4HE8D

Crystal structure of the membrane domain of respiratory complex i from thermus thermophilus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
160
structure length
160
Chain Sequence
b'MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGEIGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase subunit 7
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 160
sequence length 160
chains with identical sequence J
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00499 Oxidored_q3 NADH-ubiquinone/plastoquinone oxidoreductase chain 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1200 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4he8D00
4HE8D 4HEAJ 3RKOF
chains in the Genus database with same CATH superfamily
1YZAA 3U8PA 4JRZA 3JCUQ 5E3CA 2TMVP 3ZG1A 4C7OB 4IRUA 2YHSA 4I3MA 3HJCA 2WVOA 1L7CA 2I8BA 3EFOA 4G7HF 3U2LA 4DOZA 3TK0A 1S05A 3G4XA 2GA0A 1UFBA 4BJ6C 1FNTc 1ZHYA 1T6IA 1KU2A 2R7WA 4BJTA 5E33A 2KW3C 2MHRA 3NYLA 5JUAA 2YQYA 4Q4ZF 3ZQVA 5DQTA 3AG2C 2CW0F 1T6QA 1LE2A 5A6BA 2RD9A 3AG3C 4XLNF 2YVKA 3NKDA 2R25A 2PP4A 4G7OF 1ORYA 5COFA 2HZ8A 1D1AA 2WVQA 3L8JA 3ECSA 4JJFA 2Q9AA 1OCOC 3TJ6A 3EFOB 3IQ6A 4JEBA 1VLSA 2AU5A 4EUKB 1Q0KA 1LKXA 4I1OB 2XL4A 3AQCA 4MTFA 3B9QA 3SYNA 5L0HA 2H7VC 4W8KA 4U5DE 4CX9A 4P9FA 4DVYP 3E9VA 2P0NA 1Q0FA 2CNWD 1H9GA 2YKZA 4YWQA 3UGOA 2LIGA 4OD5A 1AEPA 5CI8A 3TOMA 3V5YA 2BE5F 3ZQYA 3RIPA 2G3KA 4O6NA 2J7PA 4CIHA 3ZTZA 3GM2A 4LDKA 1LS4A 2A0UA 4AE4A 1F1MA 4MNDA 2Q9BA 1YARO 1SF8A 3DE8A 3HTKC 2A6HF 1JPNA 3UMHA 3NKEA 3M4CA 4YT8A 2EILC 1Y4CA 2HFIA 3O6XA 3QVYA 1NFNA 3NMKA 3KKBA 4MVMA 3S29A 1D0XA 4JTDB 5L0FA 3U0CA 2H8AA 1H9TA 1TR2A 4JKVA 4Q5SF 1QPUA 4JW1A 1VB5A 4YL1A 4AL1A 1LVKA 4NTAA 1LI5A 3A9CA 2GDCA 3W8HA 4AE4B 1WASA 1NLXA 4K7BA 5K0IA 1T9KA 3EHMA 1D1BA 4OD4A 2GFHA 4YT5A 3U3BA 1ST6A 3LLIA 1OR2A 3H65A 3HNJA 3LLKA 2VB6A 2JD3A 3L34A 1DOVA 4KBLA 2V3CC 3ITFA 1JRAA 3AQBA 1WWPA 3J06A 1L3PA 2ASRA 1LS1A 2P61A 1N1CA 3PCVA 3QW1A 2QLAA 2XLEA 4H54A 4IB4A 4ONSA 3RVYA 4H4KC 3S27A 3VM6A 3R7CA 1D0ZA 2FFHA 3WAQA 3T9OA 2ICWG 3SXYA 3S84A 4JC7A 5T1DB 3DKAA 2QUPA 1APCA 1G8XA 4NTFA 4PR9A 4PJMA 3IHUA 4K1OA 3I5PA 2L6HA 3EGDA 4M63A 2C04A 1I4ZA 3H2VA 3SZRA 1LPEA 2QE9A 1AVOB 1QQ3A 3IEEA 3VF0A 2Q00A 5FCLA 1OKKA 2ZXPA 3LS0A 2FGYA 3JYYA 2BC5A 3G50A 2R7OA 3CSKA 2C03A 1V55C 1YJGA 1ZYRF 2YL0A 3V5XA 3RQFA 3DE9A 3EGDB 4IWBA 4O79A 2WVNA 1D1CA 1MQVA 1FAPB 1XZQA 2ZPAA 1HMOA 4G78A 1XWJA 2M64A 3AGTA 1OR3A 3EZHA 4XWJA 2FAPB 2J9BA 4PJJA 2LQGA 1NBBA 1TFKB 1A0BA 1HE1A 1W2WA 2J46A 4CS8C 5JRAA 4BJ1A 1VYIA 3GEIA 3Q7LA 2R7RA 1C03A 3C8GA 4ZLDA 4XEFA 2YL3A 4U5EE 3FVYA 2QY9A 3GM3A 3LNRA 3N0TA 5B1BC 2NUPA 4BJ5A 3PDMP 2LFDA 4MTOA 3EJNA 3JRTA 3DM9B 2KQ9A 4RDAA 4KNWA 4MW8A 2EPOA 4E0HA 1G4US 2A69F 2HMQA 1M2VA 4FX5A 3ZVRA 4CSAC 1GGQA 1V4AA 4EBBA 2D4UA 4F4BA 3FOPA 1E86A 4N06A 3JTLO 3T6JA 1SZIA 3K6BA 4Q7CA 4HE8D 5D91A 3C8GB 1LM3B 1MNDA 3C63A 2NUPB 4EHPA 2XS8A 3CAXA 4BG0A 3SXZA 3AOUA 2B0HA 5KYXA 1BDJB 1R5ID 1LE4A 3Q6MA 3U3FA 3OWTA 2CCYA 2QNLA 1M2VB 1YDIA 3NG1A 4FESA 2XLMA 1OCCC 4I1MA 3EZIA 3C62A 3TQOA 2KC3A 2EPMX 3IQ5A 1ZU5A 3RH3A 2YLGA 3UNGC 1MNEA 2QTVA 3GORA 1RKCA 2OQMA 3W2WA 4N4WA 3I5QA 4X0RA 5F5HA 2J9UA 4A2NB 5BUOA 2ZD9A 1YZCA 2YL1A 4OIOF 4AK9A 4NY3A 3UGPA 1IW7F 2LCHA 4DBQA 4GEHA 2NG1A 4KC9A 4JZAA 5KYXB 4XLPF 2GWWA 1YYJA 2Y3BA 256BA 4U9EA 2HMZA 3RF3A 1OCZC 3S0XA 1M2OA 4XEKA 1HW2A 2EIKC 3L8IA 4CS9C 2HJMA 1OCRC 3MYIA 4ULVA 3ZC4A 3QTHA 4U5GA 4ER9A 1NG1A 5L0IA 2VC9A 3SNHA 1RKEA 3GEHA 