4HE8D

Crystal structure of the membrane domain of respiratory complex i from thermus thermophilus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
160
structure length
160
Chain Sequence
MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGEIGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase subunit 7
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 160
sequence length 160
chains with identical sequence J
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00499 Oxidored_q3 NADH-ubiquinone/plastoquinone oxidoreductase chain 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1200 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4he8D00
3RKOF 4HEAJ 4HE8D
chains in the Genus database with same CATH superfamily
2R7VA 4D4XA 2OJQA 2R7WA 3ASNC 2EIMC 3H65A 3EG9B 3DKAA 3ABLC 4ER9A 4LDRA 1NZEA 3GODA 3S84A 2ZXOA 4A2NB 3ZVRA 4DBQA 1ZYRF 5COFA 4D4NA 1GS9A 1WTYA 4B6IA 2Q9BA 2J0WA 3LLIA 5L0CA 4Z9HA 3DE8A 3RQFA 4AX2A 1L3PA 1YJGA 1R5ID 2H7BA 2EIJC 2YKZA 4ZLDA 1LS4A 1BR1A 2ZPAA 2GWWA 2XLEA 3PCVA 2VCCA 2LSEA 1UG7A 1V55C 1MQVA 2CNWD 3O6XA 1HE9A 1EI7A 1T5OA 1JAFA 1YYXA 2P6VA 2XLVA 4XPYA 4PJNA 4G0HA 3ZQVA 1Q0KA 3BRJA 4PFOA 4QI0A 4P6IC 4YL0A 3ABMC 3UR3C 1AEPA 4JCHA 1YARO 3FXHA 3PDMP 1KU2A 1Y4CA 1Z6AA 2W4BA 2A0UA 4NCQA 3K1IA 4GYTA 1UFBA 4BJTA 3FAPB 5T3WA 2YL0A 2OEVA 2P0NA 3UMHA 1VTMP 3AQBA 3CAXA 1V54C 1FTSA 1LM3B 1Z23A 2R03A 4J7TA 1LE4A 1MNEA 3R2PA 1NU7D 4CJGA 4RBNA 1QQ3A 1CPRA 3FOPA 3VF0A 4BEMJ 2NSGA 3WAQA 4AE4A 3DAGA 1M2VB 3LLKA 5A6JA 2C03A 2Y3GA 4MW8A 2JPUA 4MTOA 1EKYA 2A68F 1TWCA 2EPKX 2J9WA 3S29A 3SNHA 3L8JA 3TOLA 2V3CC 4ZLCA 3IQ5A 4I1OB 2B0HA 2H7VC 2XLDA 1OR3A 1HW2A 3LNRA 1VOMA 2XS1A 5KYWB 2VH3A 2YVKA 4C3EA 4RD9A 4CSAA 4EKWA 2HKVA 5T3TA 4JCZA 2EPLX 3C62A 3EG9A 2ZXPA 1A41A 3H2UA 3DM5A 3EGDB 4E17A 2PF4E 1ZU4A 1OXKA 1V74B 3DXJF 2IXOA 4IARA 4MNDA 1G5ZA 5BQIA 1K40A 1FFHA 3A11A 3IHUA 2E87A 1RKEB 2I8BA 2L6FA 2NSFA 1SZIA 2KJGA 2GDCA 3OA1A 4QI2A 2DYRC 1OCZC 1D0YA 3K6BA 2EPMX 4QDLA 3LUTB 2A69F 4YL1A 3CSKA 4U5CE 4BEJA 5L3QA 3NKDA 3GM1A 2XL8A 2G62A 2OU6A 3AG4C 3SP1A 3C8GB 1LIHA 2YL1A 2VASA 2RD9A 3ABKC 2L6GA 5COGA 3U9MA 1DOVA 4Q5SF 1PD0A 2F22A 2J45A 5JUAA 4JTDB 3C63A 2OEXA 1OR2A 2KGOA 2DI3A 3DM9B 1Q0MA 1NG1A 2YZSA 4BJ5C 4CS9C 4XEVA 5L0GA 2ZXRA 3RIPA 2G3VA 1C02A 4DBRA 1O3UA 3FHDA 4NY3A 2XLMA 1OW6A 4H4KC 2L81A 4PJLA 5F28E 4EBBA 1NFOA 5BUOA 4JW1A 1WWPA 3AG1C 2MHRA 1APCA 4X0RA 5L0DA 4JURI 3C7JA 3U0CA 2HV6A 4FX5A 1MMGA 1I5NA 1D0XA 3B0VC 3HKKA 1I4ZA 2VCBA 3JRMO 3LESA 2PFDA 4M63A 1LPEA 2BE5F 1A7DA 4U9DA 2R7SA 4CIPA 5JLIA 1M56C 2YQYA 2QTVA 1M2VA 1ST6A 3G4ZA 3T6BA 3RQEA 4AL0A 3EZIA 4RDAA 2WZGA 3I4UA 5CI9A 3RVYA 4MTGA 1LI5A 1NLXA 3L34A 1RJ9A 1Q0DA 3HLZA 4PK4A 2UUHA 3U8VA 2KC3A 1K04A 1SMYF 4AK9A 4HE8D 2XLWA 1ORJA 3DWWA 3LS0A 3M4BA 3NMKA 3TOMA 3W8IA 4AE4B 3O10A 3W8HA 1IZMA 5L0HA 4MVQA 1OXBA 3BEHA 5COMA 3ZIBA 1D1CA 3EFOB 4KNWA 4MQ9F 3GANA 2XXAB 4U5DE 3M15A 2R7UA 5AC5A 1QSPA 2Q9AA 5D91A 5KYNA 1OCCC 1ZHTA 4MVMA 4ULVA 5JRAA 1H6GA 3S28A 1H9GA 2EILC 2L9JA 4CDAA 5JP7A 2CYDA 3AGUA 3VRCA 1NU9C 4U5EE 2CDQA 4LDQA 3ZTMA 4G7HF 4G7ZF 4OIPF 1O5HA 3NYMA 2D5RB 3EZHA 3U2MA 2WVQA 2HSQA 1JPJA 4J32B 4PJMA 5E2QA 5F5HA 2FAPB 2ZD9A 3Q6NA 3C8GA 4NQFA 3RH3A 4E0IA 4E18A 4MVOA 2WZLA 5L0JA 3RKOF 3MYFA 4DVZA 3GEEA 1MMNA 1KTMA 1PV3A 3RFYA 3AG2C 1CGOA 4G78A 3FAJA 4CS8A 3DZAA 4WJ0A 3M4CA 5HV9A 3HNKA 3H2VA 4W8KA 4YK5A 4IAOA 2YLIA 1T01A 2XRHA 2X0CA 4IJJA 4EBJA 4Z9JA 2KYHA 2CNWA 2OOCA 3FVYA 3QW0A 1MMAA 1OKKD 2IYLD 