1G5ZA

Crystal structure of lyme disease antigen outer surface protein c (ospc) from borrelia burgdorferi strain n40
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
164
structure length
164
Chain Sequence
PNLTEISKKITESNAVVLAVKEVETLLASIDELATKAIGKKIGNNGLEANQSKNTSLLSGAYAISDLIAEKLNVLKNEELKEKIDTAKQCSTEFTNKLKSEHAVLGLDNLTDDNAQRAILKKHANKDKGAAELEKLFKAVENLSKAAQDTLKNAVKELTSPIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Lyme disease antigen outer surface protein C from Borrelia burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Immune system
molecule keywords OUTER SURFACE PROTEIN C
total genus 64
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2000-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.240 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Lipoprotein, type 6 1g5zA00
2GA0A 1GGQA 1F1MA 1G5ZA 1YJGA
chains in the Genus database with same CATH superfamily
2A6HF 4UDVA 1K40A 1ZU5A 2HKVA 4I1MA 4MVMA 2KW3C 1MNDA 3I4UA 3L0IA 5A6KA 1UFBA 2OEVA 2Q9CA 2J46A 5DVWA 1FMWA 2IYLD 4BJTA 4CDYA 4W8KA 3L1MA 1D1CA 1T01A 1LKXA 3FVYA 2XM0A 3EZHA 4Q7CA 4CDVA 3A11A 2OJED 2HUJA 4P6IC 4E17A 4BJ5A 2L9JA 1OCOC 2I15A 4KI2A 1T6IA 1TKNA 1O87A 4CS9A 1NZEA 1R4TA 1MMNA 1VB5A 3U2LA 1E85A 3TULA 3C8GB 3TQOA 3EG9B 5KYUB 2GA0A 2AU5A 2XLHA 1C02A 3ABMC 2ZXRA 2NG1A 3K6BA 2J9UA 4HFKB 3C8GA 4C3DA 3ZG1A 4DJ9A 3KH2A 3RQEA 3AG1C 3OEOA 4P9TA 3O39A 1G4US 1H9GA 3U3BA 5EGYA 2R7SA 4PACA 2FGYA 3S27A 1HW1A 1L3PA 2J0XA 2GAQA 2YLDA 3QVYA 3FHDA 4C3EA 3EFOB 4U5HA 4CSAA 1Y4CA 2YL7A 3KPHA 2JX0A 3DD7A 3RFYA 1Z23A 3N2ZB 4CX9A 3NKEA 4JCHA 2CDQA 4PJMA 4B6IA 3HJCA 5L3VA 3AQCA 2LSEA 4FWVA 2M4EA 1KU2A 2H7OA 2P1AA 4RD9A 2EILC 1HY5A 5CI9A 4JEBA 3ATPA 1AUEA 5B1BC 4E18A 1NFNA 3RIPA 3HTKC 4O7GA 1ZW3A 1Z3IX 1BZ4A 3B0PA 4X0RA 1AEPA 2VCBA 4PJNA 4JZAA 2R7TA 2LIGA 1RKEA 2OJQA 1J8YF 3US6A 4IB4A 2H7BA 4IJJA 4DRIB 2YRFA 5F5HA 1ZU4A 2LK4A 3K1HA 3NDBB 1YLMA 1D1AA 3B29A 1Z7Qc 2V3CC 5JVEA 2CNWA 2A0UA 1JR8A 1TWCA 3RVZA 4YT4A 5DQZA 3RH3A 1M6TA 3RVYA 3DM9B 5COFA 5L0IA 2GDCA 1BR1A 3FAJA 2J8WA 2HJ3A 4PK4A 4WGZA 1JPNA 1ZHXA 1BBHA 4LDQA 2DB4A 5KYNA 2YEVA 3ASNC 1RKCA 3HKKA 4PJJA 1MMGA 1MMAA 3DMDA 1I4YA 3N0TA 1WGWA 4O6MA 4D4NA 4EBJA 1TWGA 4JC7A 1TR2A 4YL1A 1O5HA 4XQ1A 4OINF 3O10A 1S05A 4G7ZF 3POVA 3SXKA 1CGME 4BJ6A 1VYKA 5AGFA 1NG1A 3EGXB 4HE8D 2IXPA 3LS0A 3T4RA 3UR3C 5TJ5E 3ZQVA 2Q7RA 1HMOA 1OR2A 2QE9A 3U3FA 1T9KA 4MVRA 3JSEO 