2O9XA 3TD7A 1OXBA 4RD9A 5AC4A 4DRJB 4RBNA 1EQ1A 4EIYA 1NZEA 4QDLA 3KPHA 2AWCA 2IXPA 1CGOA 4YL3A 2P1AA 1RXQA 4NQFA 3WHNA 5L0JA 2PX3A 4LDRA 3UMIA 4BPMA 1SYQA 2R02A 2D5RB 2ZXWC 4P6IC 3B71A 4MVZA 3MX3A 2HSQA 3K33A 3WODF 4EKWA 1S7ZA 1RKEB 2NSFA 1M57C 4KI2A 4I44A 3DJNB 4AX2A 3X2QC 3T6GB 2OJED 3DXJF 3M15A 4YN0B 1HY5A 3ATPA 2KGOA 4FWVA 5DS4A 4MVRA 2X51A 2J0XA 4C3EA 5JT4A 3LEVA 3NYJA 2GAQA 2ETSA 3K1IA 5DQZA 2AVKA 1A41A 4CDYA 3RFYA 2VH3A 2ZXOA 3EHNA 1V54C 2XM0A 3LAYA 4JJGA 3IQCA 3O10A 3RYLA 3TULA 1Z23A 5JSLA 2J45A 2XLHA 1EI7A 2LP4A 2XLWA 3GM1A 3LUTB 3VAYA 4DBRA 1RCPA 2VASA 1HW1A 4MVQA 1ZW2A 4AL0A 5L3QA 2VCAA 1OW7A 2EPKX 3FXHA 4JVSA 1BZ4A 4MVUA 5L0CA 3SXKA 1D0YA 2AWYA 3EH2A 4XTKA 1A7EA 2A1DD 2OEVA 2Z15A 4B6IA 3ZTMA 4JE9A 3C8ZA 4MVSA 5KYUA 4ULWA 2Y3HA 4FAPB 2VCCA 1RMVA 2OJQA 2IYLD 2UUHA 4PFPA 4C3BA 4JCHA 1Z63A 3U9MA 4BJ6A 1WOLA 1MMGA 1UG7A 2LFFA 3T4RA 1PD1A 5F28E 2YWAA 5CI9A 2M4EA 2UUIA 2AP3A 2CNWA 5JP7A 1WTYA 4E7SA 3SP1A 5KYUB 3AG1C 1LIHA 1Q0MA 1G5ZA 2R03A 4LERA 3U9JA 2HV7A 2PX0A 1C17M 3ABMC 1T5OA 3GODA 3KH2A 2CGEA 4Z9HA 1BR4A 2XLVA 5DS5A 2OKUA 2YLDA 4EBJA 3DAGA 5EHHA 2WL8A 4MS2A 4XQ1A 3TOLA 4KNVA 2H7OA 2HS5A 2EIMC 5E2QA 1QKRA 3A11A 1E2XA 1TWCA 2WZLA 1E85A 3RW0A 1GQAA 2PF4E 2Q4FA 5BQHA 2J9VA 5COGA 4EBKA 4U5BE 2IXOA 3EGXA 1TWAA 2RSEB 4MW3A 4YT4A 3Q6NA 1HE9A 2L6FA 5CIVA 1IZMA 2E87A 4J7YA 4WGYA 5A6BD 1ORJA 1WN0A 2J0WA 4U9DA 1R4TA 1ZHTA 5DLJA 5EK0A 1ZU4A 5L0GA 4YJWA 1K40A 2Y3GA 2CDQA 2PBEA 2DYSC 3GWLA 2MYSA 1FFTC 1YA9A 1A7DA 3ZDLA 1QZXA 3FOOA 3KYJA 2A68F 2JX0A 3CZ6A 3HNKA 2YEVA 3LJBA 3EGXB 4IARA 5F5FA 2XLDA 3R2PA 3DD7A 1Z6AA 2XL6A 3DZAA 4IGGA 2DGJA 5A6JA 1AUEA 1NU9C 3NMJA 2R7UA 4CIPA 1TWHA 3M79A 1YVIA 1EA8A 2MWQA 3IPMO 3MBGA 1MMAA 3ABKC 4J30B 4MTGA 4YL0A 1O3UA 2J7PD 2W9YA 5L0DA 3LESA 5KYNA 3K7DA 1I5NA 1K05A 1VK5A 1V74B 2HV6A 1Y6DA 1YA7O 5BQGA 4NCQA 5HSWA 2J9WA 1JMWA 3AG4C 3ASOC 2WZGA 3ZWIA 5B1AC 3T6BA 4JTAB 5DVWA 3SEOA 3W2VA 4JTCB 1G4WR 1TQGA 2W45A 3CQZA 1ZVZA 4IAOA 1ORSC 3JRMO 1VLTA 2YL7A 3E70C 4L6RA 4MQ9F 4PFOA 4CS7A 1B68A 5A6AA 2KJGA 1ZHWA 4O6YA 1T6UA 4CJOA 1H6GA 2ZXRA 3M4BA 2OCCC 4IJJA 2WB7A 1FR0A 4OIRF 1CPQA 2Y69C 4DVZA 1GM5A 1OXKA 3HNIA 2NUTA 3ASNC 4E7ZA 1EKYA 3C7JA 4GYTA 1ZHXA 2G62A 4HEAJ 3S9OA 1YYXA 2P7VA 2IOQA 3BEHA 1KTMA 3GEEA 4XEVA 2LD6A 2A6EF 5E3AA 4LACB 3JSEO 3FAJA 4HFFB 3GWNA 4ANJA 1OQCA 2IBFA 1PD0A 1QLEC 2KK1A 4JEAA 4O6MA 5EGYA 2JPUA 1FMVA 1A7VA 3W8IA 3FAPB 4IAQA 3RVZA 1DOWA 3HNLA 4NC3A 4BEJA 2P6VA 1U89A 2V26A 1M56C 1TWGA 2NUTB 3FMSA 3RQEA 4D4NA 3F47A 4DXWA 2KNHA 3B0PA 4C3DA 3G4ZA 2I15A 3O39A 1BR1A 4LLEA 1GS9A 2EPLX 3MFNA 3U5SA 2W4MA 4G0HA 2KSFA 3B29A 4PACA 2YZSA 4CJGA 2A0BA 3K66A 3LEOA 2Q3TA 4XPXA 3I4UA 1OW8A 2IM8A 4CS8A 3DMDA 2NPUA 2XS1A 1YAUO 3LS1A 4XPYA 3L0IA 5AC5A 4E18A 3UMKA 3QVZA 5HV9A 3V5ZA 4JURI 1VMAA 3DJUB 1OKKD 1FTSA 2Q9CA 5TJ5E 4U5FE 2B0JA 1YLMA 3TJ5A 4YT2A 4CSAA 4BJ5C 1WATA 1NSGB 2R9RB 1O87A 5JVEA 1HMDA 5FZTA 3UR3C 2EIJC 5IY5C 4ZLCA 1MMDA 5JS5A 5KYWA 5AGFA 4XPWA 3GANA 4N6HA 3X1OA 4CBEA 4OIQF 4GQHA 3K1HA 5COMA 3Q7GA 2R7TA 4G7ZF 1VYKA 3BRJA 2XL8A 1ZHZA 4EWCA 5JLIA 3PMRA 4PJNA 1O5HA 3C8GD 3DAFA 4WGZA 2L6GA 5T3TA 3U2MA 3AGUA 4HFKB 2IXMA 2R05A 3SXMA 3HLZA 5T3WA 2DYRC 1JAFA 3V7OA 3FDQA 4QI2A 1SMYF 4J7TA 3IQTA 4O7GA 4OINF 1LI7A 2VCBA 2BL2A 5KYWB 4BEMJ 4U5HA 5A6KA 3QMKA 1CGME 3VYWA 3JT1A 4UDVA 1ZW3A 3KYIA 3S28A 1SR2A 3ABLC 2L9JA 3JZ0A 1Z3IX 2YRFA 4R32A 4D4XA 1CPRA 2OEXA 1JOGA 3VRCA 2EPNA 1NU7D 4YK5A 3WG7C 4CDAA 2XXAA 2Q7RA 5B3SC 3MYFA 1BR2A 2XLOA 4JCZA 