1GGQA 2J0XA 5BQHA 4CS9A 1N1CA 3R7CA 4DRHB 1D0ZA 3O55A 2PX3A 4H54A 3RYLA 4JJGA 1QVXA 4MVUA 4R32A 4U5HA 1Z5ZA 5L0IA 2YL3A 1Z3IX 1FMVA 3WG7C 3GM2A 3U3FA 2KSFA 1U89A 1C17M 3AQCA 4N06A 3JRTA 2NUPA 5FCLA 5L3VA 1XWJA 2IXNA 4XEFA 1S05A 1WGWA 1YZAA 3HNIA 1GQAA 4JEAA 3AOUA 3JT1A 4YWQA 3POVA 1CGNA 3MFNA 4JEBA 3T6JA 3QTHA 1QKRA 3KMIA 2X51A 1Q0FA 2L7AA 2I15A 1L7CA 4O6NA 4Z9IA 3TJ5A 2YLDA 1TWGA 1J8MF 4WGZA 3ZTZA 1GM5A 1HMOA 3K7DA 256BA 3HNJA 2AWCA 3EFOA 1RJ9B 2XS8A 2XXAA 3PMRA 4BJ6A 3UNGC 1TKNA 1VK5A 4JIOA 4NC3A 3RW0A 1S7ZA 4XLPF 1TFOB 1D1BA 2R7QA 3AG3C 3K66A 4EUKB 1MNDA 2LD6A 1TFKB 4HFFB 3K33A 3HJCA 4EWCA 3LNMB 4EIYA 3EH2A 3JSZA 2PBEA 2Q9CA 5JT4A 4O79A 5KYYB 2Y3HA 2IM8A 1QPUA 1OCOC 2NG1A 2KW3C 3FOOA 3NYLA 3QMKA 4J7YA 2ICWG 4DJ9A 4YT8A 3FDQA 5KYXB 2KK1A 3A9CA 2DB4A 3QW1A 1A7EA 1PD1A 2HMQA 3SXYA 2HMZA 5DS5A 2D4UA 2HUJA 3EHMA 1YYJA 1RKCA 1ZHZA 2MYSA 3V7OA 3DAFA 3IQTA 3NG1A 4BJ1A 4JJFA 4KC9A 1B68A 3DE9A 3B0UX 4ANJA 1WASA 2AP3A 1W2WA 2LP4A 1C03A 4YJWA 2NUTB 4Q4ZF 1HY5A 1VB5A 2PNOA 4MVZA 3GWNA 1VYKA 4N6HA 4DXWA 3EQLF 3B0PA 1JOGA 4YN0B 4XPWA 4JKVA 4JZAA 3LAYA 4ULWA 3RQGA 3NMIA 1Z7Qc 3SYNA 3U9JA 2M4EA 4K1OA 2GFHA 2V26A 4KI2A 4C3DA 5JS5A 3NMJA 2XLHA 4EHPA 2KQ9A 2R7OA 5L0FA 2A0BA 4IAQA 2HZ8A 3LEVA 1MMDA 5GPGB 2XSEA 2NUPB 2ETSA 4PJJA 3ZSUA 4CX9A 5A6KA 4LLCA 4Q7CA 3B29A 5DQTA 2CGEA 2AWYA 3S9OA 2IBFA 3L8IA 2Y3BA 2WZFA 5K0IA 3FMSA 4KNVA 3EH1A 2J9VA 3S27A 3ZQYA 2LCHA 3F46A 1G4WR 2AU5A 2ZXWC 2ASRA 1E84A 1OW8A 4XWJA 3L0IA 3US6A 4WGYA 1VLTA 1QZXA 3LEOA 3W2WA 2G3KA 2L6HA 1T6QA 1ZHYA 2M64A 3B71A 2YL7A 1SF8A 2OCCC 4U5FE 5EHHA 1RXQA 2EPNA 1E2XA 4FESA 1VMAA 4F4BA 2J9BA 1LVKA 3U2LA 3VM6A 2R02A 4OIRF 4YT4A 5JVEA 5KYYA 2OJED 4O7GA 5A6BD 2UUIA 4DRIB 3ASOC 4XEKA 3TJ6A 5KYXA 4CDVA 5EK0A 1V4AA 3AJMA 4O6MA 3VAYA 1AVOB 5DS6A 2H8AA 5AC4A 4IB4A 4JTCB 3DI5A 3F47A 2IXPA 3CEXA 2P7VA 2R7XA 3V5ZA 5B3SC 3TULA 4IWBA 3CQZA 3LJBA 2OKUA 5HSWA 2Z15A 4CBEA 2J7PD 3Q7LA 5A69A 3JYHA 3T9OA 4J30B 2LFDA 3KPHA 3NKEA 3IQ6A 4C3BA 1I4YA 2NUTA 4A4AA 1NSGB 4K0DA 3E70C 4MVSA 1WATA 3SEOA 3UMIA 1PCXA 1D1AA 5E3CA 4MTFA 1OKKA 1BBHA 4G7OF 5IY5C 3ITFA 3U5SA 2EPOA 4JC7A 4BG0A 4BJ5A 3PHF2 4P9FA 3X1OA 2VCAA 3DJNB 4NTFA 3UGPA 5A6AA 1OQCA 1O87A 3KH2A 3G50A 4XPXA 1A7VA 4L6RA 5FZTA 5TJ5E 3SXKA 3W4YA 4E0HA 3C8GD 1RMVA 4MS2A 3IPMO 4MVRA 2C04A 3TK0A 1BZ4A 3KL4A 5DVWA 3SXZA 3TQOA 3AGTA 3W2VA 1ZW3A 1ZHXA 2IXMA 3WHNA 2Q00A 2R05A 1JPNA 3ZG1A 1XZPA 2H7OA 5DQZA 1VLSA 1FMWA 2W45A 4U5BE 4AL1A 2OQMA 2LFFA 3MYIA 4LDKA 1E83A 2YWAA 3C8ZA 4DOZA 2R7RA 3S0XA 4KBLA 5KYUA 1LKXA 2PP4A 3EGXB 3RF3A 4IRUA 4OIQF 2FGYA 3E9VA 2LQGA 3K1HA 3CZ6A 3MBGA 3T6GB 1JRAA 2TMVP 3MX3A 3ZC4A 3I5QA 5CIVA 2Q7RA 1E85A 3QVYA 2VB6A 5B3IA 3JYYA 3NYJA 4PR9A 3UMKA 4DVYP 4I44A 4OIOF 4I1MA 3O39A 2P1AA 1HW1A 4JRZA 1BR2A 3KKBA 2YHSA 2AVKA 3TD7A 1K05A 1U6HA 2QE9A 2VC9A 4JVSA 1FR0A 4U9EA 1T6IA 1ZVZA 1RCPA 2GAQA 3EPVA 1Y6DA 1ORSC 1T6UA 1H7IA 2W9YA 2MWQA 2YLGA 3G4XA 3KYIA 1WN0A 3L1MA 4CS7A 2XLOA 1YA7O 2Q3TA 4P9TA 2LIGA 2HS5A 1FNTc 1F1MA 1LE2A 1SYQA 3GORA 5E3AA 1SR2A 4XQ1A 4O6YA 1LS1A 2IOQA 1CGME 4JTAB 4I3MA 1JMWA 3SZRA 1A0BA 2R7TA 3DJUB 1XZQA 3LS1A 4C7OA 5D92A 4JE9A 5B1BC 1M2OA 2R25A 3B9QA 1G4US 5CI8A 4GEHA 3VYWA 2BC5A 2HV7A 2J46A 4FAPB 3I5PA 5AGFA 2CW0F 3NRHA 2DYSC 1ZU5A 1U0BB 3DMDA 2WVNA 4U5GA 1LI7A 2BL2A 1BDJB 2QLAA 3EHNA 2HSBA 4XLNF 5BQGA 3QVZA 2RSEB 4DRJB 4NTBA 3UGOA 2A6HF 2Q4FA 4BPMA 4OD5A 1CPQA 4ONSA 4CS8C 3C18A 2NPUA 1H9TA 1YVIA 1YDIA 1TR2A 3GEIA 2QNLA 4CIHA 1ZW2A 1TWAA 2J9UA 2KNHA 2Y69C 