1G5ZA

Crystal structure of lyme disease antigen outer surface protein c (ospc) from borrelia burgdorferi strain n40
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
164
structure length
164
Chain Sequence
PNLTEISKKITESNAVVLAVKEVETLLASIDELATKAIGKKIGNNGLEANQSKNTSLLSGAYAISDLIAEKLNVLKNEELKEKIDTAKQCSTEFTNKLKSEHAVLGLDNLTDDNAQRAILKKHANKDKGAAELEKLFKAVENLSKAAQDTLKNAVKELTSPIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords OUTER SURFACE PROTEIN C
publication title Crystal structure of Lyme disease antigen outer surface protein C from Borrelia burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
total genus 64
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2000-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.240 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Lipoprotein, type 6 1g5zA00
1F1MA 1G5ZA 1YJGA 2GA0A 1GGQA
chains in the Genus database with same CATH superfamily
2EIKC 3NMJA 4U9DA 4BPMA 4YT4A 2A6HF 5L0GA 4U5EE 5JLIA 3US6A 3AG4C 4KNWA 5KYYB 3GM3A 1I4YA 5E2QA 2O9XA 1NU7D 4XTKA 4RDAA 1LIHA 5D91A 3TK0A 4OINF 3IQCA 1GQAA 4Q4ZF 3LJBA 5KYWA 3FOOA 4OIPF 1VLSA 1FMWA 4XEFA 1Z3IX 2G3KA 3EG9A 1NFOA 2R02A 4XQ1A 2A6EF 4C7OB 3ZWIA 1LE2A 2CGEA 3JSZA 2XLOA 4JURI 3WAQA 3DI5A 3X2QC 2Y3BA 2HV7A 2KJGA 1JOGA 1OCRC 4LLCA 1EQ1A 2BC5A 4MVSA 4Z9IA 2H7BA 3JYYA 1AVOB 1WN0A 5GPGB 1V4AA 3B0VC 1CGNA 4J32B 3IEEA 5DS6A 1AEPA 3M79A 4FWVA 3V7OA 2XLVA 4YT8A 2F22A 2R7QA 1HW1A 3ECSA 1CGME 4U9EA 2WL8A 2ZXPA 5EGYA 4JW1A 4D4XA 4H4KC 4UDVA 3N0TA 3LEOA 2LK4A 1SF8A 3ATPA 3NYMA 2L7AA 1BBHA 2Q9AA 1K04A 3C8GA 3U9MA 4EBBA 3R7CA 1KTMA 1SMYF 4CJOA 2R9RB 2XM0A 2CW0F 4XWJA 2KNHA 2LFFA 4RD9A 2DB4A 4JTCB 2JPUA 4AE4A 5A6BD 4J7YA 1AUEA 1ZYRF 2CCYA 3B9QA 3LLKA 4JEAA 1BR4A 1NSGB 2Y3HA 3DE9A 3EPVA 2KK1A 5BUOA 3AQBA 5E33A 2J7PD 2J9WA 1A7DA 1LVKA 3KPHA 1KNYA 1GM5A 4JCZA 1TWGA 1Z5ZA 2Q4FA 2ZXRA 4PK4A 4YL3A 5D92A 1TWHA 1BZ4A 2J9VA 2DYRC 2HFIA 2L6FA 1VB5A 1K05A 2OJED 3IHUA 3SNHA 4DJ9A 4XLNF 5KYWB 5L0FA 4FX5A 4KI2A 4A4AA 3IQ5A 3NKDA 2PBEA 4U5GA 2HMZA 4JE9A 3K66A 3UGPA 4AX2A 4NTBA 3EGXA 4JRZA 1ZU5A 3SXZA 4E18A 3RFYA 2WB7A 3FXHA 5TJ5E 4O7GA 2CYDA 1G5ZA 3K6BA 2C03A 2HJ3A 2Y69C 4I44A 1UFBA 4C3BA 3UMHA 2R7RA 3Q7LA 3MLGA 1M2OA 3ABMC 4K0DA 3WG7C 3M4BA 1HE1A 2J9BA 5BQIA 5A6JA 1E84A 1QKRA 4DXWA 1O3UA 1Y4CA 4E17A 3HKKA 4JC7A 5B3SC 1M6TA 1RKCA 4X0RA 1ZHTA 1JPJA 3I5PA 1YZCA 5BQHA 2R7UA 1FFTC 2VCBA 1RMVA 4LDQA 