4DJ9A 4E17A 1TFOB 3F46A 1FFHA 4P9TA 2OG2A 2PFDA 1FMWA 2YLIA 3M1CB 3N24A 3O55A 2EINC 1QSPA 3AJMA 2IXNA 3EG9A 4LDQA 2DB4A 1Z7Qc 4CS9A 2R7XA 3H2UA 3RKOF 1VTMP 1RJ9A 1ZZPA 2XM4A 2X0CA 2G3VA 2L7AA 4WABA 5GPGB 1Q0GA 4PJLA 3B0VC 3FHDA 1PCXA 3EH1A 1MMNA 4CDVA 4JIOA 2XXAB 3C18A 3NRHA 3NDBB 2L81A 5A69A 1NFOA 2R7QA 1KNYA 2W4BA 4Z9IA 3PHF2 1CGNA 2Y3DA 3NMIA 3CEXA 3EG9B 1OW6A 2XSEA 1C02A 4PK4A 4OIPF 2WZFA 1QVXA 3OEOA 1VOMA 3DI5A 1RJ9B 2KYHA 2HUJA 3EPVA 1M6TA 1WGWA 2CYDA 3L1MA 1H7IA 4A4AA 1U6HA 2XRHA 1TKNA 1K04A 4MVOA 4Z9JA 2LK4A 1BBHA 2LSEA 2HJ3A 3DWWA 3KMIA 5B3IA 1XZPA 3U8VA 4E0IA 2PNOA 3N2ZB 3LNMB 3US6A 1Q0DA 5KYYA 1J8MF 1Z5ZA 5DS6A 4U5CE 4WJ0A 1J8YF 2R7VA 3RQGA 4K0DA 4DRIB 3QW0A 3HKKA 3K1IC 4LLCA 4QI0A 3JSZA 3MLGA 5BQIA 5D92A 3ZSUA 4N6CA 1U0BB 4J32B 3JYHA 3W4YA 3ZIBA 2R7SA 4C7OA 2HSBA 3NYMA 2J8WA 4NTBA 3B0UX 2Y39A 3EQLF 4DRHB 2DI3A 2HKVA 4W8PA 1JR8A 2OU6A 1T01A 3S90A 1JPJA 3POVA 3KL4A 3OA1A 2H7BA 5KYYB 2NSGA 1E83A 2F22A 2OOCA 1I4YA 1PV3A 3DM5A 5L3VA 3QZCA 1E84A
chains in the Genus database with same CATH topology
3JCUQ 5E3CA 3ZG1A 4C7OB 4IRUA 2YHSA 4I3MA 3HJCA 2WVOA 2I8BA 3EFOA 4G7HF 4DOZA 4BJ6C 1ZHYA 1KU2A 2R7WA 4BJTA 5E33A 2KW3C 3NYLA 4Q4ZF 5DQTA 3AG2C 2CW0F 3AG3C 4XLNF 3NKDA 2PP4A 4G7OF 2WVQA 1D1AA 3ECSA 4JJFA 2Q9AA 1OCOC 3EFOB 1LKXA 4I1OB 2XL4A 3AQCA 3B9QA 3SYNA 2H7VC 4W8KA 4U5DE 4DVYP 3E9VA 2CNWD 4YWQA 3UGOA 4OD5A 5CI8A 2BE5F 3RIPA 2G3KA 4O6NA 2J7PA 4CIHA 4AE4A 4MNDA 2Q9BA 1SF8A 3HTKC 2A6HF 1JPNA 3UMHA 3NKEA 4YT8A 2EILC 3O6XA 3KKBA 3S29A 1D0XA 1TR2A 4Q5SF 4JW1A 1LVKA 4AE4B 3W8HA 4K7BA 3EHMA 1D1BA 4OD4A 2GFHA 4YT5A 1ST6A 3LLIA 3H65A 3LLKA 2VB6A 2JD3A 3L34A 4KBLA 2V3CC 3ITFA 3AQBA 1LS1A 1N1CA 4H4KC 3S27A 1D0ZA 2FFHA 5T1DB 1G8XA 4PJMA 3I5PA 3EGDA 4M63A 2C04A 3SZRA 3IEEA 5FCLA 1OKKA 2ZXPA 3LS0A 2FGYA 2R7OA 3CSKA 2C03A 1V55C 1ZYRF 3EGDB 4IWBA 4O79A 2WVNA 1D1CA 2ZPAA 3EZHA 4XWJA 4PJJA 1W2WA 2J46A 4CS8C 4BJ1A 1VYIA 2R7RA 3Q7LA 4ZLDA 4U5EE 3FVYA 2QY9A 3LNRA 3N0TA 5B1BC 2NUPA 4BJ5A 3EJNA 3JRTA 3DM9B 2KQ9A 4RDAA 4KNWA 2A69F 1M2VA 4FX5A 3ZVRA 4CSAC 4EBBA 4F4BA 4N06A 3T6JA 1SZIA 3K6BA 4Q7CA 4HE8D 5D91A 1MNDA 2NUPB 4BG0A 5KYXA 3Q6MA 3OWTA 3NG1A 1M2VB 4FESA 1OCCC 4I1MA 3EZIA 3RH3A 1ZU5A 3UNGC 1MNEA 2QTVA 5B3SC 3W2WA 4X0RA 3I5QA 5F5HA 4A2NB 2J9UA 5BUOA 4OIOF 4AK9A 4NY3A 3UGPA 1IW7F 4DBQA 4GEHA 2NG1A 4KC9A 4JZAA 5KYXB 2Y3BA 1OCZC 3S0XA 1M2OA 2EIKC 4CS9C 1OCRC 3ZC4A 4U5GA 1NG1A 3SNHA 2O9XA 3TD7A 4RD9A 4RBNA 4YT4A 1NZEA 4QDLA 2IXPA 2PX3A 3UMIA 2D5RB 2ZXWC 4P6IC 3MX3A 3K33A 3WODF 1S7ZA 4KI2A 1M57C 4I44A 3DJNB 4AX2A 3X2QC 3DXJF 4YN0B 2KGOA 4FWVA 5DS4A 2X51A 2J0XA 4C3EA 3LEVA 3NYJA 5DQZA 3RFYA 2VH3A 2ZXOA 3EHNA 1V54C 3LAYA 4JJGA 3RYLA 1Z23A 2J45A 3VAYA 4DBRA 2VASA 5L3QA 4JVSA 1D0YA 4XTKA 3EH2A 2A1DD 2Z15A 4B6IA 5KYUA 4ULWA 2Y3HA 2IYLD 4PFPA 4C3BA 4JCHA 1Z63A 4BJ6A 1MMGA 3T4RA 1PD1A 5CI9A 2M4EA 2CNWA 4E7SA 3SP1A 5KYUB 3AG1C 4LERA 2HV7A 2PX0A 3ABMC 3GODA 3KH2A 2CGEA 1BR4A 5DS5A 3DAGA 5EHHA 2WL8A 4KNVA 2H7OA 5E2QA 2EIMC 1TWCA 2WZLA 2PF4E 2J9VA 4U5BE 2IXOA 3EGXA 1TWAA 3Q6NA 1IZMA 2E87A 2J0WA 1ZHTA 5DLJA 1ZU4A 4YJWA 2Y3GA 2CDQA 2DYSC 2MYSA 1FFTC 1QZXA 2A68F 3CZ6A 5F5FA 2YEVA 3LJBA 3EGXB 3DD7A 1Z6AA 3DZAA 2DGJA 1NU9C 2R7UA 1TWHA 2MWQA 4J30B 1MMAA 3ABKC 2J7PD 2W9YA 3LESA 5KYNA 3K7DA 1VK5A 2HV6A 5HSWA 2J9WA 3AG4C 3ASOC 2WZGA 5B1AC 3T6BA 3SEOA 5DVWA 3W2VA 2W45A 3CQZA 4XLPF 4IAOA 4CS7A 3E70C 4MQ9F 4PFOA 2KJGA 1ZHWA 4O6YA 2ZXRA 2OCCC 4IJJA 2WB7A 4OIRF 2Y69C 4DVZA 2NUTA 3ASNC 4E7ZA 4GYTA 1ZHXA 2G62A 