4HE8D

Crystal structure of the membrane domain of respiratory complex i from thermus thermophilus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
160
structure length
160
Chain Sequence
MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGEIGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase subunit 7
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
total genus 51
structure length 160
sequence length 160
chains with identical sequence J
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00499 Oxidored_q3 NADH-ubiquinone/plastoquinone oxidoreductase chain 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1200 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4he8D00
3RKOF 4HEAJ 4HE8D
chains in the Genus database with same CATH superfamily
4N6HA 1VYIA 1T6QA 1H7IA 1EA8A 2XM0A 2YZSA 3IHUA 3EZHA 3W8IA 4MVZA 3SP1A 3EGXA 3O55A 4Q4ZF 3GORA 2EIMC 2G62A 2XL4A 5CIVA 4HFKB 1QZXA 4QI2A 3LESA 4D4NA 2AWCA 4R32A 1OCRC 4XTKA 4E7ZA 4O6NA 3ZTMA 2DYSC 2AVKA 3JSZA 1J8MF 3UNGC 2J0XA 4D4XA 1H9GA 1D0ZA 4ZLCA 5KYXA 5KYYA 1U6HA 1D1CA 1G5ZA 2R7RA 1U89A 4JTAB 2J9VA 5AC4A 4PJNA 4DRIB 4NTBA 3VYWA 3WG7C 2FAPB 2YLGA 2PP4A 5L0GA 3K66A 4DJ9A 3V5YA 4MTFA 5B3SC 3DAFA 1YVIA 1VLTA 1K40A 3QZCA 2E87A 3EGDB 1XZQA 3DXJF 1HY5A 1SR2A 2NSGA 1A41A 5JSLA 3DJNB 4H4KC 3QVZA 4BPMA 1PV3A 3ASOC 1H9TA 1TWAA 1RKEA 2NG1A 3QW1A 1ZW2A 4FESA 2Q3TA 1MMNA 2P7VA 3GODA 4U5HA 4AL1A 1EQ1A 3NRHA 5L0FA 4WJ0A 4CJOA 1QLEC 1K04A 2NUPA 2V26A 3HNIA 4W8KA 4L6RA 3VAYA 1CGOA 2A0BA 1YA9A 4MVMA 3UMHA 5JRAA 1LE4A 2XRHA 1C02A 3DM9B 4HFFB 1JOGA 1V74B 5CI9A 2CNWD 1YDIA 4CS8A 1Q0FA 2BE5F 1MMAA 2WVQA 1MNEA 4G78A 4XWJA 4LERA 2V3CC 4UDVA 3ATPA 2GAQA 3DD7A 2RD9A 1V4AA 4GYTA 2ZXOA 1F1MA 3AGTA 1OW6A 2X0CA 1ORSC 3RFYA 3IQ5A 1Y4CA 2HSQA 4Q7CA 1G8XA 3JYYA 3DJUB 3CQZA 5B1BC 4OD5A 3A11A 1JMWA 1RXQA 2UUIA 3JT1A 4C7OA 2XLOA 1S7ZA 5D92A 3S27A 4DOZA 1FR0A 4N4WA 3VF0A 4JTCB 5T3WA 1ZW3A 2PX3A 2Q9CA 2YKZA 2OKUA 1GS9A 3B29A 3GWNA 3KL4A 4MVUA 5EK0A 3US6A 4PACA 1ZHZA 4C3BA 4CDAA 1KNYA 5KYWB 3R7CA 3HKKA 3LJBA 2QLAA 2UUHA 2JD3A 2GWWA 3Q6NA 4PFOA 1OCOC 2HKVA 1HW1A 1NBBA 1T6UA 3LNRA 3SNHA 2LSEA 5BQIA 2VCCA 1WOLA 3SXZA 4ULWA 3UGPA 3MBGA 1FNTc 1A7VA 4YK5A 4LACB 1KU2A 4U5GA 1DOVA 1OW8A 3KKBA 2XXAA 2R7UA 3K1IC 5A6KA 1VB5A 1WTYA 3C8GA 3EHNA 1S05A 2R9RB 5A6BD 3EQLF 4C3DA 3CEXA 3K33A 4N06A 2YEVA 3B0PA 1RCPA 4PJMA 2J9WA 5F28E 2CCYA 4MVQA 2LFFA 5K0IA 2IYLD 3ZQVA 1AVOB 3FOOA 5COMA 3U9JA 4JCHA 1TQGA 4Q5SF 5A6AA 1FAPB 1AUEA 1CGNA 4DXWA 3L0IA 3ECSA 2B0HA 2J9UA 4G7OF 2J9BA 2O9XA 3Q6MA 5EHHA 1OXBA 3X1OA 3L34A 4J7YA 2PNOA 4O6YA 1JRAA 4QI0A 1Q0KA 3QMKA 4YT4A 2FFHA 1BDJB 3GEIA 5JP7A 1O87A 1RJ9B 4E7SA 5IY5C 4JEAA 3EH2A 3LEVA 2Y69C 5HSWA 3QVYA 4EWCA 2C03A 2EILC 3C62A 4YL3A 1LIHA 3EJNA 3FHDA 5BUOA 1HMDA 4XLNF 2NUTA 2PX0A 1PCXA 1LE2A 1OKKA 4PR9A 5L0JA 3FAPB 4G7HF 4FAPB 3NKDA 4U5CE 3HNJA 3N2ZB 4ZLDA 1HE9A 2R7TA 1ZHXA 4RDAA 4KNWA 3VM6A 2CGEA 1YJGA 4JJFA 4IWBA 5JS5A 3ABMC 2GFHA 3GM3A 4MW8A 2Y39A 4P9TA 3O6XA 3KYJA 1C03A 1VMAA 1YYXA 2HJ3A 2ZPAA 2J46A 1YYJA 3G4ZA 1DOWA 1M2OA 2A68F 5KYUA 3RIPA 3AG2C 2WB7A 1ORYA 1WASA 2VH3A 3IQCA 3N0TA 3AG4C 5L0HA 4EUKB 3UGOA 2R02A 1NSGB 1T6IA 2KGOA 4HE8D 1NLXA 5DQZA 1Z63A 2H7VC 4XPXA 4MVRA 3UMIA 3H2VA 4BJ1A 1QPUA 3ASNC 1BBHA 1TFKB 4JTDB 3SZRA 1M2VA 3ZVRA 3GANA 1C17M 1NFNA 3A9CA 2EIJC 3OA1A 4YL0A 3TD7A 3RH3A 3L1MA 4U9DA 2XLDA 3EGXB 3E70C 2IXMA 4LLEA 1HW2A 3EFOB 3PDMP 5DLJA 2Q00A 3AOUA 4YT5A 3HNKA 2R7WA 3V5XA 4EBJA 3LS1A 2KW3C 2WZFA 4JC7A 