2KSFA 3RF3A 1W2WA 2XS8A 1L3PA 1NZEA 1MNDA 1ZHZA 2P1AA 3DAFA 3SP1A 1C02A 3SZRA 1FTSA 3U3BA 4ER9A 4G7HF 1U0BB 3KYJA 3EH2A 4AK9A 1B68A 2ICWG 2WZGA 4PJMA 2Q9CA 1ZW3A 1ORSC 4AE4B 2J46A 3NG1A 4IJJA 3TJ5A 1A7EA 2HZ8A 3AJMA 3W8IA 2IYLD 3DAGA 3U0CA 4GEHA 3UMIA 1E83A 5AC5A 3B71A 5JSLA 4YN0B 5T3TA 4ZLCA 3W8HA 2A68F 2GA0A 1ZVZA 3U9JA 2AU5A 4JJFA 4DRJB 4DBRA 2YHSA 5E3AA 1ORYA 3MFNA 3UGOA 4JJGA 3K33A 1TWAA 1JRAA 2OKUA 3C8ZA 4LACB 4MVQA 2H7OA 2QNLA 3VYWA 1JAFA 1JR8A 1O87A 1HY5A 3HLZA 2EILC 2J9UA 2Q00A 4YL1A 4CX9A 5FCLA 3ASNC 3Q6NA 3AOUA 4IWBA 2P6VA 5L0CA 2YLDA 3L0IA 1T01A 2P61A 4CS8C 1WATA 2X0CA 4XPYA 3LNMB 1OKKD 2CNWA 2IBFA 4G7OF 3T6GB 4K7BA 4DVYP 1J8MF 1YDIA 2Q9BA 2R7WA 4OD5A 3MYFA 4CDAA 3A11A 1H7IA 2A0UA 4XLPF 4W8KA 1M2VB 1QLEC 1NFNA 4BEJA 1Q0KA 4CSAA 1FFHA 1PV3A 1NU9C 1VOMA 2AWCA 1M56C 2WZLA 1VMAA 3FVYA 4Z9HA 4EIYA 3RQEA 4LERA 2EPLX 1D1BA 3TD7A 5JS5A 4MW3A 3X1OA 4OIRF 2NSGA 1VTMP 4WABA 1RKEA 3DMDA 3S84A 4BJ6C 3FMSA 4CS9C 2EPMX 1YA9A 3EFOA 2XL4A 4MVRA 4G0HA 4OIOF 1FR0A 1GS9A 1QSPA 1PD1A 3ABLC 4F4BA 4R32A 1BR1A 2EINC 3U5SA 1KU2A 3NMIA 1YA7O 2BE5F 2QTVA 3LUTB 1VLTA 3ZTMA 3JRTA 4YK5A 4U5CE 2XM4A 4J7TA 1LS4A 3JSEO 2J0WA 4PFPA 3ZG1A 1TKNA 1Z63A 5T1DB 3GODA 1HMOA 2TMVP 1Y6DA 3DD7A 3SYNA 3M15A 5L0IA 2A0BA 1QPUA 2A69F 1OXBA 5DLJA 3DZAA 2RD9A 1IZMA 3KYIA 3B0PA 2YLIA 3ZC4A 1CPRA 5AC4A 5KYUA 1ORJA 1Q0DA 5EK0A 4CIPA 4KNVA 1CPQA 1GGQA 3GM1A 4PACA 3F46A 4L6RA 3IQTA 3T6JA 3PMRA 3AG2C 3R2PA 1OW8A 3OEOA 4BG0A 4KBLA 3K1IA 5JUAA 3GWLA 1MMDA 3IQ6A 1C03A 1QVXA 4XEKA 2H7VC 1RXQA 2MYSA 3JZ0A 2X51A 4C3DA 4DBQA 5HV9A 2YVKA 1OCZC 2YEVA 3O6XA 2JD3A 1ZZPA 3EZIA 4PFOA 2R7XA 5DS5A 4MVMA 2KW3C 3HNIA 4NCQA 3B29A 2LQGA 1YVIA 1RKEB 2IXMA 3OWTA 3GM2A 2HJMA 1TFOB 4EWCA 2VCAA 3EHMA 3Q7GA 2R7OA 3S0XA 2J0XA 3GORA 3EFOB 3SEOA 2PNOA 2L6HA 2OU6A 2YLGA 3AG3C 2R7SA 5B1AC 1I5NA 4PJLA 4MTOA 1T5OA 3AQCA 3EG9B 3ITFA 2JX0A 3O55A 1T6IA 4JCHA 3U2MA 4NY3A 3DJUB 4BJTA 4E7SA 5HSWA 4I3MA 1OQCA 2C04A 1HW2A 2QUPA 5L0HA 3A9CA 1PD0A 4XPXA 5COGA 1YYXA 4IAOA 1H9GA 1TQGA 3UR3C 3I5QA 3QMKA 4JKVA 3RYLA 3N24A 4E0HA 2XLEA 3JYHA 3EJNA 3U8VA 4NQFA 1U6HA 1RCPA 1YAUO 2D4UA 1D1CA 2OG2A 3C62A 3H2UA 3RIPA 3U2LA 3U3FA 2DGJA 5JT4A 1H9TA 1LI7A 1ZHYA 2A1DD 3EHNA 4HE8D 2HS5A 4K1OA 3H65A 5KYUB 1HMDA 1E86A 2PFDA 2CDQA 2ZXWC 2FGYA 2J7PA 4U5HA 5DQTA 1BDJB 1APCA 3PCVA 3S29A 1I4ZA 5KYXA 3O10A 3T9OA 2XS1A 1XZQA 3GWNA 2HUJA 3C8GB 5CIVA 1LE4A 4XEVA 1E2XA 2HSBA 