4CDYA 3Q7GA 2YEVA 2J8WA 2XM4A 2XM0A 3M79A 2FFHA 3ZWIA 2OG2A 1OW7A 2WB7A 3OWTA 1ZHWA 3EGXA 2YRFA 1NBBA 3JSEO 1EQ1A 4CJOA 5F5FA 4FWVA 4E7ZA 3ZDLA 1Q0GA 4IGGA 5JSLA 1HE1A 1TWHA 4UDVA 3EJNA 4YT2A 1DOWA 2JD3A 2HJMA 5DLJA 3Q6MA 5KYUB 1FAPB 1JR8A 4OD4A 1IW7F 1G8XA 1YAUO 1T9KA 3JTLO 3K1IC 4HEAJ 2DGJA 3V5XA 3N24A 1QLEC 2CCYA 4LACB 2B0JA 3M1CB 5T1DB 4EBKA 1R4TA 1WOLA 5EGYA 4W8PA 3NDBB 3OEOA 3T4RA 1ZZPA 2O9XA 4NTAA 5A6BA 3MLGA 1YZCA 2R9RB 4N6CA 1BR4A 2QUPA 1NFNA 3N2ZB 4N4WA 4PFPA 2XL6A 4HFKB 4LERA 1YA9A 2HJ3A 1J8YF 3ATPA 4YL3A 1Z63A 4PACA 3GWLA 5B1AC 1ORYA 2EINC 1KNYA 3JCUQ 2HFIA 3S90A 2LK4A 3U3BA 3WODF 2EIKC 3GEHA 3HNLA 5DS4A 1VYIA 4WABA 4BJ6C 3N0TA 2WVOA 3HTKC 3KYJA 4MW3A 4YT5A 3V5YA 1E86A 2J7PA 2JX0A 3GM3A 4K7BA 3SXMA 5KYWA 1YLMA 1TQGA 3QZCA 4LLEA 3U8PA 4CSAC 1OCRC 2XL4A 2PX0A 3IQCA 2W4MA 3JZ0A 5E33A 1EA8A 4XTKA 1FFTC 4OINF 2WL8A 2GA0A 3ECSA 4GQHA 4E7SA 3EGDA 3IEEA 2Y39A 2Y3DA 1HMDA 3DD7A 1M6TA 1M57C 3X2QC 2P61A 4C7OB 2A6EF 1RKEA 2A1DD 3J06A 2QY9A 3RVZA 1AUEA
chains in the Genus database with same CATH topology
2R7VA 2R7WA 3ASNC 2EIMC 3H65A 3EG9B 3ABLC 1NZEA 3GODA 2ZXOA 4A2NB 3ZVRA 4DBQA 1ZYRF 4B6IA 2Q9BA 2J0WA 3LLIA 4AX2A 2H7BA 2EIJC 4ZLDA 2ZPAA 1BR1A 2LSEA 1V55C 2CNWD 3O6XA 2P6VA 1Z63A 4DVYP 4PJNA 4G0HA 4PFOA 4QI0A 4P6IC 3UR3C 3ABMC 4JCHA 1KU2A 1Z6AA 2W4BA 4GYTA 4BJTA 5T3WA 3UMHA 3AQBA 1V54C 1FTSA 1Z23A 1MNEA 1NU7D 4RBNA 4AE4A 3DAGA 1M2VB 3LLKA 2C03A 2Y3GA 2A68F 1TWCA 2J9WA 3S29A 3SNHA 2V3CC 4ZLCA 4I1OB 2H7VC 3LNRA 1VOMA 5KYWB 2VH3A 4C3EA 4CSAA 4RD9A 5T3TA 3EG9A 2ZXPA 3DM5A 3EGDB 2PF4E 1ZU4A 3DXJF 4MNDA 2IXOA 1FFHA 2E87A 2I8BA 1SZIA 2KJGA 3OA1A 4QI2A 2DYRC 1OCZC 1D0YA 4QDLA 4BEJA 5L3QA 2A69F 3CSKA 4U5CE 3NKDA 2G62A 3SP1A 3AG4C 2VASA 3ABKC 4Q5SF 1PD0A 2J45A 2KGOA 3DM9B 1NG1A 2YZSA 4BJ5C 4CS9C 2ZXRA 3RIPA 2G3VA 4DBRA 3FHDA 4NY3A 4H4KC 4PJLA 2L81A 4EBBA 5BUOA 4JW1A 3AG1C 4X0RA 4JURI 2HV6A 4FX5A 1MMGA 1D0XA 3B0VC 3LESA 4M63A 2PFDA 2BE5F 2R7SA 1M56C 2QTVA 1M2VA 1ST6A 3T6BA 3EZIA 4RDAA 2WZGA 3I4UA 5CI9A 3L34A 1RJ9A 3HLZA 4PK4A 1SMYF 4AK9A 4HE8D 3LS0A 4AE4B 3W8IA 3W8HA 1IZMA 3ZIBA 1D1CA 3EFOB 4KNWA 4MQ9F 3GANA 2XXAB 4U5DE 2R7UA 2Q9AA 5D91A 5KYNA 1OCCC 1ZHTA 3S28A 2EILC 2L9JA 1NU9C 4U5EE 2CDQA 4G7HF 4G7ZF 4OIPF 1O5HA 3NYMA 2D5RB 3EZHA 2WVQA 5E2QA 1JPJA 4J32B 4PJMA 5F5HA 3Q6NA 3RH3A 2WZLA 3RKOF 4DVZA 1MMNA 3RFYA 3AG2C 3FAJA 4CS8A 3DZAA 4WJ0A 4W8KA 4IAOA 2XRHA 4IJJA 2CNWA 3FVYA 1MMAA 1OKKD 2IYLD 2J0XA 4CS9A 1N1CA 1D0ZA 2PX3A 3RYLA 4JJGA 4U5HA 1Z5ZA 3WG7C 1Z3IX 1FMVA 3AQCA 4N06A 3JRTA 2NUPA 5FCLA 5L3VA 2IXNA 1WGWA 4YWQA 3POVA 3JT1A 3T6JA 3KMIA 2X51A 4O6NA 1TWGA 1J8MF 3K7DA 3EFOA 1RJ9B 2XXAA 3PMRA 4BJ6A 3UNGC 1TKNA 1VK5A 1S7ZA 4XLPF 2R7QA 1D1BA 3AG3C 3K66A 1MNDA 4HFFB 3K33A 3HJCA 4EWCA 3EH2A 3JSZA 2Q9CA 4O79A 5KYYB 2Y3HA 2NG1A 3NYLA 1OCOC 3QMKA 2KW3C 4YT8A 3FDQA 5KYXB 1PD1A 5DS5A 3EHMA 1ZHZA 2MYSA 3V7OA 3DAFA 3NG1A 4BJ1A 4JJFA 4KC9A 3B0UX 4ANJA 1W2WA 4YJWA 2NUTB 4Q4ZF 1VYKA 3EQLF 3B0PA 4YN0B 4JZAA 3LAYA 4ULWA 3SYNA 2M4EA 2GFHA 2V26A 4KI2A 4C3DA 2KQ9A 2R7OA 3LEVA 1MMDA 2XSEA 2NUPB 4PJJA 3ZSUA 4LLCA 4Q7CA 5DQTA 2CGEA 2Y3BA 2WZFA 4KNVA 3EH1A 2J9VA 3S27A 3F46A 2ZXWC 4XWJA 3L0IA 1QZXA 3W2WA 2G3KA 4U5FE 1ZHYA 5EHHA 1SF8A 2OCCC 4FESA 1VMAA 4F4BA 1LVKA 4YT4A 4OIRF 5KYYA 4O7GA 3ASOC 5KYXA 4O6MA 3VAYA 5DS6A 3F47A 2IXPA 2P7VA 2R7XA 5B3SC 4IWBA 3CQZA 3LJBA 5HSWA 2Z15A 4CBEA 2J7PD 3Q7LA 3JYHA 4J30B 3NKEA 4C3BA 2NUTA 4K0DA 3E70C 3SEOA 3UMIA 1PCXA 1D1AA 5E3CA 1OKKA 4G7OF 5IY5C 3ITFA 4BG0A 4BJ5A 