4HE8D

Crystal structure of the membrane domain of respiratory complex i from thermus thermophilus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
160
structure length
160
Chain Sequence
b'MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGEIGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
molecule keywords NADH-quinone oxidoreductase subunit 7
molecule tags Oxidoreductase
total genus 51
structure length 160
sequence length 160
chains with identical sequence J
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00499 Oxidored_q3 NADH-ubiquinone/plastoquinone oxidoreductase chain 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1200 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4he8D00
3RKOF 4HEAJ 4HE8D
chains in the Genus database with same CATH superfamily
3W2VA 1GS9A 2NSFA 1AEPA 2OJED 4KI2A 3Q6MA 4PJMA 4U5BE 1OW8A 3B0PA 3HJCA 1C02A 1LPEA 2CNWD 2QTVA 2HSBA 2VC9A 1TQGA 1PD0A 1NU9C 1ZU4A 1E2XA 4N4WA 5D92A 5A6JA 2J9UA 3AG4C 3DM9B 4FESA 1V74B 1TWAA 2HUJA 3U5SA 3TJ6A 5EHHA 5L0IA 3I5QA 4BEMJ 2P6VA 1XZPA 2EIMC 2HMQA 3EPVA 2QE9A 2V3CC 2PNOA 1M56C 3JRTA 2JX0A 2A0BA 3RVZA 3SNHA 3QVYA 3U0CA 2VCBA 4EUKB 2R05A 2EIJC 2KK1A 4KBLA 4ZLCA 4IAOA 1OCCC 2WVOA 4A4AA 4CSAC 1ZHYA 3TOMA 1LE4A 4BJ1A 5JLIA 2EIKC 1F1MA 3EHMA 2CW0F 3U2LA 3ZC4A 4JJGA 3QMKA 2J46A 1NZEA 4JTAB 1E83A 3EJNA 3JCUQ 1RCPA 1LIHA 4MTFA 5E33A 2J0WA 4AL1A 1LM3B 1O87A 5KYYB 2GAQA 4N06A 5JP7A 1HW2A 2TMVP 1GQAA 3AQBA 4RBNA 4BJ6A 4DVYP 4DBQA 4H4KC 1R5ID 4E0HA 3ABMC 2J9VA 2OOCA 4M63A 4EIYA 4DJ9A 2BC5A 2XS8A 2Q00A 2AWYA 1YYXA 2XM4A 4Z9JA 3FXHA 2EPLX 3OWTA 5A6BD 3X2QC 2KJGA 1PD1A 1Q0GA 1VK5A 2P1AA 2QNLA 4EBKA 5COFA 3EHNA 1V55C 1YYJA 3U2MA 1HY5A 3EFOB 2WVQA 1IW7F 3W8IA 5DS4A 1BR2A 1H9TA 5KYUA 4CDYA 2R7QA 3SP1A 1WN0A 4NCQA 2G62A 2CYDA 3HNIA 4JEAA 1E86A 2Q4FA 2NSGA 2PF4E 4U5DE 4MW3A 1D1BA 4U5CE 4YT5A 4CBEA 4X0RA 3TD7A 4B6IA 4U5FE 4QDLA 3C8GD 3VRCA 3E70C 256BA 4O6MA 4RDAA 1NU7D 3IPMO 3Q6NA 3B9QA 4AX2A 1UG7A 1NG1A 2H7VC 2O9XA 3NKDA 5K0IA 5KYWA 3FOOA 5T1DB 2R7RA 3G50A 4FWVA 4C7OA 2G3KA 2R7WA 4NQFA 4BJ5C 1WTYA 3KPHA 5A69A 1FMVA 2HJMA 5COGA 1U89A 3IQCA 3EH2A 5CI9A 2A69F 2CCYA 2PFDA 5EK0A 5T3WA 4FX5A 1HMOA 4AK9A 1ZHWA 2DGJA 5L3QA 2XXAB 3ZTMA 4HE8D 4J7TA 1OW6A 2L6GA 4CX9A 3DJUB 2J9WA 3EZHA 1Z5ZA 1APCA 2MYSA 3BRJA 1FNTc 4OIQF 3HTKC 4EWCA 3HNKA 4NY3A 4XWJA 5F5FA 2P0NA 3K33A 4DXWA 3MYFA 3Q7LA 3DZAA 2FFHA 3L8JA 3GEHA 3QW1A 1D1AA 1T6UA 2IXMA 4P9TA 3A9CA 3CEXA 3CQZA 5JRAA 3U3BA 1RXQA 3LESA 3AG2C 5CI8A 2Y3GA 3KMIA 3ZIBA 3POVA 4JJFA 1U6HA 4MVUA 1TKNA 2XLDA 1CPQA 3EZIA 5DQTA 4LACB 2F22A 2JD3A 2UUHA 4EHPA 4QI0A 5F28E 1RJ9B 1LI5A 2A1DD 3AOUA 2R9RB 3C8ZA 3SZRA 4BEJA 4QI2A 1BR1A 2DB4A 2YEVA 4IB4A 3U8VA 3EG9B 5FZTA 2RD9A 1SYQA 1XZQA 3R2PA 1IZMA 2B0HA 1HE1A 3LEOA 4YK5A 4PJLA 2FGYA 2R7UA 3I4UA 4IRUA 4MVZA 4JRZA 1ZZPA 3L34A 4JE9A 1FMWA 3QTHA 3B71A 3GM3A 4HFFB 2GWWA 1PV3A 2RSEB 3QVZA 3ZSUA 1BBHA 2KYHA 2VCAA 5DVWA 1TR2A 4MVQA 1LKXA 4CS8C 4E0IA 1OKKD 4AE4A 4ZLDA 5BQGA 3LEVA 2IXOA 3J06A 1Z7Qc 3K7DA 4CDVA 1RMVA 2WZLA 2ZXPA 4AE4B 3CAXA 3PCVA 3VF0A 3W8HA 2AU5A 2X51A 3AGUA 4BJTA 3T6JA 2I15A 1ZHZA 1YZCA 4KC9A 1MNDA 2KQ9A 4Q7CA 5DLJA 2C03A 3G4ZA 3E9VA 1M6TA 4J7YA 3NYMA 3N24A 2OEXA 1G5ZA 3WHNA 2GDCA 2W9YA 4N6CA 1BZ4A 4LDKA 1RKCA 2DYSC 3KYIA 1TWGA 4MS2A 2NG1A 3NYLA 4DRJB 2EPKX 1YARO 2XLHA 2EPMX 3NRHA 3DM5A 4U9DA 1T5OA 3LLKA 3LLIA 1MQVA 2NUTB 4L6RA 4NC3A 3T6GB 2XS1A 1V4AA 1MMNA 2EILC 2P61A 5KYYA 2ZXWC 4CIHA 1ORJA 3V5XA 2BL2A 1WWPA 1G8XA 2J7PA 