2NSFA 5DVWA 1D0XA 1YJGA 5DQZA 4U5DE 4JZAA 4NC3A 3EH1A 4FAPB 2J45A 2YL3A 4HFFB 3W2WA 4Z9JA 3F47A 4YWQA 1RJ9A 4C3EA 2R7TA 3MX3A 3RQGA 1H6GA 1SZIA 2D5RB 3EZHA 2PX3A 1LS1A 2ZPAA 4JTAB 2FAPB 2G3VA 3V5XA 4MQ9F 1OW6A 3CSKA 3S27A 1VYIA 3H2VA 4N06A 4P9TA 1HE9A 2WVNA 4FESA 1V55C 2YL0A 3RKOF 4B6IA 3CQZA 4BJ5C 1J8YF 2WVOA 2P0NA 3HTKC 3LEVA 2WZFA 4ULWA 5F28E 2AP3A 3DM9B 4JIOA 4WGYA 2XRHA 2R25A 3EGXB 3V5YA 5KYYA 4O6NA 2GFHA 2ZD9A 4EBJA 5L0DA 1A41A 5CI8A 3PDMP 1NLXA 5IY5C 3AGUA 3KKBA 2HKVA 2Y3GA 5F5HA 5B1BC 1MMGA 4YT5A 2OEXA 1T6QA 4C7OA 3ZVRA 2EIJC 1O5HA 3G50A 3L8IA 2VASA 4IAQA 4JTDB 4OD4A 2XSEA 3SXMA 2OOCA 3LAYA 2W4BA 1YLMA 3B0UX 1D1AA 2YQYA 256BA 2KGOA 2L6GA 2XL6A 3DKAA 4MNDA 1Q0FA 3K1HA 2R7VA 3T6BA 5KYXB 4YJWA 2XXAA 2I15A 3NYJA 4EUKB 4PR9A 4M63A 1XWJA 3CAXA 3L1MA 2ZXOA 1BR2A 3TQOA 1D0ZA 1IW7F 2Q3TA 3TULA 1MMNA 3E70C 5KYNA 2LP4A 3MYIA 3FAJA 4E0IA 1Z23A 1RJ9B 1EA8A 2R05A 2V3CC 2OCCC 2VC9A 5F5FA 3PHF2 4PJNA 1TWCA 3N2ZB 3RQFA 2NUTA 3LNRA 2P7VA 3BEHA 5JVEA 2LIGA 2V26A 5COMA 2M4EA 3DE8A 1YZAA 3SXYA 3WODF 2XL8A 5DS4A 4N6HA 4MVZA 1OR3A 3C63A 1G4WR 1T9KA 3TOLA 4N6CA 3L8JA 3DXJF 5JP7A 5L0JA 3FDQA 1V74B 3JT1A 3RW0A 3SXKA 4W8PA 2OEVA 4HFKB 3G4XA 1LM3B 3GEEA 1Z7Qc 4CS8A 1A7VA 3C8GD 1Q0GA 2VCCA 2LCHA 3E9VA 3FOPA 3RVZA 1G8XA 2QE9A 1EKYA 2IXNA 3DWWA 3ZIBA 3GEIA 4I1OB 3AGTA 1NBBA 4AL0A 5L3QA 3Q6MA 1OXKA 5BQGA 3M4CA 1ZU4A 2NPUA 1QZXA 3UMKA 3WHNA 1L7CA 4MVOA 1DOWA 2L81A 3U8PA 3O39A 2Q7RA 3UNGC 4BEMJ 4IRUA 4OIQF 3TJ6A 4I1MA 4GYTA 4BJ6A 2XXAB 1EI7A 4CJGA 4CS9A 1CGOA 1M57C 2ETSA 3JTLO 2AVKA 2NUPA 1ZHXA 4LLEA 1LPEA 2IOQA 3LS0A 3VAYA 2H8AA 3NKEA 4BJ1A 1C17M 1R4TA 4JVSA 4N4WA 4E7ZA 4NTFA 2MHRA 3ZDLA 3QVYA 2Y39A 3K7DA 1OR2A 4JEBA 2LD6A 3GEHA 3S9OA 2EPNA 2HSQA 3QZCA 4O6MA 2XLHA 4YL0A 1ZHWA 1WOLA 1T6UA 4QDLA 2XLMA 1MNEA 2YL7A 3HJCA 3L34A 3QW0A 1ST6A 2PF4E 1WWPA 2YRFA 3JRMO 2EIMC 2NUTB 4ULVA 2YWAA 4DRIB 4GQHA 1F1MA 3POVA 4LDKA 1LI5A 1FMVA 2YL1A 2QLAA 1WGWA 3LESA 1OCOC 4IARA 4EHPA 2VH3A 1WTYA 3GANA 2IM8A 2AWYA 5A6BA 4QI2A 4A2NB 2GAQA 1N1CA 3EGDA 3VM6A 3ZQVA 3C7JA 4ZLDA 1MMAA 4CBEA 4DVZA 2RSEB 3LLIA 1A0BA 3CZ6A 5A69A 4EKWA 4MW8A 2KC3A 2R03A 4Q7CA 3J06A 4NTAA 1E85A 4CS7A 4HEAJ 4ONSA 3NDBB 4MVUA 3HNJA 3S28A 2DI3A 4AL1A 5T3WA 1D0YA 4J30B 1WASA 3VRCA 3FAPB 4CIHA 2KQ9A 3ZTZA 1V54C 4G7ZF 2GWWA 3EQLF 2PX0A 4O79A 1ZW2A 2KYHA 3HNKA 3NRHA 3AG1C 3NMKA 4U5FE 5A6KA 1JPNA 2EPKX 3RVYA 2J8WA 4MTGA 1U89A 2QY9A 1SYQA 3DM5A 5CI9A 