1G5ZA

Crystal structure of lyme disease antigen outer surface protein c (ospc) from borrelia burgdorferi strain n40
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
164
structure length
164
Chain Sequence
PNLTEISKKITESNAVVLAVKEVETLLASIDELATKAIGKKIGNNGLEANQSKNTSLLSGAYAISDLIAEKLNVLKNEELKEKIDTAKQCSTEFTNKLKSEHAVLGLDNLTDDNAQRAILKKHANKDKGAAELEKLFKAVENLSKAAQDTLKNAVKELTSPIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Lyme disease antigen outer surface protein C from Borrelia burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Immune system
molecule keywords OUTER SURFACE PROTEIN C
total genus 64
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2000-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.240 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Lipoprotein, type 6 1g5zA00
1G5ZA 1F1MA 1YJGA 1GGQA 2GA0A
chains in the Genus database with same CATH superfamily
3N2ZB 5JSLA 2EIMC 2LFFA 3CAXA 4ULWA 3B71A 3L8IA 2Q9CA 4YL1A 3SXZA 3ZSUA 3FAJA 4DJ9A 1O3UA 3C62A 5JT4A 4E17A 2O9XA 1D0YA 1SF8A 4XPWA 1ZHWA 2MWQA 3LEOA 5KYWA 5L0DA 4YT4A 3DM9B 1T6IA 4G7OF 3US6A 3A11A 3PDMP 1XZPA 4CS9C 5A69A 1OKKA 1ZHZA 2BC5A 3CEXA 2HV6A 1NLXA 3C8GD 3NYMA 1ZW2A 4K0DA 4ZLCA 5BUOA 5IY5C 3NKDA 3NDBB 3RQEA 1YAUO 4IAOA 1B68A 1D1CA 5FCLA 3GEIA 2Q9BA 3U9MA 4KNWA 2W9YA 3NMJA 3MLGA 2YZSA 4L6RA 4E0HA 2W45A 2FAPB 1YA9A 2XLHA 3KYJA 3TK0A 1EQ1A 1FNTc 5DLJA 2X0CA 2DGJA 4JCZA 4PFPA 4W8PA 4B6IA 4J32B 2FGYA 2JPUA 1BR2A 5COMA 1ORJA 1S05A 3G4ZA 4C3DA 1OR3A 1U89A 3NYLA 2IM8A 2XL4A 4JTAB 4U5EE 3ZTMA 5D92A 2I8BA 2WVNA 3GWLA 3WG7C 4ER9A 5BQHA 1CPRA 4F4BA 4MNDA 2LCHA 3JYHA 3R7CA 4XWJA 1ZU5A 2HV7A 3EQLF 4JZAA 5DQTA 2W4BA 4HFFB 2HJMA 2Q3TA 4AL0A 3DI5A 4MTOA 3EG9B 5EGYA 1BR1A 3JSEO 1AVOB 3GWNA 4AL1A 1O5HA 1TR2A 1FMVA 2LIGA 2LK4A 3LLKA 4JEAA 2R7WA 4BJ5A 4YL3A 2HMZA 1BBHA 3K6BA 1FTSA 3RQFA 5AC5A 2YQYA 2CGEA 2Q00A 4G0HA 4PJMA 4Z9IA 1O87A 3O55A 5CI9A 2YLGA 4YT8A 2OJED 3B29A 2UUIA 3EGXA 1GQAA 3LEVA 4YJWA 3G50A 4BJ6C 3U3BA 3E70C 2ZXPA 2YEVA 3L0IA 3K7DA 4DRJB 2LD6A 5B3SC 5A6BD 3IQTA 1D1BA 1T6QA 2EINC 5L3QA 3LESA 4DXWA 1RKEA 4CIHA 3LNRA 5E3AA 3S0XA 5KYUB 3C8GA 3TJ5A 1D0ZA 4UDVA 2YL3A 3TULA 1PD1A 1I5NA 2GA0A 3OWTA 2HZ8A 2R7VA 3R2PA 4CBEA 2D4UA 1CGME 1EKYA 1GS9A 4A2NB 3DMDA 5A6KA 2KGOA 5D91A 2PF4E 2OJQA 3F47A 1MQVA 3JYYA 2NUTB 3FMSA 5L0CA 2QLAA 2J7PD 1ZW3A 3OA1A 1RXQA 1YZAA 3AGUA 2C03A 1LS1A 2CW0F 3DJNB 3FVYA 