5A6KA 4CJOA 3ZVRA 5BQIA 2A6EF 1JPNA 4CS9C 1VOMA 3RQFA 3RH3A 3T9OA 2IM8A 5AC4A 1B68A 3M15A 2YLDA 3UR3C 1ZVZA 2HFIA 1O3UA 3QW0A 3S27A 3NMJA 3SXMA 4DRIB 2OU6A 1A7DA 4YWQA 5HV9A 5IY5C 3VM6A 4N6HA 2ASRA 2MWQA 3TOLA 2D4UA 2HV7A 1ORSC 1PCXA 4IWBA 1E84A 4OD4A 2FAPB 5JVEA 5B3SC 2OEVA 2YZSA 3DMDA 1I5NA 3KL4A 4A2NB 3S90A 3KYJA 2IBFA 3V5ZA 3EFOA 1H6GA 4ULWA 4W8KA 3A11A 3LNMB 3SYNA 3EQLF 1VLSA 3W4YA 4CSAA 1S05A 3OEOA 4K7BA 4Z9IA 4Q4ZF 1H9GA 3TJ5A 4G7HF 1V54C 2E87A 5KYNA 1BR4A 3F47A 2L81A 4W8PA 2L6FA 1NLXA 1T6IA 3AJMA 3DWWA 4MTGA 3S84A 1YJGA 1YA9A 3UNGC 1TWCA 2YVKA 2YQYA 1U0BB 3IQ6A 1L3PA 2H7BA 3FOPA 3M4BA 3O10A 1ZHTA 2EPOA 4JCHA 3FDQA 3FMSA 4RD9A 1OCZC 1CGME 2H8AA 2J0XA 1C03A 2YLGA 3MYIA 1XWJA 4P9FA 2WZFA 1ZHXA 3US6A 1AVOB 3T6BA 1M2VB 3C8GB 2DI3A 3I5PA 3DJNB 3X1OA 3JSEO 1CPRA 3ASNC 2P7VA 3M1CB 3UMIA 1SMYF 4WJ0A 4ONSA 1BDJB 2W4BA 3K1HA 3T4RA 1LS1A 3AGTA 5BUOA 5EGYA 3B29A 4DVZA 2IOQA 2YLIA 4AL0A 2XXAA 3K1IA 1FFHA 1NFNA 2A0UA 1T01A 3O55A 4PK4A 1M57C 3M79A 1A41A 4MVRA 4IJJA 2Y39A 4U5GA 3LAYA 4C3EA 2R25A 1DOWA 2LK4A 2OKUA 3SXZA 2IXNA 4I44A 2LFDA 1ZU5A 3L1MA 1GM5A 2OCCC 3L0IA 4J32B 1MMAA 1NFOA 2HSQA 1JMWA 3OA1A 2Q9BA 3LNRA 1RKEB 4YT4A 2JPUA 1WASA 4IGGA 5BQHA 1MMGA 3C7JA 3PHF2 1EKYA 5KYXB 1Z63A 2WZGA 3ZQYA 1I4YA 3JTLO 2R7OA 3R7CA 1C17M 1T6QA 2V26A 2VASA 3NKEA 4WGZA 4F4BA 1TWHA 3BEHA 4YL3A 1LS4A 4BJ5A 1YLMA 1J8MF 3KH2A 1YVIA 1RJ9A 2XLMA 2XRHA 3PMRA 3LUTB 3ABLC 4OIOF 3S29A 4MTOA 2Q3TA 1WATA 3EG9A 4XEKA 4JW1A 2R03A 2YL0A 4EBBA 2X0CA 3JZ0A 5L0FA 3FAJA 3RVYA 4Q5SF 1VB5A 1ZW3A 1LE2A 2YL7A 1HW1A 3GM1A 3ZTZA 2M4EA 3GM2A 3O6XA 2Q9CA 3AG1C 4O79A 4GQHA 2AVKA 2LCHA 3CSKA 2LSEA 1QPUA 1OXBA 4WABA 1J8YF 1R4TA 4I3MA 4LERA 3EGDB 1UFBA 2NUPB 1H7IA 1O5HA 2M64A 1WOLA 2XL8A 3FAPB 3MLGA 4K1OA 2HMZA 1K04A 3TULA 3N2ZB 1A7VA 2XLVA 2J45A 1EA8A 2ZXOA 3ITFA 3L8IA 3U8PA 4EKWA 4XLPF 3JYYA 1MNEA 2XM0A 3WODF 4ANJA 5L0CA 4GYTA 3HNLA 3V5YA 2HV6A 3DXJF 1EQ1A 2YWAA 1TFKB 1JAFA 2CNWA 2Z15A 3LS0A 4I1OB 3S28A 3KKBA 3GEIA 4EBJA 1SF8A 2XL6A 2HS5A 3RKOF 4CS7A 1FFTC 2LFFA 1ST6A 2I8BA 2ZD9A 4G0HA 4YL1A 4YT8A 3ZWIA 4WGYA 3AG3C 5D91A 3C63A 4JC7A 3RW0A 5GPGB 2R7VA 4YJWA 4O6YA 2XSEA 3S0XA 1QQ3A 1ORYA 4H54A 1JRAA 3AQCA 4JIOA 1E85A 3HKKA 4NTFA 3PDMP 1G4WR 2PX0A 3DAGA 2NUTA 4JKVA 2KNHA 1Y6DA 1W2WA 2XLWA 4P6IC 1KU2A 1TFOB 4PFOA 4MVMA 4JEBA 4OD5A 2YKZA 4JURI 2C04A 3DE8A 1K40A 2D5RB 3ATPA 1VMAA 3H2VA 4C3DA 3IQ5A 2A68F 2KGOA 3K6BA 2Y3DA 2VH3A 2ZPAA 1Z3IX 1Z23A 4BJ6C 1VLTA 3F46A 4MQ9F 3IHUA 3TK0A 3C62A 1Q0MA 1YAUO 1HMDA 2IXPA 2QY9A 1Q0DA 3NMIA 5L3VA 3GWNA 5CIVA 1NBBA 3V7OA 3IQTA 3RQGA 3SEOA 1JR8A 2AP3A 3ASOC 1Q0FA 3U9JA 1Q0KA 3MBGA 4LLEA 3DI5A 4G7ZF 1A0BA 4E7SA 2WL8A 3O39A 4O6NA 4LLCA 2IYLD 1ZYRF 5L0JA 3H2UA 4PACA 3ZG1A 3HLZA 5AGFA 5L0DA 2VCCA 4XEFA 3W2WA 2R7TA 4E17A 5A6BA 2Y3HA 2W45A 1K05A 3CZ6A 4OIPF 4G7OF 2J7PD 1ZW2A 1OR3A 1QSPA 2ICWG 3K66A 4IAQA 3G4XA 1D0YA 2KSFA 3Q7GA 4KNWA 5B1AC 1QLEC 3DD7A 1QVXA 3JT1A 3ZDLA 3QZCA 4GEHA 4D4NA 3RYLA 1QZXA 1T9KA 2CGEA 1YZAA 2HKVA 2PP4A 3NMKA 3B0VC 2LIGA 3M4CA 1GGQA 3JSZA 4C3BA 4CS9A 3UGPA 1CGOA 3RF3A 2XLOA 2OJQA 4YN0B 5B3IA 4ULVA 2BE5F 4MVSA 3EGXA 4DBRA 3N0TA 1M2VA 3C8GA 3WAQA 2Q7RA 2J9BA 4E7ZA 3VAYA 2EINC 2GA0A 3EGXB 3NG1A 2Y69C 1OW7A 2PBEA 2R7SA 4HEAJ 5TJ5E 5DS5A 4BG0A 5JUAA 3MX3A 2XL4A 3MFNA 4ER9A 1I4ZA 3K1IC 1JOGA 1VYKA 3C18A 2G3VA 5B1BC 4E18A 3FVYA 4PJJA 1S7ZA 1WGWA 4HFKB 5AC5A 1OCOC 1L7CA 4U5EE 1D0XA 1LVKA 5E3AA 4MW8A 5KYUB 3B0UX 4NTBA 2HZ8A 4O7GA 1EI7A 2KW3C 4K0DA 4XPXA 3RIPA 1AUEA 4Z9HA 1RKEA 2H7OA 