1Q0MA 3ZDLA 1QVXA 4XWJA 5CIVA 1LE4A 1TQGA 2IOQA 3CSKA 3OA1A 4RDAA 2C04A 1DOVA 2DGJA 1LE2A 4KNVA 1M2VB 2J0WA 3UGPA 1FFTC 2OQMA 4WABA 3AG4C 4JJFA 4GEHA 2IXMA 3UMHA 3OWTA 4OIOF 4QI2A 3LS1A 3WG7C 1LM3B 5BQIA 2J7PA 2A0BA 1ZHTA 3DJUB 4DOZA 3B0VC 3GANA 4JTDB 3ZVRA 5KYXA 2UUIA 1G8XA 4XTKA 4HFFB 1YYJA 1H7IA 4AL1A 1OXBA 4FX5A 3QW1A 3L8JA 2KQ9A 2Q4FA 2Y3BA 4NQFA 2Q3TA 4NY3A 2Y3HA 3CQZA 1WATA 3U8VA 5FCLA 5L0JA 4CJOA 2VCAA 1VTMP 5JP7A 3M4CA 4A2NB 2A1DD 3C8ZA 4J7TA 1APCA 2D5RB 4JE9A 4Z9JA 1LS1A 3NKDA 2Y69C 2EPOA 3RQGA 4J7YA 2L6FA 2XS8A 4GYTA 1WWPA 5KYYA 2EINC 1M2OA 2LD6A 3U0CA 4H54A 2WVNA 2XL8A 3ECSA 2XS1A 3C18A 4U9EA 4XLNF 1IZMA 3LJBA 4A4AA 1F1MA 3M4BA 3K1IC 4CBEA 3DZAA 1O3UA 1LIHA 2IM8A 3HNKA 4KC9A 3W2WA 1YA9A 4EBBA 4N06A 4YJWA 3IHUA 3JTLO 1GGQA 3G4XA 3L8IA 4G0HA 5L0CA 4LDKA 1BR4A 1VMAA 2EPLX 1NBBA 1PV3A 1EKYA 3C7JA 4E7ZA 3LEVA 2Z15A 3VF0A 3IQCA 3C8GD 3JRTA 2H7VC 1RKEB 2R7WA 3DE8A 1CPQA 3Q6MA 4IAOA 1QLEC 3SXYA 4G78A 1ST6A 3ITFA 4KNWA 1T5OA 4K0DA 3U9JA 1EQ1A 1BDJB 4GQHA 2KJGA 1OW6A 1OXKA 5CI8A 4ZLDA 3SXZA 3S28A 5B3SC 3UMKA 1E84A 2X51A 3LUTB 4MVZA 3SXMA 1A41A 3S90A 2MYSA 2L81A 2XLVA 1JMWA 4MTOA 3W4YA 4YT2A 2CW0F 1V54C 2XLDA 4H4KC 3A9CA 5BQGA 4LERA 5DS6A 1J8MF 1QZXA 3MLGA 4NC3A 1LPEA 4EKWA 3ASOC 3AG3C 2RD9A 4QDLA 5KYWB 2WVQA 1ZHYA 3RF3A 4BEJA 2Y39A 2H8AA 2OCCC 1OQCA 3M15A 4AX2A 4MS2A 2ICWG 4Z9HA 2NUTB 2AP3A 3SP1A 3LESA 3O55A 4PJLA 2NUTA 2R7RA 3V7OA 1LVKA 1XZQA 1JOGA 3BRJA 1NSGB 1NU7D 1ORYA 3LLIA 2ZPAA 1IW7F 1BR2A 4MVQA 3TK0A 2NSFA 2WB7A 3QZCA 3X2QC 4BG0A 2WZFA 2VH3A 2IXOA 3N24A 1JRAA 2LFDA 1GS9A 2XLWA 1M2VA 4MW8A 4MTGA 2PP4A 3SYNA 1E86A 2A68F 2O9XA 1V55C 2G3KA 5HV9A 4WGYA 3CAXA 2IXNA 2B0HA 4YK5A 3T6GB 1M56C 3UMIA 1Q0DA 3VAYA 1S7ZA 4XPWA 1V4AA 1HW2A 3M1CB 4WJ0A 4N6HA 4C7OA 3WODF 4E7SA 4BPMA 3DWWA 2LCHA 2YHSA 1SMYF 2CCYA 2G62A 2R03A 3SNHA 2PX3A 3ABKC 1YZCA 2KGOA 5A69A 1RJ9A 3QMKA 4MQ9F 2EIJC 1TWHA 1OCRC 2HS5A 4JEAA 2YKZA 3VYWA 1HMDA 2MHRA 1MQVA 1WN0A 5T3TA 4PFPA 2B0JA 2ASRA 1VLTA 1NFOA 1JAFA 1RXQA 2VASA 3AGUA 3HLZA 3J06A 4DBRA 2L6HA 2ZXWC 1FTSA 2QLAA 3U9MA 3V5YA 5KYXB 2HFIA 2WZGA 3ZQYA 5D92A 4BEMJ 3PCVA 2C03A 3X1OA 4ER9A 4J32B 1Z5ZA 3GWLA 4U5BE 3L34A 3AJMA 4AE4B 5JS5A 3S84A 3NMJA 1E83A 4DXWA 1MNEA 1QQ3A 4K7BA 4W8PA 4EBKA 2XXAA 5L0FA 1H9TA 4G7OF 2GFHA 1SR2A 3F46A 3DKAA 2GWWA 4XEFA 3NYLA 2XXAB 1I4ZA 2L7AA 3QTHA 3RW0A 4CIHA 2R9RB 1QKRA 1C03A 2YLIA 3M79A 2Y3GA 3ZSUA 5JLIA 2J9WA 4BJ1A 