5JP7A 2KW3C 2QE9A 2VC9A 2Y3HA 3M79A 2CDQA 1UG7A 4NQFA 2H7OA 3S29A 3T9OA 5F5HA 4DBQA 1TQGA 2XS8A 5CIVA 3J06A 1YYXA 2ZXOA 2JX0A 3FDQA 1E85A 4OIPF 3EH2A 1MNDA 1LIHA 1RJ9B 4HE8D 3U9JA 3SXKA 3U2MA 3AG4C 4JJFA 3RVYA 4E18A 5B1AC 2M64A 2F22A 4XEKA 3ABKC 2J9UA 1T01A 2OKUA 3Q6MA 4N4WA 4RD9A 5B3IA 3Q7GA 4D4NA 1VTMP 3X1OA 1HMDA 4BEMJ 3VM6A 5L0JA 3M1CB 1K40A 1S7ZA 1OKKD 1OXKA 4MVSA 2GFHA 3T4RA 1VYKA 2R03A 4MVZA 1ORSC 3W2WA 3NRHA 4IARA 1QLEC 2UUHA 5E33A 4Q5SF 2XLMA 4JCHA 3JRTA 3IEEA 3ITFA 4EUKB 3BEHA 2ZXWC 4OINF 4P6IC 5CI8A 5KYYB 4I3MA 1JMWA 4QDLA 3PHF2 3AG2C 1YJGA 2EILC 3DE8A 1YA7O 4CS9A 1IW7F 5DS6A 5KYXB 1L7CA 3S84A 2WVOA 4XEVA 1NBBA 3WHNA 3LUTB 4C7OB 1M2OA 2OQMA 3JT1A 5DQZA 2A69F 1F1MA 1PCXA 5KYUA 4JE9A 5JLIA 1VLTA 3O10A 4J7YA 5BQGA 1OCOC 4PFOA 4MVRA 5EK0A 1Z7Qc 1H7IA 3LJBA 2IBFA 1YZCA 3QVZA 3ZTZA 2A1DD 1Q0MA 1CGOA 2LFDA 2OU6A 1Q0GA 2PP4A 2J45A 5GPGB 3EFOB 1WATA 1MMAA 5E2QA 3ZQYA 1EI7A 4CSAA 1V74B 3AOUA 3EGXB 1OR2A 3DJUB 2HUJA 1CPQA 2Y69C 4I1MA 3VAYA 1T5OA 1U0BB 1FMWA 3JTLO 1Y6DA 3W8IA 1C17M 1ZHTA 3LNMB 3O6XA 3M4CA 3M15A 4OD4A 1A0BA 2OCCC 4NTFA 1A7EA 1TKNA 2CYDA 2HSBA 2I15A 2XM0A 3LS1A 2Z15A 4NTAA 3LLIA 1JR8A 3RVZA 3ZVRA 4BPMA 5JS5A 1LI7A 4OIOF 3SZRA 3QZCA 2P6VA 4J30B 4EBKA 3KMIA 4O6MA 3LAYA 1SMYF 1YYJA 2VCBA 1U6HA 3MYFA 1QZXA 4WGYA 3MFNA 4YT5A 3RQGA 1M56C 1AEPA 2WVQA 4DOZA 2YLDA 3EZHA 1OCCC 2DI3A 3M4BA 3N24A 4O79A 1VMAA 5AGFA 4HEAJ 1TWHA 4K1OA 4P9TA 3JCUQ 3EGDB 2RD9A 4PJJA 2G3VA 2R02A 2KK1A 3ECSA 5L0FA 3T6BA 2YVKA 1WOLA 4GEHA 4KI2A 2NUPA 3L1MA 1SZIA 3DXJF 3N0TA 4IB4A 4YL0A 5T3WA 4AK9A 3EHMA 1I4ZA 2XSEA 2KJGA 2A6EF 2KNHA 4YWQA 1KNYA 2Q4FA 2VASA 2ETSA 5KYWB 1PV3A 2V26A 2OOCA 2HFIA 3W8HA 4EWCA 2Y3GA 4X0RA 1SR2A 3QW0A 4O7GA 3S9OA 2QUPA 2GAQA 2IYLD 3GEEA 3ZIBA 3Q6NA 4DVZA 4CDYA 5L0IA 2R7OA 4CS8C 3O39A 1LE4A 3GM1A 4MW8A 2JD3A 4NY3A 5JRAA 3UGOA 1VYIA 4JIOA 3GEHA 4LLCA 1R4TA 1GM5A 2J8WA 2LQGA 4AX2A 3U8PA 2ZPAA 4Q7CA 1WWPA 2EIJC 1Z23A 3I5QA 5AC4A 3QVYA 4I44A 3ZG1A 1V55C 5DS5A 2QTVA 2YLIA 3EZIA 5T3TA 4R32A 4PACA 1PD0A 4MVOA 1RMVA 3FHDA 3VRCA 5F5FA 3KKBA 3RH3A 4WJ0A 3FOOA 1YDIA 1J8MF 2YL7A 1H9TA 3I4UA 1MNEA 2L7AA 3EPVA 3JSZA 2IXOA 1QKRA 3T6GB 1HE9A 1N1CA 2ICWG 1Z63A 2MYSA 4XLPF 1TWCA 1M2VB 4IRUA 3G4XA 4KNVA 1E2XA 3TOMA 1TFKB 3EFOA 4U5DE 1MMGA 2YL0A 1QQ3A 3AG1C 2M4EA 1VLSA 4IWBA 1HMOA 2YKZA 1QPUA 1EA8A 2G62A 1NU9C 2XLVA 3NG1A 3X2QC 1UFBA 4DVYP 2VB6A 3RW0A 4LLEA 2NSGA 3DZAA 2DB4A 2J0XA 