3PHF2 3X1OA 3DJNB 3UGPA 1O87A 3KH2A 2C04A 3KL4A 5DVWA 3W2VA 1ZHXA 2IXMA 5DQZA 1JPNA 2H7OA 1FMWA 2W45A 4U5BE 4DOZA 2R7RA 3S0XA 4KBLA 5KYUA 1LKXA 2PP4A 3EGXB 4IRUA 4OIQF 2FGYA 3E9VA 3K1HA 3CZ6A 3MX3A 3ZC4A 3I5QA 2VB6A 3UMKA 3NYJA 4I44A 4OIOF 4I1MA 3O39A 1BR2A 3KKBA 2YHSA 3TD7A 4JVSA 3EPVA 2W9YA 2MWQA 4CS7A 2Q3TA 5E3AA 4O6YA 1LS1A 2IOQA 4I3MA 3SZRA 2R7TA 3DJUB 3LS1A 4C7OA 5D92A 5B1BC 1M2OA 3B9QA 2QY9A 5CI8A 4GEHA 3VYWA 2HV7A 2J46A 3I5PA 2CW0F 3NRHA 2DYSC 1ZU5A 3DMDA 2WVNA 4U5GA 3EHNA 4XLNF 3UGOA 2A6HF 4CS8C 4OD5A 1TR2A 4CIHA 2J9UA 1TWAA 2KNHA 2Y69C 3Q7GA 2YEVA 2FFHA 2OG2A 2WB7A 3OWTA 1ZHWA 3EGXA 5F5FA 4FWVA 4E7ZA 1TWHA 3EJNA 4YT2A 2JD3A 5DLJA 3Q6MA 5KYUB 4OD4A 1IW7F 1G8XA 3K1IC 4HEAJ 2DGJA 3N24A 1QLEC 4LACB 5T1DB 2B0JA 3M1CB 5EGYA 3NDBB 3OEOA 3T4RA 2O9XA 3MLGA 1BR4A 3N2ZB 4PFPA 4HFKB 4LERA 1J8YF 5B1AC 2EINC 3JCUQ 3WODF 2EIKC 5DS4A 1VYIA 4BJ6C 3N0TA 2WVOA 3HTKC 4YT5A 2J7PA 4K7BA 5KYWA 4LLEA 3QZCA 4CSAC 1OCRC 2XL4A 2PX0A 5E33A 2W4MA 4XTKA 1FFTC 4OINF 2WL8A 4E7SA 3ECSA 3EGDA 3IEEA 2Y39A 2Y3DA 3DD7A 1M57C 3X2QC 4C7OB 2A6EF 2A1DD 3K6BA 3ZG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKO F;  4HEA J;  4HE8 D; 
#chains in the Genus database with same CATH topology
 2R7V A;  4D4X A;  2OJQ A;  2R7W A;  3ASN C;  2EIM C;  3H65 A;  3EG9 B;  3DKA A;  3ABL C;  4ER9 A;  4LDR A;  1NZE A;  3GOD A;  3S84 A;  2ZXO A;  4A2N B;  3ZVR A;  4DBQ A;  1ZYR F;  5COF A;  4D4N A;  1GS9 A;  1WTY A;  4B6I A;  2Q9B A;  2J0W A;  3LLI A;  5L0C A;  4Z9H A;  3DE8 A;  3RQF A;  4AX2 A;  1L3P A;  1YJG A;  1R5I D;  2H7B A;  2EIJ C;  2YKZ A;  4ZLD A;  1LS4 A;  1BR1 A;  2ZPA A;  2GWW A;  2XLE A;  3PCV A;  2VCC A;  2LSE A;  1UG7 A;  1V55 C;  1MQV A;  2CNW D;  3O6X A;  1HE9 A;  1EI7 A;  1T5O A;  1JAF A;  1YYX A;  2P6V A;  2XLV A;  4XPY A;  4PJN A;  4G0H A;  3ZQV A;  1Q0K A;  3BRJ A;  4PFO A;  4QI0 A;  4P6I C;  4YL0 A;  3ABM C;  3UR3 C;  1AEP A;  4JCH A;  1YAR O;  3FXH A;  3PDM P;  1KU2 A;  1Y4C A;  1Z6A A;  2W4B A;  2A0U A;  4NCQ A;  3K1I A;  4GYT A;  1UFB A;  4BJT A;  3FAP B;  5T3W A;  2YL0 A;  2OEV A;  2P0N A;  3UMH A;  1VTM P;  3AQB A;  3CAX A;  1V54 C;  1FTS A;  1LM3 B;  1Z23 A;  2R03 A;  4J7T A;  1LE4 A;  1MNE A;  3R2P A;  1NU7 D;  4CJG A;  4RBN A;  1QQ3 A;  1CPR A;  3FOP A;  3VF0 A;  4BEM J;  2NSG A;  3WAQ A;  4AE4 A;  3DAG A;  1M2V B;  3LLK A;  5A6J A;  2C03 A;  2Y3G A;  4MW8 A;  2JPU A;  4MTO A;  1EKY A;  2A68 F;  1TWC A;  2EPK X;  2J9W A;  3S29 A;  3SNH A;  3L8J A;  3TOL A;  2V3C C;  4ZLC A;  3IQ5 A;  4I1O B;  2B0H A;  2H7V C;  2XLD A;  1OR3 A;  1HW2 A;  3LNR A;  1VOM A;  2XS1 A;  5KYW B;  2VH3 A;  2YVK A;  4C3E A;  4RD9 A;  4CSA A;  4EKW A;  2HKV A;  5T3T A;  4JCZ A;  2EPL X;  3C62 A;  3EG9 A;  2ZXP A;  1A41 A;  3H2U A;  3DM5 A;  3EGD B;  4E17 A;  2PF4 E;  1ZU4 A;  1OXK A;  1V74 B;  3DXJ F;  2IXO A;  4IAR A;  4MND A;  1G5Z A;  5BQI A;  1K40 A;  1FFH A;  3A11 A;  3IHU A;  2E87 A;  1RKE B;  2I8B A;  2L6F A;  2NSF A;  1SZI A;  2KJG A;  2GDC A;  3OA1 A;  4QI2 A;  2DYR C;  1OCZ C;  1D0Y A;  3K6B A;  2EPM X;  4QDL A;  3LUT B;  2A69 F;  4YL1 A;  3CSK A;  4U5C E;  4BEJ A;  5L3Q A;  3NKD A;  3GM1 A;  2XL8 A;  2G62 A;  2OU6 A;  3AG4 C;  3SP1 A;  3C8G B;  1LIH A;  2YL1 A;  2VAS A;  2RD9 A;  3ABK C;  2L6G A;  5COG A;  3U9M A;  1DOV A;  4Q5S F;  1PD0 A;  2F22 A;  2J45 A;  5JUA A;  4JTD B;  3C63 A;  2OEX A;  1OR2 A;  2KGO A;  2DI3 A;  3DM9 B;  1Q0M A;  1NG1 A;  2YZS A;  4BJ5 C;  4CS9 C;  4XEV A;  5L0G A;  