2HSBA 3K66A 3T6BA 5AC4A 1CGOA 1Y6DA 2VC9A 3QW0A 5DQTA 5JRAA 2L6GA 3IPMO 3EG9A 1FR0A 3JRMO 3NMKA 1I5NA 1YVIA 2HSQA 2J7PD 4JIOA 3EHNA 3QVZA 4LLEA 4PR9A 3EFOA 3V5ZA 4ONSA 5KYWA 3FAPB 2HMZA 2RSEB 5FZTA 4U9DA 1PD0A 3JT1A 1MMDA 3EPVA 3O6XA 4CS9C 4IAQA 5IY5C 4HEAJ 2R25A 4EHPA 1C17M 4OIQF 1Q0FA 3CEXA 1OKKA 4JRZA 5HSWA 1CGNA 2OKUA 4DVYP 4LLCA 1Q0KA 2MWQA 2XL6A 1RCPA 4OD5A 2QNLA 5A6BD 1Z6AA 2YL3A 2OOCA 4KBLA 3AOUA 3NYMA 4AL0A 3EJNA 2TMVP 1VLSA 4M63A 4DRHB 4G7HF 3NG1A 3ZTZA 2CYDA 3ZC4A 1PD1A 4JKVA 4E0IA 3GWNA 4MTFA 2ETSA 2UUHA 4CIPA 4JTCB 5F5FA 1JPJA 5A6JA 4RBNA 1ZVZA 3FDQA 4AE4A 2BE5F 2XLMA 3JCUQ 4XPXA 2P61A 1G4WR 2EPMX 1XZPA 2R7QA 2XL4A 1A7EA 4N6CA 2KYHA 2NPUA 2QY9A 3GM3A 4YL0A 5L0GA 5KYUA 3KL4A 1B68A 4I3MA 3ZIBA 3NRHA 2OU6A 1HE1A 2WL8A 3LNMB 4JJGA 4N4WA 2YL1A 3IQ5A 3R2PA 4IARA 4ULWA 4DBQA 2ZXOA 1OW7A 1YJGA 1U6HA 3HNIA 4JW1A 3LNRA 3MBGA 1LS4A 3RYLA 2V26A 4LDRA 3SZRA 3Q6NA 2R7VA 4O79A 1K04A 5L0HA 3MYIA 1YAUO 4P9FA 3F47A 1OR3A 3CZ6A 3LEOA 5AC5A 2R7XA 1A7DA 4MNDA 1ORSC 1GM5A 4FESA 1NLXA 2JD3A 5EHHA 3JZ0A 3K7DA 4JTAB 3TJ5A 1PCXA 1OCZC 2DYSC 4XEVA 3S0XA 4I1OB 5E2QA 4Q4ZF 5T3WA 1W2WA 4YWQA 1G5ZA 3I5PA 2EPKX 1N1CA 2QTVA 2XLEA 2W45A 2ZXPA 3TD7A 3DXJF 3AGTA 1QPUA 1VK5A 3EGDA 2FFHA 2HV7A 3MX3A 4MVOA 5GPGB 2Q9BA 4CJGA 2Q00A 3GM1A 4NTAA 4CS8C 4ZLCA 4ANJA 4E0HA 5DS4A 1ORJA 2A6EF 3DAGA 3DI5A 3LLKA 4OIPF 2PF4E 4NCQA 5B1AC 3FMSA 3DAFA 2IBFA 3ZTMA 2PFDA 3EHMA 1SZIA 3GEEA 3PHF2 3T6JA 2EPNA 3K1IA 5D91A 2VCCA 3VM6A 4CS7A 1FNTc 1QSPA 1WOLA 4O6NA 4U5FE 2PNOA 4XPYA 5E3AA 2Y3DA 1FFHA 3UNGC 4CDAA 2M64A 3IQ6A 5JSLA 5A6AA 2DYRC 3NYJA 5BQHA 1ZW2A 5KYYB 3H2VA 3E9VA 4MW3A 5K0IA 3WAQA 4L6RA 4R32A 3PDMP 3JYYA 4O6YA 5B3IA 2P7VA 2W9YA 3Q7LA 3K33A 1OW8A 5COGA 1VYIA 5COMA 1K05A 2AWCA 1ZHWA 3U2MA 2R7UA 3RKOF 2HJMA 3T9OA 5JT4A 2YLGA 2AVKA 2EIMC 3PMRA 4YT8A 5JUAA 1Z63A 1E2XA 1M57C 3W8IA 1UG7A 2D4UA 2VB6A 1HE9A 1TWAA 1YA7O 3HNJA 3IQTA 2YQYA 1TFOB 3JYHA 3TJ6A 3ZWIA 2J9BA 3GODA 1T6UA 3H65A 4AK9A 1A0BA 1YZAA 2BL2A 3W8HA 3EZIA 3B71A 3I5QA 5DLJA 5A6BA 1YYXA 3GORA 3S29A 2PX0A 4IGGA 1U89A 2WZLA 5L0DA 3H2UA 4JCZA 4JVSA 1D1BA 2J45A 2JPUA 2W4BA 3E70C 2XM4A 3B9QA 2LFFA 4U5GA 4U5DE 4CSAC 4J30B 2YZSA 3DM5A 2XSEA 2LP4A 3NMIA 3IEEA 4NTFA 1YDIA 3WHNA 1KNYA 2KSFA 2AWYA 3DE9A 1A7VA 2P0NA 4OD4A 2YVKA 3EH1A 1AVOB 3EQLF 3KMIA 5E33A 2OG2A 3HNLA 3Q7GA 3R7CA 1WTYA 1EA8A 2WVOA 2P6VA 3RQFA 3SEOA 2Q9AA 3JSZA 4U5EE 5BUOA 1RMVA 2W4MA 2QUPA 