1R5ID 2NG1A 1NG1A 2WVQA 1M2VA 2NUPB 2W9YA 2XLWA 3I4UA 3KL4A 5EHHA 2Z15A 2VB6A 1XZPA 3OA1A 3FHDA 3QVZA 4ANJA 3G4ZA 2EPOA 1S7ZA 3ASOC 3C18A 1MQVA 3TOMA 5K0IA 5L3VA 4CSAC 4DRHB 2L9JA 5B3IA 2I8BA 3CEXA 5FZTA 2XLDA 1K40A 3LS1A 2LFDA 4CDYA 2PP4A 4MS2A 1LKXA 1Q0MA 2DYSC 2ASRA 1JMWA 1SR2A 2HV6A 4Q5SF 5AGFA 3M1CB 1UG7A 3BRJA 2CNWD 4IGGA 3RH3A 3ABKC 3W4YA 2LSEA 4U5BE 2B0HA 1TR2A 2W4MA 1FAPB 3ZSUA 3S90A 5JRAA 2B0JA 3JCUQ 3KMIA 2IXOA 3EGDB 3DJNB 2HMQA 2BL2A 3ZQYA 1FNTc 5E3CA 2UUIA 4PJJA 2OJQA 4IB4A 4QI0A 2YKZA 3T4RA 3QTHA 1TFKB 2W45A 4DOZA 4YT2A 2UUHA 2G62A 2Y3DA 3W2VA 2IXPA 4WGZA 1G4US 2E87A 5COFA 1DOVA 4P9FA 4MTFA 2GDCA 4H54A 1S05A 3VF0A 4KC9A 4EBKA 1YYJA 4P6IC 4WJ0A 2YZSA 1OW7A 1YARO 3KH2A 4G78A 2OQMA 3MBGA 3QW1A 3V5ZA 2FFHA 4LDRA 1PCXA 4O6YA 3NYLA 2M64A 1QQ3A 4D4NA 3HNLA 1OCCC 2MWQA 1VYKA 1Z6AA 3IPMO 4XPWA 4CDVA 4RBNA 1OKKA 3K1IC 1VK5A 5A6AA 4BJ5A
chains in the Genus database with same CATH topology
1F1MA 1G5ZA 1YJGA 2GA0A 1GGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F1M A;  1G5Z A;  1YJG A;  2GA0 A;  1GGQ A; 
#chains in the Genus database with same CATH topology
 2EIK C;  3NMJ A;  4U9D A;  4BPM A;  4YT4 A;  2A6H F;  5L0G A;  4U5E E;  5JLI A;  3US6 A;  3AG4 C;  4KNW A;  5KYY B;  3GM3 A;  1I4Y A;  5E2Q A;  2O9X A;  1NU7 D;  4XTK A;  4RDA A;  1LIH A;  5D91 A;  3TK0 A;  4OIN F;  3IQC A;  1GQA A;  4Q4Z F;  3LJB A;  5KYW A;  3FOO A;  4OIP F;  1VLS A;  1FMW A;  4XEF A;  1Z3I X;  2G3K A;  3EG9 A;  1NFO A;  2R02 A;  4XQ1 A;  2A6E F;  4C7O B;  3ZWI A;  1LE2 A;  2CGE A;  3JSZ A;  2XLO A;  4JUR I;  3WAQ A;  3DI5 A;  3X2Q C;  2Y3B A;  2HV7 A;  2KJG A;  1JOG A;  1OCR C;  4LLC A;  1EQ1 A;  2BC5 A;  4MVS A;  4Z9I A;  2H7B A;  3JYY A;  1AVO B;  1WN0 A;  5GPG B;  1V4A A;  3B0V C;  1CGN A;  4J32 B;  3IEE A;  5DS6 A;  1AEP A;  3M79 A;  4FWV A;  3V7O A;  2XLV A;  4YT8 A;  2F22 A;  2R7Q A;  1HW1 A;  3ECS A;  1CGM E;  4U9E A;  2WL8 A;  2ZXP A;  5EGY A;  4JW1 A;  4D4X A;  4H4K C;  4UDV A;  3N0T A;  3LEO A;  2LK4 A;  1SF8 A;  3ATP A;  3NYM A;  2L7A A;  1BBH A;  2Q9A A;  1K04 A;  3C8G A;  3U9M A;  4EBB A;  3R7C A;  1KTM A;  1SMY F;  4CJO A;  2R9R B;  2XM0 A;  2CW0 F;  4XWJ A;  2KNH A;  2LFF A;  4RD9 A;  2DB4 A;  4JTC B;  2JPU A;  4AE4 A;  5A6B D;  4J7Y A;  1AUE A;  1ZYR F;  2CCY A;  3B9Q A;  3LLK A;  4JEA A;  1BR4 A;  1NSG B;  2Y3H A;  3DE9 A;  3EPV A;  2KK1 A;  5BUO A;  3AQB A;  5E33 