2ZXR A;  3RIP A;  2G3V A;  1C02 A;  4DBR A;  1O3U A;  3FHD A;  4NY3 A;  2XLM A;  1OW6 A;  4H4K C;  2L81 A;  4PJL A;  5F28 E;  4EBB A;  1NFO A;  5BUO A;  4JW1 A;  1WWP A;  3AG1 C;  2MHR A;  1APC A;  4X0R A;  5L0D A;  4JUR I;  3C7J A;  3U0C A;  2HV6 A;  4FX5 A;  1MMG A;  1I5N A;  1D0X A;  3B0V C;  3HKK A;  1I4Z A;  2VCB A;  3JRM O;  3LES A;  2PFD A;  4M63 A;  1LPE A;  2BE5 F;  1A7D A;  4U9D A;  2R7S A;  4CIP A;  5JLI A;  1M56 C;  2YQY A;  2QTV A;  1M2V A;  1ST6 A;  3G4Z A;  3T6B A;  3RQE A;  4AL0 A;  3EZI A;  4RDA A;  2WZG A;  3I4U A;  5CI9 A;  3RVY A;  4MTG A;  1LI5 A;  1NLX A;  3L34 A;  1RJ9 A;  1Q0D A;  3HLZ A;  4PK4 A;  2UUH A;  3U8V A;  2KC3 A;  1K04 A;  1SMY F;  4AK9 A;  4HE8 D;  2XLW A;  1ORJ A;  3DWW A;  3LS0 A;  3M4B A;  3NMK A;  3TOM A;  3W8I A;  4AE4 B;  3O10 A;  3W8H A;  1IZM A;  5L0H A;  4MVQ A;  1OXB A;  3BEH A;  5COM A;  3ZIB A;  1D1C A;  3EFO B;  4KNW A;  4MQ9 F;  3GAN A;  2XXA B;  4U5D E;  3M15 A;  2R7U A;  5AC5 A;  1QSP A;  2Q9A A;  5D91 A;  5KYN A;  1OCC C;  1ZHT A;  4MVM A;  4ULV A;  5JRA A;  1H6G A;  3S28 A;  1H9G A;  2EIL C;  2L9J A;  4CDA A;  5JP7 A;  2CYD A;  3AGU A;  3VRC A;  1NU9 C;  4U5E E;  2CDQ A;  4LDQ A;  3ZTM A;  4G7H F;  4G7Z F;  4OIP F;  1O5H A;  3NYM A;  2D5R B;  3EZH A;  3U2M A;  2WVQ A;  2HSQ A;  1JPJ A;  4J32 B;  4PJM A;  5E2Q A;  5F5H A;  2FAP B;  2ZD9 A;  3Q6N A;  3C8G A;  4NQF A;  3RH3 A;  4E0I A;  4E18 A;  4MVO A;  2WZL A;  5L0J A;  3RKO F;  3MYF A;  4DVZ A;  3GEE A;  1MMN A;  1KTM A;  1PV3 A;  3RFY A;  3AG2 C;  1CGO A;  4G78 A;  3FAJ A;  4CS8 A;  3DZA A;  4WJ0 A;  3M4C A;  5HV9 A;  3HNK A;  3H2V A;  4W8K A;  4YK5 A;  4IAO A;  2YLI A;  1T01 A;  2XRH A;  2X0C A;  4IJJ A;  4EBJ A;  4Z9J A;  2KYH A;  2CNW A;  2OOC A;  3FVY A;  3QW0 A;  1MMA A;  1OKK D;  2IYL D;  1GGQ A;  2J0X A;  5BQH A;  4CS9 A;  1N1C A;  3R7C A;  4DRH B;  1D0Z A;  3O55 A;  2PX3 A;  4H54 A;  3RYL A;  4JJG A;  1QVX A;  4MVU A;  4R32 A;  4U5H A;  1Z5Z A;  5L0I A;  2YL3 A;  1Z3I X;  1FMV A;  3WG7 C;  3GM2 A;  3U3F A;  2KSF A;  1U89 A;  1C17 M;  3AQC A;  4N06 A;  3JRT A;  2NUP A;  5FCL A;  5L3V A;  1XWJ A;  2IXN A;  4XEF A;  1S05 A;  1WGW A;  1YZA A;  3HNI A;  1GQA A;  4JEA A;  3AOU A;  3JT1 A;  4YWQ A;  3POV A;  1CGN A;  3MFN A;  4JEB A;  3T6J A;  3QTH A;  1QKR A;  3KMI A;  2X51 A;  1Q0F A;  2L7A A;  2I15 A;  1L7C A;  4O6N A;  4Z9I A;  3TJ5 A;  2YLD A;  1TWG A;  1J8M F;  4WGZ A;  3ZTZ A;  1GM5 A;  1HMO A;  3K7D A;  256B A;  3HNJ A;  2AWC A;  3EFO A;  1RJ9 B;  2XS8 A;  2XXA A;  3PMR A;  4BJ6 A;  3UNG C;  1TKN A;  1VK5 A;  4JIO A;  4NC3 A;  3RW0 A;  1S7Z A;  4XLP F;  1TFO B;  1D1B A;  2R7Q A;  3AG3 C;  3K66 A;  4EUK B;  1MND A;  2LD6 A;  1TFK B;  4HFF B;  3K33 A;  3HJC A;  4EWC A;  3LNM B;  4EIY A;  3EH2 A;  3JSZ A;  2PBE A;  2Q9C A;  5JT4 A;  4O79 A;  5KYY B;  2Y3H A;  2IM8 A;  1QPU A;  1OCO C;  2NG1 A;  2KW3 C;  3FOO A;  3NYL A;  3QMK A;  4J7Y A;  2ICW G;  4DJ9 A;  4YT8 A;  3FDQ A;  5KYX B;  2KK1 A;  3A9C A;  2DB4 A;  3QW1 A;  1A7E A;  1PD1 A;  2HMQ A;  3SXY A;  2HMZ A;  5DS5 A;  2D4U A;  2HUJ A;  3EHM A;  1YYJ A;  1RKC A;  1ZHZ A;  2MYS A;  3V7O A;  3DAF A;  3IQT A;  3NG1 A;  4BJ1 A;  4JJF A;  4KC9 A;  1B68 A;  3DE9 A;  3B0U X;  4ANJ A;  1WAS A;  2AP3 A;  1W2W A;  2LP4 A;  1C03 A;  4YJW A;  2NUT B;  4Q4Z F;  1HY5 A;  1VB5 A;  2PNO A;  4MVZ A;  3GWN A;  1VYK A;  4N6H A;  4DXW A;  3EQL F;  3B0P A;  1JOG A;  4YN0 B;  4XPW A;  4JKV A;  4JZA A;  3LAY A;  4ULW A;  3RQG