1OR3A

Apolipoprotein e3 (apoe3), trigonal truncation mutant 165
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
143
structure length
136
Chain Sequence
b'SGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (APOLIPOPROTEIN E)
molecule tags Lipid binding protein
source organism Homo sapiens
publication title Conformational flexibility in the apolipoprotein E amino-terminal domain structure determined from three new crystal forms: implications for lipid binding.
pubmed rcsb
total genus 58
structure length 136
sequence length 143
ec nomenclature
pdb deposition date 1998-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1or3A00
1AEPA 1H7IA 1B68A 1NFOA 1OR2A 1LE2A 1YA9A 2KC3A 1GS9A 1EA8A 1NFNA 1OR3A 1BZ4A 1EQ1A 1LE4A 3R2PA 3S84A 1LS4A 1LPEA
chains in the Genus database with same CATH superfamily
3AG1C 4CJGA 1ZHWA 4P9TA 4K0DA 4YT8A 2XM0A 4ZLDA 1RJ9B 1ZU4A 4JJFA 1L7CA 3T6JA 4EWCA 1WGWA 3SXYA 4AL1A 4U5HA 2D4UA 5L3QA 4ER9A 2XXAB 4OINF 4OIRF 3SNHA 1BR4A 3JSEO 3HJCA 4XPYA 4MW3A 5E3CA 1IZMA 2XXAA 1XWJA 5DVWA 1Z6AA 5COMA 3U5SA 1OCZC 1AEPA 4Q5SF 1E2XA 3NKEA 1G4US 2IXOA 1PD1A 2R05A 2I8BA 2QUPA 3EQLF 1I5NA 2Y39A 4O7GA 2OG2A 4BJ5A 2FGYA 3T6BA 4DBRA 1H6GA 2ZD9A 3CSKA 3K7DA 4QI0A 3O10A 3FAPB 2EPMX 3C8GB 3IQCA 4JTCB 3W2WA 4ULWA 4MVRA 2Q7RA 3Q7LA 4XEVA 2DYRC 1D1CA 5A6JA 1YYJA 3U2LA 2WZGA 4YJWA 2Z15A 2R7XA 4JZAA 3UGPA 1T6QA 2Y3HA 4DBQA 3MLGA 1OW8A 1FFTC 1TFKB 1CPRA 3KH2A 4E0HA 2LCHA 3FOOA 4JKVA 2XLEA 5JVEA 3VAYA 5K0IA 2J9VA 2WVNA 2M4EA 4YWQA 1FMVA 3EGDA 4L6RA 3ZTZA 4IGGA 1EQ1A 2IXNA 1OQCA 3NYMA 4JE9A 2Q00A 3VYWA 2KC3A 1YYXA 2C04A 4G0HA 4JTAB 4ONSA 1HMDA 1VTMP 2CNWA 2EPOA 1YZCA 1LE4A 1OXBA 3RQEA 1D0YA 1FAPB 1FMWA 1SYQA 4E0IA 5DS4A 1PCXA 4CS8C 3LUTB 1JRAA 3B71A 4U5BE 3TOMA 1E84A 2WVQA 3DJNB 4CJOA 3ATPA 3EFOB 2GFHA 2WL8A 3DM5A 2P61A 3G50A 3OEOA 4WGYA 4XQ1A 3S29A 3U2MA 2YZSA 1XZPA 3AGTA 3NRHA 4H4KC 4YN0B 5DLJA 4LDQA 4EKWA 1ZVZA 1SF8A 4E17A 4YT5A 4ZLCA 2XL8A 1WN0A 1PD0A 3UNGC 2KK1A 4P9FA 1Q0KA 2R7WA 3PMRA 3W8IA 3V7OA 1ZYRF 1V74B 3KKBA 1DOWA 4MNDA 2IM8A 2W9YA 