4HEAJ 2P7VA 2IOQA 5E3AA 2A6EF 4LACB 3FAJA 4HFFB 4ANJA 1PD0A 1QLEC 4O6MA 5EGYA 1FMVA 3W8IA 4BEJA 2P6VA 2V26A 1M56C 1TWGA 2NUTB 3F47A 2KNHA 3B0PA 4C3DA 3O39A 1BR1A 4LLEA 2W4MA 4G0HA 2YZSA 3K66A 2Q3TA 3I4UA 4CS8A 3DMDA 3LS1A 3L0IA 3UMKA 4JURI 1VMAA 3DJUB 1OKKD 1FTSA 2Q9CA 4U5FE 2B0JA 4CSAA 4YT2A 4BJ5C 1O87A 3UR3C 2EIJC 5IY5C 4ZLCA 1MMDA 5KYWA 3GANA 3X1OA 4CBEA 4OIQF 3K1HA 3Q7GA 2R7TA 4G7ZF 1VYKA 1ZHZA 4EWCA 3PMRA 4PJNA 1O5HA 3DAFA 5T3TA 4HFKB 2IXMA 3FDQA 3V7OA 3HLZA 5T3WA 2DYRC 4QI2A 1SMYF 4O7GA 4OINF 5KYWB 4U5HA 3QMKA 3VYWA 3JT1A 3S28A 3ABLC 2L9JA 1Z3IX 1NU7D 3WG7C 2XXAA 1BR2A 3F46A 1FFHA 2OG2A 2PFDA 1FMWA 3M1CB 3N24A 2EINC 2IXNA 3EG9A 4CS9A 2R7XA 3RKOF 1RJ9A 2G3VA 4PJLA 3B0VC 3FHDA 1PCXA 3EH1A 1MMNA 2XXAB 3NRHA 3NDBB 2L81A 2R7QA 2W4BA 3PHF2 2Y3DA 3EG9B 2XSEA 4PK4A 4OIPF 2WZFA 3OEOA 1VOMA 1RJ9B 3EPVA 1WGWA 2XRHA 1TKNA 3KMIA 2LSEA 3N2ZB 5KYYA 1J8MF 1Z5ZA 5DS6A 4U5CE 4WJ0A 1J8YF 2R7VA 4K0DA 3K1IC 4LLCA 4QI0A 3JSZA 3MLGA 5D92A 3ZSUA 4J32B 3JYHA 2R7SA 3ZIBA 4C7OA 3NYMA 3B0UX 2Y39A 3EQLF 1JPJA 3POVA 3KL4A 3OA1A 2H7BA 5KYYB 3DM5A 5L3VA 3QZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HE8 D;  4HEA J;  3RKO F; 
#chains in the Genus database with same CATH topology
 1YZA A;  3U8P A;  4JRZ A;  3JCU Q;  5E3C A;  2TMV P;  3ZG1 A;  4C7O B;  4IRU A;  2YHS A;  4I3M A;  3HJC A;  2WVO A;  1L7C A;  2I8B A;  3EFO A;  4G7H F;  3U2L A;  4DOZ A;  3TK0 A;  1S05 A;  3G4X A;  2GA0 A;  1UFB A;  4BJ6 C;  1FNT c;  1ZHY A;  1T6I A;  1KU2 A;  2R7W A;  4BJT A;  5E33 A;  2KW3 C;  2MHR A;  3NYL A;  5JUA A;  2YQY A;  4Q4Z F;  3ZQV A;  5DQT A;  3AG2 C;  2CW0 F;  1T6Q A;  1LE2 A;  5A6B A;  2RD9 A;  3AG3 C;  4XLN F;  2YVK A;  3NKD A;  2R25 A;  2PP4 A;  4G7O F;  1ORY A;  5COF A;  2HZ8 A;  1D1A A;  2WVQ A;  3L8J A;  3ECS A;  4JJF A;  2Q9A A;  1OCO C;  3TJ6 A;  3EFO B;  3IQ6 A;  4JEB A;  1VLS A;  2AU5 A;  4EUK B;  1Q0K A;  1LKX A;  4I1O B;  2XL4 A;  3AQC A;  4MTF A;  3B9Q A;  3SYN A;  5L0H A;  2H7V C;  4W8K A;  4U5D E;  4CX9 A;  4P9F A;  4DVY P;  3E9V A;  2P0N A;  1Q0F A;  2CNW D;  1H9G A;  2YKZ A;  4YWQ A;  3UGO A;  2LIG A;  4OD5 A;  1AEP A;  5CI8 A;  3TOM A;  3V5Y A;  2BE5 F;  3ZQY A;  3RIP A;  2G3K A;  4O6N A;  2J7P A;  4CIH A;  3ZTZ A;  3GM2 A;  4LDK A;  1LS4 A;  2A0U A;  4AE4 A;  1F1M A;  4MND A;  2Q9B A;  1YAR O;  1SF8 A;  3DE8 A;  3HTK C;  2A6H F;  1JPN A;  3UMH A;  3NKE A;  3M4C A;  4YT8 A;  2EIL C;  1Y4C A;  2HFI A;  3O6X A;  3QVY A;  1NFN A;  3NMK A;  3KKB A;  4MVM A;  3S29 A;  1D0X A;  4JTD B;  5L0F A;  3U0C A;  2H8A A;  1H9T A;  1TR2 A;  4JKV A;  4Q5S F;  1QPU A;  4JW1 A;  1VB5 A;  4YL1 A;  4AL1 A;  1LVK A;  4NTA A;  1LI5 A;  3A9C A;  2GDC A;  3W8H A;  4AE4 B;  1WAS A;  1NLX A;  4K7B A;  5K0I A;  1T9K A;  3EHM A;  1D1B A;  4OD4 A;  2GFH A;  4YT5 A;  3U3B A;  1ST6 A;  3LLI A;  1OR2 A;  3H65 A;  3HNJ A;  3LLK A;  2VB6 A;  2JD3 A;  3L34 A;  1DOV A;  4KBL A;  2V3C C;  3ITF A;  1JRA A;  3AQB A;  1WWP A;  3J06 A;  1L3P A;  2ASR A;  1LS1 A;  2P61 A;  1N1C A;  3PCV A;  3QW1 A;  2QLA A;  2XLE A;  4H54 A;  4IB4 A;  4ONS A;  3RVY A;  4H4K C;  3S27 A;  3VM6 A;  3R7C A;  1D0Z A;  2FFH A;  3WAQ A;  3T9O A;  2ICW G;  3SXY A;  3S84 A;  4JC7 A;  5T1D B;  3DKA A;  2QUP A;  1APC A;  1G8X A;  4NTF A;  4PR9 A;  4PJM A;  3IHU A;  4K1O A;  3I5P A;  2L6H A;  3EGD A;  4M63 A;  2C04 A;  1I4Z A;  3H2V A;  3SZR A;  1LPE A;  2QE9 A;  1AVO B;  1QQ3 A;  3IEE A;  3VF0 A;  2Q00 A;  5FCL A;  1OKK A;  2ZXP A;  3LS0 A;  