1NFNA 1YLMA 3W4YA 1DOWA 2ZXRA 3HNIA 4C7OA 1AUEA 2Q9AA 1IZMA 4MVQA 2FFHA 1H6GA 4NTBA 3KYIA 4O6NA 4CX9A 4XPYA 1WTYA 3ATPA 5KYXA 1JOGA 1Y4CA 2B0JA 2R25A 3L8JA 3K33A 2A6HF 1ZHYA 4BJTA 4C3BA 1M57C 3QW1A 3JRMO 2EPMX 3UR3C 4RBNA 3BRJA 2WZGA 4A4AA 4U5HA 1BR4A 3DKAA 3E9VA 1RKCA 2RSEB 4LDRA 4AE4B 3DAGA 4FWVA 3RFYA 3U2LA 3K1IC 4DRIB 4JEBA 2W4MA 3HTKC 3OEOA 4U5GA 2Q7RA 3U3FA 2KC3A 2MHRA 1KU2A 2AP3A 4MVUA 3V5YA 3HNJA 1M6TA 2BE5F 1BDJB 2HJ3A 1WASA 2YL1A 4H54A 4WGZA 3HNLA 4MS2A 2R05A 3GM2A 1RJ9A 1VOMA 4BJ1A 1G5ZA 4O6YA 5A6AA 1NSGB 4MVMA 3RIPA 4FAPB 3TOLA 2WZLA 5E3CA 2L6GA 2A0BA 3AGTA 3EH1A 2AWYA 2IXNA 2EPLX 1Q0DA 2J9VA 1C02A 2IXPA 2KQ9A 1HW1A 3ASNC 1TFOB 1OW7A 1H9GA 3CSKA 4JKVA 3ZC4A 2A0UA 4DRHB 1MMNA 1YARO 1YVIA 1GGQA 2CCYA 4IJJA 3KH2A 3SP1A 3W2VA 2PFDA 4BJ5C 4ANJA 2L81A 4LDQA 3RF3A 2R7RA 1G4US 3GM3A 3NYJA 2H8AA 3HLZA 5COGA 4YT2A 2DYRC 1XWJA 4IGGA 2R9RB 3IQ6A 1W2WA 4W8KA 1D1AA 4H4KC 4JJGA 4CIPA 2IXMA 2L6FA 2PBEA 3FAPB 3B0PA 2DYSC 2QY9A 2VCAA 1G4WR 3CZ6A 1ZVZA 4MW3A 1T9KA 1ORYA 2NPUA 3IQCA 5COFA 3NMIA 1E83A 3IHUA 2XL6A 3U5SA 5L0HA 3AQCA 4E7SA 1VB5A 4U9EA 1LI5A 4PJNA 2KYHA 5A6JA 2AVKA 1J8YF 3C8ZA 3EGDA 3RYLA 2GWWA 3GANA 4E0IA 3C8GB 1I4YA 3DM5A 1QSPA 1DOVA 2XLEA 2WL8A 3A9CA 4CS8A 2PX3A 4G7HF 3CQZA 4JURI 1LE2A 4CJOA 4EBBA 1JAFA 3V5XA 1L3PA 2J9WA 4MQ9F 3U8VA 2R7UA 2XS1A 1OW8A 1OXBA 3NMKA 4JW1A 3WAQA 4ULVA 3ZQVA 4KC9A 2EPOA 1WGWA 3VF0A 2H7BA 1Q0FA 3ABLC 3L34A 3HJCA 4XEFA 4CS7A 2P61A 3S90A 5FZTA 2HKVA 3DWWA 3UMKA 2R7SA 1HY5A 1KTMA 3C63A 1Z5ZA 4J7TA 1XZQA 1TWAA 3K66A 3C18A 1HW2A 3S28A 2J0WA 3TQOA 2XL8A 1MMDA 1JPJA 3EG9A 1D0XA 4I1OB 5HV9A 1Z3IX 4FX5A 1ST6A 1A7VA 1ZZPA 3EJNA 4U5FE 2NG1A 1OQCA 2WB7A 3KL4A 3FXHA 5DVWA 3ABMC 4OIRF 4YK5A 4C3EA 1C03A 3MYIA 3ZWIA 3IPMO 4XLNF 2XXAB 1JPNA 5B1BC 3T6JA 2LSEA 3DD7A 4PR9A 3HNKA 4Z9HA 3B0VC 2P0NA 3VYWA 3TD7A 1K04A 1LPEA 2C04A 2Y3DA 3V7OA 2P7VA 2X51A 2J7PA 3SXMA 4FESA 5KYYA 3SYNA 2EPNA 1FR0A 4XPXA 4CJGA 1V4AA 1BZ4A 4N6HA 5JVEA 2P1AA 1CGNA 1A41A 4JRZA 4N06A 2TMVP 1OCRC 2Y3BA 3ASOC 4JC7A 2NUPB 4CSAC 1ZU4A 3MX3A 2E87A 1LVKA 5BQIA 3RKOF 1FFHA 4PK4A 3ZDLA 3V5ZA 2R7TA 4G78A 3UMHA 2XXAA 2H7VC 2VCCA 4YN0B 2LP4A 2J46A 4EIYA 3JZ0A 1JRAA 4Z9JA 4ZLDA 1A7DA 1Z6AA 2QNLA 4WABA 1E84A 2V3CC 3POVA 1TWGA 4BEJA 3SNHA 3TJ6A 5EHHA 4EKWA 1K05A 1LS4A 4U5CE 3SXYA 1NU7D 4RDAA 4D4XA 2PX0A 5K0IA 1SYQA 4U5BE 2ZD9A 2OEXA 1ZYRF 2CNWA 4LDKA 4XTKA 1RCPA 4BG0A 1NFOA 3QMKA 3H65A 4JTDB 