3SXYA 3NDBB 1M2OA 2R7XA 3RQEA 5JT4A 5L0HA 2A6HF 5KYXA 1KNYA 1OCRC 2NPUA 3IEEA 1MMDA 1N1CA 5FCLA 2QUPA 1YA7O 3DKAA 4JVSA 1A7EA 3UMKA 4CIPA 1D0ZA 1OQCA 4OINF 5KYWB 4JZAA 4D4XA 3VYWA 2W4MA 2GFHA 4C7OB 4MVOA 5F5HA 3GWLA 5A6AA 3HNJA 4XPWA 1Y4CA 3LS1A 4MNDA 3U3FA 3TQOA 2LP4A 1SZIA 4XPYA 3U9MA 1FAPB 3JRMO 1JPJA 2J8WA 3DE9A 5L0GA 1KTMA 2YL1A 5E2QA 2XLEA 4JTCB 5JSLA 3UMHA 2YRFA 4XTKA 1QKRA 4DRHB 5HSWA 1D1CA 2OQMA 2Y3BA 2B0JA 3FHDA 3H65A 5T3TA 4XLNF 4PFPA 3EGDA 2NUPA 2R02A 1YDIA 3S9OA 3GORA 1NSGB 4YT2A 1VYIA 1SR2A 4PR9A 4UDVA 4XQ1A 4CDAA 3ECSA 4LDRA 5DS6A 4LDQA 5DQZA 1VTMP 2EPNA 2L9JA 1OKKA 4CJGA 4G78A 2WB7A 1CGNA 3NYJA 3LJBA 4JCZA 4DOZA 1Z6AA 4KNVA 4R32A 2YHSA 3RFYA 1FR0A 1OR2A 2ETSA 3ZQVA 4YL0A 3GEEA 1LI7A 2L7AA 2QLAA 2MHRA 2HJ3A 4JTDB 2Q9AA 4U5HA 2DYRC 2KC3A 3WG7C 2PX3A 4U9EA 3DAFA 5COMA 5E3CA 3EH1A 2L6HA 4NTAA 3SXKA 4J30B 2UUIA 4IARA 4PJNA 1HE9A 1G4US 2YL3A 2ZXRA 4FAPB 5JS5A 3GODA 2VB6A 4XEVA 2WVNA 3ABKC 1DOVA 4BPMA 1OXKA 1FTSA 2OG2A 3UGOA 2LQGA 4OIRF 2AWCA 3JYHA 2CDQA 4CS8A 3GANA 2LD6A 4I1MA
chains in the Genus database with same CATH topology
3W2VA 4KI2A 3Q6MA 4PJMA 4U5BE 3B0PA 3HJCA 2CNWD 2QTVA 1PD0A 1NU9C 1ZU4A 5D92A 2J9UA 3AG4C 3DM9B 4FESA 1TWAA 5EHHA 3I5QA 2P6VA 2EIMC 3EPVA 2V3CC 1M56C 3JRTA 3SNHA 2EIJC 4KBLA 4IAOA 1OCCC 2WVOA 4CSAC 1ZHYA 4BJ1A 2EIKC 3EHMA 2CW0F 3ZC4A 4JJGA 3QMKA 2J46A 1NZEA 3EJNA 3JCUQ 5E33A 2J0WA 5KYYB 1O87A 4N06A 3AQBA 4RBNA 4BJ6A 4DVYP 4DBQA 4H4KC 3ABMC 2J9VA 4M63A 3OWTA 3X2QC 2KJGA 1PD1A 1VK5A 3EHNA 1V55C 3EFOB 2WVQA 1IW7F 3W8IA 5DS4A 1BR2A 5KYUA 2R7QA 3SP1A 2G62A 2PF4E 4U5DE 4U5CE 1D1BA 4YT5A 4CBEA 4X0RA 3TD7A 4B6IA 4U5FE 4QDLA 3E70C 4O6MA 4RDAA 1NU7D 3Q6NA 3B9QA 4AX2A 1NG1A 2H7VC 2O9XA 3NKDA 5KYWA 5T1DB 2R7RA 4C7OA 4FWVA 2G3KA 2R7WA 4BJ5C 1FMVA 3EH2A 5CI9A 2A69F 2PFDA 5T3WA 4FX5A 4AK9A 1ZHWA 2DGJA 5L3QA 2XXAB 4HE8D 3DJUB 2J9WA 3EZHA 1Z5ZA 2MYSA 4OIQF 3HTKC 4EWCA 5F5FA 4NY3A 4XWJA 3K33A 3Q7LA 3DZAA 2FFHA 1D1AA 2IXMA 3CQZA 3LESA 3AG2C 5CI8A 2Y3GA 3KMIA 3ZIBA 3POVA 4JJFA 1TKNA 3EZIA 5DQTA 4LACB 2JD3A 4QI0A 1RJ9B 3SZRA 2A1DD 4BEJA 4QI2A 1BR1A 2YEVA 3EG9B 1IZMA 4PJLA 2FGYA 2R7UA 3I4UA 4IRUA 3L34A 1FMWA 4HFFB 3ZSUA 5DVWA 1TR2A 1LKXA 4CS8C 1OKKD 4AE4A 4ZLDA 3LEVA 2IXOA 3K7DA 2WZLA 2ZXPA 4AE4B 4BJTA 3W8HA 2X51A 3T6JA 1ZHZA 4KC9A 1MNDA 2KQ9A 4Q7CA 5DLJA 2C03A 3E9VA 3NYMA 3N24A 2W9YA 2DYSC 1TWGA 2NG1A 3NYLA 3NRHA 3DM5A 3LLKA 3LLIA 2NUTB 1MMNA 2EILC 5KYYA 2ZXWC 4CIHA 2J7PA 1G8XA 3ZVRA 2A6EF 1JPNA 4CS9C 1VOMA 3RH3A 3UR3C 3S27A 4ZLCA 5IY5C 4YWQA 2MWQA 2HV7A 4IWBA 1PCXA 4OD4A 5B3SC 2YZSA 3DMDA 3KL4A 4A2NB 3EFOA 4ULWA 4W8KA 3SYNA 3EQLF 4CSAA 3OEOA 4K7BA 4G7HF 4Q4ZF 1V54C 2E87A 5KYNA 1BR4A 3F47A 2L81A 3UNGC 1TWCA 2H7BA 3FDQA 1ZHTA 4JCHA 4RD9A 1OCZC 2J0XA 2WZFA 1ZHXA 3T6BA 1M2VB 3I5PA 3DJNB 3X1OA 3ASNC 2P7VA 3M1CB 3UMIA 1SMYF 4WJ0A 2W4BA 3K1HA 3T4RA 1LS1A 5BUOA 4DVZA 2XXAA 2IOQA 1FFHA 4PK4A 1M57C 4IJJA 2Y39A 4U5GA 3LAYA 4C3EA 2IXNA 4I44A 1ZU5A 2OCCC 3L0IA 4J32B 1MMAA 4YT4A 5L3VA 3OA1A 2Q9BA 3LNRA 1MMGA 3PHF2 5KYXB 1Z63A 2WZGA 5EGYA 2R7OA 4F4BA 3NKEA 2V26A 2VASA 1TWHA 4BJ5A 1J8MF 3KH2A 4OIOF 1RJ9A 3PMRA 2XRHA 3ABLC 3S29A 2Q3TA 3EG9A 4JW1A 4EBBA 3FAJA 4Q5SF 2M4EA 3O6XA 2Q9CA 3AG1C 4O79A 3CSKA 2LSEA 1J8YF 4I3MA 4LERA 3EGDB 2NUPB 1O5HA 3MLGA 3N2ZB 2ZXOA 2J45A 4XLPF 3ITFA 1MNEA 3WODF 4ANJA 4GYTA 2HV6A 3DXJF 2CNWA 2Z15A 3LS0A 4I1OB 3S28A 3KKBA 1SF8A 3RKOF 4CS7A 1FFTC 1ST6A 2I8BA 4G0HA 4YT8A 5D91A 3AG3C 2R7VA 4YJWA 4O6YA 2XSEA 3S0XA 3AQCA 2PX0A 3DAGA 2NUTA 2KNHA 1W2WA 