A;  3NMI A;  1Z7Q c;  3SYN A;  3U9J A;  2M4E A;  4K1O A;  2GFH A;  2V26 A;  4KI2 A;  4C3D A;  5JS5 A;  3NMJ A;  2XLH A;  4EHP A;  2KQ9 A;  2R7O A;  5L0F A;  2A0B A;  4IAQ A;  2HZ8 A;  3LEV A;  1MMD A;  5GPG B;  2XSE A;  2NUP B;  2ETS A;  4PJJ A;  3ZSU A;  4CX9 A;  5A6K A;  4LLC A;  4Q7C A;  3B29 A;  5DQT A;  2CGE A;  2AWY A;  3S9O A;  2IBF A;  3L8I A;  2Y3B A;  2WZF A;  5K0I A;  3FMS A;  4KNV A;  3EH1 A;  2J9V A;  3S27 A;  3ZQY A;  2LCH A;  3F46 A;  1G4W R;  2AU5 A;  2ZXW C;  2ASR A;  1E84 A;  1OW8 A;  4XWJ A;  3L0I A;  3US6 A;  4WGY A;  1VLT A;  1QZX A;  3LEO A;  3W2W A;  2G3K A;  2L6H A;  1T6Q A;  1ZHY A;  2M64 A;  3B71 A;  2YL7 A;  1SF8 A;  2OCC C;  4U5F E;  5EHH A;  1RXQ A;  2EPN A;  1E2X A;  4FES A;  1VMA A;  4F4B A;  2J9B A;  1LVK A;  3U2L A;  3VM6 A;  2R02 A;  4OIR F;  4YT4 A;  5JVE A;  5KYY A;  2OJE D;  4O7G A;  5A6B D;  2UUI A;  4DRI B;  3ASO C;  4XEK A;  3TJ6 A;  5KYX A;  4CDV A;  5EK0 A;  1V4A A;  3AJM A;  4O6M A;  3VAY A;  1AVO B;  5DS6 A;  2H8A A;  5AC4 A;  4IB4 A;  4JTC B;  3DI5 A;  3F47 A;  2IXP A;  3CEX A;  2P7V A;  2R7X A;  3V5Z A;  5B3S C;  3TUL A;  4IWB A;  3CQZ A;  3LJB A;  2OKU A;  5HSW A;  2Z15 A;  4CBE A;  2J7P D;  3Q7L A;  5A69 A;  3JYH A;  3T9O A;  4J30 B;  2LFD A;  3KPH A;  3NKE A;  3IQ6 A;  4C3B A;  1I4Y A;  2NUT A;  4A4A A;  1NSG B;  4K0D A;  3E70 C;  4MVS A;  1WAT A;  3SEO A;  3UMI A;  1PCX A;  1D1A A;  5E3C A;  4MTF A;  1OKK A;  1BBH A;  4G7O F;  5IY5 C;  3ITF A;  3U5S A;  2EPO A;  4JC7 A;  4BG0 A;  4BJ5 A;  3PHF 2;  4P9F A;  3X1O A;  2VCA A;  3DJN B;  4NTF A;  3UGP A;  5A6A A;  1OQC A;  1O87 A;  3KH2 A;  3G50 A;  4XPX A;  1A7V A;  4L6R A;  5FZT A;  5TJ5 E;  3SXK A;  3W4Y A;  4E0H A;  3C8G D;  1RMV A;  4MS2 A;  3IPM O;  4MVR A;  2C04 A;  3TK0 A;  1BZ4 A;  3KL4 A;  5DVW A;  3SXZ A;  3TQO A;  3AGT A;  3W2V A;  1ZW3 A;  1ZHX A;  2IXM A;  3WHN A;  2Q00 A;  2R05 A;  1JPN A;  3ZG1 A;  1XZP A;  2H7O A;  5DQZ A;  1VLS A;  1FMW A;  2W45 A;  4U5B E;  4AL1 A;  2OQM A;  2LFF A;  3MYI A;  4LDK A;  1E83 A;  2YWA A;  3C8Z A;  4DOZ A;  2R7R A;  3S0X A;  4KBL A;  5KYU A;  1LKX A;  2PP4 A;  3EGX B;  3RF3 A;  4IRU A;  4OIQ F;  2FGY A;  3E9V A;  2LQG A;  3K1H A;  3CZ6 A;  3MBG A;  3T6G B;  1JRA A;  2TMV P;  3MX3 A;  3ZC4 A;  3I5Q A;  5CIV A;  2Q7R A;  1E85 A;  3QVY A;  2VB6 A;  5B3I A;  3JYY A;  3NYJ A;  4PR9 A;  3UMK A;  4DVY P;  4I44 A;  4OIO F;  4I1M A;  3O39 A;  2P1A A;  1HW1 A;  4JRZ A;  1BR2 A;  3KKB A;  2YHS A;  2AVK A;  3TD7 A;  1K05 A;  1U6H A;  2QE9 A;  2VC9 A;  4JVS A;  1FR0 A;  4U9E A;  1T6I A;  1ZVZ A;  1RCP A;  2GAQ A;  3EPV A;  1Y6D A;  1ORS C;  1T6U A;  1H7I A;  2W9Y A;  2MWQ A;  2YLG A;  3G4X A;  3KYI A;  1WN0 A;  3L1M A;  4CS7 A;  2XLO A;  1YA7 O;  2Q3T A;  4P9T A;  2LIG A;  2HS5 A;  1FNT c;  1F1M A;  1LE2 A;  1SYQ A;  3GOR A;  5E3A A;  1SR2 A;  4XQ1 A;  4O6Y A;  1LS1 A;  2IOQ A;  1CGM E;  4JTA B;  4I3M A;  1JMW A;  3SZR A;  1A0B A;  2R7T A;  3DJU B;  1XZQ A;  3LS1 A;  4C7O A;  5D92 A;  4JE9 A;  5B1B C;  1M2O A;  2R25 A;  3B9Q A;  1G4U S;  5CI8 A;  4GEH A;  3VYW A;  2BC5 A;  2HV7 A;  2J46 A;  4FAP B;  3I5P A;  5AGF A;  2CW0 F;  3NRH A;  2DYS C;  1ZU5 A;  1U0B B;  3DMD A;  2WVN A;  4U5G A;  1LI7 A;  2BL2 A;  1BDJ B;  2QLA A;  3EHN A;  2HSB A;  4XLN F;  5BQG A;  3QVZ A;  2RSE B;  4DRJ B;  4NTB A;  3UGO A;  2A6H F;  2Q4F A;  4BPM A;  4OD5 A;  1CPQ A;  4ONS A;  4CS8 C;  3C18 A;  2NPU A;  1H9T A;  1YVI A;  1YDI A;  1TR2 A;  3GEI A;  2QNL