3K66A 2J0WA 5KYYA 4LERA 2Y69C 3MYIA 3ASNC 5KYXB 3DXJF 4C3DA 3M15A 4IAOA 1YZAA 1QKRA 2BL2A 1MQVA 2WVOA 4U5DE 1KTMA 1JAFA 3PCVA 5KYUB 2H7VC 4J32B 5BUOA 1OKKA 5EHHA 1YAUO 2EPLX 2XL4A 1ST6A 4IB4A 3VM6A 4AK9A 1YDIA 3NMKA 2AWCA 1R5ID 3KPHA 3EH2A 4JRZA 3Q7GA 4JVSA 4YL3A 1JOGA 3G4ZA 5HSWA 1OW6A 2NUPB 2YRFA 2KGOA 2IXMA 2P7VA 4NTBA 1A7EA 4CS9C 1TKNA 2LQGA 3BRJA 4HE8D 3NDBB 4CSAC 5CI8A 3O6XA 1WATA 4XLPF 4M63A 4HEAJ 3MFNA 1AUEA 3I5PA 3S28A 3TD7A 3A11A 1LS1A 1E83A 2J7PA 4C7OA 3LNRA 1LE2A 4JJGA 4PACA 5JSLA 3NMJA 3RKOF 3GWLA 3DI5A 2PBEA 2NUTB 3U9MA 3HLZA 4E18A 4RBNA 2XLMA 3WODF 2Q3TA 2XS8A 1VLSA 3GODA 5KYUA 1L3PA 2W4BA 4N4WA 1Q0MA 1Y4CA 2P6VA 2H7OA 3EG9B 3U3FA 3G4XA 3H2VA 2H7BA 4E7ZA 5EK0A 5DQZA 2W4MA 2Y3GA 3LESA 2LSEA 4U5EE 3B9QA 3B0VC 3ZVRA 2ZXPA 1T6IA 2EIKC 4W8PA 3AOUA 4OD4A 2A6HF 1RCPA 1BZ4A 3C18A 3LEVA 2CGEA 2NSGA 5AGFA 2XL6A 1H7IA 3O39A 3EGDB 2OU6A 3DKAA 3MYFA 3UMIA 1CPQA 1WASA 2PX3A 2X51A 4XEFA 4JIOA 3JCUQ 3L8IA 3AQBA 2YHSA 2RSEB 1I4ZA 3DD7A 3GORA 2PP4A 4LLEA 3HNIA 5JP7A 1R4TA 1LS4A 4DVYP 1Q0FA 3DE9A 3W2VA 1NFOA 2P1AA 4D4NA 1AVOB 4QI2A 1A0BA 1EA8A 1HW2A 1M56C 4WABA 3BEHA 3UGOA 2VC9A 1W2WA 4FX5A 4CDAA 1QVXA 4OIQF 1WWPA 2XSEA 4OIOF 3LAYA 3Q6NA 3KYJA 1VOMA 1BBHA 3V5ZA 3EH1A 3DAFA 1ZHXA 5E3AA 2A1DD 3Q6MA 1OXKA 3B29A 4XLNF 1OCRC 4IARA 4C3BA 5JLIA 5JRAA 3IEEA 5BQIA 3R2PA 2EIMC 1S05A 2OEVA 3K33A 2HFIA 5BQGA 1Y6DA 3GWNA 5KYYB 1V55C 2C03A 2HKVA 3ECSA 3SXZA 4AL0A 3F47A 3FVYA 4XWJA 5DQTA 1SR2A 5T1DB 2J46A 5KYWB 3DJUB 2DI3A 4MW8A 3RQFA 3RVYA 2ICWG 2MWQA 2A0UA 4B6IA 1A7VA 2HZ8A 3U8VA 2HJ3A 1TFOB 5L0DA 3H65A 3LS0A 1OR2A 2ZXOA 2LP4A 3FAJA 3N2ZB 5JT4A 4DXWA 3B0UX 1J8YF 5F5HA 1D0ZA 1KU2A 3GM2A 4A2NB 1V4AA 2J8WA 2Q9AA 4K7BA 3E9VA 4I44A 3EGXA 4KBLA 3ZSUA 1S7ZA 2QTVA 5KYNA 3PDMP 5DS6A 3VF0A 2P0NA 4KC9A 4YK5A 1TWHA 3ZWIA 1C02A 1RJ9A 4NY3A 2B0HA 1TQGA 4O79A 4BPMA 3DZAA 1QLEC 2R7QA 1A7DA 3JRTA 4HFFB 3SZRA 2VH3A 3LS1A 5D92A 3H2UA 4C3EA 1MMDA 2Q4FA 4H54A 5L0CA 3TJ5A 4G7OF 4G7ZF 4MVSA 3LJBA 1GQAA 1CGME 3SYNA 1HW1A 1JPJA 3FOPA 4J7TA 2DYSC 4CDVA 2V3CC 2OQMA 2OJQA 3EHNA 3M79A 2BE5F 