3KKBA 1LI7A 4JURI 2FAPB 1TFKB 3EH2A 1CPRA 3FXHA 2KC3A 4D4XA 2BC5A 1LI5A 2YWAA 3DJNB 1OCCC 3KYJA 2X0CA 4BJ5C 4EIYA 5DS5A 4MVUA 1NU9C 4U5CE 1DOWA 3AG2C 4LACB 4FAPB 2R7OA 4YT5A 2F22A 2J9VA 3C63A 2NSGA 3G4ZA 4XLPF 4Q5SF 5L3QA 1R5ID 4XEKA 1D0YA 2E87A 1V74B 2ZD9A 3C62A 3G50A 4EWCA 2DI3A 1RJ9B 3EGDB 4QI0A 5EK0A 5F28E 3GEHA 3W2VA 4C7OB 1H6GA 2CNWD 3ABLC 4ULVA 4Z9IA 4DVZA 4K1OA 1Q0GA 2OEXA 1FMVA 2G3VA 2I8BA 2PBEA 4IWBA 3TOLA 1ZZPA 3U8PA 2KK1A 2R02A 4CS8A 3AQBA 3LAYA 1XWJA 2KNHA 3MFNA 3VRCA 1WASA 2HMQA 3EGXA 3GEIA 3V5XA 4EUKB 4YL3A 5E3CA 4C3BA 1ZHZA 3GM2A 4DRJB 1OKKD 1KTMA 1YARO 2R05A 3S9OA 3U5SA 3UGOA 2NUPA 2EIKC 2YL0A 4MVSA 1EI7A 4BJ6C 3TOMA 256BA 4NTBA 4OIRF 3BEHA 5T1DB 3MYFA 1VOMA 1L7CA 2NUPB 1U0BB 3FOOA 2XRHA 1D0ZA 1ZYRF 4PFOA 3B0UX 4IRUA 2XLOA 2HV6A 4I44A 1GQAA 3KYIA 1SYQA 1FAPB 2HZ8A 4F4BA 2CGEA 3FOPA 1D0XA 2A69F 2LQGA 1T6QA 4YN0B 1SF8A
chains in the Genus database with same CATH topology
2GA0A 1GGQA 1F1MA 1G5ZA 1YJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA0 A;  1GGQ A;  1F1M A;  1G5Z A;  1YJG A; 
#chains in the Genus database with same CATH topology
 2A6H F;  4UDV A;  1K40 A;  1ZU5 A;  2HKV A;  4I1M A;  4MVM A;  2KW3 C;  1MND A;  3I4U A;  3L0I A;  5A6K A;  1UFB A;  2OEV A;  2Q9C A;  2J46 A;  5DVW A;  1FMW A;  2IYL D;  4BJT A;  4CDY A;  4W8K A;  3L1M A;  1D1C A;  1T01 A;  1LKX A;  3FVY A;  2XM0 A;  3EZH A;  4Q7C A;  4CDV A;  3A11 A;  2OJE D;  2HUJ A;  4P6I C;  4E17 A;  4BJ5 A;  2L9J A;  1OCO C;  2I15 A;  4KI2 A;  1T6I A;  1TKN A;  1O87 A;  4CS9 A;  1NZE A;  1R4T A;  1MMN A;  1VB5 A;  3U2L A;  1E85 A;  3TUL A;  3C8G B;  3TQO A;  3EG9 B;  5KYU B;  2GA0 A;  2AU5 A;  2XLH A;  1C02 A;  3ABM C;  2ZXR A;  2NG1 A;  3K6B A;  2J9U A;  4HFK B;  3C8G A;  4C3D A;  3ZG1 A;  4DJ9 A;  3KH2 A;  3RQE A;  3AG1 C;  3OEO A;  4P9T A;  3O39 A;  1G4U S;  1H9G A;  3U3B A;  5EGY A;  2R7S A;  4PAC A;  2FGY A;  3S27 A;  1HW1 A;  1L3P A;  2J0X A;  2GAQ A;  2YLD A;  3QVY A;  3FHD A;  4C3E A;  3EFO B;  4U5H A;  4CSA A;  1Y4C A;  2YL7 A;  3KPH A;  2JX0 A;  3DD7 A;  3RFY A;  1Z23 A;  3N2Z B;  4CX9 A;  3NKE A;  4JCH A;  2CDQ A;  4PJM A;  4B6I A;  3HJC A;  5L3V A;  3AQC A;  2LSE A;  4FWV A;  2M4E A;  1KU2 A;  2H7O A;  2P1A A;  4RD9 A;  2EIL C;  1HY5 A;  5CI9 A;  4JEB A;  3ATP A;  1AUE A;  5B1B C;  4E18 A;  1NFN A;  3RIP A;  3HTK C;  4O7G A;  1ZW3 A;  1Z3I X;  1BZ4 A;  3B0P A;  4X0R A;  1AEP