A;  2J7P D;  2J9W A;  1A7D A;  1LVK A;  3KPH A;  1KNY A;  1GM5 A;  4JCZ A;  1TWG A;  1Z5Z A;  2Q4F A;  2ZXR A;  4PK4 A;  4YL3 A;  5D92 A;  1TWH A;  1BZ4 A;  2J9V A;  2DYR C;  2HFI A;  2L6F A;  1VB5 A;  1K05 A;  2OJE D;  3IHU A;  3SNH A;  4DJ9 A;  4XLN F;  5KYW B;  5L0F A;  4FX5 A;  4KI2 A;  4A4A A;  3IQ5 A;  3NKD A;  2PBE A;  4U5G A;  2HMZ A;  4JE9 A;  3K66 A;  3UGP A;  4AX2 A;  4NTB A;  3EGX A;  4JRZ A;  1ZU5 A;  3SXZ A;  4E18 A;  3RFY A;  2WB7 A;  3FXH A;  5TJ5 E;  4O7G A;  2CYD A;  1G5Z A;  3K6B A;  2C03 A;  2HJ3 A;  2Y69 C;  4I44 A;  1UFB A;  4C3B A;  3UMH A;  2R7R A;  3Q7L A;  3MLG A;  1M2O A;  3ABM C;  4K0D A;  3WG7 C;  3M4B A;  1HE1 A;  2J9B A;  5BQI A;  5A6J A;  1E84 A;  1QKR A;  4DXW A;  1O3U A;  1Y4C A;  4E17 A;  3HKK A;  4JC7 A;  5B3S C;  1M6T A;  1RKC A;  4X0R A;  1ZHT A;  1JPJ A;  3I5P A;  1YZC A;  5BQH A;  2R7U A;  1FFT C;  2VCB A;  1RMV A;  4LDQ A;  2KSF A;  3RF3 A;  1W2W A;  2XS8 A;  1L3P A;  1NZE A;  1MND A;  1ZHZ A;  2P1A A;  3DAF A;  3SP1 A;  1C02 A;  3SZR A;  1FTS A;  3U3B A;  4ER9 A;  4G7H F;  1U0B B;  3KYJ A;  3EH2 A;  4AK9 A;  1B68 A;  2ICW G;  2WZG A;  4PJM A;  2Q9C A;  1ZW3 A;  1ORS C;  4AE4 B;  2J46 A;  3NG1 A;  4IJJ A;  3TJ5 A;  1A7E A;  2HZ8 A;  3AJM A;  3W8I A;  2IYL D;  3DAG A;  3U0C A;  4GEH A;  3UMI A;  1E83 A;  5AC5 A;  3B71 A;  5JSL A;  4YN0 B;  5T3T A;  4ZLC A;  3W8H A;  2A68 F;  2GA0 A;  1ZVZ A;  3U9J A;  2AU5 A;  4JJF A;  4DRJ B;  4DBR A;  2YHS A;  5E3A A;  1ORY A;  3MFN A;  3UGO A;  4JJG A;  3K33 A;  1TWA A;  1JRA A;  2OKU A;  3C8Z A;  4LAC B;  4MVQ A;  2H7O A;  2QNL A;  3VYW A;  1JAF A;  1JR8 A;  1O87 A;  1HY5 A;  3HLZ A;  2EIL C;  2J9U A;  2Q00 A;  4YL1 A;  4CX9 A;  5FCL A;  3ASN C;  3Q6N A;  3AOU A;  4IWB A;  2P6V A;  5L0C A;  2YLD A;  3L0I A;  1T01 A;  2P61 A;  4CS8 C;  1WAT A;  2X0C A;  4XPY A;  3LNM B;  1OKK D;  2CNW A;  2IBF A;  4G7O F;  3T6G B;  4K7B A;  4DVY P;  1J8M F;  1YDI A;  2Q9B A;  2R7W A;  4OD5 A;  3MYF A;  4CDA A;  3A11 A;  1H7I A;  2A0U A;  4XLP F;  4W8K A;  1M2V B;  1QLE C;  1NFN A;  4BEJ A;  1Q0K A;  4CSA A;  1FFH A;  1PV3 A;  1NU9 C;  1VOM A;  2AWC A;  1M56 C;  2WZL A;  1VMA A;  3FVY A;  4Z9H A;  4EIY A;  3RQE A;  4LER A;  2EPL X;  1D1B A;  3TD7 A;  5JS5 A;  4MW3 A;  3X1O A;  4OIR F;  2NSG A;  1VTM P;  4WAB A;  1RKE A;  3DMD A;  3S84 A;  4BJ6 C;  3FMS A;  4CS9 C;  2EPM X;  1YA9 A;  3EFO A;  2XL4 A;  4MVR A;  