4P6IC 1KU2A 4PFOA 4OD5A 4JURI 2C04A 2D5RB 1VMAA 4C3DA 2A68F 2KGOA 3K6BA 2Y3DA 2VH3A 2ZPAA 1Z3IX 1Z23A 4BJ6C 3F46A 4MQ9F 2IXPA 2QY9A 3V7OA 3SEOA 3ASOC 4LLEA 4G7ZF 4E7SA 2WL8A 3O39A 4O6NA 4LLCA 2IYLD 1ZYRF 3ZG1A 3HLZA 2R7TA 3W2WA 2Y3HA 2W45A 3CZ6A 4OIPF 4G7OF 2J7PD 4KNWA 3K66A 1D0YA 3Q7GA 5B1AC 1QLEC 3DD7A 3JT1A 3QZCA 4GEHA 3RYLA 1QZXA 2CGEA 2PP4A 3B0VC 4CS9A 3JSZA 4C3BA 3UGPA 4YN0B 2BE5F 3EGXA 4DBRA 3N0TA 1M2VA 4E7ZA 3VAYA 2EINC 3EGXB 3NG1A 2Y69C 2R7SA 4HEAJ 5DS5A 4BG0A 3MX3A 2XL4A 3K1IC 1VYKA 2G3VA 5B1BC 3FVYA 4PJJA 1S7ZA 1WGWA 4HFKB 1OCOC 5E3AA 4U5EE 1D0XA 1LVKA 5KYUB 3B0UX 4O7GA 2KW3C 3RIPA 4K0DA 2H7OA 3NDBB 2R7XA 1M2OA 2A6HF 5KYXA 1OCRC 3IEEA 1MMDA 1N1CA 5FCLA 4JVSA 3UMKA 1D0ZA 4OINF 5KYWB 4JZAA 3VYWA 2W4MA 2GFHA 4C7OB 5F5HA 3LS1A 4MNDA 1SZIA 1JPJA 5E2QA 3UMHA 4XTKA 5HSWA 1D1CA 2Y3BA 3FHDA 2B0JA 3H65A 5T3TA 4XLNF 4PFPA 3EGDA 2NUPA 4YT2A 1VYIA 3ECSA 5DS6A 5DQZA 2L9JA 1OKKA 2WB7A 3NYJA 3LJBA 4DOZA 1Z6AA 4KNVA 2YHSA 3RFYA 4U5HA 2Q9AA 2DYRC 3WG7C 2PX3A 3DAFA 5E3CA 3EH1A 4J30B 4PJNA 2ZXRA 3GODA 2VB6A 2WVNA 3ABKC 1FTSA 2OG2A 3UGOA 4OIRF 3JYHA 2CDQA 4CS8A 3GANA 4I1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKO F;  4HEA J;  4HE8 D; 
#chains in the Genus database with same CATH topology
 3W2V A;  1GS9 A;  2NSF A;  1AEP A;  2OJE D;  4KI2 A;  3Q6M A;  4PJM A;  4U5B E;  1OW8 A;  3B0P A;  3HJC A;  1C02 A;  1LPE A;  2CNW D;  2QTV A;  2HSB A;  2VC9 A;  1TQG A;  1PD0 A;  1NU9 C;  1ZU4 A;  1E2X A;  4N4W A;  5D92 A;  5A6J A;  2J9U A;  3AG4 C;  3DM9 B;  4FES A;  1V74 B;  1TWA A;  2HUJ A;  3U5S A;  3TJ6 A;  5EHH A;  5L0I A;  3I5Q A;  4BEM J;  2P6V A;  1XZP A;  2EIM C;  2HMQ A;  3EPV A;  2QE9 A;  2V3C C;  2PNO A;  1M56 C;  3JRT A;  2JX0 A;  2A0B A;  3RVZ A;  3SNH A;  3QVY A;  3U0C A;  2VCB A;  4EUK B;  2R05 A;  2EIJ C;  2KK1 A;  4KBL A;  4ZLC A;  4IAO A;  1OCC C;  2WVO A;  4A4A A;  4CSA C;  1ZHY A;  3TOM A;  1LE4 A;  4BJ1 A;  5JLI A;  2EIK C;  1F1M A;  3EHM A;  2CW0 F;  3U2L A;  3ZC4 A;  4JJG A;  3QMK A;  2J46 A;  1NZE A;  4JTA B;  1E83 A;  3EJN A;  3JCU Q;  1RCP A;  1LIH A;  4MTF A;  5E33 A;  2J0W A;  4AL1 A;  1LM3 B;  1O87 A;  5KYY B;  2GAQ A;  4N06 A;  5JP7 A;  1HW2 A;  2TMV P;  1GQA A;  3AQB A;  4RBN A;  4BJ6 A;  4DVY P;  4DBQ A;  4H4K C;  1R5I D;  4E0H A;  3ABM C;  2J9V A;  2OOC A;  4M63 A;  4EIY A;  4DJ9 A;  2BC5 A;  2XS8 A;  2Q00 A;  2AWY A;  1YYX A;  2XM4 A;  4Z9J A;  3FXH A;  2EPL X;  3OWT A;  5A6B D;  3X2Q C;  2KJG A;  1PD1 A;  1Q0G A;  1VK5 A;  2P1A A;  2QNL A;  4EBK A;  5COF A;  3EHN A;  1V55 C;  1YYJ A;  3U2M A;  1HY5 A;  3EFO B;  2WVQ A;  1IW7 F;  3W8I A;  5DS4 A;  1BR2 A;  1H9T A;  5KYU A;  4CDY A;  2R7Q A;  3SP1 A;  1WN0 A;  4NCQ A;  2G62 A;  2CYD A;  3HNI A;  4JEA A;  1E86 A;  2Q4F A;  2NSG A;  2PF4 E;  4U5D E;  4MW3 A;  1D1B A;  4U5C E;  4YT5 A;  4CBE A;  4X0R A;  3TD7 A;  4B6I A;  4U5F E;  4QDL A;  3C8G D;  3VRC A;  3E70 C;  256B A;  4O6M A;  4RDA A;  1NU7 D;  3IPM O;  3Q6N A;  3B9Q A;  4AX2 A;  1UG7 A;  1NG1 A;  2H7V C;  2O9X A;  3NKD A;  5K0I A;  5KYW A;  3FOO A;  5T1D B;  2R7R A;  3G50 A;  4FWV A;  4C7O A;  2G3K A;  2R7W A;  4NQF A;  4BJ5 C;  1WTY A;  3KPH A;  5A69 A;  1FMV A;  2HJM A;  5COG A;  1U89 A;  3IQC A;  3EH2 A;  5CI9 A;  2A69 F;  2CCY A;  2PFD A;  5EK0 A;  5T3W A;  4FX5 A;  1HMO A;  4AK9 A;  1ZHW A;  2DGJ A;  5L3Q A;  2XXA B;  3ZTM A;  4HE8 D;  4J7T A;  1OW6 A;  2L6G A;  4CX9 A;  3DJU B;  2J9W A;  3EZH A;  1Z5Z A;  1APC A;  2MYS A;  3BRJ A;  1FNT