3FDQA 2YL1A 2HMZA 2YHSA 3G4XA 3MYFA 1YLMA 1A0BA 4DBRA 2BC5A 3LNMB 5KYYB 5KYXB 2DYRC 3DMDA 2EPMX 1LI5A 3F47A 4NTAA 3RQFA 2WVNA 4CS8C 1A7DA 1TWHA 1SF8A 3HJCA 2VCBA 2Q4FA 3M15A 2OG2A 3EG9A 3OEOA 2EPLX 3G50A 4CS7A 1NG1A 1K05A 2C04A 2OU6A 1KTMA 1VOMA 3O39A 5DQTA 3CZ6A 2KYHA 2B0JA 2PF4E 4YT2A 1MQVA 5COFA 2HZ8A 3U2MA 2GDCA 3W2WA 1RKEB 5TJ5E 2XM4A 1N1CA 4CIHA 5E3AA 3Q7GA 1EI7A 1L7CA 2NUPB 2ZXPA 3FOPA 4DRJB 3JRTA 4E0IA 2H7BA 1YAUO 3LEOA 1D0XA 2YLIA 4J32B 3T4RA 2ZXRA 1GM5A 4BEMJ 3WHNA 2AP3A 1M57C 3MFNA 3N24A 3X2QC 5L0IA 3RQGA 1WATA 3ZC4A 2XS8A 3S90A 2XS1A 1APCA 4NC3A 3B71A 3GWLA 2OJED 1ST6A 1RKCA 4MVSA 4DVZA 4MNDA 3M4BA 2P61A 2G3KA 1SZIA 1FFTC 2G3VA 2KC3A 2LFDA 5T3TA 1I5NA 4AE4A 1SYQA 4E0HA 2MWQA 1UFBA 4K1OA 3RYLA 1E84A 2PFDA 2F22A 2P6VA 2YL3A 2RSEB 4NTFA 4U5EE 5JT4A 2R7XA 3S9OA 3ZWIA 5JUAA 4C7OB 3WAQA 4U5DE 3RKOF 3PMRA 4ONSA 2HJMA 1Z5ZA 2LQGA 4Z9HA 5F5HA 3DKAA 1ZU5A 1O5HA 3NMIA 3U0CA 1CGME 1T9KA 3RQEA 3U9MA 2Y3DA 4H54A 3U3FA 2BL2A 4G7ZF 2QNLA 3FMSA 4N6CA 1D1AA 3NMJA 5COGA 1WN0A 2QUPA 2LK4A 3LLIA 4MS2A 4XPYA 5F5FA 5JLIA 2OEVA 2ICWG 1TR2A 1FMVA 2EPNA 2ZD9A 1IW7F 2VC9A 2YVKA 3F46A 5B3IA 2L6GA 2XXAB 1FMWA 1TFOB 4O7GA 2X51A 2L6HA 3C8GB 3HNLA 3I4UA 4YJWA 5FZTA 3K1HA 1Q0MA 4KI2A 1PD1A 3FVYA 3NYMA 4CBEA 4EIYA 4BJ6A 3LLKA 1OR2A 1YARO 5HV9A 3MX3A 3AGUA 1OXKA 2J7PD 4JKVA 4CJGA 2Q9BA 2YL7A 4ER9A 4XLPF 2Q9AA 4YWQA 5A6BA 4OIQF 2IXPA 4RBNA 3FAJA 3SXMA 2LD6A 3C18A 2J0WA 4K0DA 1QKRA 3KPHA 2XLVA 4MQ9F 5DVWA 4OIOF 4EBKA 4ANJA 2HFIA 2LP4A 3B0UX 1G4US 5L3VA 2ETSA 4G0HA 2DB4A 4HEAJ 3U3BA 2D5RB 4EHPA 2XLWA 5AGFA 1T5OA 2CDQA 2I15A 1OKKD 2L6FA 2R05A 2OEXA 4A4AA 3M79A 4PJJA 2R25A 2OCCC 4M63A 3NMKA 4LDKA 1PD0A 2NUTB 2WVOA 4BJ5A 2R7SA 3ZQYA 1OCCC 4JRZA 3MLGA 1JPJA 1VLSA 4OINF 4AX2A 2VASA 4OIPF 1Q0DA 4CDVA 2J8WA 3E9VA 4I1MA 5JVEA 3DE8A 1BR1A 4J30B 4MW3A 3TJ6A 1E83A 4CX9A 3HTKC 1BZ4A 4WGZA 3H2UA 3KYIA 1VK5A 2XLEA 4DRHB 2A69F 2XL8A 4WABA 3UR3C 3POVA 2L9JA 4U5FE 3TOLA 5L0CA 1OQCA 1VTMP 2A6EF 2CYDA 4BEJA 3T6BA 1ORJA 2EPOA 4CS9A 5AC5A 5DS6A 3IQ6A 5KYUB 2IM8A 1MMDA 4Z9IA 4XPWA 5B1AC 1ZZPA 1ZYRF 1MMGA 3CAXA 4P9FA 3ABLC 3S28A 1YZCA 3R2PA 4NQFA 3C8ZA 4JJGA 2YRFA 2MYSA 4OIRF 1LKXA 1YA7O 3UMKA 1Z7Qc 3S29A 1M2VB 3KH2A 3DM5A 4P6IC 4BJTA 4IB4A 3NYLA 2R7VA 4KBLA 3EHMA 3QW0A 3GM2A 4BG0A 4EBBA 4JZAA 5DS4A 1M6TA 2IOQA 5KYNA 1I4ZA 1T01A 2M4EA 1I4YA 2P1AA 2Y3HA 3NYJA 5E33A 1BR2A 2WZLA 2YWAA 4CSAA 1D1BA 3EFOA 1UG7A 4OD4A 3NDBB 1XZPA 2JPUA 3L8IA 2A0UA 4EKWA 1RMVA 1LI7A 1LS1A 3ITFA 1Q0GA 4IARA 4JE9A 3EH1A 3J06A 3DWWA 4GQHA 2HS5A 2HUJA 3T9OA 3ZTZA 3WODF 4CIPA 4Z9JA 2A6HF 5E3CA 3V5ZA 3EGDA 2QTVA 2IBFA 4I44A 1JR8A 3EG9B 1LPEA 2Y3GA 1V54C 1ZHYA 2L7AA 3U8VA 4LDQA 3AJMA 2MHRA 4K7BA 2W4BA 3SYNA 3ZSUA 4U5BE 2OQMA 4KNVA 2IXNA 3EPVA 1QVXA 2QY9A 3JSEO 4E18A 4U9EA 3W4YA 3Q7LA 1Z6AA 3IEEA 1E85A 3IPMO 1IZMA 2PBEA 3C63A 2DI3A 2Q7RA 2AU5A 3AQCA 2A1DD 3JZ0A 3LAYA 3L8JA 5GPGB 4F4BA 2KJGA 4CDYA 3PHF2 256BA 3EZIA 4IRUA 4XEKA 1AEPA 3LUTB 3KMIA 3DI5A 2CNWA 4IAOA 3V7OA 1M56C 2J45A 3SXKA 3TQOA 3K7DA 1GQAA 1L3PA 1Z23A 3B0VC 4X0RA 3O10A 2L81A 4PJLA 1D0YA 3TJ5A 2DGJA 1A7EA 3AG3C 5FCLA 2HV6A 3C7JA 3DE9A 2XSEA 1JAFA 4AE4B 5DS5A 2I8BA 1WWPA 2KQ9A 2P0NA 3MYIA 3B9QA 4XEFA 1G4WR 3BEHA 4J7TA 3I5QA 2KNHA 2OOCA 4LLCA 4YT8A 2AWYA 3BRJA 4AK9A 1W2WA 3T6JA 4B6IA 5L3QA 1E2XA 4BJ6C 2LIGA 3ABKC 5E2QA 2R03A 4IJJA 2YL0A 1CPQA 4FX5A 4WGYA 3RW0A 3S84A 3AG1C 3AQBA 5T1DB 5KYWA 1WGWA 3M1CB 4JURI 3PCVA 5D91A 2JX0A 1OR3A 3C8GD 3K6BA 1V55C 5BQHA 4C3EA 3HLZA 1FTSA 2H7OA 2W45A 