4JVSA 4EHPA 4QI2A 3GORA 256BA 4CDVA 3Q7LA 4BJ6A 2BL2A 2XM4A 3LS0A 3PCVA 4IAQA 4LERA 4N6CA 4U9DA 4P9FA 3WODF 4AE4A 1LKXA 5HSWA 3KPHA 3S27A 1FAPB 5TJ5E 3C7JA 4KBLA 2NUTA 1APCA 1VK5A 2D5RB 3QTHA 2VH3A 3H2UA 5DS4A 1OW6A 2EIKC 3MBGA 1E86A 4M63A 3AJMA 3I5PA 3IQ5A 5T1DB 2HSQA 2KSFA 2HMQA 3K1HA 3K1IA 2HS5A 4OD5A 1WN0A 5L3VA 2B0HA 3AQBA 5A6BA 1RKEB 2EPKX 1NG1A 4PJLA 3FOPA 3NKEA 5JUAA 4Q4ZF 2AWCA 3U0CA 2YWAA 4K7BA 2XLDA 3HKKA 2CNWD 2L9JA 2XLOA 2ASRA 4MTFA 2XLWA 3EHNA 2WZFA 2GDCA 3DAFA 1ZHXA 4CDAA 4NCQA 4GYTA 1Q0KA 4LACB 1M2VA 3DE9A 4MTGA 3F46A 3AG3C 3SEOA 2YHSA 4NC3A 3H2VA 2XRHA 2NSFA 1QVXA 5KYNA 2OG2A 3PMRA 3UNGC 3B0UX 3UMIA 2IOQA 4DBRA 2YRFA 2R7XA 4OIQF 3UGPA 2Y39A 4HFKB 1OCZC 2J9BA 4ONSA 1NZEA 2R7QA 2PNOA 3B9QA 5L0GA 1HE1A 2AU5A 1G8XA 3GODA 1LM3B 4G7ZF 4E7ZA 1V54C 2OEVA 4JTCB 4QI0A 4XQ1A 1T6UA 1R5ID 2A68F 2G3KA 4GQHA 5F28E 4EBJA 1FFTC 2L6HA
chains in the Genus database with same CATH topology
1G5ZA 1F1MA 1YJGA 1GGQA 2GA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G5Z A;  1F1M A;  1YJG A;  1GGQ A;  2GA0 A; 
#chains in the Genus database with same CATH topology
 3N2Z B;  5JSL A;  2EIM C;  2LFF A;  3CAX A;  4ULW A;  3B71 A;  3L8I A;  2Q9C A;  4YL1 A;  3SXZ A;  3ZSU A;  3FAJ A;  4DJ9 A;  1O3U A;  3C62 A;  5JT4 A;  4E17 A;  2O9X A;  1D0Y A;  1SF8 A;  4XPW A;  1ZHW A;  2MWQ A;  3LEO A;  5KYW A;  5L0D A;  4YT4 A;  3DM9 B;  1T6I A;  4G7O F;  3US6 A;  3A11 A;  3PDM P;  1XZP A;  4CS9 C;  5A69 A;  1OKK A;  1ZHZ A;  2BC5 A;  3CEX A;  2HV6 A;  1NLX A;  3C8G D;  3NYM A;  1ZW2 A;  4K0D A;  4ZLC A;  5BUO A;  5IY5 C;  3NKD A;  3NDB B;  3RQE A;  1YAU O;  4IAO A;  1B68 A;  1D1C A;  5FCL A;  3GEI A;  2Q9B A;  3U9M A;  4KNW A;  2W9Y A;  3NMJ A;  3MLG A;  2YZS A;  4L6R A;  4E0H A;  2W45 A;  2FAP B;  1YA9 A;  2XLH A;  3KYJ A;  3TK0 A;  1EQ1 A;  1FNT c;  5DLJ A;  2X0C A;  2DGJ A;  4JCZ A;  4PFP A;  4W8P A;  4B6I A;  4J32 B;  2FGY A;  2JPU A;  1BR2 A;  5COM A;  1ORJ A;  1S05 A;  3G4Z A;  4C3D A;  1OR3 A;  1U89 A;  3NYL A;  2IM8 A;  2XL4 A;  4JTA B;  4U5E E;  3ZTM A;  5D92 A;  2I8B A;  2WVN A;  3GWL A;  3WG7 C;  4ER9 A;  5BQH A;  1CPR A;  4F4B A;  4MND A;  2LCH A;  3JYH A;  3R7C A;  4XWJ A;  1ZU5 A;  2HV7 A;  3EQL F;  4JZA A;  5DQT A;  2W4B A;  4HFF B;  2HJM A;  2Q3T A;  4AL0 A;  3DI5 A;  4MTO A;  3EG9 B;  5EGY A;  1BR1 A;  3JSE O;  1AVO B;  3GWN A;  4AL1 A;  1O5H A;  1TR2 A;  1FMV A;  2LIG