5A6AA 1RMVA 1WOLA 3S9OA 2D5RB 2ZXRA 3B0PA 3KMIA 4XTKA 3S27A 1Z3IX 5AC5A 1BR2A 3C8GA 2Q9BA 1JR8A 1NSGB 1QPUA 3DWWA 2OCCC 4JC7A 1TWCA 1VMAA 4AE4B 4EIYA 4CSAA 3EZIA 4FAPB 2CYDA 1VYKA 4MTFA 3WHNA 5B1AC 2JPUA 4MTOA 5T3TA 4XPXA 4P6IC 3GEIA 3MBGA 2HMZA 3ABMC 4LACB 2AU5A 4CS8A 4DRIB 2HUJA 3U3BA 1JMWA 2G3VA 5D91A 4K1OA 1M2VB 1U0BB 4WGZA 1EKYA 3GEEA 1QSPA 2LK4A 4PFOA 3CQZA 1T6UA 3V5XA 5L0JA 4JEAA 4FESA 2XS1A 2GDCA 4N6CA 5A6BD 3RIPA 3CEXA 2G3KA 4KI2A 2XM4A 3FHDA 3LLKA 1H9TA 2IYLD 1OCOC 2AP3A 1V54C 2HV7A 4PJJA 2HS5A 2FFHA 2PNOA 1HY5A 1I4YA 3NYJA 3QVZA 4JCHA 1Q0GA 2WZFA 4ULVA 3CAXA 2KW3C 3EPVA 3WAQA 1RXQA 5B3SC 2O9XA 2XLDA 5FZTA 3S0XA 4C7OB 4MVQA 1OCCC 3LLIA 2CDQA 1NG1A 5GPGB 1QZXA 2E87A 3C8GD 4N6HA 4JW1A 2GAQA 4NCQA 4NTAA 3W8HA 4D4XA 4CBEA 5A6KA 3KYIA 1LPEA 2NG1A 3MX3A 3FMSA 1JPNA 4U5CE 1YA9A 1ZHZA 5COFA 4CDYA 1O3UA 2EILC 4BJTA 4UDVA 2NUPA 1BDJB 5L0HA 1LIHA 2L6FA 4PJMA 4DRJB 2A69F 1CGOA 2ASRA 2PFDA 4WJ0A 1FTSA 5T3WA 2Y3DA 1LI7A 3GANA 1OR3A 1C03A 2BC5A 1U6HA 1TWGA 4U5FE 3V5YA 4NQFA 2R7UA 3AJMA 4IRUA 3U0CA 2JD3A 2VCBA 3ABKC 2YL7A 1APCA 3EG9A 4JURI 2DGJA 3IQTA 1KNYA 4LDKA 3QTHA 2PX0A 4IJJA 3N24A 5L0IA 5KYXA 3U8PA 4YT2A 2VCCA 3C62A 1TWAA 3I5QA 4PJLA 5HV9A 3IPMO 2VB6A 4BG0A 3NMIA 1ZHYA 1NU7D 1F1MA 1SMYF 3RQGA 1ZZPA 2Y3BA 4CX9A 2M64A 2XRHA 3RF3A 2R03A 3JSZA 4JCZA 2QY9A 3HNKA 4BJ6A 5JS5A 3JT1A 5IY5C 3M4BA 1BR1A 4DOZA 1GGQA 2R7TA 3IQ5A 3AG4C 5EGYA 3DE8A 3O55A 4OD5A 2UUHA 4U9DA 3JRMO 1U89A 3L34A 1ORJA 4PJNA 4PR9A 4R32A 4BJ5C 3RFYA 2MYSA 3J06A 4KNWA 2AWYA 2EINC 2R7SA 2H8AA 1LKXA 4NC3A 1D1AA 2ETSA 3EJNA 3SXKA 3SXMA 3TOLA 2YWAA 2TMVP 1M6TA 3SP1A 1GM5A 2WB7A 2XLWA 5FCLA 2YVKA 5TJ5E 4PFPA 2LD6A 5L3VA 4BJ1A 1MNEA 1OW7A 3AQCA 4W8KA 1T5OA 2UUIA 2CCYA 3QW0A 3ZQYA 2L7AA 3ZIBA 3JZ0A 2HSBA 3N0TA 4MVOA 4DVZA 2L6GA 4Z9HA 3PHF2 5F28E 4N06A 3X2QC 1NLXA 2J9WA 2A0BA 3C63A 4CS9A 3QVYA 5L0GA 2YL0A 5F5FA 3TJ6A 2IBFA 4BEJA 2CNWD 4LLCA 1MMNA 5AC4A 1HMOA 4O6NA 3U9JA 3K1IC 1FNTc 3L8JA 1ZW3A 5DS5A 5COGA 3OWTA 2CW0F 4IWBA 5L0FA 5E33A 1PV3A 3L1MA 4MQ9F 3HNJA 5CI9A 4I1OB 4BJ6C 4O6YA 3RH3A 4CIHA 