2FGYA 3SEOA 4DVYP 2EIKC 1HE1A 3SXYA 4AL0A 4NY3A 5A69A 2OJQA 1Y6DA 4XQ1A 2KK1A 1Z3IX 3RF3A 2W9YA 3GEEA 1U0BB 1LM3B 2WZGA 1OW7A 5CI8A 4YL1A 4MTGA 3NKEA 2HSBA 2NSFA 3OWTA 3VRCA 3U2LA 4LDRA 1GGQA 1VYKA 3I5PA 1ZHTA 3IQTA 2EPKX 2Y3BA 4IGGA 4NCQA 3QTHA 2IXOA 1LVKA 4JVSA 2KSFA 2QE9A 4QDLA 1QQ3A 4JEBA 4BJ5C 1NFOA 4I1OB 2TMVP 1EKYA 2VCAA 1E86A 2YQYA 1QSPA 2NPUA 1NU7D 1XWJA 4PK4A 3T6GB 3NG1A 2W4MA 2WL8A 2CW0F 3ZG1A 5A6JA 1RJ9A 1O3UA 1FFHA 2M64A 2XLHA 3JRMO 4JCZA 3RVZA 4DBQA 1JPNA 2J7PA 3JTLO 3M4CA 4CS9C 2D4UA 3K1IA 3TOMA 2LCHA 1BR4A 1SMYF 4O79A 3W2VA 4E17A 1ZVZA 2XL6A 3W8HA 2HV7A 4PFPA 1J8YF 1MNDA 3DAGA 3DZAA 3RVYA 4I3MA 3JCUQ 1TKNA 1CPRA 2ASRA 3CSKA 3FXHA 4XEVA 4RD9A 5EGYA 2VB6A 4IAQA 1H6GA 2EINC 2H8AA 3U5SA 3TULA 1NU9C 1LS4A 1TWCA 3GM1A 2GA0A 5BQGA 2R7QA 3S0XA 1TWGA 3TK0A 2ZXWC 3GEHA 2XLMA 4JW1A 4MTOA 4A2NB 1R5ID 1ZHWA 3ZDLA 3U8PA 3JYHA 4KC9A 4MVOA 2Z15A 4FWVA 4ULVA 3ZIBA 2R7OA 1R4TA 4CSAC 3H65A 3LS0A 4W8PA 2HMQA 1HMOA 1YZAA 1NZEA 1OCZC 5L0DA 4GEHA 4YN0B 4O6MA 4JIOA 1B68A 2YLDA 1ZU4A
chains in the Genus database with same CATH topology
1VYIA 2YZSA 3EZHA 3W8IA 3SP1A 3EGXA 4Q4ZF 2EIMC 2G62A 2XL4A 4QI2A 4HFKB 1QZXA 3LESA 4E7ZA 1OCRC 4XTKA 4O6NA 2DYSC 3JSZA 1J8MF 3UNGC 2J0XA 1D0ZA 4ZLCA 5KYXA 5KYYA 2R7RA 1D1CA 2J9VA 4PJNA 3VYWA 3WG7C 2PP4A 3K66A 5B3SC 3DAFA 3QZCA 2E87A 3EGDB 3DXJF 3DJNB 4H4KC 3ASOC 1TWAA 4FESA 2NG1A 5DQZA 2Q3TA 1MMNA 2P7VA 3GODA 4U5HA 3NRHA 4WJ0A 1QLEC 2NUPA 4W8KA 2V26A 3VAYA 3UMHA 2XRHA 3DM9B 4HFFB 5CI9A 2CNWD 4CS8A 2BE5F 1MMAA 2WVQA 1MNEA 4XWJA 4LERA 2V3CC 3DD7A 4GYTA 2ZXOA 3RFYA 4Q7CA 1G8XA 3DJUB 3CQZA 5B1BC 4OD5A 3JT1A 4C7OA 5D92A 1S7ZA 3S27A 4DOZA 5T3WA 2PX3A 2Q9CA 3KL4A 1ZHZA 4C3BA 5KYWB 3LJBA 4PFOA 2JD3A 3Q6NA 1OCOC 3LNRA 3SNHA 2LSEA 4ULWA 3UGPA 4LACB 1KU2A 4U5GA 3KKBA 2XXAA 2R7UA 3K1IC 3EHNA 3EQLF 4C3DA 3K33A 4N06A 2YEVA 3B0PA 4PJMA 2J9WA 2IYLD 4JCHA 4Q5SF 3L0IA 3ECSA 2J9UA 2O9XA 3Q6MA 5EHHA 3X1OA 3L34A 4O6YA 4QI0A 3QMKA 4YT4A 2FFHA 1O87A 1RJ9B 4E7SA 5IY5C 3EH2A 3LEVA 2Y69C 5HSWA 4EWCA 2C03A 2EILC 3EJNA 3FHDA 5BUOA 4XLNF 2NUTA 2PX0A 1PCXA 1OKKA 4G7HF 3NKDA 4U5CE 3N2ZB 4ZLDA 2R7TA 1ZHXA 4RDAA 4KNWA 2CGEA 4JJFA 4IWBA 3ABMC 2GFHA 2Y39A 3O6XA 1VMAA 3LLIA 2ZPAA 2J46A 1M2OA 5KYUA 2A68F 3RIPA 3AG2C 2WB7A 2VH3A 3UGOA 3N0TA 3AG4C 2KGOA 4HE8D 1Z63A 2H7VC 3UMIA 4BJ1A 3ASNC 3SZRA 1M2VA 3ZVRA 3GANA 3OA1A 3TD7A 2EIJC 3RH3A 3EGXB 3E70C 2IXMA 4LLEA 3EFOB 5DLJA 2R7WA 4YT5A 3LS1A 2KW3C 2WZFA 3FDQA 2YHSA 4G7OF 4DBRA 5KYXB 5KYYB 2DYRC 3DMDA 3F47A 2WVNA 4CS8C 1TWHA 1SF8A 3HJCA 2OG2A 3EG9A 3OEOA 4CS7A 1NG1A 2C04A 1VOMA 3O39A 5DQTA 3CZ6A 2B0JA 2PF4E 4YT2A 3W2WA 1N1CA 4CIHA 5E3AA 3Q7GA 2ZXPA 2NUPB 3JRTA 2H7BA 1D0XA 3T4RA 4J32B 2ZXRA 3N24A 1M57C 3X2QC 3ZC4A 1ST6A 4DVZA 4MNDA 2G3KA 1SZIA 1FFTC 2G3VA 4AE4A 5T3TA 2MWQA 3RYLA 2PFDA 2P6VA 2R7XA 4U5EE 4C7OB 4U5DE 3RKOF 3PMRA 1Z5ZA 5F5HA 1ZU5A 1O5HA 2Y3DA 4G7ZF 1D1AA 5F5FA 1TR2A 1FMVA 1IW7F 3F46A 2XXAB 1FMWA 4O7GA 2X51A 3I4UA 4YJWA 3K1HA 4KI2A 1PD1A 3FVYA 3NYMA 4CBEA 4BJ6A 3LLKA 3MX3A 2J7PD 2Q9BA 4XLPF 2Q9AA 4YWQA 4OIQF 2IXPA 4RBNA 3FAJA 2J0WA 4K0DA 4MQ9F 5DVWA 4OIOF 4ANJA 3B0UX 5L3VA 4G0HA 4HEAJ 2D5RB 2CDQA 1OKKD 4PJJA 2OCCC 4M63A 1PD0A 2NUTB 2WVOA 4BJ5A 2R7SA 4OIPF 1OCCC 4OINF 3MLGA 1JPJA 4AX2A 2VASA 3E9VA 4I1MA 4J30B 1BR1A 3HTKC 1VK5A 2A69F 3UR3C 3POVA 2L9JA 4U5FE 2A6EF 4BEJA 4CS9A 3T6BA 5DS6A 5KYUB 1MMDA 5B1AC 1ZYRF 1MMGA 3ABLC 3S28A 4JJGA 2MYSA 4OIRF 1LKXA 3UMKA 3S29A 1M2VB 3KH2A 3DM5A 4P6IC 4BJTA 3NYLA 2R7VA 4KBLA 3EHMA 4BG0A 4EBBA 