A;  2LK4 A;  3LLK A;  4JEA A;  2R7W A;  4BJ5 A;  4YL3 A;  2HMZ A;  1BBH A;  3K6B A;  1FTS A;  3RQF A;  5AC5 A;  2YQY A;  2CGE A;  2Q00 A;  4G0H A;  4PJM A;  4Z9I A;  1O87 A;  3O55 A;  5CI9 A;  2YLG A;  4YT8 A;  2OJE D;  3B29 A;  2UUI A;  3EGX A;  1GQA A;  3LEV A;  4YJW A;  3G50 A;  4BJ6 C;  3U3B A;  3E70 C;  2ZXP A;  2YEV A;  3L0I A;  3K7D A;  4DRJ B;  2LD6 A;  5B3S C;  5A6B D;  3IQT A;  1D1B A;  1T6Q A;  2EIN C;  5L3Q A;  3LES A;  4DXW A;  1RKE A;  4CIH A;  3LNR A;  5E3A A;  3S0X A;  5KYU B;  3C8G A;  3TJ5 A;  1D0Z A;  4UDV A;  2YL3 A;  3TUL A;  1PD1 A;  1I5N A;  2GA0 A;  3OWT A;  2HZ8 A;  2R7V A;  3R2P A;  4CBE A;  2D4U A;  1CGM E;  1EKY A;  1GS9 A;  4A2N B;  3DMD A;  5A6K A;  2KGO A;  5D91 A;  2PF4 E;  2OJQ A;  3F47 A;  1MQV A;  3JYY A;  2NUT B;  3FMS A;  5L0C A;  2QLA A;  2J7P D;  1ZW3 A;  3OA1 A;  1RXQ A;  1YZA A;  3AGU A;  2C03 A;  1LS1 A;  2CW0 F;  3DJN B;  3FVY A;  5JP7 A;  2KW3 C;  2QE9 A;  2VC9 A;  2Y3H A;  3M79 A;  2CDQ A;  1UG7 A;  4NQF A;  2H7O A;  3S29 A;  3T9O A;  5F5H A;  4DBQ A;  1TQG A;  2XS8 A;  5CIV A;  3J06 A;  1YYX A;  2ZXO A;  2JX0 A;  3FDQ A;  1E85 A;  4OIP F;  3EH2 A;  1MND A;  1LIH A;  1RJ9 B;  4HE8 D;  3U9J A;  3SXK A;  3U2M A;  3AG4 C;  4JJF A;  3RVY A;  4E18 A;  5B1A C;  2M64 A;  2F22 A;  4XEK A;  3ABK C;  2J9U A;  1T01 A;  2OKU A;  3Q6M A;  4N4W A;  4RD9 A;  5B3I A;  3Q7G A;  4D4N A;  1VTM P;  3X1O A;  1HMD A;  4BEM J;  3VM6 A;  5L0J A;  3M1C B;  1K40 A;  1S7Z A;  1OKK D;  1OXK A;  4MVS A;  2GFH A;  3T4R A;  1VYK A;  2R03 A;  4MVZ A;  1ORS C;  3W2W A;  3NRH A;  4IAR A;  1QLE C;  2UUH A;  5E33 A;  4Q5S F;  2XLM A;  4JCH A;  3JRT A;  3IEE A;  3ITF A;  4EUK B;  3BEH A;  2ZXW C;  4OIN F;  4P6I C;  5CI8 A;  5KYY B;  4I3M A;  1JMW A;  4QDL A;  3PHF 2;  3AG2 C;  1YJG A;  2EIL C;  3DE8 A;  1YA7 O;  4CS9 A;  1IW7 F;  5DS6 A;  5KYX B;  1L7C A;  3S84 A;  2WVO A;  4XEV A;  1NBB A;  3WHN A;  3LUT B;  4C7O B;  1M2O A;  2OQM A;  3JT1 A;  5DQZ A;  2A69 F;  1F1M A;  1PCX A;  5KYU A;  4JE9 A;  5JLI A;  1VLT A;  3O10 A;  4J7Y A;  5BQG A;  1OCO C;  4PFO A;  4MVR A;  5EK0 A;  1Z7Q c;  1H7I A;  3LJB A;  2IBF A;  1YZC A;  3QVZ A;  3ZTZ A;  2A1D D;  1Q0M A;  1CGO A;  2LFD A;  2OU6 A;  1Q0G A;  2PP4 A;  2J45 A;  5GPG B;  3EFO B;  1WAT A;  1MMA A;  5E2Q A;  3ZQY A;  1EI7 A;  4CSA A;  1V74 B;  3AOU A;  3EGX B;  1OR2 A;  3DJU B;  2HUJ A;  1CPQ A;  2Y69 C;  4I1M