A;  4CIH A;  1ZW2 A;  1TWA A;  2J9U A;  2KNH A;  2Y69 C;  4CDY A;  3Q7G A;  2YEV A;  2J8W A;  2XM4 A;  2XM0 A;  3M79 A;  2FFH A;  3ZWI A;  2OG2 A;  1OW7 A;  2WB7 A;  3OWT A;  1ZHW A;  3EGX A;  2YRF A;  1NBB A;  3JSE O;  1EQ1 A;  4CJO A;  5F5F A;  4FWV A;  4E7Z A;  3ZDL A;  1Q0G A;  4IGG A;  5JSL A;  1HE1 A;  1TWH A;  4UDV A;  3EJN A;  4YT2 A;  1DOW A;  2JD3 A;  2HJM A;  5DLJ A;  3Q6M A;  5KYU B;  1FAP B;  1JR8 A;  4OD4 A;  1IW7 F;  1G8X A;  1YAU O;  1T9K A;  3JTL O;  3K1I C;  4HEA J;  2DGJ A;  3V5X A;  3N24 A;  1QLE C;  2CCY A;  4LAC B;  2B0J A;  3M1C B;  5T1D B;  4EBK A;  1R4T A;  1WOL A;  5EGY A;  4W8P A;  3NDB B;  3OEO A;  3T4R A;  1ZZP A;  2O9X A;  4NTA A;  5A6B A;  3MLG A;  1YZC A;  2R9R B;  4N6C A;  1BR4 A;  2QUP A;  1NFN A;  3N2Z B;  4N4W A;  4PFP A;  2XL6 A;  4HFK B;  4LER A;  1YA9 A;  2HJ3 A;  1J8Y F;  3ATP A;  4YL3 A;  1Z63 A;  4PAC A;  3GWL A;  5B1A C;  1ORY A;  2EIN C;  1KNY A;  3JCU Q;  2HFI A;  3S90 A;  2LK4 A;  3U3B A;  3WOD F;  2EIK C;  3GEH A;  3HNL A;  5DS4 A;  1VYI A;  4WAB A;  4BJ6 C;  3N0T A;  2WVO A;  3HTK C;  3KYJ A;  4MW3 A;  4YT5 A;  3V5Y A;  1E86 A;  2J7P A;  2JX0 A;  3GM3 A;  4K7B A;  3SXM A;  5KYW A;  1YLM A;  1TQG A;  3QZC A;  4LLE A;  3U8P A;  4CSA C;  1OCR C;  2XL4 A;  2PX0 A;  3IQC A;  2W4M A;  3JZ0 A;  5E33 A;  1EA8 A;  4XTK A;  1FFT C;  4OIN F;  2WL8 A;  2GA0 A;  3ECS A;  4GQH A;  4E7S A;  3EGD A;  3IEE A;  2Y39 A;  2Y3D A;  1HMD A;  3DD7 A;  1M6T A;  1M57 C;  3X2Q C;  2P61 A;  4C7O B;  2A6E F;  1RKE A;  2A1D D;  3J06 A;  2QY9 A;  3RVZ A;  1AUE A; 
#chains in the Genus database with same CATH homology
 2R7V A;  2R7W A;  3ASN C;  2EIM C;  3H65 A;  3EG9 B;  3ABL C;  1NZE A;  3GOD A;  2ZXO A;  4A2N B;  3ZVR A;  4DBQ A;  1ZYR F;  4B6I A;  2Q9B A;  2J0W A;  3LLI A;  4AX2 A;  2H7B A;  2EIJ C;  4ZLD A;  2ZPA A;  1BR1 A;  2LSE A;  1V55 C;  2CNW D;  3O6X A;  2P6V A;  1Z63 A;  4DVY P;  4PJN A;  4G0H A;  4PFO A;  4QI0 A;  4P6I C;  3UR3 C;  3ABM C;  4JCH A;  1KU2 A;  1Z6A A;  2W4B A;  4GYT A;  4BJT A;  5T3W A;  3UMH A;  3AQB A;  1V54 C;  1FTS A;  1Z23 A;  1MNE A;  1NU7 D;  4RBN A;  4AE4 A;  3DAG A;  1M2V B;  3LLK A;  2C03 A;  2Y3G A;  2A68 F;  1TWC A;  2J9W A;  3S29 A;  3SNH A;  2V3C C;  4ZLC A;  4I1O B;  2H7V C;  3LNR A;  1VOM A;  5KYW B;  2VH3 A;  4C3E A;  4CSA A;  4RD9 A;  5T3T A;  3EG9 A;  2ZXP A;  3DM5 A;  3EGD B;  2PF4 E;  1ZU4 A;  3DXJ F;  4MND A;  2IXO A;  1FFH A;  2E87 A;  2I8B A;  1SZI A;  2KJG A;  3OA1 A;  4QI2 A;  2DYR C;  1OCZ C;  1D0Y A;  4QDL A;  4BEJ A;  5L3Q A;  2A69 F;  3CSK A;  4U5C E;  3NKD A;  2G62 A;  3SP1 A;  3AG4 C;  2VAS A;  3ABK C;  4Q5S F;  1PD0 A;  2J45 A;  2KGO A;  3DM9 B;  1NG1 A;  2YZS A;  4BJ5 C;  4CS9 C;  2ZXR A;  3RIP A;  2G3V A;  4DBR A;  3FHD A;  4NY3 A;  4H4K C;  4PJL A;  2L81 A;  4EBB A;  5BUO A;  4JW1 A;  3AG1 C;  4X0R A;  4JUR I;  2HV6 A;  4FX5 A;  1MMG A;  1D0X A;  3B0V C;  3LES A;  4M63 A;  2PFD A;  2BE5 F;  2R7S A;  1M56 C;  2QTV A;  1M2V A;  1ST6 A;  3T6B A;  3EZI A;  4RDA A;  2WZG A;  3I4U A;  5CI9 A;  3L34 A;  1RJ9 A;  3HLZ A;  4PK4 A;  1SMY F;  4AK9 A;  4HE8 D;  3LS0 A;  4AE4 B;  3W8I A;  3W8H A;  1IZM A;  3ZIB A;  1D1C A;  3EFO B;  4KNW A;  4MQ9 F;  3GAN A;  2XXA B;  4U5D E;  2R7U A;  2Q9A A;  5D91 A;  5KYN A;  1OCC C;  1ZHT A;  3S28 A;  2EIL C;  2L9J A;  1NU9 C;  4U5E E;  2CDQ A;  4G7H F;  4G7Z F;  4OIP F;  1O5H A;  3NYM A;  2D5R B;  3EZH A;  2WVQ A;  5E2Q A;  1JPJ A;  4J32 B;  4PJM A;  5F5H