A;  2VCB A;  4PJN A;  4JZA A;  2R7T A;  2LIG A;  1RKE A;  2OJQ A;  1J8Y F;  3US6 A;  4IB4 A;  2H7B A;  4IJJ A;  4DRI B;  2YRF A;  5F5H A;  1ZU4 A;  2LK4 A;  3K1H A;  3NDB B;  1YLM A;  1D1A A;  3B29 A;  1Z7Q c;  2V3C C;  5JVE A;  2CNW A;  2A0U A;  1JR8 A;  1TWC A;  3RVZ A;  4YT4 A;  5DQZ A;  3RH3 A;  1M6T A;  3RVY A;  3DM9 B;  5COF A;  5L0I A;  2GDC A;  1BR1 A;  3FAJ A;  2J8W A;  2HJ3 A;  4PK4 A;  4WGZ A;  1JPN A;  1ZHX A;  1BBH A;  4LDQ A;  2DB4 A;  5KYN A;  2YEV A;  3ASN C;  1RKC A;  3HKK A;  4PJJ A;  1MMG A;  1MMA A;  3DMD A;  1I4Y A;  3N0T A;  1WGW A;  4O6M A;  4D4N A;  4EBJ A;  1TWG A;  4JC7 A;  1TR2 A;  4YL1 A;  1O5H A;  4XQ1 A;  4OIN F;  3O10 A;  1S05 A;  4G7Z F;  3POV A;  3SXK A;  1CGM E;  4BJ6 A;  1VYK A;  5AGF A;  1NG1 A;  3EGX B;  4HE8 D;  2IXP A;  3LS0 A;  3T4R A;  3UR3 C;  5TJ5 E;  3ZQV A;  2Q7R A;  1HMO A;  1OR2 A;  2QE9 A;  3U3F A;  1T9K A;  4MVR A;  3JSE O;  1Q0M A;  3ZDL A;  1QVX A;  4XWJ A;  5CIV A;  1LE4 A;  1TQG A;  2IOQ A;  3CSK A;  3OA1 A;  4RDA A;  2C04 A;  1DOV A;  2DGJ A;  1LE2 A;  4KNV A;  1M2V B;  2J0W A;  3UGP A;  1FFT C;  2OQM A;  4WAB A;  3AG4 C;  4JJF A;  4GEH A;  2IXM A;  3UMH A;  3OWT A;  4OIO F;  4QI2 A;  3LS1 A;  3WG7 C;  1LM3 B;  5BQI A;  2J7P A;  2A0B A;  1ZHT A;  3DJU B;  4DOZ A;  3B0V C;  3GAN A;  4JTD B;  3ZVR A;  5KYX A;  2UUI A;  1G8X A;  4XTK A;  4HFF B;  1YYJ A;  1H7I A;  4AL1 A;  1OXB A;  4FX5 A;  3QW1 A;  3L8J A;  2KQ9 A;  2Q4F A;  2Y3B A;  4NQF A;  2Q3T A;  4NY3 A;  2Y3H A;  3CQZ A;  1WAT A;  3U8V A;  5FCL A;  5L0J A;  4CJO A;  2VCA A;  1VTM P;  5JP7 A;  3M4C A;  4A2N B;  2A1D D;  3C8Z A;  4J7T A;  1APC A;  2D5R B;  4JE9 A;  4Z9J A;  1LS1 A;  3NKD A;  2Y69 C;  2EPO A;  3RQG A;  4J7Y A;  2L6F A;  2XS8 A;  4GYT A;  1WWP A;  5KYY A;  2EIN C;  1M2O A;  2LD6 A;  3U0C A;  4H54 A;  2WVN A;  2XL8 A;  3ECS A;  2XS1 A;  3C18 A;  4U9E A;  4XLN F;  1IZM A;  3LJB A;  4A4A A;  1F1M A;  3M4B A;  3K1I C;  4CBE A;  3DZA A;  1O3U A;  1LIH A;  2IM8 A;  3HNK A;  4KC9 A;  3W2W A;  1YA9 A;  4EBB A;  4N06 A;  4YJW A;  3IHU A;  3JTL O;  1GGQ A;  3G4X A;  3L8I A;  4G0H A;  5L0C A;  4LDK A;  1BR4 A;  1VMA A;  2EPL X;  1NBB A;  1PV3 A;  1EKY A;  3C7J A;  4E7Z A;  3LEV A;  2Z15 A;  3VF0 A;  3IQC A;  3C8G D;  3JRT A;  2H7V C;  1RKE B;  2R7W A;  3DE8 A;  1CPQ A;  3Q6M A;  4IAO A;  1QLE C;  3SXY A;  4G78 A;  1ST6 A;  3ITF A;  4KNW A;  1T5O A;  4K0D