4G0H A;  4OIO F;  1FR0 A;  1GS9 A;  1QSP A;  1PD1 A;  3ABL C;  4F4B A;  4R32 A;  1BR1 A;  2EIN C;  3U5S A;  1KU2 A;  3NMI A;  1YA7 O;  2BE5 F;  2QTV A;  3LUT B;  1VLT A;  3ZTM A;  3JRT A;  4YK5 A;  4U5C E;  2XM4 A;  4J7T A;  1LS4 A;  3JSE O;  2J0W A;  4PFP A;  3ZG1 A;  1TKN A;  1Z63 A;  5T1D B;  3GOD A;  1HMO A;  2TMV P;  1Y6D A;  3DD7 A;  3SYN A;  3M15 A;  5L0I A;  2A0B A;  1QPU A;  2A69 F;  1OXB A;  5DLJ A;  3DZA A;  2RD9 A;  1IZM A;  3KYI A;  3B0P A;  2YLI A;  3ZC4 A;  1CPR A;  5AC4 A;  5KYU A;  1ORJ A;  1Q0D A;  5EK0 A;  4CIP A;  4KNV A;  1CPQ A;  1GGQ A;  3GM1 A;  4PAC A;  3F46 A;  4L6R A;  3IQT A;  3T6J A;  3PMR A;  3AG2 C;  3R2P A;  1OW8 A;  3OEO A;  4BG0 A;  4KBL A;  3K1I A;  5JUA A;  3GWL A;  1MMD A;  3IQ6 A;  1C03 A;  1QVX A;  4XEK A;  2H7V C;  1RXQ A;  2MYS A;  3JZ0 A;  2X51 A;  4C3D A;  4DBQ A;  5HV9 A;  2YVK A;  1OCZ C;  2YEV A;  3O6X A;  2JD3 A;  1ZZP A;  3EZI A;  4PFO A;  2R7X A;  5DS5 A;  4MVM A;  2KW3 C;  3HNI A;  4NCQ A;  3B29 A;  2LQG A;  1YVI A;  1RKE B;  2IXM A;  3OWT A;  3GM2 A;  2HJM A;  1TFO B;  4EWC A;  2VCA A;  3EHM A;  3Q7G A;  2R7O A;  3S0X A;  2J0X A;  3GOR A;  3EFO B;  3SEO A;  2PNO A;  2L6H A;  2OU6 A;  2YLG A;  3AG3 C;  2R7S A;  5B1A C;  1I5N A;  4PJL A;  4MTO A;  1T5O A;  3AQC A;  3EG9 B;  3ITF A;  2JX0 A;  3O55 A;  1T6I A;  4JCH A;  3U2M A;  4NY3 A;  3DJU B;  4BJT A;  4E7S A;  5HSW A;  4I3M A;  1OQC A;  2C04 A;  1HW2 A;  2QUP A;  5L0H A;  3A9C A;  1PD0 A;  4XPX A;  5COG A;  1YYX A;  4IAO A;  1H9G A;  1TQG A;  3UR3 C;  3I5Q A;  3QMK A;  4JKV A;  3RYL A;  3N24 A;  4E0H A;  2XLE A;  3JYH A;  3EJN A;  3U8V A;  4NQF A;  1U6H A;  1RCP A;  1YAU O;  2D4U A;  1D1C A;  2OG2 A;  3C62 A;  3H2U A;  3RIP A;  3U2L A;  3U3F A;  2DGJ A;  5JT4 A;  1H9T A;  1LI7 A;  1ZHY A;  2A1D D;  3EHN A;  4HE8 D;  2HS5 A;  4K1O A;  3H65 A;  5KYU B;  1HMD A;  1E86 A;  2PFD A;  2CDQ A;  2ZXW C;  2FGY A;  2J7P A;  4U5H A;  5DQT A;  1BDJ B;  1APC A;  3PCV A;  3S29 A;  1I4Z A;  5KYX A;  3O10 A;  3T9O A;  2XS1 A;  1XZQ A;  3GWN A;  2HUJ A;  3C8G B;  5CIV A;  1LE4 A;  4XEV A;  1E2X A;  2HSB A;  2NSF A;  5DVW A;  1D0X A;  1YJG A;  5DQZ A;  4U5D E;  4JZA A;  4NC3 A;  3EH1 A;  4FAP B;  2J45 A;  2YL3 A;  4HFF B;  3W2W A;  4Z9J A;  3F47 A;  4YWQ A;  1RJ9 A;  4C3E A;  2R7T A;  3MX3 A;  3RQG A;  1H6G A;  1SZI A;  2D5R B;  3EZH A;  2PX3 A;  1LS1 A;  2ZPA A;  4JTA B;  2FAP B;  