A;  3Q6N A;  3RH3 A;  2WZL A;  3RKO F;  4DVZ A;  1MMN A;  3RFY A;  3AG2 C;  3FAJ A;  4CS8 A;  3DZA A;  4WJ0 A;  4W8K A;  4IAO A;  2XRH A;  4IJJ A;  2CNW A;  3FVY A;  1MMA A;  1OKK D;  2IYL D;  2J0X A;  4CS9 A;  1N1C A;  1D0Z A;  2PX3 A;  3RYL A;  4JJG A;  4U5H A;  1Z5Z A;  3WG7 C;  1Z3I X;  1FMV A;  3AQC A;  4N06 A;  3JRT A;  2NUP A;  5FCL A;  5L3V A;  2IXN A;  1WGW A;  4YWQ A;  3POV A;  3JT1 A;  3T6J A;  3KMI A;  2X51 A;  4O6N A;  1TWG A;  1J8M F;  3K7D A;  3EFO A;  1RJ9 B;  2XXA A;  3PMR A;  4BJ6 A;  3UNG C;  1TKN A;  1VK5 A;  1S7Z A;  4XLP F;  2R7Q A;  1D1B A;  3AG3 C;  3K66 A;  1MND A;  4HFF B;  3K33 A;  3HJC A;  4EWC A;  3EH2 A;  3JSZ A;  2Q9C A;  4O79 A;  5KYY B;  2Y3H A;  2NG1 A;  3NYL A;  1OCO C;  3QMK A;  2KW3 C;  4YT8 A;  3FDQ A;  5KYX B;  1PD1 A;  5DS5 A;  3EHM A;  1ZHZ A;  2MYS A;  3V7O A;  3DAF A;  3NG1 A;  4BJ1 A;  4JJF A;  4KC9 A;  3B0U X;  4ANJ A;  1W2W A;  4YJW A;  2NUT B;  4Q4Z F;  1VYK A;  3EQL F;  3B0P A;  4YN0 B;  4JZA A;  3LAY A;  4ULW A;  3SYN A;  2M4E A;  2GFH A;  2V26 A;  4KI2 A;  4C3D A;  2KQ9 A;  2R7O A;  3LEV A;  1MMD A;  2XSE A;  2NUP B;  4PJJ A;  3ZSU A;  4LLC A;  4Q7C A;  5DQT A;  2CGE A;  2Y3B A;  2WZF A;  4KNV A;  3EH1 A;  2J9V A;  3S27 A;  3F46 A;  2ZXW C;  4XWJ A;  3L0I A;  1QZX A;  3W2W A;  2G3K A;  4U5F E;  1ZHY A;  5EHH A;  1SF8 A;  2OCC C;  4FES A;  1VMA A;  4F4B A;  1LVK A;  4YT4 A;  4OIR F;  5KYY A;  4O7G A;  3ASO C;  5KYX A;  4O6M A;  3VAY A;  5DS6 A;  3F47 A;  2IXP A;  2P7V A;  2R7X A;  5B3S C;  4IWB A;  3CQZ A;  3LJB A;  5HSW A;  2Z15 A;  4CBE A;  2J7P D;  3Q7L A;  3JYH A;  4J30 B;  3NKE A;  4C3B A;  2NUT A;  4K0D A;  3E70 C;  3SEO A;  3UMI A;  1PCX A;  1D1A A;  5E3C A;  1OKK A;  4G7O F;  5IY5 C;  3ITF A;  4BG0 A;  4BJ5 A;  3PHF 2;  3X1O A;  3DJN B;  3UGP A;  1O87 A;  3KH2 A;  2C04 A;  3KL4 A;  5DVW A;  3W2V A;  1ZHX A;  2IXM A;  5DQZ A;  1JPN A;  2H7O A;  1FMW A;  2W45 A;  4U5B E;  4DOZ A;  2R7R A;  3S0X A;  4KBL A;  5KYU A;  1LKX A;  2PP4 A;  3EGX B;  4IRU A;  4OIQ F;  2FGY A;  3E9V A;  3K1H A;  3CZ6 A;  3MX3 A;  3ZC4 A;  3I5Q A;  2VB6 A;  3UMK A;  3NYJ A;  4I44 A;  4OIO F;  4I1M A;  3O39 A;  1BR2 A;  3KKB A;  2YHS A;  3TD7 A;  4JVS A;  3EPV A;  2W9Y A;  2MWQ A;  4CS7 A;  2Q3T A;  5E3A A;  4O6Y A;  1LS1 A;  2IOQ A;  4I3M A;  3SZR A;  2R7T A;  3DJU B;  3LS1 A;  4C7O A;  5D92 A;  5B1B C;  1M2O A;  3B9Q A;  2QY9 A;  5CI8 A;  4GEH A;  3VYW A;  2HV7 A;  2J46 A;  3I5P A;  2CW0 F;  3NRH A;  2DYS C;  1ZU5 A;  3DMD A;  2WVN A;  4U5G A;  3EHN A;  4XLN F;  3UGO A;  2A6H F;  4CS8 C;  4OD5 A;  1TR2 A;  4CIH A;  2J9U A;  1TWA A;  2KNH A;  2Y69 C;  3Q7G A;  2YEV A;  2FFH A;  2OG2 A;  2WB7 A;  3OWT A;  1ZHW A;  3EGX A;  5F5F A;  4FWV A;  4E7Z A;  1TWH A;  3EJN A;  4YT2 A;  2JD3 A;  5DLJ A;  3Q6M A;  5KYU B;  4OD4 A;  1IW7 F;  1G8X A;  3K1I C;  4HEA J;  2DGJ A;  3N24 A;  1QLE C;  4LAC B;  5T1D B;  2B0J A;  3M1C B;  5EGY A;  3NDB B;  3OEO A;  3T4R A;  2O9X A;  3MLG A;  1BR4 A;  3N2Z B;  4PFP A;  4HFK B;  4LER A;  1J8Y F;  5B1A C;  2EIN C;  3JCU Q;  3WOD F;  2EIK C;  5DS4 A;  1VYI A;  4BJ6 C;  3N0T A;  2WVO A;  3HTK C;  4YT5 A;  2J7P A;  4K7B A;  5KYW A;  4LLE A;  3QZC A;  4CSA C;  1OCR C;  2XL4 A;  2PX0 A;  5E33 A;  2W4M A;  4XTK A;  1FFT C;  4OIN F;  2WL8 A;  4E7S A;  3ECS A;  3EGD A;  3IEE A;  2Y39 A;  2Y3D A;  3DD7 A;  1M57 C;  3X2Q C;  4C7O B;  2A6E F;  2A1D D;  3K6B A;  3ZG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...