A;  3VAY A;  1T5O A;  1U0B B;  1FMW A;  3JTL O;  1Y6D A;  3W8I A;  1C17 M;  1ZHT A;  3LNM B;  3O6X A;  3M4C A;  3M15 A;  4OD4 A;  1A0B A;  2OCC C;  4NTF A;  1A7E A;  1TKN A;  2CYD A;  2HSB A;  2I15 A;  2XM0 A;  3LS1 A;  2Z15 A;  4NTA A;  3LLI A;  1JR8 A;  3RVZ A;  3ZVR A;  4BPM A;  5JS5 A;  1LI7 A;  4OIO F;  3SZR A;  3QZC A;  2P6V A;  4J30 B;  4EBK A;  3KMI A;  4O6M A;  3LAY A;  1SMY F;  1YYJ A;  2VCB A;  1U6H A;  3MYF A;  1QZX A;  4WGY A;  3MFN A;  4YT5 A;  3RQG A;  1M56 C;  1AEP A;  2WVQ A;  4DOZ A;  2YLD A;  3EZH A;  1OCC C;  2DI3 A;  3M4B A;  3N24 A;  4O79 A;  1VMA A;  5AGF A;  4HEA J;  1TWH A;  4K1O A;  4P9T A;  3JCU Q;  3EGD B;  2RD9 A;  4PJJ A;  2G3V A;  2R02 A;  2KK1 A;  3ECS A;  5L0F A;  3T6B A;  2YVK A;  1WOL A;  4GEH A;  4KI2 A;  2NUP A;  3L1M A;  1SZI A;  3DXJ F;  3N0T A;  4IB4 A;  4YL0 A;  5T3W A;  4AK9 A;  3EHM A;  1I4Z A;  2XSE A;  2KJG A;  2A6E F;  2KNH A;  4YWQ A;  1KNY A;  2Q4F A;  2VAS A;  2ETS A;  5KYW B;  1PV3 A;  2V26 A;  2OOC A;  2HFI A;  3W8H A;  4EWC A;  2Y3G A;  4X0R A;  1SR2 A;  3QW0 A;  4O7G A;  3S9O A;  2QUP A;  2GAQ A;  2IYL D;  3GEE A;  3ZIB A;  3Q6N A;  4DVZ A;  4CDY A;  5L0I A;  2R7O A;  4CS8 C;  3O39 A;  1LE4 A;  3GM1 A;  4MW8 A;  2JD3 A;  4NY3 A;  5JRA A;  3UGO A;  1VYI A;  4JIO A;  3GEH A;  4LLC A;  1R4T A;  1GM5 A;  2J8W A;  2LQG A;  4AX2 A;  3U8P A;  2ZPA A;  4Q7C A;  1WWP A;  2EIJ C;  1Z23 A;  3I5Q A;  5AC4 A;  3QVY A;  4I44 A;  3ZG1 A;  1V55 C;  5DS5 A;  2QTV A;  2YLI A;  3EZI A;  5T3T A;  4R32 A;  4PAC A;  1PD0 A;  4MVO A;  1RMV A;  3FHD A;  3VRC A;  5F5F A;  3KKB A;  3RH3 A;  4WJ0 A;  3FOO A;  1YDI A;  1J8M F;  2YL7 A;  1H9T A;  3I4U A;  1MNE A;  2L7A A;  3EPV A;  3JSZ A;  2IXO A;  1QKR A;  3T6G B;  1HE9 A;  1N1C A;  2ICW G;  1Z63 A;  2MYS A;  4XLP F;  1TWC A;  1M2V B;  4IRU A;  3G4X A;  4KNV A;  1E2X A;  3TOM A;  1TFK B;  3EFO A;  4U5D E;  1MMG A;  2YL0 A;  1QQ3 A;  3AG1 C;  2M4E A;  1VLS A;  4IWB A;  1HMO A;  2YKZ A;  1QPU A;  1EA8 A;  2G62 A;  1NU9 C;  2XLV A;  3NG1 A;  3X2Q C;  1UFB A;  4DVY P;  2VB6 A;  3RW0 A;  4LLE A;  2NSG A;  3DZA A;  2DB4 A;  2J0X A;  1NFN A;  1YLM A;  3W4Y A;  1DOW A;  2ZXR A;  3HNI A;  4C7O A;  1AUE A;  2Q9A A;  1IZM A;  4MVQ A;  2FFH A;  1H6G A;  4NTB A;  3KYI A;  4O6N A;  4CX9 A;  4XPY A;  1WTY A;  3ATP A;  5KYX A;  1JOG A;  1Y4C A;  2B0J A;  2R25 A;  3L8J A;  3K33 A;  2A6H F;  1ZHY A;  4BJT