2FGY A;  3JYY A;  2BC5 A;  3G50 A;  2R7O A;  3CSK A;  2C03 A;  1V55 C;  1YJG A;  1ZYR F;  2YL0 A;  3V5X A;  3RQF A;  3DE9 A;  3EGD B;  4IWB A;  4O79 A;  2WVN A;  1D1C A;  1MQV A;  1FAP B;  1XZQ A;  2ZPA A;  1HMO A;  4G78 A;  1XWJ A;  2M64 A;  3AGT A;  1OR3 A;  3EZH A;  4XWJ A;  2FAP B;  2J9B A;  4PJJ A;  2LQG A;  1NBB A;  1TFK B;  1A0B A;  1HE1 A;  1W2W A;  2J46 A;  4CS8 C;  5JRA A;  4BJ1 A;  1VYI A;  3GEI A;  3Q7L A;  2R7R A;  1C03 A;  3C8G A;  4ZLD A;  4XEF A;  2YL3 A;  4U5E E;  3FVY A;  2QY9 A;  3GM3 A;  3LNR A;  3N0T A;  5B1B C;  2NUP A;  4BJ5 A;  3PDM P;  2LFD A;  4MTO A;  3EJN A;  3JRT A;  3DM9 B;  2KQ9 A;  4RDA A;  4KNW A;  4MW8 A;  2EPO A;  4E0H A;  1G4U S;  2A69 F;  2HMQ A;  1M2V A;  4FX5 A;  3ZVR A;  4CSA C;  1GGQ A;  1V4A A;  4EBB A;  2D4U A;  4F4B A;  3FOP A;  1E86 A;  4N06 A;  3JTL O;  3T6J A;  1SZI A;  3K6B A;  4Q7C A;  4HE8 D;  5D91 A;  3C8G B;  1LM3 B;  1MND A;  3C63 A;  2NUP B;  4EHP A;  2XS8 A;  3CAX A;  4BG0 A;  3SXZ A;  3AOU A;  2B0H A;  5KYX A;  1BDJ B;  1R5I D;  1LE4 A;  3Q6M A;  3U3F A;  3OWT A;  2CCY A;  2QNL A;  1M2V B;  1YDI A;  3NG1 A;  4FES A;  2XLM A;  1OCC C;  4I1M A;  3EZI A;  3C62 A;  3TQO A;  2KC3 A;  2EPM X;  3IQ5 A;  1ZU5 A;  3RH3 A;  2YLG A;  3UNG C;  1MNE A;  2QTV A;  3GOR A;  1RKC A;  2OQM A;  3W2W A;  4N4W A;  3I5Q A;  4X0R A;  5F5H A;  2J9U A;  4A2N B;  5BUO A;  2ZD9 A;  1YZC A;  2YL1 A;  4OIO F;  4AK9 A;  4NY3 A;  3UGP A;  1IW7 F;  2LCH A;  4DBQ A;  4GEH A;  2NG1 A;  4KC9 A;  4JZA A;  5KYX B;  4XLP F;  2GWW A;  1YYJ A;  2Y3B A;  256B A;  4U9E A;  2HMZ A;  3RF3 A;  1OCZ C;  3S0X A;  1M2O A;  4XEK A;  1HW2 A;  2EIK C;  3L8I A;  4CS9 C;  2HJM A;  1OCR C;  3MYI A;  4ULV A;  3ZC4 A;  3QTH A;  4U5G A;  4ER9 A;  1NG1 A;  5L0I A;  2VC9 A;  3SNH A;  1RKE A;  3GEH A;  2O9X A;  3TD7 A;  1OXB A;  4RD9 A;  5AC4 A;  4DRJ B;  4RBN A;  1EQ1 A;  4EIY A;  1NZE A;  4QDL A;  3KPH A;  2AWC A;  2IXP A;  1CGO A;  4YL3 A;  2P1A A;  1RXQ A;  4NQF A;  3WHN A;  5L0J A;  2PX3 A;  4LDR A;  3UMI A;  4BPM A;  1SYQ A;  2R02 A;  2D5R B;  2ZXW C;  4P6I C;  3B71 A;  4MVZ A;  3MX3 A;  2HSQ A;  3K33 A;  3WOD F;  4EKW A;  1S7Z A;  1RKE B;  2NSF A;  1M57 C;  4KI2 A;  4I44 A;  3DJN B;  4AX2 A;  3X2Q C;  3T6G B;  2OJE D;  3DXJ F;  3M15 A;  4YN0 B;  1HY5 A;  3ATP A;  2KGO A;  4FWV A;  5DS4 A;  4MVR A;  2X51 A;  2J0X A;  4C3E A;  5JT4 A;  3LEV A;  3NYJ A;  2GAQ A;  2ETS A;  3K1I A;  5DQZ A;  2AVK A;  1A41 A;  4CDY A;  3RFY A;  2VH3 A;  2ZXO A;  3EHN A;  1V54 C;  2XM0 A;  3LAY A;  4JJG A;  3IQC A;  3O10 A;  3RYL A;  3TUL A;  1Z23 A;  5JSL A;  2J45 A;  2XLH A;  1EI7 A;  2LP4 A;  2XLW A;  3GM1 A;  3LUT B;  3VAY A;  4DBR A;  1RCP A;  2VAS A;  1HW1 A;  4MVQ A;  1ZW2 A;  4AL0 A;  5L3Q A;  2VCA A;  1OW7 A;  2EPK X;  3FXH A;  4JVS A;  1BZ4 A;  4MVU A;  5L0C A;  3SXK A;  1D0Y A;  2AWY A;  3EH2 A;  4XTK A;  1A7E A;  2A1D D;  2OEV A;  2Z15 A;  4B6I A;  3ZTM A;  4JE9 A;  3C8Z A;  4MVS A;  5KYU A;  4ULW A;  2Y3H A;  4FAP B;  2VCC A;  1RMV A;  2OJQ A;  2IYL D;  2UUH A;  4PFP A;  4C3B A;  4JCH A;  1Z63 A;  3U9M A;  4BJ6 A;  1WOL A;  1MMG A;  1UG7 A;  2LFF A;  3T4R A;  1PD1 A;  5F28 E;  2YWA A;  5CI9 A;  2M4E A;  2UUI A;  2AP3 A;  2CNW A;  5JP7 A;  1WTY A;  4E7S A;  3SP1 A;  5KYU B;  3AG1 C;  1LIH A;  1Q0M A;  1G5Z A;  2R03 A;  4LER A;  3U9J A;  2HV7 A;  2PX0 A;  1C17 M;  3ABM C;  1T5O A;  3GOD A;  3KH2 A;  2CGE A;  4Z9H A;  1BR4 A;  2XLV A;  5DS5 A;  2OKU A;  2YLD A;  4EBJ A;  