4JZAA 5DS4A 5KYNA 2IOQA 2M4EA 3NYJA 2Y3HA 5E33A 1BR2A 2WZLA 4CSAA 1D1BA 3EFOA 3NDBB 4OD4A 1LS1A 3ITFA 3EH1A 3WODF 2A6HF 5E3CA 3EGDA 2QTVA 4I44A 3EG9B 2Y3GA 1V54C 1ZHYA 3SYNA 4K7BA 2W4BA 3ZSUA 4U5BE 4KNVA 2IXNA 3EPVA 2QY9A 3Q7LA 1Z6AA 3IEEA 1IZMA 3AQCA 2A1DD 3LAYA 4F4BA 2KJGA 3PHF2 3EZIA 4IRUA 3KMIA 2CNWA 4IAOA 3V7OA 1M56C 2J45A 3K7DA 1Z23A 3B0VC 4X0RA 2L81A 4PJLA 1D0YA 2DGJA 3AG3C 5FCLA 2HV6A 4AE4B 5DS5A 2XSEA 2I8BA 2KQ9A 3B9QA 3I5QA 2KNHA 4LLCA 4YT8A 4AK9A 1W2WA 3T6JA 4B6IA 5L3QA 4BJ6C 3ABKC 5E2QA 4IJJA 4FX5A 3AG1C 3AQBA 5T1DB 5KYWA 1WGWA 3M1CB 4JURI 5D91A 3K6BA 1V55C 4C3EA 3HLZA 1FTSA 2H7OA 2W45A 2FGYA 3SEOA 4DVYP 2EIKC 4NY3A 1Z3IX 2W9YA 2WZGA 5CI8A 3NKEA 3OWTA 1VYKA 3I5PA 1ZHTA 2Y3BA 4QDLA 2IXOA 1LVKA 4JVSA 4BJ5C 4I1OB 1NU7D 4PK4A 3NG1A 2W4MA 2WL8A 2CW0F 3ZG1A 1RJ9A 1FFHA 4DBQA 1JPNA 2J7PA 4CS9C 1BR4A 1SMYF 4O79A 3W2VA 3W8HA 2HV7A 4PFPA 1J8YF 1MNDA 3DAGA 3DZAA 4I3MA 3JCUQ 1TKNA 3CSKA 4RD9A 5EGYA 2VB6A 2EINC 1NU9C 1TWCA 2R7QA 3S0XA 1TWGA 4A2NB 2ZXWC 4JW1A 1ZHWA 3JYHA 4KC9A 2Z15A 4FWVA 3ZIBA 2R7OA 4CSAC 3H65A 3LS0A 1NZEA 1OCZC 4GEHA 4YN0B 4O6MA 1ZU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKO F;  4HEA J;  4HE8 D; 
#chains in the Genus database with same CATH topology
 4N6H A;  1VYI A;  1T6Q A;  1H7I A;  1EA8 A;  2XM0 A;  2YZS A;  3IHU A;  3EZH A;  3W8I A;  4MVZ A;  3SP1 A;  3EGX A;  3O55 A;  4Q4Z F;  3GOR A;  2EIM C;  2G62 A;  2XL4 A;  5CIV A;  4HFK B;  1QZX A;  4QI2 A;  3LES A;  4D4N A;  2AWC A;  4R32 A;  1OCR C;  4XTK A;  4E7Z A;  4O6N A;  3ZTM A;  2DYS C;  2AVK A;  3JSZ A;  1J8M F;  3UNG C;  2J0X A;  4D4X A;  1H9G A;  1D0Z A;  4ZLC A;  5KYX A;  5KYY A;  1U6H A;  1D1C A;  1G5Z A;  2R7R A;  1U89 A;  4JTA B;  2J9V A;  5AC4 A;  4PJN A;  4DRI B;  4NTB A;  3VYW A;  3WG7 C;  2FAP B;  2YLG A;  2PP4 A;  5L0G A;  3K66 A;  4DJ9 A;  3V5Y A;  4MTF A;  5B3S C;  3DAF A;  1YVI A;  1VLT A;  1K40 A;  3QZC A;  2E87 A;  3EGD B;  1XZQ A;  3DXJ F;  1HY5 A;  1SR2 A;  2NSG A;  1A41 A;  5JSL A;  3DJN B;  4H4K C;  3QVZ A;  4BPM A;  1PV3 A;  3ASO C;  1H9T A;  1TWA A;  1RKE A;  2NG1 A;  3QW1 A;  1ZW2 A;  4FES A;  2Q3T A;  1MMN A;  2P7V A;  3GOD A;  4U5H A;  4AL1 A;  1EQ1 A;  3NRH A;  5L0F A;  4WJ0 A;  4CJO A;  1QLE C;  1K04 A;  2NUP A;  2V26 A;  3HNI A;  4W8K A;  4L6R A;  3VAY A;  1CGO A;  2A0B A;  1YA9 A;  4MVM A;  3UMH A;  5JRA A;  1LE4 A;  2XRH A;  1C02 A;  3DM9 B;  4HFF B;  1JOG A;  1V74 B;  5CI9 A;  2CNW D;  1YDI A;  4CS8 A;  1Q0F A;  2BE5 F;  1MMA A;  2WVQ A;  1MNE A;  4G78 A;  4XWJ A;  4LER A;  2V3C C;  4UDV A;  3ATP A;  2GAQ A;  3DD7 A;  2RD9 A;  1V4A A;  4GYT A;  2ZXO A;  1F1M A;  3AGT A;  1OW6 A;  2X0C A;  1ORS C;  3RFY A;  3IQ5 A;  1Y4C A;  2HSQ A;  4Q7C A;  1G8X A;  3JYY A;  3DJU B;  3CQZ A;  5B1B C;  4OD5 A;  3A11 A;  1JMW A;  1RXQ A;  2UUI A;  3JT1 A;  4C7O A;  2XLO A;  1S7Z A;  5D92 A;  3S27 A;  4DOZ A;  1FR0 A;  4N4W A;  3VF0 A;  4JTC B;  5T3W A;  1ZW3 A;  2PX3 A;  2Q9C A;  2YKZ A;  2OKU A;  1GS9 A;  3B29 A;  3GWN A;  3KL4 A;  4MVU A;  5EK0 A;  3US6 A;  4PAC A;  1ZHZ A;  4C3B A;  4CDA A;  1KNY A;  5KYW B;  3R7C A;  3HKK A;  3LJB A;  2QLA A;  2UUH A;  2JD3 A;  2GWW A;  3Q6N A;  4PFO A;  1OCO C;  2HKV A;  1HW1 A;  1NBB A;  1T6U A;  3LNR A;  3SNH A;  2LSE A;  5BQI A;  2VCC A;  1WOL A;  3SXZ A;  4ULW A;  3UGP A;  3MBG A;  1FNT c;  1A7V A;  4YK5 A;  4LAC B;  1KU2 A;  4U5G A;  1DOV A;  1OW8 A;  3KKB A;  2XXA A;  2R7U A;  3K1I C;  5A6K A;  1VB5 A;  1WTY A;  3C8G A;  3EHN