c;  4OIQ F;  3HTK C;  4EWC A;  3HNK A;  4NY3 A;  4XWJ A;  5F5F A;  2P0N A;  3K33 A;  4DXW A;  3MYF A;  3Q7L A;  3DZA A;  2FFH A;  3L8J A;  3GEH A;  3QW1 A;  1D1A A;  1T6U A;  2IXM A;  4P9T A;  3A9C A;  3CEX A;  3CQZ A;  5JRA A;  3U3B A;  1RXQ A;  3LES A;  3AG2 C;  5CI8 A;  2Y3G A;  3KMI A;  3ZIB A;  3POV A;  4JJF A;  1U6H A;  4MVU A;  1TKN A;  2XLD A;  1CPQ A;  3EZI A;  5DQT A;  4LAC B;  2F22 A;  2JD3 A;  2UUH A;  4EHP A;  4QI0 A;  5F28 E;  1RJ9 B;  1LI5 A;  2A1D D;  3AOU A;  2R9R B;  3C8Z A;  3SZR A;  4BEJ A;  4QI2 A;  1BR1 A;  2DB4 A;  2YEV A;  4IB4 A;  3U8V A;  3EG9 B;  5FZT A;  2RD9 A;  1SYQ A;  1XZQ A;  3R2P A;  1IZM A;  2B0H A;  1HE1 A;  3LEO A;  4YK5 A;  4PJL A;  2FGY A;  2R7U A;  3I4U A;  4IRU A;  4MVZ A;  4JRZ A;  1ZZP A;  3L34 A;  4JE9 A;  1FMW A;  3QTH A;  3B71 A;  3GM3 A;  4HFF B;  2GWW A;  1PV3 A;  2RSE B;  3QVZ A;  3ZSU A;  1BBH A;  2KYH A;  2VCA A;  5DVW A;  1TR2 A;  4MVQ A;  1LKX A;  4CS8 C;  4E0I A;  1OKK D;  4AE4 A;  4ZLD A;  5BQG A;  3LEV A;  2IXO A;  3J06 A;  1Z7Q c;  3K7D A;  4CDV A;  1RMV A;  2WZL A;  2ZXP A;  4AE4 B;  3CAX A;  3PCV A;  3VF0 A;  3W8H A;  2AU5 A;  2X51 A;  3AGU A;  4BJT A;  3T6J A;  2I15 A;  1ZHZ A;  1YZC A;  4KC9 A;  1MND A;  2KQ9 A;  4Q7C A;  5DLJ A;  2C03 A;  3G4Z A;  3E9V A;  1M6T A;  4J7Y A;  3NYM A;  3N24 A;  2OEX A;  1G5Z A;  3WHN A;  2GDC A;  2W9Y A;  4N6C A;  1BZ4 A;  4LDK A;  1RKC A;  2DYS C;  3KYI A;  1TWG A;  4MS2 A;  2NG1 A;  3NYL A;  4DRJ B;  2EPK X;  1YAR O;  2XLH A;  2EPM X;  3NRH A;  3DM5 A;  4U9D A;  1T5O A;  3LLK A;  3LLI A;  1MQV A;  2NUT B;  4L6R A;  4NC3 A;  3T6G B;  2XS1 A;  1V4A A;  1MMN A;  2EIL C;  2P61 A;  5KYY A;  2ZXW C;  4CIH A;  1ORJ A;  3V5X A;  2BL2 A;  1WWP A;  1G8X A;  2J7P A;  5A6K A;  4CJO A;  3ZVR A;  5BQI A;  2A6E F;  1JPN A;  4CS9 C;  1VOM A;  3RQF A;  3RH3 A;  3T9O A;  2IM8 A;  5AC4 A;  1B68 A;  3M15 A;  2YLD A;  3UR3 C;  1ZVZ A;  2HFI A;  1O3U A;  3QW0 A;  3S27 A;  3NMJ A;  3SXM A;  4DRI B;  2OU6 A;  1A7D A;  4YWQ A;  5HV9 A;  5IY5 C;  3VM6 A;  4N6H A;  2ASR A;  2MWQ A;  3TOL A;  2D4U A;  2HV7 A;  1ORS C;  1PCX A;  4IWB A;  1E84 A;  4OD4 A;  2FAP B;  5JVE A;  5B3S C;  2OEV A;  2YZS A;  3DMD A;  1I5N A;  3KL4 A;  4A2N B;  3S90 A;  3KYJ A;  2IBF A;  3V5Z A;  3EFO A;  1H6G A;  4ULW A;  4W8K A;  3A11 A;  3LNM B;  3SYN A;  3EQL F;  1VLS A;  3W4Y A;  4CSA A;  1S05 A;  3OEO A;  4K7B A;  4Z9I A;  4Q4Z F;  1H9G A;  3TJ5 A;  4G7H F;  1V54 C;  2E87 A;  5KYN A;  1BR4 A;  3F47 A;  2L81 A;  4W8P A;  2L6F A;  1NLX A;  1T6I A;  3AJM A;  3DWW A;  4MTG A;  3S84 A;  1YJG A;  1YA9 A;  3UNG C;  1TWC A;  2YVK A;  2YQY A;  1U0B B;  3IQ6 A;  1L3P A;  2H7B A;  3FOP A;  3M4B A;  3O10 A;  1ZHT A;  2EPO A;  4JCH A;  3FDQ A;  3FMS A;  4RD9 A;  1OCZ C;  1CGM E;  2H8A A;  2J0X A;  1C03 A;  2YLG A;  3MYI A;  1XWJ A;  4P9F A;  2WZF A;  1ZHX A;  3US6 A;  1AVO B;  3T6B A;  1M2V B;  3C8G B;  2DI3 A;  3I5P A;  3DJN B;  3X1O A;  3JSE O;  1CPR A;  3ASN C;  2P7V A;  3M1C B;  3UMI A;  1SMY F;  4WJ0 A;  4ONS A;  1BDJ B;  2W4B A;  3K1H A;  3T4R A;  1LS1 A;  3AGT A;  5BUO A;  5EGY A;  3B29 A;  4DVZ A;  2IOQ A;  2YLI A;  4AL0 A;  2XXA A;  3K1I A;  1FFH A;  1NFN A;  2A0U A;  1T01 A;  3O55 A;  4PK4 A;  1M57 C;  3M79 A;  1A41 A;  4MVR A;  4IJJ A;  2Y39 A;  4U5G A;  3LAY A;  4C3E A;  2R25 A;  1DOW A;  2LK4 A;  2OKU A;  3SXZ A;  2IXN A;  4I44 A;  2LFD A;  1ZU5 A;  3L1M A;  1GM5 A;  2OCC C;  3L0I A;  4J32 B;  1MMA A;  1NFO A;  2HSQ A;  