A;  3U9J A;  1EQ1 A;  1BDJ B;  4GQH A;  2KJG A;  1OW6 A;  1OXK A;  5CI8 A;  4ZLD A;  3SXZ A;  3S28 A;  5B3S C;  3UMK A;  1E84 A;  2X51 A;  3LUT B;  4MVZ A;  3SXM A;  1A41 A;  3S90 A;  2MYS A;  2L81 A;  2XLV A;  1JMW A;  4MTO A;  3W4Y A;  4YT2 A;  2CW0 F;  1V54 C;  2XLD A;  4H4K C;  3A9C A;  5BQG A;  4LER A;  5DS6 A;  1J8M F;  1QZX A;  3MLG A;  4NC3 A;  1LPE A;  4EKW A;  3ASO C;  3AG3 C;  2RD9 A;  4QDL A;  5KYW B;  2WVQ A;  1ZHY A;  3RF3 A;  4BEJ A;  2Y39 A;  2H8A A;  2OCC C;  1OQC A;  3M15 A;  4AX2 A;  4MS2 A;  2ICW G;  4Z9H A;  2NUT B;  2AP3 A;  3SP1 A;  3LES A;  3O55 A;  4PJL A;  2NUT A;  2R7R A;  3V7O A;  1LVK A;  1XZQ A;  1JOG A;  3BRJ A;  1NSG B;  1NU7 D;  1ORY A;  3LLI A;  2ZPA A;  1IW7 F;  1BR2 A;  4MVQ A;  3TK0 A;  2NSF A;  2WB7 A;  3QZC A;  3X2Q C;  4BG0 A;  2WZF A;  2VH3 A;  2IXO A;  3N24 A;  1JRA A;  2LFD A;  1GS9 A;  2XLW A;  1M2V A;  4MW8 A;  4MTG A;  2PP4 A;  3SYN A;  1E86 A;  2A68 F;  2O9X A;  1V55 C;  2G3K A;  5HV9 A;  4WGY A;  3CAX A;  2IXN A;  2B0H A;  4YK5 A;  3T6G B;  1M56 C;  3UMI A;  1Q0D A;  3VAY A;  1S7Z A;  4XPW A;  1V4A A;  1HW2 A;  3M1C B;  4WJ0 A;  4N6H A;  4C7O A;  3WOD F;  4E7S A;  4BPM A;  3DWW A;  2LCH A;  2YHS A;  1SMY F;  2CCY A;  2G62 A;  2R03 A;  3SNH A;  2PX3 A;  3ABK C;  1YZC A;  2KGO A;  5A69 A;  1RJ9 A;  3QMK A;  4MQ9 F;  2EIJ C;  1TWH A;  1OCR C;  2HS5 A;  4JEA A;  2YKZ A;  3VYW A;  1HMD A;  2MHR A;  1MQV A;  1WN0 A;  5T3T A;  4PFP A;  2B0J A;  2ASR A;  1VLT A;  1NFO A;  1JAF A;  1RXQ A;  2VAS A;  3AGU A;  3HLZ A;  3J06 A;  4DBR A;  2L6H A;  2ZXW C;  1FTS A;  2QLA A;  3U9M A;  3V5Y A;  5KYX B;  2HFI A;  2WZG A;  3ZQY A;  5D92 A;  4BEM J;  3PCV A;  2C03 A;  3X1O A;  4ER9 A;  4J32 B;  1Z5Z A;  3GWL A;  4U5B E;  3L34 A;  3AJM A;  4AE4 B;  5JS5 A;  3S84 A;  3NMJ A;  1E83 A;  4DXW A;  1MNE A;  1QQ3 A;  4K7B A;  4W8P A;  4EBK A;  2XXA A;  5L0F A;  1H9T A;  4G7O F;  2GFH A;  1SR2 A;  3F46 A;  3DKA A;  2GWW A;  4XEF A;  3NYL A;  2XXA B;  1I4Z A;  2L7A A;  3QTH A;  3RW0 A;  4CIH A;  2R9R B;  1QKR A;  1C03 A;  2YLI A;  3M79 A;  2Y3G A;  3ZSU A;  5JLI A;  2J9W A;  4BJ1 A;  2HSB A;  3K66 A;  3T6B A;  5AC4 A;  1CGO A;  1Y6D A;  2VC9 A;  3QW0 A;  5DQT A;  5JRA A;  2L6G A;  3IPM O;  3EG9 A;  1FR0 A;  3JRM O;  3NMK A;  1I5N A;  1YVI A;  2HSQ A;  2J7P D;  4JIO A;  3EHN A;  3QVZ A;  4LLE A;  4PR9 A;  3EFO A;  3V5Z A;  4ONS A;  5KYW A;  3FAP