A;  4C3B A;  1M57 C;  3QW1 A;  3JRM O;  2EPM X;  3UR3 C;  4RBN A;  3BRJ A;  2WZG A;  4A4A A;  4U5H A;  1BR4 A;  3DKA A;  3E9V A;  1RKC A;  2RSE B;  4LDR A;  4AE4 B;  3DAG A;  4FWV A;  3RFY A;  3U2L A;  3K1I C;  4DRI B;  4JEB A;  2W4M A;  3HTK C;  3OEO A;  4U5G A;  2Q7R A;  3U3F A;  2KC3 A;  2MHR A;  1KU2 A;  2AP3 A;  4MVU A;  3V5Y A;  3HNJ A;  1M6T A;  2BE5 F;  1BDJ B;  2HJ3 A;  1WAS A;  2YL1 A;  4H54 A;  4WGZ A;  3HNL A;  4MS2 A;  2R05 A;  3GM2 A;  1RJ9 A;  1VOM A;  4BJ1 A;  1G5Z A;  4O6Y A;  5A6A A;  1NSG B;  4MVM A;  3RIP A;  4FAP B;  3TOL A;  2WZL A;  5E3C A;  2L6G A;  2A0B A;  3AGT A;  3EH1 A;  2AWY A;  2IXN A;  2EPL X;  1Q0D A;  2J9V A;  1C02 A;  2IXP A;  2KQ9 A;  1HW1 A;  3ASN C;  1TFO B;  1OW7 A;  1H9G A;  3CSK A;  4JKV A;  3ZC4 A;  2A0U A;  4DRH B;  1MMN A;  1YAR O;  1YVI A;  1GGQ A;  2CCY A;  4IJJ A;  3KH2 A;  3SP1 A;  3W2V A;  2PFD A;  4BJ5 C;  4ANJ A;  2L81 A;  4LDQ A;  3RF3 A;  2R7R A;  1G4U S;  3GM3 A;  3NYJ A;  2H8A A;  3HLZ A;  5COG A;  4YT2 A;  2DYR C;  1XWJ A;  4IGG A;  2R9R B;  3IQ6 A;  1W2W A;  4W8K A;  1D1A A;  4H4K C;  4JJG A;  4CIP A;  2IXM A;  2L6F A;  2PBE A;  3FAP B;  3B0P A;  2DYS C;  2QY9 A;  2VCA A;  1G4W R;  3CZ6 A;  1ZVZ A;  4MW3 A;  1T9K A;  1ORY A;  2NPU A;  3IQC A;  5COF A;  3NMI A;  1E83 A;  3IHU A;  2XL6 A;  3U5S A;  5L0H A;  3AQC A;  4E7S A;  1VB5 A;  4U9E A;  1LI5 A;  4PJN A;  2KYH A;  5A6J A;  2AVK A;  1J8Y F;  3C8Z A;  3EGD A;  3RYL A;  2GWW A;  3GAN A;  4E0I A;  3C8G B;  1I4Y A;  3DM5 A;  1QSP A;  1DOV A;  2XLE A;  2WL8 A;  3A9C A;  4CS8 A;  2PX3 A;  4G7H F;  3CQZ A;  4JUR I;  1LE2 A;  4CJO A;  4EBB A;  1JAF A;  3V5X A;  1L3P A;  2J9W A;  4MQ9 F;  3U8V A;  2R7U A;  2XS1 A;  1OW8 A;  1OXB A;  3NMK A;  4JW1 A;  3WAQ A;  4ULV A;  3ZQV A;  4KC9 A;  2EPO A;  1WGW A;  3VF0 A;  2H7B A;  1Q0F A;  3ABL C;  3L34 A;  3HJC A;  4XEF A;  4CS7 A;  2P61 A;  3S90 A;  5FZT A;  2HKV A;  3DWW A;  3UMK A;  2R7S A;  1HY5 A;  1KTM A;  3C63 A;  1Z5Z A;  4J7T A;  1XZQ A;  1TWA A;  3K66 A;  3C18 A;  1HW2 A;  3S28 A;  2J0W A;  3TQO A;  2XL8 A;  1MMD A;  1JPJ A;  3EG9 A;  1D0X A;  4I1O B;  5HV9 A;  1Z3I X;  4FX5 A;  1ST6 A;  1A7V A;  1ZZP A;  3EJN A;  4U5F E;  2NG1 A;  1OQC A;  2WB7 A;  3KL4 A;  3FXH A;  5DVW A;  3ABM C;  4OIR F;  4YK5 A;  4C3E A;  1C03 A;  3MYI A;  3ZWI A;  3IPM O;  4XLN F;  2XXA B;  1JPN A;  5B1B C;  3T6J A;  2LSE A;  3DD7 A;  4PR9 