1JMW A;  3OA1 A;  2Q9B A;  3LNR A;  1RKE B;  4YT4 A;  2JPU A;  1WAS A;  4IGG A;  5BQH A;  1MMG A;  3C7J A;  3PHF 2;  1EKY A;  5KYX B;  1Z63 A;  2WZG A;  3ZQY A;  1I4Y A;  3JTL O;  2R7O A;  3R7C A;  1C17 M;  1T6Q A;  2V26 A;  2VAS A;  3NKE A;  4WGZ A;  4F4B A;  1TWH A;  3BEH A;  4YL3 A;  1LS4 A;  4BJ5 A;  1YLM A;  1J8M F;  3KH2 A;  1YVI A;  1RJ9 A;  2XLM A;  2XRH A;  3PMR A;  3LUT B;  3ABL C;  4OIO F;  3S29 A;  4MTO A;  2Q3T A;  1WAT A;  3EG9 A;  4XEK A;  4JW1 A;  2R03 A;  2YL0 A;  4EBB A;  2X0C A;  3JZ0 A;  5L0F A;  3FAJ A;  3RVY A;  4Q5S F;  1VB5 A;  1ZW3 A;  1LE2 A;  2YL7 A;  1HW1 A;  3GM1 A;  3ZTZ A;  2M4E A;  3GM2 A;  3O6X A;  2Q9C A;  3AG1 C;  4O79 A;  4GQH A;  2AVK A;  2LCH A;  3CSK A;  2LSE A;  1QPU A;  1OXB A;  4WAB A;  1J8Y F;  1R4T A;  4I3M A;  4LER A;  3EGD B;  1UFB A;  2NUP B;  1H7I A;  1O5H A;  2M64 A;  1WOL A;  2XL8 A;  3FAP B;  3MLG A;  4K1O A;  2HMZ A;  1K04 A;  3TUL A;  3N2Z B;  1A7V A;  2XLV A;  2J45 A;  1EA8 A;  2ZXO A;  3ITF A;  3L8I A;  3U8P A;  4EKW A;  4XLP F;  3JYY A;  1MNE A;  2XM0 A;  3WOD F;  4ANJ A;  5L0C A;  4GYT A;  3HNL A;  3V5Y A;  2HV6 A;  3DXJ F;  1EQ1 A;  2YWA A;  1TFK B;  1JAF A;  2CNW A;  2Z15 A;  3LS0 A;  4I1O B;  3S28 A;  3KKB A;  3GEI A;  4EBJ A;  1SF8 A;  2XL6 A;  2HS5 A;  3RKO F;  4CS7 A;  1FFT C;  2LFF A;  1ST6 A;  2I8B A;  2ZD9 A;  4G0H A;  4YL1 A;  4YT8 A;  3ZWI A;  4WGY A;  3AG3 C;  5D91 A;  3C63 A;  4JC7 A;  3RW0 A;  5GPG B;  2R7V A;  4YJW A;  4O6Y A;  2XSE A;  3S0X A;  1QQ3 A;  1ORY A;  4H54 A;  1JRA A;  3AQC A;  4JIO A;  1E85 A;  3HKK A;  4NTF A;  3PDM P;  1G4W R;  2PX0 A;  3DAG A;  2NUT A;  4JKV A;  2KNH A;  1Y6D A;  1W2W A;  2XLW A;  4P6I C;  1KU2 A;  1TFO B;  4PFO A;  4MVM A;  4JEB A;  4OD5 A;  2YKZ A;  4JUR I;  2C04 A;  3DE8 A;  1K40 A;  2D5R B;  3ATP A;  1VMA A;  3H2V A;  4C3D A;  3IQ5 A;  2A68 F;  2KGO A;  3K6B A;  2Y3D A;  2VH3 A;  2ZPA A;  1Z3I X;  1Z23 A;  4BJ6 C;  1VLT A;  3F46 A;  4MQ9 F;  3IHU A;  3TK0 A;  3C62 A;  1Q0M A;  1YAU O;  1HMD A;  2IXP A;  2QY9 A;  1Q0D A;  3NMI A;  5L3V A;  3GWN A;  5CIV A;  1NBB A;  3V7O A;  3IQT A;  3RQG A;  3SEO A;  1JR8 A;  2AP3 A;  3ASO C;  1Q0F A;  3U9J A;  1Q0K A;  3MBG A;  4LLE A;  3DI5 A;  4G7Z F;  1A0B A;  4E7S A;  2WL8 A;  3O39 A;  4O6N A;  4LLC A;  2IYL D;  1ZYR F;  5L0J A;  3H2U A;  4PAC A;  3ZG1 A;  3HLZ A;  5AGF A;  5L0D A;  2VCC A;  4XEF A;  3W2W A;  2R7T A;  4E17 A;  5A6B A;  2Y3H A;  2W45 A;  1K05 A;  3CZ6 A;  4OIP F;  4G7O F;  2J7P D;  1ZW2 A;  1OR3 A;  1QSP A;  2ICW G;  3K66 A;  4IAQ A;  3G4X A;  1D0Y A;  2KSF A;  3Q7G A;  4KNW A;  5B1A C;  1QLE C;  3DD7 A;  1QVX A;  3JT1 A;  3ZDL A;  3QZC A;  4GEH A;  4D4N A;  3RYL A;  1QZX A;  1T9K A;  2CGE A;  1YZA A;  2HKV A;  2PP4 A;  3NMK A;  3B0V C;  2LIG A;  3M4C A;  1GGQ A;  3JSZ A;  4C3B A;  4CS9 A;  3UGP A;  1CGO A;  3RF3 A;  2XLO A;  2OJQ A;  4YN0 B;  5B3I A;  4ULV A;  2BE5 F;  4MVS A;  3EGX A;  4DBR A;  3N0T A;  1M2V A;  3C8G A;  3WAQ A;  2Q7R A;  2J9B A;  4E7Z A;  3VAY A;  2EIN C;  2GA0 A;  3EGX B;  3NG1 A;  2Y69 C;  1OW7 A;  2PBE A;  2R7S A;  4HEA J;  5TJ5 E;  5DS5 A;  4BG0 A;  5JUA A;  3MX3 A;  2XL4 A;  3MFN A;  4ER9 A;  1I4Z A;  3K1I C;  1JOG A;  1VYK A;  3C18 A;  2G3V A;  5B1B C;  4E18 A;  3FVY A;  4PJJ A;  1S7Z A;  1WGW A;  4HFK B;  5AC5 A;  1OCO C;  1L7C A;  4U5E E;  1D0X A;  1LVK A;  5E3A A;  4MW8 A;  5KYU B;  3B0U X;  4NTB A;  2HZ8 A;  4O7G A;  1EI7 A;  2KW3 C;  4K0D A;  4XPX A;  3RIP A;  1AUE A;  4Z9H A;  