B;  2HMZ A;  2RSE B;  5FZT A;  4U9D A;  1PD0 A;  3JT1 A;  1MMD A;  3EPV A;  3O6X A;  4CS9 C;  4IAQ A;  5IY5 C;  4HEA J;  2R25 A;  4EHP A;  1C17 M;  4OIQ F;  1Q0F A;  3CEX A;  1OKK A;  4JRZ A;  5HSW A;  1CGN A;  2OKU A;  4DVY P;  4LLC A;  1Q0K A;  2MWQ A;  2XL6 A;  1RCP A;  4OD5 A;  2QNL A;  5A6B D;  1Z6A A;  2YL3 A;  2OOC A;  4KBL A;  3AOU A;  3NYM A;  4AL0 A;  3EJN A;  2TMV P;  1VLS A;  4M63 A;  4DRH B;  4G7H F;  3NG1 A;  3ZTZ A;  2CYD A;  3ZC4 A;  1PD1 A;  4JKV A;  4E0I A;  3GWN A;  4MTF A;  2ETS A;  2UUH A;  4CIP A;  4JTC B;  5F5F A;  1JPJ A;  5A6J A;  4RBN A;  1ZVZ A;  3FDQ A;  4AE4 A;  2BE5 F;  2XLM A;  3JCU Q;  4XPX A;  2P61 A;  1G4W R;  2EPM X;  1XZP A;  2R7Q A;  2XL4 A;  1A7E A;  4N6C A;  2KYH A;  2NPU A;  2QY9 A;  3GM3 A;  4YL0 A;  5L0G A;  5KYU A;  3KL4 A;  1B68 A;  4I3M A;  3ZIB A;  3NRH A;  2OU6 A;  1HE1 A;  2WL8 A;  3LNM B;  4JJG A;  4N4W A;  2YL1 A;  3IQ5 A;  3R2P A;  4IAR A;  4ULW A;  4DBQ A;  2ZXO A;  1OW7 A;  1YJG A;  1U6H A;  3HNI A;  4JW1 A;  3LNR A;  3MBG A;  1LS4 A;  3RYL A;  2V26 A;  4LDR A;  3SZR A;  3Q6N A;  2R7V A;  4O79 A;  1K04 A;  5L0H A;  3MYI A;  1YAU O;  4P9F A;  3F47 A;  1OR3 A;  3CZ6 A;  3LEO A;  5AC5 A;  2R7X A;  1A7D A;  4MND A;  1ORS C;  1GM5 A;  4FES A;  1NLX A;  2JD3 A;  5EHH A;  3JZ0 A;  3K7D A;  4JTA B;  3TJ5 A;  1PCX A;  1OCZ C;  2DYS C;  4XEV A;  3S0X A;  4I1O B;  5E2Q A;  4Q4Z F;  5T3W A;  1W2W A;  4YWQ A;  1G5Z A;  3I5P A;  2EPK X;  1N1C A;  2QTV A;  2XLE A;  2W45 A;  2ZXP A;  3TD7 A;  3DXJ F;  3AGT A;  1QPU A;  1VK5 A;  3EGD A;  2FFH A;  2HV7 A;  3MX3 A;  4MVO A;  5GPG B;  2Q9B A;  4CJG A;  2Q00 A;  3GM1 A;  4NTA A;  4CS8 C;  4ZLC A;  4ANJ A;  4E0H A;  5DS4 A;  1ORJ A;  2A6E F;  3DAG A;  3DI5 A;  3LLK A;  4OIP F;  2PF4 E;  4NCQ A;  5B1A C;  3FMS A;  3DAF A;  2IBF A;  3ZTM A;  2PFD A;  3EHM A;  1SZI A;  3GEE A;  3PHF 2;  3T6J A;  2EPN A;  3K1I A;  5D91 A;  2VCC A;  3VM6 A;  4CS7 A;  1FNT c;  1QSP A;  1WOL A;  4O6N A;  4U5F E;  2PNO A;  4XPY A;  5E3A A;  2Y3D A;  1FFH A;  3UNG C;  4CDA A;  2M64 A;  3IQ6 A;  5JSL A;  5A6A A;  2DYR C;  3NYJ A;  5BQH A;  1ZW2 A;  5KYY B;  3H2V A;  3E9V A;  4MW3 A;  5K0I A;  3WAQ A;  4L6R A;  4R32 A;  3PDM P;  3JYY A;  4O6Y A;  5B3I A;  2P7V A;  2W9Y A;  3Q7L A;  3K33 A;  1OW8 A;  5COG A;  1VYI A;  5COM A;  1K05 A;  2AWC A;  1ZHW A;  3U2M A;  2R7U A;  3RKO F;  2HJM A;  3T9O A;  5JT4 A;  2YLG