A;  1S05 A;  2R9R B;  5A6B D;  3EQL F;  4C3D A;  3CEX A;  3K33 A;  4N06 A;  2YEV A;  3B0P A;  1RCP A;  4PJM A;  2J9W A;  5F28 E;  2CCY A;  4MVQ A;  2LFF A;  5K0I A;  2IYL D;  3ZQV A;  1AVO B;  3FOO A;  5COM A;  3U9J A;  4JCH A;  1TQG A;  4Q5S F;  5A6A A;  1FAP B;  1AUE A;  1CGN A;  4DXW A;  3L0I A;  3ECS A;  2B0H A;  2J9U A;  4G7O F;  2J9B A;  2O9X A;  3Q6M A;  5EHH A;  1OXB A;  3X1O A;  3L34 A;  4J7Y A;  2PNO A;  4O6Y A;  1JRA A;  4QI0 A;  1Q0K A;  3QMK A;  4YT4 A;  2FFH A;  1BDJ B;  3GEI A;  5JP7 A;  1O87 A;  1RJ9 B;  4E7S A;  5IY5 C;  4JEA A;  3EH2 A;  3LEV A;  2Y69 C;  5HSW A;  3QVY A;  4EWC A;  2C03 A;  2EIL C;  3C62 A;  4YL3 A;  1LIH A;  3EJN A;  3FHD A;  5BUO A;  1HMD A;  4XLN F;  2NUT A;  2PX0 A;  1PCX A;  1LE2 A;  1OKK A;  4PR9 A;  5L0J A;  3FAP B;  4G7H F;  4FAP B;  3NKD A;  4U5C E;  3HNJ A;  3N2Z B;  4ZLD A;  1HE9 A;  2R7T A;  1ZHX A;  4RDA A;  4KNW A;  3VM6 A;  2CGE A;  1YJG A;  4JJF A;  4IWB A;  5JS5 A;  3ABM C;  2GFH A;  3GM3 A;  4MW8 A;  2Y39 A;  4P9T A;  3O6X A;  3KYJ A;  1C03 A;  1VMA A;  1YYX A;  2HJ3 A;  2ZPA A;  2J46 A;  1YYJ A;  3G4Z A;  1DOW A;  1M2O A;  2A68 F;  5KYU A;  3RIP A;  3AG2 C;  2WB7 A;  1ORY A;  1WAS A;  2VH3 A;  3IQC A;  3N0T A;  3AG4 C;  5L0H A;  4EUK B;  3UGO A;  2R02 A;  1NSG B;  1T6I A;  2KGO A;  4HE8 D;  1NLX A;  5DQZ A;  1Z63 A;  2H7V C;  4XPX A;  4MVR A;  3UMI A;  3H2V A;  4BJ1 A;  1QPU A;  3ASN C;  1BBH A;  1TFK B;  4JTD B;  3SZR A;  1M2V A;  3ZVR A;  3GAN A;  1C17 M;  1NFN A;  3A9C A;  2EIJ C;  3OA1 A;  4YL0 A;  3TD7 A;  3RH3 A;  3L1M A;  4U9D A;  2XLD A;  3EGX B;  3E70 C;  2IXM A;  4LLE A;  1HW2 A;  3EFO B;  3PDM P;  5DLJ A;  2Q00 A;  3AOU A;  4YT5 A;  3HNK A;  2R7W A;  3V5X A;  4EBJ A;  3LS1 A;  2KW3 C;  2WZF A;  4JC7 A;  3FDQ A;  2YL1 A;  2HMZ A;  2YHS A;  3G4X A;  3MYF A;  1YLM A;  1A0B A;  4DBR A;  2BC5 A;  3LNM B;  5KYY B;  5KYX B;  2DYR C;  3DMD A;  2EPM X;  1LI5 A;  3F47 A;  4NTA A;  3RQF A;  2WVN A;  4CS8 C;  1A7D A;  1TWH A;  1SF8 A;  3HJC A;  2VCB A;  2Q4F A;  3M15 A;  2OG2 A;  3EG9 A;  3OEO A;  2EPL X;  3G50 A;  4CS7 A;  1NG1 A;  1K05 A;  2C04 A;  2OU6 A;  1KTM A;  1VOM A;  3O39 A;  5DQT A;  3CZ6 A;  2KYH A;  2B0J A;  2PF4 E;  4YT2 A;  1MQV A;  5COF A;  2HZ8 A;  3U2M A;  2GDC A;  3W2W A;  1RKE B;  5TJ5 E;  2XM4 A;  1N1C A;  4CIH A;  5E3A A;  3Q7G A;  1EI7 A;  1L7C A;  2NUP B;  2ZXP A;  3FOP A;  4DRJ B;  3JRT A;  4E0I A;  2H7B A;  1YAU O;  3LEO A;  1D0X A;  2YLI A;  4J32 B;  3T4R A;  2ZXR A;  1GM5 A;  4BEM J;  3WHN A;  2AP3 A;  1M57 C;  3MFN A;  3N24 A;  3X2Q C;  5L0I A;  3RQG A;  1WAT A;  3ZC4 A;  2XS8 A;  3S90 A;  2XS1 A;  1APC A;  4NC3 A;  3B71 A;  3GWL A;  2OJE D;  1ST6 A;  1RKC A;  4MVS A;  4DVZ A;  4MND A;  3M4B A;  2P61 A;  2G3K A;  1SZI A;  1FFT C;  2G3V A;  2KC3 A;  2LFD A;  5T3T A;  1I5N A;  4AE4 A;  1SYQ A;  4E0H A;  2MWQ A;  1UFB A;  4K1O A;  3RYL A;  1E84 A;  2PFD A;  2F22 A;  2P6V A;  2YL3 A;  2RSE B;  4NTF A;  4U5E E;  5JT4 A;  2R7X A;  3S9O A;  3ZWI A;  5JUA A;  4C7O B;  3WAQ A;  4U5D E;  3RKO F;  3PMR A;  4ONS A;  2HJM A;  1Z5Z A;  2LQG A;  4Z9H A;  5F5H A;  3DKA A;  1ZU5 A;  1O5H A;  3NMI A;  3U0C A;  1CGM E;  1T9K A;  3RQE A;  3U9M A;  2Y3D A;  4H54 A;  3U3F A;  2BL2 A;  4G7Z F;  2QNL A;  3FMS A;  4N6C A;  1D1A A;  3NMJ A;  5COG A;  1WN0 A;  2QUP A;  2LK4 A;  3LLI A;  4MS2 A;  4XPY A;  5F5F A;  5JLI A;  2OEV A;  2ICW G;  1TR2 A;  1FMV A;  2EPN A;  2ZD9 A;  1IW7 F;  2VC9 A;  2YVK A;  3F46 A;  