A;  5K0I A;  4BJT A;  1WN0 A;  2ZD9 A;  2AP3 A;  4D4X A;  1FNT c;  3LES A;  3V5X A;  4GEH A;  1VK5 A;  2XLD A;  2KYH A;  4X0R A;  1AEP A;  3IPM O;  1WAS A;  1YA9 A;  2LCH A;  5COG A;  2A0B A;  3Q7G A;  4GQH A;  2VCB A;  5DLJ A;  5DS4 A;  1BR1 A;  5JRA A;  3K6B A;  3CAX A;  3UMH A;  3DE9 A;  3SEO A;  2W4M A;  2O9X A;  4LER A;  1OR3 A;  4IRU A;  1FMV A;  4N4W A;  4OD5 A;  3FAP B;  4ULW A;  1T6Q A;  1WAT A;  1PD1 A;  3U2M A;  4C3B A;  1YVI A;  4DJ9 A;  1JR8 A;  1ZYR F;  4N06 A;  4NY3 A;  3POV A;  5DS5 A;  2MWQ A;  4O6M A;  2J45 A;  3TUL A;  3JYH A;  2G3V A;  4PJM A;  3S27 A;  1JAF A;  1Q0K A;  1A7V A;  2NPU A;  2CNW D;  3C8G D;  3G4Z A;  4JKV A;  2M64 A;  1NU9 C;  3GWL A;  3M79 A;  4DRJ B;  3AGU A;  2HUJ A;  2CGE A;  1PV3 A;  1BDJ B;  4QDL A;  4JEA A;  4MS2 A;  5T3W A;  4XEK A;  3UMK A;  2GDC A;  2X51 A;  1LM3 B;  1S05 A;  3TJ5 A;  1G4W R;  4C3D A;  2F22 A;  2HMZ A;  2IBF A;  2L7A A;  2LK4 A;  2IYL D;  5BQI A;  2J7P D;  4ANJ A;  3UGP A;  5L0D A;  4J7T A;  3LS1 A;  1LKX A;  1GQA A;  1Z5Z A;  4KNW A;  5L0I A;  2QLA A;  1BBH A;  3KL4 A;  3L8I A;  2ICW G;  1KU2 A;  1CPQ A;  1ORY A;  4C7O A;  1ZHX A;  3BEH A;  2R7R A;  4AE4 B;  2HMQ A;  3VM6 A;  1D1A A;  3A9C A;  3O6X A;  4J30 B;  2VCA A;  2PBE A;  3TOM A;  1C03 A;  3JCU Q;  2Y69 C;  4XTK A;  1RKE B;  4AL0 A;  2WL8 A;  4OIN F;  2AVK A;  3H2V A;  1JOG A;  2D5R B;  2J9W A;  2XLO A;  1FFH A;  4K7B A;  4LLC A;  5B1B C;  3U3B A;  5A6B A;  1E84 A;  4C7O B;  3FAJ A;  3AJM A;  3NG1 A;  1TWC A;  3E70 C;  5KYW B;  2LQG A;  5JT4 A;  1T6U A;  3J06 A;  1RKC A;  2Z15 A;  4KNV A;  2WZF A;  3Q7L A;  4EUK B;  3EFO B;  2DYR C;  3C7J A;  3H2U A;  1NFO A;  1TWG A;  2R25 A;  2IXM A;  1YAR O;  2LFF A; 
#chains in the Genus database with same CATH homology
 4H54 A;  3T9O A;  4Z9H A;  1VLS A;  2ASR A;  4Z9J A;  3ATP A;  1WAS A;  1VLT A;  2LIG A;  1JMW A;  2D4U A;  1LIH A;  4Z9I A;  1WAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...