A;  3HNK A;  4Z9H A;  3B0V C;  2P0N A;  3VYW A;  3TD7 A;  1K04 A;  1LPE A;  2C04 A;  2Y3D A;  3V7O A;  2P7V A;  2X51 A;  2J7P A;  3SXM A;  4FES A;  5KYY A;  3SYN A;  2EPN A;  1FR0 A;  4XPX A;  4CJG A;  1V4A A;  1BZ4 A;  4N6H A;  5JVE A;  2P1A A;  1CGN A;  1A41 A;  4JRZ A;  4N06 A;  2TMV P;  1OCR C;  2Y3B A;  3ASO C;  4JC7 A;  2NUP B;  4CSA C;  1ZU4 A;  3MX3 A;  2E87 A;  1LVK A;  5BQI A;  3RKO F;  1FFH A;  4PK4 A;  3ZDL A;  3V5Z A;  2R7T A;  4G78 A;  3UMH A;  2XXA A;  2H7V C;  2VCC A;  4YN0 B;  2LP4 A;  2J46 A;  4EIY A;  3JZ0 A;  1JRA A;  4Z9J A;  4ZLD A;  1A7D A;  1Z6A A;  2QNL A;  4WAB A;  1E84 A;  2V3C C;  3POV A;  1TWG A;  4BEJ A;  3SNH A;  3TJ6 A;  5EHH A;  4EKW A;  1K05 A;  1LS4 A;  4U5C E;  3SXY A;  1NU7 D;  4RDA A;  4D4X A;  2PX0 A;  5K0I A;  1SYQ A;  4U5B E;  2ZD9 A;  2OEX A;  1ZYR F;  2CNW A;  4LDK A;  4XTK A;  1RCP A;  4BG0 A;  1NFO A;  3QMK A;  3H65 A;  4JTD B;  4JVS A;  4EHP A;  4QI2 A;  3GOR A;  256B A;  4CDV A;  3Q7L A;  4BJ6 A;  2BL2 A;  2XM4 A;  3LS0 A;  3PCV A;  4IAQ A;  4LER A;  4N6C A;  4U9D A;  4P9F A;  3WOD F;  4AE4 A;  1LKX A;  5HSW A;  3KPH A;  3S27 A;  1FAP B;  5TJ5 E;  3C7J A;  4KBL A;  2NUT A;  1APC A;  1VK5 A;  2D5R B;  3QTH A;  2VH3 A;  3H2U A;  5DS4 A;  1OW6 A;  2EIK C;  3MBG A;  1E86 A;  4M63 A;  3AJM A;  3I5P A;  3IQ5 A;  5T1D B;  2HSQ A;  2KSF A;  2HMQ A;  3K1H A;  3K1I A;  2HS5 A;  4OD5 A;  1WN0 A;  5L3V A;  2B0H A;  3AQB A;  5A6B A;  1RKE B;  2EPK X;  1NG1 A;  4PJL A;  3FOP A;  3NKE A;  5JUA A;  4Q4Z F;  2AWC A;  3U0C A;  2YWA A;  4K7B A;  2XLD A;  3HKK A;  2CNW D;  2L9J A;  2XLO A;  2ASR A;  4MTF A;  2XLW A;  3EHN A;  2WZF A;  2GDC A;  3DAF A;  1ZHX A;  4CDA A;  4NCQ A;  4GYT A;  1Q0K A;  4LAC B;  1M2V A;  3DE9 A;  4MTG A;  3F46 A;  3AG3 C;  3SEO A;  2YHS A;  4NC3 A;  3H2V A;  2XRH A;  2NSF A;  1QVX A;  5KYN A;  2OG2 A;  3PMR A;  3UNG C;  3B0U X;  3UMI A;  2IOQ A;  4DBR A;  2YRF A;  2R7X A;  4OIQ F;  3UGP A;  2Y39 A;  4HFK B;  1OCZ C;  2J9B A;  4ONS A;  1NZE A;  2R7Q A;  2PNO A;  3B9Q A;  5L0G A;  1HE1 A;  2AU5 A;  1G8X A;  3GOD A;  1LM3 B;  4G7Z F;  4E7Z A;  1V54 C;  2OEV A;  4JTC B;  4QI0 A;  4XQ1 A;  1T6U A;  1R5I D;  2A68 F;  2G3K A;  4GQH A;  5F28 E;  4EBJ A;  1FFT C;  2L6H A; 
#chains in the Genus database with same CATH homology
 1G5Z A;  1F1M A;  1YJG A;  1GGQ A;  2GA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...