5B3I A;  2L6G A;  2XXA B;  1FMW A;  1TFO B;  4O7G A;  2X51 A;  2L6H A;  3C8G B;  3HNL A;  3I4U A;  4YJW A;  5FZT A;  3K1H A;  1Q0M A;  4KI2 A;  1PD1 A;  3FVY A;  3NYM A;  4CBE A;  4EIY A;  4BJ6 A;  3LLK A;  1OR2 A;  1YAR O;  5HV9 A;  3MX3 A;  3AGU A;  1OXK A;  2J7P D;  4JKV A;  4CJG A;  2Q9B A;  2YL7 A;  4ER9 A;  4XLP F;  2Q9A A;  4YWQ A;  5A6B A;  4OIQ F;  2IXP A;  4RBN A;  3FAJ A;  3SXM A;  2LD6 A;  3C18 A;  2J0W A;  4K0D A;  1QKR A;  3KPH A;  2XLV A;  4MQ9 F;  5DVW A;  4OIO F;  4EBK A;  4ANJ A;  2HFI A;  2LP4 A;  3B0U X;  1G4U S;  5L3V A;  2ETS A;  4G0H A;  2DB4 A;  4HEA J;  3U3B A;  2D5R B;  4EHP A;  2XLW A;  5AGF A;  1T5O A;  2CDQ A;  2I15 A;  1OKK D;  2L6F A;  2R05 A;  2OEX A;  4A4A A;  3M79 A;  4PJJ A;  2R25 A;  2OCC C;  4M63 A;  3NMK A;  4LDK A;  1PD0 A;  2NUT B;  2WVO A;  4BJ5 A;  2R7S A;  3ZQY A;  1OCC C;  4JRZ A;  3MLG A;  1JPJ A;  1VLS A;  4OIN F;  4AX2 A;  2VAS A;  4OIP F;  1Q0D A;  4CDV A;  2J8W A;  3E9V A;  4I1M A;  5JVE A;  3DE8 A;  1BR1 A;  4J30 B;  4MW3 A;  3TJ6 A;  1E83 A;  4CX9 A;  3HTK C;  1BZ4 A;  4WGZ A;  3H2U A;  3KYI A;  1VK5 A;  2XLE A;  4DRH B;  2A69 F;  2XL8 A;  4WAB A;  3UR3 C;  3POV A;  2L9J A;  4U5F E;  3TOL A;  5L0C A;  1OQC A;  1VTM P;  2A6E F;  2CYD A;  4BEJ A;  3T6B A;  1ORJ A;  2EPO A;  4CS9 A;  5AC5 A;  5DS6 A;  3IQ6 A;  5KYU B;  2IM8 A;  1MMD A;  4Z9I A;  4XPW A;  5B1A C;  1ZZP A;  1ZYR F;  1MMG A;  3CAX A;  4P9F A;  3ABL C;  3S28 A;  1YZC A;  3R2P A;  4NQF A;  3C8Z A;  4JJG A;  2YRF A;  2MYS A;  4OIR F;  1LKX A;  1YA7 O;  3UMK A;  1Z7Q c;  3S29 A;  1M2V B;  3KH2 A;  3DM5 A;  4P6I C;  4BJT A;  4IB4 A;  3NYL A;  2R7V A;  4KBL A;  3EHM A;  3QW0 A;  3GM2 A;  4BG0 A;  4EBB A;  4JZA A;  5DS4 A;  1M6T A;  2IOQ A;  5KYN A;  1I4Z A;  1T01 A;  2M4E A;  1I4Y A;  2P1A A;  2Y3H A;  3NYJ A;  5E33 A;  1BR2 A;  2WZL A;  2YWA A;  4CSA A;  1D1B A;  3EFO A;  1UG7 A;  4OD4 A;  3NDB B;  1XZP A;  2JPU A;  3L8I A;  2A0U A;  4EKW A;  1RMV A;  1LI7 A;  1LS1 A;  3ITF A;  1Q0G A;  4IAR A;  4JE9 A;  3EH1 A;  3J06 A;  3DWW A;  4GQH A;  2HS5 A;  2HUJ A;  3T9O A;  3ZTZ A;  3WOD F;  4CIP A;  4Z9J A;  2A6H F;  5E3C A;  3V5Z A;  3EGD A;  2QTV A;  2IBF A;  4I44 A;  1JR8 A;  3EG9 B;  1LPE A;  2Y3G A;  1V54 C;  1ZHY A;  2L7A A;  3U8V A;  4LDQ A;  3AJM A;  2MHR A;  4K7B A;  2W4B A;  3SYN A;  3ZSU A;  4U5B E;  2OQM A;  4KNV A;  2IXN A;  3EPV A;  1QVX A;  2QY9 A;  3JSE O;  4E18 A;  4U9E A;  3W4Y A;  3Q7L A;  1Z6A A;  3IEE A;  1E85 A;  3IPM O;  1IZM A;  2PBE A;  3C63 A;  2DI3 A;  2Q7R A;  2AU5 A;  3AQC A;  2A1D D;  3JZ0 A;  3LAY A;  3L8J A;  5GPG B;  4F4B A;  2KJG A;  4CDY A;  3PHF 2;  256B A;  3EZI A;  4IRU A;  4XEK A;  1AEP A;  3LUT B;  3KMI A;  3DI5 A;  2CNW A;  4IAO A;  3V7O A;  1M56 C;  2J45 A;  3SXK A;  3TQO A;  3K7D A;  1GQA A;  1L3P A;  1Z23 A;  3B0V C;  4X0R A;  3O10 A;  2L81 A;  4PJL A;  1D0Y A;  3TJ5 A;  2DGJ A;  1A7E A;  3AG3 C;  5FCL A;  2HV6 A;  3C7J A;  3DE9 A;  2XSE A;  1JAF A;  4AE4 B;  5DS5 A;  2I8B A;  1WWP A;  2KQ9 A;  2P0N A;  3MYI A;  3B9Q A;  4XEF A;  1G4W R;  3BEH A;  4J7T A;  3I5Q A;  2KNH A;  2OOC A;  4LLC A;  4YT8 A;  2AWY A;  3BRJ A;  4AK9 A;  1W2W A;  3T6J A;  4B6I A;  5L3Q A;  1E2X A;  4BJ6 C;  2LIG A;  3ABK C;  5E2Q A;  2R03 A;  4IJJ A;  2YL0 A;  1CPQ A;  4FX5 A;  4WGY A;  3RW0 A;  3S84 A;  3AG1 C;  3AQB A;  5T1D B;  5KYW A;  1WGW A;  3M1C B;  4JUR I;  3PCV A;  5D91 A;  2JX0 A;  1OR3 A;  3C8G D;  3K6B A;  1V55 C;  5BQH A;  4C3E A;  3HLZ A;  1FTS A;  2H7O A;  2W45 A;  2FGY A;  3SEO A;  4DVY P;  2EIK C;  1HE1 A;  3SXY A;  4AL0 A;  4NY3 A;  5A69 A;  2OJQ A;  1Y6D A;  4XQ1 A;  2KK1 A;  1Z3I X;  3RF3 A;  2W9Y A;  3GEE A;  1U0B B;  1LM3 B;  2WZG A;  1OW7 A;  5CI8 A;  4YL1 A;  4MTG A;  3NKE A;  2HSB A;  2NSF A;  3OWT A;  3VRC A;  3U2L A;  4LDR A;  1GGQ A;  1VYK A;  3I5P A;  1ZHT A;  3IQT A;  2EPK X;  2Y3B A;  4IGG A;  4NCQ A;  3QTH A;  2IXO A;  1LVK A;  4JVS A;  2KSF A;  2QE9 A;  4QDL A;  1QQ3 A;  4JEB A;  4BJ5 C;  1NFO A;  4I1O B;  2TMV P;  1EKY A;  2VCA A;  1E86 A;  2YQY A;  1QSP A;  2NPU A;  1NU7 D;  1XWJ A;  4PK4 A;  3T6G B;  3NG1 A;  2W4M A;  2WL8 A;  2CW0 F;  3ZG1 A;  5A6J A;  1RJ9 A;  1O3U A;  1FFH A;  2M64 A;  2XLH A;  3JRM O;  4JCZ A;  3RVZ A;  4DBQ A;  1JPN A;  2J7P A;  3JTL O;  3M4C A;  4CS9 C;  2D4U A;  3K1I A;  3TOM A;  2LCH A;  1BR4 A;  1SMY F;  4O79 A;  3W2V A;  4E17 A;  1ZVZ A;  2XL6 A;  3W8H A;  2HV7 A;  4PFP A;  1J8Y F;  1MND A;  3DAG A;  3DZA A;  3RVY A;  4I3M A;  3JCU Q;  1TKN A;  1CPR A;  2ASR A;  3CSK A;  3FXH A;  4XEV A;  4RD9 A;  5EGY A;  2VB6 A;  4IAQ A;  1H6G A;  2EIN C;  2H8A A;  3U5S A;  3TUL A;  1NU9 C;  1LS4 A;  1TWC A;  3GM1 A;  2GA0 A;  5BQG A;  2R7Q A;  3S0X A;  1TWG A;  3TK0 A;  2ZXW C;  3GEH A;  2XLM A;  4JW1 A;  4MTO A;  4A2N B;  1R5I D;  1ZHW A;  3ZDL A;  3U8P A;  3JYH A;  4KC9 A;  4MVO A;  2Z15 A;  4FWV A;  4ULV A;  3ZIB A;  2R7O A;  1R4T A;  4CSA C;  3H65 A;  3LS0 A;  4W8P A;  2HMQ A;  1HMO A;  1YZA A;  1NZE A;  1OCZ C;  5L0D A;  4GEH A;  4YN0 B;  4O6M A;  4JIO A;  1B68 A;  2YLD A;  1ZU4 A; 
#chains in the Genus database with same CATH homology
 1VYI A;  2YZS A;  3EZH A;  3W8I A;  3SP1 A;  3EGX A;  4Q4Z F;  2EIM C;  2G62 A;  2XL4 A;  4QI2 A;  4HFK B;  1QZX A;  3LES A;  4E7Z A;  1OCR C;  4XTK A;  4O6N A;  2DYS C;  3JSZ A;  1J8M F;  3UNG C;  2J0X A;  1D0Z A;  4ZLC A;  5KYX A;  5KYY A;  2R7R A;  1D1C A;  2J9V A;  4PJN A;  3VYW A;  3WG7 C;  2PP4 A;  3K66 A;  5B3S C;  3DAF A;  3QZC A;  2E87 A;  3EGD B;  3DXJ F;  3DJN B;  4H4K C;  3ASO C;  1TWA A;  4FES A;  2NG1 A;  5DQZ A;  2Q3T A;  1MMN A;  2P7V A;  3GOD A;  4U5H A;  3NRH A;  4WJ0 A;  1QLE C;  2NUP A;  4W8K A;  2V26 A;  3VAY A;  3UMH A;  2XRH A;  3DM9 B;  4HFF B;  5CI9 A;  2CNW D;  4CS8 A;  2BE5 F;  1MMA A;  2WVQ A;  1MNE A;  4XWJ A;  4LER A;  2V3C C;  3DD7 A;  4GYT A;  2ZXO A;  3RFY A;  4Q7C A;  1G8X A;  3DJU B;  3CQZ A;  5B1B C;  4OD5 A;  3JT1 A;  4C7O A;  5D92 A;  1S7Z A;  3S27 A;  4DOZ A;  5T3W A;  2PX3 A;  2Q9C A;  3KL4 A;  1ZHZ A;  4C3B A;  5KYW B;  3LJB A;  4PFO A;  2JD3 A;  3Q6N A;  1OCO C;  3LNR A;  3SNH A;  2LSE A;  4ULW A;  3UGP A;  4LAC B;  1KU2 A;  4U5G A;  3KKB A;  2XXA A;  2R7U A;  3K1I C;  3EHN A;  3EQL F;  4C3D A;  3K33 A;  4N06 A;  2YEV A;  3B0P A;  4PJM A;  2J9W A;  2IYL D;  4JCH A;  4Q5S F;  3L0I A;  3ECS A;  2J9U A;  2O9X A;  3Q6M A;  5EHH A;  3X1O A;  3L34 A;  4O6Y A;  4QI0 A;  3QMK A;  4YT4 A;  2FFH A;  1O87 A;  1RJ9 B;  4E7S A;  5IY5 C;  3EH2 A;  3LEV A;  2Y69 C;  5HSW A;  4EWC A;  2C03 A;  2EIL C;  3EJN A;  3FHD A;  5BUO A;  4XLN F;  2NUT A;  2PX0 A;  1PCX A;  1OKK A;  4G7H F;  3NKD A;  4U5C E;  3N2Z B;  4ZLD A;  2R7T A;  1ZHX A;  4RDA A;  4KNW A;  2CGE A;  4JJF A;  4IWB A;  3ABM C;  2GFH A;  2Y39 A;  3O6X A;  1VMA A;  3LLI A;  2ZPA A;  2J46 A;  1M2O A;  5KYU A;  2A68 F;  3RIP A;  3AG2 C;  2WB7 A;  2VH3 A;  3UGO A;  3N0T A;  3AG4 C;  2KGO A;  4HE8 D;  1Z63 A;  2H7V C;  3UMI A;  4BJ1 A;  3ASN C;  