1RKE A;  2H7O A;  3SXY A;  3NDB B;  1M2O A;  2R7X A;  3RQE A;  5JT4 A;  5L0H A;  2A6H F;  5KYX A;  1KNY A;  1OCR C;  2NPU A;  3IEE A;  1MMD A;  1N1C A;  5FCL A;  2QUP A;  1YA7 O;  3DKA A;  4JVS A;  1A7E A;  3UMK A;  4CIP A;  1D0Z A;  1OQC A;  4OIN F;  5KYW B;  4JZA A;  4D4X A;  3VYW A;  2W4M A;  2GFH A;  4C7O B;  4MVO A;  5F5H A;  3GWL A;  5A6A A;  3HNJ A;  4XPW A;  1Y4C A;  3LS1 A;  4MND A;  3U3F A;  3TQO A;  2LP4 A;  1SZI A;  4XPY A;  3U9M A;  1FAP B;  3JRM O;  1JPJ A;  2J8W A;  3DE9 A;  5L0G A;  1KTM A;  2YL1 A;  5E2Q A;  2XLE A;  4JTC B;  5JSL A;  3UMH A;  2YRF A;  4XTK A;  1QKR A;  4DRH B;  5HSW A;  1D1C A;  2OQM A;  2Y3B A;  2B0J A;  3FHD A;  3H65 A;  5T3T A;  4XLN F;  4PFP A;  3EGD A;  2NUP A;  2R02 A;  1YDI A;  3S9O A;  3GOR A;  1NSG B;  4YT2 A;  1VYI A;  1SR2 A;  4PR9 A;  4UDV A;  4XQ1 A;  4CDA A;  3ECS A;  4LDR A;  5DS6 A;  4LDQ A;  5DQZ A;  1VTM P;  2EPN A;  2L9J A;  1OKK A;  4CJG A;  4G78 A;  2WB7 A;  1CGN A;  3NYJ A;  3LJB A;  4JCZ A;  4DOZ A;  1Z6A A;  4KNV A;  4R32 A;  2YHS A;  3RFY A;  1FR0 A;  1OR2 A;  2ETS A;  3ZQV A;  4YL0 A;  3GEE A;  1LI7 A;  2L7A A;  2QLA A;  2MHR A;  2HJ3 A;  4JTD B;  2Q9A A;  4U5H A;  2DYR C;  2KC3 A;  3WG7 C;  2PX3 A;  4U9E A;  3DAF A;  5COM A;  5E3C A;  3EH1 A;  2L6H A;  4NTA A;  3SXK A;  4J30 B;  2UUI A;  4IAR A;  4PJN A;  1HE9 A;  1G4U S;  2YL3 A;  2ZXR A;  4FAP B;  5JS5 A;  3GOD A;  2VB6 A;  4XEV A;  2WVN A;  3ABK C;  1DOV A;  4BPM A;  1OXK A;  1FTS A;  2OG2 A;  3UGO A;  2LQG A;  4OIR F;  2AWC A;  3JYH A;  2CDQ A;  4CS8 A;  3GAN A;  2LD6 A;  4I1M A; 
#chains in the Genus database with same CATH homology
 3W2V A;  4KI2 A;  3Q6M A;  4PJM A;  4U5B E;  3B0P A;  3HJC A;  2CNW D;  2QTV A;  1PD0 A;  1NU9 C;  1ZU4 A;  5D92 A;  2J9U A;  3AG4 C;  3DM9 B;  4FES A;  1TWA A;  5EHH A;  3I5Q A;  2P6V A;  2EIM C;  3EPV A;  2V3C C;  1M56 C;  3JRT A;  3SNH A;  2EIJ C;  4KBL A;  4IAO A;  1OCC C;  2WVO A;  4CSA C;  1ZHY A;  4BJ1 A;  2EIK C;  3EHM A;  2CW0 F;  3ZC4 A;  4JJG A;  3QMK A;  2J46 A;  1NZE A;  3EJN A;  3JCU Q;  5E33 A;  2J0W A;  5KYY B;  1O87 A;  4N06 A;  3AQB A;  4RBN A;  4BJ6 A;  4DVY P;  4DBQ A;  4H4K C;  3ABM C;  2J9V A;  4M63 A;  3OWT A;  3X2Q C;  2KJG A;  1PD1 A;  1VK5 A;  3EHN A;  1V55 C;  3EFO B;  2WVQ A;  1IW7 F;  3W8I A;  5DS4 A;  1BR2 A;  5KYU A;  2R7Q A;  3SP1 A;  2G62 A;  2PF4 E;  4U5D E;  4U5C E;  1D1B A;  4YT5 A;  4CBE A;  4X0R A;  3TD7 A;  4B6I A;  4U5F E;  4QDL A;  3E70 C;  4O6M A;  4RDA A;  1NU7 D;  3Q6N A;  3B9Q A;  4AX2 A;  1NG1 A;  2H7V C;  2O9X A;  3NKD A;  5KYW A;  5T1D B;  2R7R A;  4C7O A;  4FWV A;  2G3K A;  2R7W A;  4BJ5 C;  1FMV A;  3EH2 A;  5CI9 A;  2A69 F;  2PFD A;  5T3W A;  4FX5 A;  4AK9 A;  1ZHW A;  2DGJ A;  5L3Q A;  2XXA B;  4HE8 D;  3DJU B;  2J9W A;  3EZH A;  1Z5Z A;  2MYS A;  4OIQ F;  3HTK C;  4EWC A;  5F5F A;  4NY3 A;  4XWJ A;  3K33 A;  3Q7L A;  3DZA A;  2FFH A;  1D1A A;  2IXM A;  3CQZ A;  3LES A;  3AG2 C;  5CI8 A;  2Y3G A;  3KMI A;  3ZIB A;  3POV A;  4JJF A;  1TKN A;  3EZI A;  5DQT A;  4LAC B;  2JD3 A;  4QI0 A;  1RJ9 B;  3SZR A;  2A1D D;  4BEJ A;  4QI2 A;  1BR1 A;  2YEV A;  3EG9 B;  1IZM A;  4PJL A;  2FGY A;  2R7U A;  3I4U A;  4IRU A;  3L34 A;  1FMW A;  4HFF B;  3ZSU A;  5DVW A;  1TR2 A;  1LKX A;  4CS8 C;  1OKK D;  4AE4 A;  4ZLD A;  3LEV A;  2IXO A;  3K7D A;  2WZL A;  2ZXP A;  4AE4 B;  4BJT A;  3W8H A;  2X51 A;  3T6J A;  1ZHZ A;  4KC9 A;  1MND A;  2KQ9 A;  4Q7C A;  5DLJ A;  2C03 A;  3E9V A;  3NYM