A;  2AVK A;  2EIM C;  3PMR A;  4YT8 A;  5JUA A;  1Z63 A;  1E2X A;  1M57 C;  3W8I A;  1UG7 A;  2D4U A;  2VB6 A;  1HE9 A;  1TWA A;  1YA7 O;  3HNJ A;  3IQT A;  2YQY A;  1TFO B;  3JYH A;  3TJ6 A;  3ZWI A;  2J9B A;  3GOD A;  1T6U A;  3H65 A;  4AK9 A;  1A0B A;  1YZA A;  2BL2 A;  3W8H A;  3EZI A;  3B71 A;  3I5Q A;  5DLJ A;  5A6B A;  1YYX A;  3GOR A;  3S29 A;  2PX0 A;  4IGG A;  1U89 A;  2WZL A;  5L0D A;  3H2U A;  4JCZ A;  4JVS A;  1D1B A;  2J45 A;  2JPU A;  2W4B A;  3E70 C;  2XM4 A;  3B9Q A;  2LFF A;  4U5G A;  4U5D E;  4CSA C;  4J30 B;  2YZS A;  3DM5 A;  2XSE A;  2LP4 A;  3NMI A;  3IEE A;  4NTF A;  1YDI A;  3WHN A;  1KNY A;  2KSF A;  2AWY A;  3DE9 A;  1A7V A;  2P0N A;  4OD4 A;  2YVK A;  3EH1 A;  1AVO B;  3EQL F;  3KMI A;  5E33 A;  2OG2 A;  3HNL A;  3Q7G A;  3R7C A;  1WTY A;  1EA8 A;  2WVO A;  2P6V A;  3RQF A;  3SEO A;  2Q9A A;  3JSZ A;  4U5E E;  5BUO A;  1RMV A;  2W4M A;  2QUP A;  3KKB A;  1LI7 A;  4JUR I;  2FAP B;  1TFK B;  3EH2 A;  1CPR A;  3FXH A;  2KC3 A;  4D4X A;  2BC5 A;  1LI5 A;  2YWA A;  3DJN B;  1OCC C;  3KYJ A;  2X0C A;  4BJ5 C;  4EIY A;  5DS5 A;  4MVU A;  1NU9 C;  4U5C E;  1DOW A;  3AG2 C;  4LAC B;  4FAP B;  2R7O A;  4YT5 A;  2F22 A;  2J9V A;  3C63 A;  2NSG A;  3G4Z A;  4XLP F;  4Q5S F;  5L3Q A;  1R5I D;  4XEK A;  1D0Y A;  2E87 A;  1V74 B;  2ZD9 A;  3C62 A;  3G50 A;  4EWC A;  2DI3 A;  1RJ9 B;  3EGD B;  4QI0 A;  5EK0 A;  5F28 E;  3GEH A;  3W2V A;  4C7O B;  1H6G A;  2CNW D;  3ABL C;  4ULV A;  4Z9I A;  4DVZ A;  4K1O A;  1Q0G A;  2OEX A;  1FMV A;  2G3V A;  2I8B A;  2PBE A;  4IWB A;  3TOL A;  1ZZP A;  3U8P A;  2KK1 A;  2R02 A;  4CS8 A;  3AQB A;  3LAY A;  1XWJ A;  2KNH A;  3MFN A;  3VRC A;  1WAS A;  2HMQ A;  3EGX A;  3GEI A;  3V5X A;  4EUK B;  4YL3 A;  5E3C A;  4C3B A;  1ZHZ A;  3GM2 A;  4DRJ B;  1OKK D;  1KTM A;  1YAR O;  2R05 A;  3S9O A;  3U5S A;  3UGO A;  2NUP A;  2EIK C;  2YL0 A;  4MVS A;  1EI7 A;  4BJ6 C;  3TOM A;  256B A;  4NTB A;  4OIR F;  3BEH A;  5T1D B;  3MYF A;  1VOM A;  1L7C A;  2NUP B;  1U0B B;  3FOO A;  2XRH A;  1D0Z A;  1ZYR F;  4PFO A;  3B0U X;  4IRU A;  2XLO A;  2HV6 A;  4I44 A;  1GQA A;  3KYI A;  1SYQ A;  1FAP B;  2HZ8 A;  4F4B A;  2CGE A;  3FOP A;  1D0X A;  2A69 F;  2LQG A;  1T6Q A;  4YN0 B;  1SF8 A; 
#chains in the Genus database with same CATH homology
 2GA0 A;  1GGQ A;  1F1M A;  1G5Z A;  1YJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...