3SZR A;  1M2V A;  3ZVR A;  3GAN A;  3OA1 A;  3TD7 A;  2EIJ C;  3RH3 A;  3EGX B;  3E70 C;  2IXM A;  4LLE A;  3EFO B;  5DLJ A;  2R7W A;  4YT5 A;  3LS1 A;  2KW3 C;  2WZF A;  3FDQ A;  2YHS A;  4G7O F;  4DBR A;  5KYX B;  5KYY B;  2DYR C;  3DMD A;  3F47 A;  2WVN A;  4CS8 C;  1TWH A;  1SF8 A;  3HJC A;  2OG2 A;  3EG9 A;  3OEO A;  4CS7 A;  1NG1 A;  2C04 A;  1VOM A;  3O39 A;  5DQT A;  3CZ6 A;  2B0J A;  2PF4 E;  4YT2 A;  3W2W A;  1N1C A;  4CIH A;  5E3A A;  3Q7G A;  2ZXP A;  2NUP B;  3JRT A;  2H7B A;  1D0X A;  3T4R A;  4J32 B;  2ZXR A;  3N24 A;  1M57 C;  3X2Q C;  3ZC4 A;  1ST6 A;  4DVZ A;  4MND A;  2G3K A;  1SZI A;  1FFT C;  2G3V A;  4AE4 A;  5T3T A;  2MWQ A;  3RYL A;  2PFD A;  2P6V A;  2R7X A;  4U5E E;  4C7O B;  4U5D E;  3RKO F;  3PMR A;  1Z5Z A;  5F5H A;  1ZU5 A;  1O5H A;  2Y3D A;  4G7Z F;  1D1A A;  5F5F A;  1TR2 A;  1FMV A;  1IW7 F;  3F46 A;  2XXA B;  1FMW A;  4O7G A;  2X51 A;  3I4U A;  4YJW A;  3K1H A;  4KI2 A;  1PD1 A;  3FVY A;  3NYM A;  4CBE A;  4BJ6 A;  3LLK A;  3MX3 A;  2J7P D;  2Q9B A;  4XLP F;  2Q9A A;  4YWQ A;  4OIQ F;  2IXP A;  4RBN A;  3FAJ A;  2J0W A;  4K0D A;  4MQ9 F;  5DVW A;  4OIO F;  4ANJ A;  3B0U X;  5L3V A;  4G0H A;  4HEA J;  2D5R B;  2CDQ A;  1OKK D;  4PJJ A;  2OCC C;  4M63 A;  1PD0 A;  2NUT B;  2WVO A;  4BJ5 A;  2R7S A;  4OIP F;  1OCC C;  4OIN F;  3MLG A;  1JPJ A;  4AX2 A;  2VAS A;  3E9V A;  4I1M A;  4J30 B;  1BR1 A;  3HTK C;  1VK5 A;  2A69 F;  3UR3 C;  3POV A;  2L9J A;  4U5F E;  2A6E F;  4BEJ A;  4CS9 A;  3T6B A;  5DS6 A;  5KYU B;  1MMD A;  5B1A C;  1ZYR F;  1MMG A;  3ABL C;  3S28 A;  4JJG A;  2MYS A;  4OIR F;  1LKX A;  3UMK A;  3S29 A;  1M2V B;  3KH2 A;  3DM5 A;  4P6I C;  4BJT A;  3NYL A;  2R7V A;  4KBL A;  3EHM A;  4BG0 A;  4EBB A;  4JZA A;  5DS4 A;  5KYN A;  2IOQ A;  2M4E A;  3NYJ A;  2Y3H A;  5E33 A;  1BR2 A;  2WZL A;  4CSA A;  1D1B A;  3EFO A;  3NDB B;  4OD4 A;  1LS1 A;  3ITF A;  3EH1 A;  3WOD F;  2A6H F;  5E3C A;  3EGD A;  2QTV A;  4I44 A;  3EG9 B;  2Y3G A;  1V54 C;  1ZHY A;  3SYN A;  4K7B A;  2W4B A;  3ZSU A;  4U5B E;  4KNV A;  2IXN A;  3EPV A;  2QY9 A;  3Q7L A;  1Z6A A;  3IEE A;  1IZM A;  3AQC A;  2A1D D;  3LAY A;  4F4B A;  2KJG A;  3PHF 2;  3EZI A;  4IRU A;  3KMI A;  2CNW A;  4IAO A;  3V7O A;  1M56 C;  2J45 A;  3K7D A;  1Z23 A;  3B0V C;  4X0R A;  2L81 A;  4PJL A;  1D0Y A;  2DGJ A;  3AG3 C;  5FCL A;  2HV6 A;  4AE4 B;  5DS5 A;  2XSE A;  2I8B A;  2KQ9 A;  3B9Q A;  3I5Q A;  2KNH A;  4LLC A;  4YT8 A;  4AK9 A;  1W2W A;  3T6J A;  4B6I A;  5L3Q A;  4BJ6 C;  3ABK C;  5E2Q A;  4IJJ A;  4FX5 A;  3AG1 C;  3AQB A;  5T1D B;  5KYW A;  1WGW A;  3M1C B;  4JUR I;  5D91 A;  3K6B A;  1V55 C;  4C3E A;  3HLZ A;  1FTS A;  2H7O A;  2W45 A;  2FGY A;  3SEO A;  4DVY P;  2EIK C;  4NY3 A;  1Z3I X;  2W9Y A;  2WZG A;  5CI8 A;  3NKE A;  3OWT A;  1VYK A;  3I5P A;  1ZHT A;  2Y3B A;  4QDL A;  2IXO A;  1LVK A;  4JVS A;  4BJ5 C;  4I1O B;  1NU7 D;  4PK4 A;  3NG1 A;  2W4M A;  2WL8 A;  2CW0 F;  3ZG1 A;  1RJ9 A;  1FFH A;  4DBQ A;  1JPN A;  2J7P A;  4CS9 C;  1BR4 A;  1SMY F;  4O79 A;  3W2V A;  3W8H A;  2HV7 A;  4PFP A;  1J8Y F;  1MND A;  3DAG A;  3DZA A;  4I3M A;  3JCU Q;  1TKN A;  3CSK A;  4RD9 A;  5EGY A;  2VB6 A;  2EIN C;  1NU9 C;  1TWC A;  2R7Q A;  3S0X A;  1TWG A;  4A2N B;  2ZXW C;  4JW1 A;  1ZHW A;  3JYH A;  4KC9 A;  2Z15 A;  4FWV A;  3ZIB A;  2R7O A;  4CSA C;  3H65 A;  3LS0 A;  1NZE A;  1OCZ C;  4GEH A;  4YN0 B;  4O6M A;  1ZU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...