A;  3N24 A;  2W9Y A;  2DYS C;  1TWG A;  2NG1 A;  3NYL A;  3NRH A;  3DM5 A;  3LLK A;  3LLI A;  2NUT B;  1MMN A;  2EIL C;  5KYY A;  2ZXW C;  4CIH A;  2J7P A;  1G8X A;  3ZVR A;  2A6E F;  1JPN A;  4CS9 C;  1VOM A;  3RH3 A;  3UR3 C;  3S27 A;  4ZLC A;  5IY5 C;  4YWQ A;  2MWQ A;  2HV7 A;  4IWB A;  1PCX A;  4OD4 A;  5B3S C;  2YZS A;  3DMD A;  3KL4 A;  4A2N B;  3EFO A;  4ULW A;  4W8K A;  3SYN A;  3EQL F;  4CSA A;  3OEO A;  4K7B A;  4G7H F;  4Q4Z F;  1V54 C;  2E87 A;  5KYN A;  1BR4 A;  3F47 A;  2L81 A;  3UNG C;  1TWC A;  2H7B A;  3FDQ A;  1ZHT A;  4JCH A;  4RD9 A;  1OCZ C;  2J0X A;  2WZF A;  1ZHX A;  3T6B A;  1M2V B;  3I5P A;  3DJN B;  3X1O A;  3ASN C;  2P7V A;  3M1C B;  3UMI A;  1SMY F;  4WJ0 A;  2W4B A;  3K1H A;  3T4R A;  1LS1 A;  5BUO A;  4DVZ A;  2XXA A;  2IOQ A;  1FFH A;  4PK4 A;  1M57 C;  4IJJ A;  2Y39 A;  4U5G A;  3LAY A;  4C3E A;  2IXN A;  4I44 A;  1ZU5 A;  2OCC C;  3L0I A;  4J32 B;  1MMA A;  4YT4 A;  5L3V A;  3OA1 A;  2Q9B A;  3LNR A;  1MMG A;  3PHF 2;  5KYX B;  1Z63 A;  2WZG A;  5EGY A;  2R7O A;  4F4B A;  3NKE A;  2V26 A;  2VAS A;  1TWH A;  4BJ5 A;  1J8M F;  3KH2 A;  4OIO F;  1RJ9 A;  3PMR A;  2XRH A;  3ABL C;  3S29 A;  2Q3T A;  3EG9 A;  4JW1 A;  4EBB A;  3FAJ A;  4Q5S F;  2M4E A;  3O6X A;  2Q9C A;  3AG1 C;  4O79 A;  3CSK A;  2LSE A;  1J8Y F;  4I3M A;  4LER A;  3EGD B;  2NUP B;  1O5H A;  3MLG A;  3N2Z B;  2ZXO A;  2J45 A;  4XLP F;  3ITF A;  1MNE A;  3WOD F;  4ANJ A;  4GYT A;  2HV6 A;  3DXJ F;  2CNW A;  2Z15 A;  3LS0 A;  4I1O B;  3S28 A;  3KKB A;  1SF8 A;  3RKO F;  4CS7 A;  1FFT C;  1ST6 A;  2I8B A;  4G0H A;  4YT8 A;  5D91 A;  3AG3 C;  2R7V A;  4YJW A;  4O6Y A;  2XSE A;  3S0X A;  3AQC A;  2PX0 A;  3DAG A;  2NUT A;  2KNH A;  1W2W A;  4P6I C;  1KU2 A;  4PFO A;  4OD5 A;  4JUR I;  2C04 A;  2D5R B;  1VMA A;  4C3D A;  2A68 F;  2KGO A;  3K6B A;  2Y3D A;  2VH3 A;  2ZPA A;  1Z3I X;  1Z23 A;  4BJ6 C;  3F46 A;  4MQ9 F;  2IXP A;  2QY9 A;  3V7O A;  3SEO A;  3ASO C;  4LLE A;  4G7Z F;  4E7S A;  2WL8 A;  3O39 A;  4O6N A;  4LLC A;  2IYL D;  1ZYR F;  3ZG1 A;  3HLZ A;  2R7T A;  3W2W A;  2Y3H A;  2W45 A;  3CZ6 A;  4OIP F;  4G7O F;  2J7P D;  4KNW A;  3K66 A;  1D0Y A;  3Q7G A;  5B1A C;  1QLE C;  3DD7 A;  3JT1 A;  3QZC A;  4GEH A;  3RYL A;  1QZX A;  2CGE A;  2PP4 A;  3B0V C;  4CS9 A;  3JSZ A;  4C3B A;  3UGP A;  4YN0 B;  2BE5 F;  3EGX A;  4DBR A;  3N0T A;  1M2V A;  4E7Z A;  3VAY A;  2EIN C;  3EGX B;  3NG1 A;  2Y69 C;  2R7S A;  4HEA J;  5DS5 A;  4BG0 A;  3MX3 A;  2XL4 A;  3K1I C;  1VYK A;  2G3V A;  5B1B C;  3FVY A;  4PJJ A;  1S7Z A;  1WGW A;  4HFK B;  1OCO C;  5E3A A;  4U5E E;  1D0X A;  1LVK A;  5KYU B;  3B0U X;  4O7G A;  2KW3 C;  3RIP A;  4K0D A;  2H7O A;  3NDB B;  2R7X A;  1M2O A;  2A6H F;  5KYX A;  1OCR C;  3IEE A;  1MMD A;  1N1C A;  5FCL A;  4JVS A;  3UMK A;  1D0Z A;  4OIN F;  5KYW B;  4JZA A;  3VYW A;  2W4M A;  2GFH A;  4C7O B;  5F5H A;  3LS1 A;  4MND A;  1SZI A;  1JPJ A;  5E2Q A;  3UMH A;  4XTK A;  5HSW A;  1D1C A;  2Y3B A;  3FHD A;  2B0J A;  3H65 A;  5T3T A;  4XLN F;  4PFP A;  3EGD A;  2NUP A;  4YT2 A;  1VYI A;  3ECS A;  5DS6 A;  5DQZ A;  2L9J A;  1OKK A;  2WB7 A;  3NYJ A;  3LJB A;  4DOZ A;  1Z6A A;  4KNV A;  2YHS A;  3RFY A;  4U5H A;  2Q9A A;  2DYR C;  3WG7 C;  2PX3 A;  3DAF A;  5E3C A;  3EH1 A;  4J30 B;  4PJN A;  2ZXR A;  3GOD A;  2VB6 A;  2WVN A;  3ABK C;  1FTS A;  2OG2 A;  3UGO A;  4OIR F;  3JYH A;  2CDQ A;  4CS8 A;  3GAN A;  4I1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...