3DAG A;  5EHH A;  2WL8 A;  4MS2 A;  4XQ1 A;  3TOL A;  4KNV A;  2H7O A;  2HS5 A;  2EIM C;  5E2Q A;  1QKR A;  3A11 A;  1E2X A;  1TWC A;  2WZL A;  1E85 A;  3RW0 A;  1GQA A;  2PF4 E;  2Q4F A;  5BQH A;  2J9V A;  5COG A;  4EBK A;  4U5B E;  2IXO A;  3EGX A;  1TWA A;  2RSE B;  4MW3 A;  4YT4 A;  3Q6N A;  1HE9 A;  2L6F A;  5CIV A;  1IZM A;  2E87 A;  4J7Y A;  4WGY A;  5A6B D;  1ORJ A;  1WN0 A;  2J0W A;  4U9D A;  1R4T A;  1ZHT A;  5DLJ A;  5EK0 A;  1ZU4 A;  5L0G A;  4YJW A;  1K40 A;  2Y3G A;  2CDQ A;  2PBE A;  2DYS C;  3GWL A;  2MYS A;  1FFT C;  1YA9 A;  1A7D A;  3ZDL A;  1QZX A;  3FOO A;  3KYJ A;  2A68 F;  2JX0 A;  3CZ6 A;  3HNK A;  2YEV A;  3LJB A;  3EGX B;  4IAR A;  5F5F A;  2XLD A;  3R2P A;  3DD7 A;  1Z6A A;  2XL6 A;  3DZA A;  4IGG A;  2DGJ A;  5A6J A;  1AUE A;  1NU9 C;  3NMJ A;  2R7U A;  4CIP A;  1TWH A;  3M79 A;  1YVI A;  1EA8 A;  2MWQ A;  3IPM O;  3MBG A;  1MMA A;  3ABK C;  4J30 B;  4MTG A;  4YL0 A;  1O3U A;  2J7P D;  2W9Y A;  5L0D A;  3LES A;  5KYN A;  3K7D A;  1I5N A;  1K05 A;  1VK5 A;  1V74 B;  2HV6 A;  1Y6D A;  1YA7 O;  5BQG A;  4NCQ A;  5HSW A;  2J9W A;  1JMW A;  3AG4 C;  3ASO C;  2WZG A;  3ZWI A;  5B1A C;  3T6B A;  4JTA B;  5DVW A;  3SEO A;  3W2V A;  4JTC B;  1G4W R;  1TQG A;  2W45 A;  3CQZ A;  1ZVZ A;  4IAO A;  1ORS C;  3JRM O;  1VLT A;  2YL7 A;  3E70 C;  4L6R A;  4MQ9 F;  4PFO A;  4CS7 A;  1B68 A;  5A6A A;  2KJG A;  1ZHW A;  4O6Y A;  1T6U A;  4CJO A;  1H6G A;  2ZXR A;  3M4B A;  2OCC C;  4IJJ A;  2WB7 A;  1FR0 A;  4OIR F;  1CPQ A;  2Y69 C;  4DVZ A;  1GM5 A;  1OXK A;  3HNI A;  2NUT A;  3ASN C;  4E7Z A;  1EKY A;  3C7J A;  4GYT A;  1ZHX A;  2G62 A;  4HEA J;  3S9O A;  1YYX A;  2P7V A;  2IOQ A;  3BEH A;  1KTM A;  3GEE A;  4XEV A;  2LD6 A;  2A6E F;  5E3A A;  4LAC B;  3JSE O;  3FAJ A;  4HFF B;  3GWN A;  4ANJ A;  1OQC A;  2IBF A;  1PD0 A;  1QLE C;  2KK1 A;  4JEA A;  4O6M A;  5EGY A;  2JPU A;  1FMV A;  1A7V A;  3W8I A;  3FAP B;  4IAQ A;  3RVZ A;  1DOW A;  3HNL A;  4NC3 A;  4BEJ A;  2P6V A;  1U89 A;  2V26 A;  1M56 C;  1TWG A;  2NUT B;  3FMS A;  3RQE A;  4D4N A;  3F47 A;  4DXW A;  2KNH A;  3B0P A;  4C3D A;  3G4Z A;  2I15 A;  3O39 A;  1BR1 A;  4LLE A;  1GS9 A;  2EPL X;  3MFN A;  3U5S A;  2W4M A;  4G0H A;  2KSF A;  3B29 A;  4PAC A;  2YZS A;  4CJG A;  2A0B A;  3K66 A;  3LEO A;  2Q3T A;  4XPX A;  3I4U A;  1OW8 A;  2IM8 A;  4CS8 A;  3DMD A;  2NPU A;  2XS1 A;  1YAU O;  3LS1 A;  4XPY A;  3L0I A;  5AC5 A;  4E18 A;  3UMK A;  3QVZ A;  5HV9 A;  3V5Z A;  4JUR I;  1VMA A;  3DJU B;  1OKK D;  1FTS A;  2Q9C A;  5TJ5 E;  4U5F E;  2B0J A;  1YLM A;  3TJ5 A;  4YT2 A;  4CSA A;  4BJ5 C;  1WAT A;  1NSG B;  2R9R B;  1O87 A;  5JVE A;  1HMD A;  5FZT A;  3UR3 C;  2EIJ C;  5IY5 C;  4ZLC A;  1MMD A;  5JS5 A;  5KYW A;  5AGF A;  4XPW A;  3GAN A;  4N6H A;  3X1O A;  4CBE A;  4OIQ F;  4GQH A;  3K1H A;  5COM A;  3Q7G A;  2R7T A;  4G7Z F;  1VYK A;  3BRJ A;  2XL8 A;  1ZHZ A;  4EWC A;  5JLI A;  3PMR A;  4PJN A;  1O5H A;  3C8G D;  3DAF A;  4WGZ A;  2L6G A;  5T3T A;  3U2M A;  3AGU A;  4HFK B;  2IXM A;  2R05 A;  3SXM A;  3HLZ A;  5T3W A;  2DYR C;  1JAF A;  3V7O A;  3FDQ A;  4QI2 A;  1SMY F;  4J7T A;  3IQT A;  4O7G A;  4OIN F;  1LI7 A;  2VCB A;  2BL2 A;  5KYW B;  4BEM J;  4U5H A;  5A6K A;  3QMK A;  1CGM E;  3VYW A;  3JT1 A;  4UDV A;  1ZW3 A;  3KYI A;  3S28 A;  1SR2 A;  3ABL C;  2L9J A;  3JZ0 A;  1Z3I X;  2YRF A;  4R32 A;  4D4X A;  1CPR A;  2OEX A;  1JOG A;  3VRC A;  2EPN A;  1NU7 D;  4YK5 A;  3WG7 C;  4CDA A;  2XXA