2G3V A;  3V5X A;  4MQ9 F;  1OW6 A;  3CSK A;  3S27 A;  1VYI A;  3H2V A;  4N06 A;  4P9T A;  1HE9 A;  2WVN A;  4FES A;  1V55 C;  2YL0 A;  3RKO F;  4B6I A;  3CQZ A;  4BJ5 C;  1J8Y F;  2WVO A;  2P0N A;  3HTK C;  3LEV A;  2WZF A;  4ULW A;  5F28 E;  2AP3 A;  3DM9 B;  4JIO A;  4WGY A;  2XRH A;  2R25 A;  3EGX B;  3V5Y A;  5KYY A;  4O6N A;  2GFH A;  2ZD9 A;  4EBJ A;  5L0D A;  1A41 A;  5CI8 A;  3PDM P;  1NLX A;  5IY5 C;  3AGU A;  3KKB A;  2HKV A;  2Y3G A;  5F5H A;  5B1B C;  1MMG A;  4YT5 A;  2OEX A;  1T6Q A;  4C7O A;  3ZVR A;  2EIJ C;  1O5H A;  3G50 A;  3L8I A;  2VAS A;  4IAQ A;  4JTD B;  4OD4 A;  2XSE A;  3SXM A;  2OOC A;  3LAY A;  2W4B A;  1YLM A;  3B0U X;  1D1A A;  2YQY A;  256B A;  2KGO A;  2L6G A;  2XL6 A;  3DKA A;  4MND A;  1Q0F A;  3K1H A;  2R7V A;  3T6B A;  5KYX B;  4YJW A;  2XXA A;  2I15 A;  3NYJ A;  4EUK B;  4PR9 A;  4M63 A;  1XWJ A;  3CAX A;  3L1M A;  2ZXO A;  1BR2 A;  3TQO A;  1D0Z A;  1IW7 F;  2Q3T A;  3TUL A;  1MMN A;  3E70 C;  5KYN A;  2LP4 A;  3MYI A;  3FAJ A;  4E0I A;  1Z23 A;  1RJ9 B;  1EA8 A;  2R05 A;  2V3C C;  2OCC C;  2VC9 A;  5F5F A;  3PHF 2;  4PJN A;  1TWC A;  3N2Z B;  3RQF A;  2NUT A;  3LNR A;  2P7V A;  3BEH A;  5JVE A;  2LIG A;  2V26 A;  5COM A;  2M4E A;  3DE8 A;  1YZA A;  3SXY A;  3WOD F;  2XL8 A;  5DS4 A;  4N6H A;  4MVZ A;  1OR3 A;  3C63 A;  1G4W R;  1T9K A;  3TOL A;  4N6C A;  3L8J A;  3DXJ F;  5JP7 A;  5L0J A;  3FDQ A;  1V74 B;  3JT1 A;  3RW0 A;  3SXK A;  4W8P A;  2OEV A;  4HFK B;  3G4X A;  1LM3 B;  3GEE A;  1Z7Q c;  4CS8 A;  1A7V A;  3C8G D;  1Q0G A;  2VCC A;  2LCH A;  3E9V A;  3FOP A;  3RVZ A;  1G8X A;  2QE9 A;  1EKY A;  2IXN A;  3DWW A;  3ZIB A;  3GEI A;  4I1O B;  3AGT A;  1NBB A;  4AL0 A;  5L3Q A;  3Q6M A;  1OXK A;  5BQG A;  3M4C A;  1ZU4 A;  2NPU A;  1QZX A;  3UMK A;  3WHN A;  1L7C A;  4MVO A;  1DOW A;  2L81 A;  3U8P A;  3O39 A;  2Q7R A;  3UNG C;  4BEM J;  4IRU A;  4OIQ F;  3TJ6 A;  4I1M A;  4GYT A;  4BJ6 A;  2XXA B;  1EI7 A;  4CJG A;  4CS9 A;  1CGO A;  1M57 C;  2ETS A;  3JTL O;  2AVK A;  2NUP A;  1ZHX A;  4LLE A;  1LPE A;  2IOQ A;  3LS0 A;  3VAY A;  2H8A A;  3NKE A;  4BJ1 A;  1C17 M;  1R4T A;  4JVS A;  4N4W A;  4E7Z A;  4NTF A;  2MHR A;  3ZDL A;  3QVY A;  2Y39 A;  3K7D A;  1OR2 A;  4JEB A;  2LD6 A;  3GEH A;  3S9O A;  2EPN A;  2HSQ A;  3QZC A;  4O6M A;  2XLH A;  4YL0 A;  1ZHW A;  1WOL A;  1T6U A;  4QDL A;  2XLM A;  1MNE A;  2YL7 A;  3HJC A;  3L34 