A;  2Q7R A;  5B3S C;  3MYF A;  1BR2 A;  2XLO A;  4JCZ A;  4DJ9 A;  4E17 A;  1TFO B;  3F46 A;  1FFH A;  4P9T A;  2OG2 A;  2PFD A;  1FMW A;  2YLI A;  3M1C B;  3N24 A;  3O55 A;  2EIN C;  1QSP A;  3AJM A;  2IXN A;  3EG9 A;  4LDQ A;  2DB4 A;  1Z7Q c;  4CS9 A;  2R7X A;  3H2U A;  3RKO F;  1VTM P;  1RJ9 A;  1ZZP A;  2XM4 A;  2X0C A;  2G3V A;  2L7A A;  4WAB A;  5GPG B;  1Q0G A;  4PJL A;  3B0V C;  3FHD A;  1PCX A;  3EH1 A;  1MMN A;  4CDV A;  4JIO A;  2XXA B;  3C18 A;  3NRH A;  3NDB B;  2L81 A;  5A69 A;  1NFO A;  2R7Q A;  1KNY A;  2W4B A;  4Z9I A;  3PHF 2;  1CGN A;  2Y3D A;  3NMI A;  3CEX A;  3EG9 B;  1OW6 A;  2XSE A;  1C02 A;  4PK4 A;  4OIP F;  2WZF A;  1QVX A;  3OEO A;  1VOM A;  3DI5 A;  1RJ9 B;  2KYH A;  2HUJ A;  3EPV A;  1M6T A;  1WGW A;  2CYD A;  3L1M A;  1H7I A;  4A4A A;  1U6H A;  2XRH A;  1TKN A;  1K04 A;  4MVO A;  4Z9J A;  2LK4 A;  1BBH A;  2LSE A;  2HJ3 A;  3DWW A;  3KMI A;  5B3I A;  1XZP A;  3U8V A;  4E0I A;  2PNO A;  3N2Z B;  3LNM B;  3US6 A;  1Q0D A;  5KYY A;  1J8M F;  1Z5Z A;  5DS6 A;  4U5C E;  4WJ0 A;  1J8Y F;  2R7V A;  3RQG A;  4K0D A;  4DRI B;  3QW0 A;  3HKK A;  3K1I C;  4LLC A;  4QI0 A;  3JSZ A;  3MLG A;  5BQI A;  5D92 A;  3ZSU A;  4N6C A;  1U0B B;  4J32 B;  3JYH A;  3W4Y A;  3ZIB A;  2R7S A;  4C7O A;  2HSB A;  3NYM A;  2J8W A;  4NTB A;  3B0U X;  2Y39 A;  3EQL F;  4DRH B;  2DI3 A;  2HKV A;  4W8P A;  1JR8 A;  2OU6 A;  1T01 A;  3S90 A;  1JPJ A;  3POV A;  3KL4 A;  3OA1 A;  2H7B A;  5KYY B;  2NSG A;  1E83 A;  2F22 A;  2OOC A;  1I4Y A;  1PV3 A;  3DM5 A;  5L3V A;  3QZC A;  1E84 A; 
#chains in the Genus database with same CATH homology
 3JCU Q;  5E3C A;  3ZG1 A;  4C7O B;  4IRU A;  2YHS A;  4I3M A;  3HJC A;  2WVO A;  2I8B A;  3EFO A;  4G7H F;  4DOZ A;  4BJ6 C;  1ZHY A;  1KU2 A;  2R7W A;  4BJT A;  5E33 A;  2KW3 C;  3NYL A;  4Q4Z F;  5DQT A;  3AG2 C;  2CW0 F;  3AG3 C;  4XLN F;  3NKD A;  2PP4 A;  4G7O F;  2WVQ A;  1D1A A;  3ECS A;  4JJF A;  2Q9A A;  1OCO C;  3EFO B;  1LKX A;  4I1O B;  2XL4 A;  3AQC A;  3B9Q A;  3SYN A;  2H7V C;  4W8K A;  4U5D E;  4DVY P;  3E9V A;  2CNW D;  4YWQ A;  3UGO A;  4OD5 A;  5CI8 A;  2BE5 F;  3RIP A;  2G3K A;  4O6N A;  2J7P A;  4CIH A;  4AE4 A;  4MND A;  2Q9B A;  1SF8 A;  3HTK C;  2A6H F;  1JPN A;  3UMH A;  3NKE A;  4YT8 A;  2EIL C;  3O6X A;  3KKB A;  3S29 A;  1D0X A;  1TR2 A;  4Q5S F;  4JW1 A;  1LVK A;  4AE4 B;  3W8H A;  4K7B A;  3EHM A;  1D1B A;  4OD4 A;  2GFH A;  4YT5 A;  1ST6 A;  3LLI A;  3H65 A;  3LLK A;  2VB6 A;  2JD3 A;  3L34 A;  4KBL A;  2V3C C;  3ITF A;  3AQB A;  1LS1 A;  1N1C A;  4H4K C;  3S27 A;  1D0Z A;  2FFH A;  5T1D B;  1G8X A;  4PJM A;  3I5P A;  3EGD A;  4M63 A;  2C04 A;  3SZR A;  3IEE A;  5FCL A;  1OKK A;  2ZXP A;  3LS0 A;  2FGY A;  2R7O A;  3CSK A;  2C03 A;  1V55 C;  1ZYR F;  3EGD B;  4IWB A;  4O79 A;  2WVN A;  1D1C A;  2ZPA A;  3EZH A;  4XWJ A;  4PJJ A;  1W2W A;  2J46 A;  4CS8 C;  4BJ1 A;  1VYI A;  2R7R A;  3Q7L A;  4ZLD A;  4U5E E;  3FVY A;  2QY9 A;  3LNR A;  3N0T A;  5B1B C;  2NUP A;  4BJ5 A;  3EJN A;  3JRT A;  3DM9 B;  2KQ9 A;  4RDA A;  4KNW A;  2A69 F;  1M2V A;  4FX5 A;  3ZVR A;  4CSA C;  4EBB A;  4F4B A;  4N06 A;  3T6J A;  1SZI A;  3K6B A;  4Q7C A;  4HE8 D;  5D91 A;  1MND A;  2NUP B;  4BG0 A;  5KYX A;  3Q6M A;  3OWT A;  3NG1 A;  1M2V B;  4FES A;  1OCC C;  4I1M A;  3EZI A;  3RH3 A;  1ZU5 A;  3UNG C;  1MNE A;  2QTV A;  5B3S C;  3W2W A;  4X0R A;  3I5Q A;  5F5H A;  4A2N B;  2J9U A;  5BUO A;  4OIO F;  4AK9 A;  4NY3 A;  3UGP A;  1IW7 F;  4DBQ A;  4GEH A;  2NG1 A;  4KC9 A;  4JZA A;  5KYX B;  2Y3B A;  1OCZ C;  3S0X A;  1M2O A;  2EIK C;  4CS9 C;  1OCR C;  3ZC4 A;  4U5G A;  1NG1 A;  3SNH A;  2O9X A;  3TD7 A;  4RD9 A;  4RBN A;  4YT4 A;  1NZE A;  4QDL A;  2IXP A;  2PX3 A;  3UMI A;  2D5R B;  2ZXW C;  4P6I C;  3MX3 A;  3K33 A;  3WOD F;  1S7Z A;  4KI2 A;  1M57 C;  4I44 A;  3DJN B;  4AX2 A;  3X2Q C;  3DXJ F;  4YN0 B;  2KGO A;  4FWV A;  5DS4 A;  2X51 A;  2J0X A;  4C3E A;  3LEV A;  3NYJ A;  5DQZ A;  3RFY A;  2VH3 A;  2ZXO A;  3EHN A;  1V54 C;  3LAY A;  4JJG A;  3RYL A;  1Z23 A;  2J45 A;  3VAY A;  4DBR A;  2VAS A;  5L3Q A;  4JVS A;  1D0Y A;  4XTK A;  3EH2 A;  2A1D D;  2Z15 A;  4B6I A;  5KYU A;  4ULW A;  2Y3H A;  2IYL D;  4PFP A;  4C3B A;  4JCH A;  1Z63 A;  4BJ6 A;  1MMG A;  3T4R A;  1PD1 A;  5CI9 A;  2M4E A;  2CNW A;  4E7S A;  3SP1 A;  5KYU B;  3AG1 C;  4LER A;  2HV7 A;  2PX0 A;  3ABM C;  3GOD A;  3KH2 A;  2CGE A;  1BR4 A;  5DS5 A;  3DAG A;  5EHH A;  2WL8 A;  4KNV A;  2H7O A;  5E2Q A;  2EIM C;  1TWC A;  2WZL A;  2PF4 E;  2J9V A;  4U5B E;  2IXO A;  3EGX A;  1TWA A;  3Q6N A;  1IZM A;  2E87 A;  2J0W A;  1ZHT A;  5DLJ A;  1ZU4 A;  4YJW A;  2Y3G A;  2CDQ A;  2DYS C;  2MYS A;  1FFT C;  1QZX A;  2A68 F;  3CZ6 A;  5F5F A;  2YEV A;  3LJB A;  3EGX B;  3DD7 A;  1Z6A A;  3DZA A;  2DGJ A;  1NU9 C;  2R7U A;  1TWH A;  2MWQ A;  4J30 B;  1MMA A;  3ABK C;  2J7P D;  2W9Y A;  3LES A;  5KYN A;  3K7D A;  1VK5 A;  2HV6 A;  5HSW A;  2J9W A;  3AG4 C;  3ASO C;  2WZG A;  5B1A C;  3T6B A;  3SEO A;  5DVW A;  3W2V A;  2W45 A;  3CQZ A;  4XLP F;  4IAO A;  4CS7 A;  3E70 C;  4MQ9 F;  4PFO A;  2KJG A;  1ZHW A;  4O6Y A;  2ZXR A;  2OCC C;  4IJJ A;  2WB7 A;  4OIR F;  2Y69 C;  4DVZ A;  2NUT A;  3ASN C;  4E7Z A;  4GYT A;  1ZHX A;  2G62 A;  4HEA J;  2P7V A;  2IOQ A;  5E3A A;  2A6E F;  4LAC B;  3FAJ A;  4HFF B;  4ANJ A;  1PD0 A;  1QLE C;  4O6M A;  5EGY A;  1FMV A;  3W8I A;  4BEJ A;  2P6V A;  2V26 A;  1M56 C;  1TWG A;  2NUT B;  3F47 A;  2KNH A;  3B0P A;  4C3D A;  3O39 A;  1BR1 A;  4LLE A;  2W4M A;  4G0H A;  2YZS A;  3K66 A;  2Q3T A;  3I4U A;  4CS8 A;  3DMD A;  3LS1 A;  3L0I A;  3UMK A;  4JUR I;  1VMA A;  3DJU B;  1OKK D;  1FTS A;  2Q9C A;  4U5F E;  2B0J A;  4CSA A;  4YT2 A;  4BJ5 C;  1O87 A;  3UR3 C;  2EIJ C;  5IY5 C;  4ZLC A;  1MMD A;  5KYW A;  3GAN A;  3X1O A;  4CBE A;  4OIQ F;  3K1H A;  3Q7G A;  2R7T A;  4G7Z F;  1VYK A;  1ZHZ A;  4EWC A;  3PMR A;  4PJN A;  1O5H A;  3DAF A;  5T3T A;  4HFK B;  2IXM A;  3FDQ A;  3V7O A;  3HLZ A;  5T3W A;  2DYR C;  4QI2 A;  1SMY F;  4O7G A;  4OIN F;  5KYW B;  4U5H A;  3QMK A;  3VYW A;  3JT1 A;  3S28 A;  3ABL C;  2L9J A;  1Z3I X;  1NU7 D;  3WG7 C;  2XXA A;  1BR2 A;  3F46 A;  1FFH A;  2OG2 A;  2PFD A;  1FMW A;  3M1C B;  3N24 A;  2EIN C;  2IXN A;  3EG9 A;  4CS9 A;  2R7X A;  3RKO F;  1RJ9 A;  2G3V A;  4PJL A;  3B0V C;  3FHD A;  1PCX A;  3EH1 A;  1MMN A;  2XXA B;  3NRH A;  3NDB B;  2L81 A;  2R7Q A;  2W4B A;  3PHF 2;  2Y3D A;  3EG9 B;  2XSE A;  4PK4 A;  4OIP F;  2WZF A;  3OEO A;  1VOM A;  1RJ9 B;  3EPV A;  1WGW A;  2XRH A;  1TKN A;  3KMI A;  2LSE A;  3N2Z B;  5KYY A;  1J8M F;  1Z5Z A;  5DS6 A;  4U5C E;  4WJ0 A;  1J8Y F;  2R7V A;  4K0D A;  3K1I C;  4LLC A;  4QI0 A;  3JSZ A;  3MLG A;  5D92 A;  3ZSU A;  4J32 B;  3JYH A;  2R7S A;  3ZIB A;  4C7O A;  3NYM A;  3B0U X;  2Y39 A;  3EQL F;  1JPJ A;  3POV A;  3KL4 A;  3OA1 A;  2H7B A;  5KYY B;  3DM5 A;  5L3V A;  3QZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...