A;  3QW0 A;  1ST6 A;  2PF4 E;  1WWP A;  2YRF A;  3JRM O;  2EIM C;  2NUT B;  4ULV A;  2YWA A;  4DRI B;  4GQH A;  1F1M A;  3POV A;  4LDK A;  1LI5 A;  1FMV A;  2YL1 A;  2QLA A;  1WGW A;  3LES A;  1OCO C;  4IAR A;  4EHP A;  2VH3 A;  1WTY A;  3GAN A;  2IM8 A;  2AWY A;  5A6B A;  4QI2 A;  4A2N B;  2GAQ A;  1N1C A;  3EGD A;  3VM6 A;  3ZQV A;  3C7J A;  4ZLD A;  1MMA A;  4CBE A;  4DVZ A;  2RSE B;  3LLI A;  1A0B A;  3CZ6 A;  5A69 A;  4EKW A;  4MW8 A;  2KC3 A;  2R03 A;  4Q7C A;  3J06 A;  4NTA A;  1E85 A;  4CS7 A;  4HEA J;  4ONS A;  3NDB B;  4MVU A;  3HNJ A;  3S28 A;  2DI3 A;  4AL1 A;  5T3W A;  1D0Y A;  4J30 B;  1WAS A;  3VRC A;  3FAP B;  4CIH A;  2KQ9 A;  3ZTZ A;  1V54 C;  4G7Z F;  2GWW A;  3EQL F;  2PX0 A;  4O79 A;  1ZW2 A;  2KYH A;  3HNK A;  3NRH A;  3AG1 C;  3NMK A;  4U5F E;  5A6K A;  1JPN A;  2EPK X;  3RVY A;  2J8W A;  4MTG A;  1U89 A;  2QY9 A;  1SYQ A;  3DM5 A;  5CI9 A;  1R5I D;  2NG1 A;  1NG1 A;  2WVQ A;  1M2V A;  2NUP B;  2W9Y A;  2XLW A;  3I4U A;  3KL4 A;  5EHH A;  2Z15 A;  2VB6 A;  1XZP A;  3OA1 A;  3FHD A;  3QVZ A;  4ANJ A;  3G4Z A;  2EPO A;  1S7Z A;  3ASO C;  3C18 A;  1MQV A;  3TOM A;  5K0I A;  5L3V A;  4CSA C;  4DRH B;  2L9J A;  5B3I A;  2I8B A;  3CEX A;  5FZT A;  2XLD A;  1K40 A;  3LS1 A;  2LFD A;  4CDY A;  2PP4 A;  4MS2 A;  1LKX A;  1Q0M A;  2DYS C;  2ASR A;  1JMW A;  1SR2 A;  2HV6 A;  4Q5S F;  5AGF A;  3M1C B;  1UG7 A;  3BRJ A;  2CNW D;  4IGG A;  3RH3 A;  3ABK C;  3W4Y A;  2LSE A;  4U5B E;  2B0H A;  1TR2 A;  2W4M A;  1FAP B;  3ZSU A;  3S90 A;  5JRA A;  2B0J A;  3JCU Q;  3KMI A;  2IXO A;  3EGD B;  3DJN B;  2HMQ A;  2BL2 A;  3ZQY A;  1FNT c;  5E3C A;  2UUI A;  4PJJ A;  2OJQ A;  4IB4 A;  4QI0 A;  2YKZ A;  3T4R A;  3QTH A;  1TFK B;  2W45 A;  4DOZ A;  4YT2 A;  2UUH A;  2G62 A;  2Y3D A;  3W2V A;  2IXP A;  4WGZ A;  1G4U S;  2E87 A;  5COF A;  1DOV A;  4P9F A;  4MTF A;  2GDC A;  4H54 A;  1S05 A;  3VF0 A;  4KC9 A;  4EBK A;  1YYJ A;  4P6I C;  4WJ0 A;  2YZS A;  1OW7 A;  1YAR O;  3KH2 A;  4G78 A;  2OQM A;  3MBG A;  3QW1 A;  3V5Z A;  2FFH A;  4LDR A;  1PCX A;  4O6Y A;  3NYL A;  2M64 A;  1QQ3 A;  4D4N A;  3HNL A;  1OCC C;  2MWQ A;  1VYK A;  1Z6A A;  3IPM O;  4XPW A;  4CDV A;  4RBN A;  1OKK A;  3K1I C;  1VK5 A;  5A6A A;  4BJ5 A; 
#chains in the Genus database with same CATH homology
 1F1M A;  1G5Z A;  1YJG A;  2GA0 A;  1GGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...