2YEVA 1IW7F 3JYYA 3E70C 4J30B 1YJGA 2QE9A 2R7OA 1Z5ZA 2X0CA 1YARO 2LFDA 1SZIA 3F46A 1QQ3A 4XEKA 1FR0A 1YA7O 4JEBA 1DOVA 5A6BA 1LI5A 1H9GA 1ORSC 1Q0DA 3L0IA 5E2QA 1Z7Qc 1MMAA 4U9EA 3I4UA 1ZW2A 2VCAA 3M1CB 3T4RA 2NUTA 1TR2A 4CS7A 2B0JA 4AE4A 1O87A 2LIGA 2JX0A 2QLAA 2DB4A 2FAPB 4QDLA 3VRCA 3TQOA 4Z9IA 1RKCA 3ASOC 1ZHTA 3GEHA 3AG3C 2G62A 3HTKC 4G78A 1G4WR 3C8ZA 3ZTMA 1G5ZA 4DJ9A 5JUAA 3ZDLA 3DMDA 2R02A 1K40A 4U5GA 4EUKB 3R7CA 3ZC4A 4EHPA 1YLMA 256BA 2HSQA 3EFOA 3HNLA 4HFKB 2ZXWC 1D1BA 4J7YA 1K04A 2GA0A 3EHMA 2HV6A 1LVKA 3OA1A 3LNMB 3NG1A 2XLOA 2YKZA 3TK0A 1OKKD 4E7SA 4X0RA 4EBKA 2RD9A 4Q4ZF 4MVMA 2NSFA 2R9RB 4JTDB 2J7PD 1NU9C 2MHRA 1O5HA 2J9UA 2AVKA 3SEOA 1ORYA 3S84A 2LFFA 2W45A 1FFHA 4G7HF 4EBBA 2OEXA 2KSFA 4EBJA 3ABLC 4XPWA 1M2VA 3GM1A 3DAGA 3EGXB 4F4BA 1E85A 1MNDA 1VYIA 2IOQA 4LDRA 3M4CA 2A68F 3K6BA 4RDAA 5CIVA 2HJMA 1WTYA 2ZPAA 2L9JA 3GM3A 3K1HA 1Z23A 3WG7C 2EIJC 2YL3A 3ZQVA 3DM9B 2R7VA 2WZLA 4GQHA 4KNVA 5B3IA 1LM3B 2KNHA 2EPKX 3FXHA 4IAQA 1B68A 2L81A 2QNLA 1VLTA 2R25A 4ANJA 4DRHB 1VK5A 2F22A 3RYLA 3CZ6A 4FWVA 1XZQA 3NKDA 1C17M 3W4YA 3KL4A 4I1MA 1MMGA 1T9KA 1D0XA 3JTLO 2J45A 5BQHA 2YLIA 1GS9A 4GEHA 2IXPA 1A41A 1UG7A 2KYHA 2V26A 4YL1A 1VB5A 4Q7CA 1HE1A 2R7RA 3X1OA 2YLDA 5B1BC 1NFNA 4MS2A 4MVZA 2OKUA 1M57C 2L6HA 3QMKA 3QW1A 4RD9A 2VASA 1K05A 1UFBA 3AG2C 2KJGA 1E86A 3NYLA 3T9OA 2J0XA 1J8MF 3EZHA 3S90A 4OIPF 3UR3C 3LEOA 4YL0A 2EPNA 4NTFA 1G8XA 1RKEA 2J9BA 2OOCA 2PF4E 3ITFA 3HKKA 3IQ6A 1M2OA 3RVZA 2GWWA 2KQ9A 2NPUA 2YLGA 1YVIA 3US6A 4CIPA 3TULA 3FDQA 2XLVA 3POVA 4O6MA 4AX2A 1CGNA 4YT4A 4I3MA 3K1IA 1N1CA 3AGUA 2YL1A 1Z63A 2HMQA 3T6GB 4MVUA 1NZEA 4Z9JA 2A6EF 2I15A 3C7JA 3UMKA 5A69A 2YQYA 1T01A 1ZU5A 1HE9A 3JYHA 3RW0A 3A9CA 2XLHA 4PK4A 4MTGA 1EI7A 2Q9CA 1RKEB 4A4AA 3QZCA 3UMHA 4GYTA 5KYWA 4BEMJ 3ZG1A 2OJED 3IHUA 1NBBA
chains in the Genus database with same CATH topology
1AEPA 1H7IA 1B68A 1NFOA 1OR2A 1LE2A 1YA9A 2KC3A 1GS9A 1EA8A 1NFNA 1OR3A 1BZ4A 1EQ1A 1LE4A 3R2PA 3S84A 1LS4A 1LPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AEP A;  1H7I A;  1B68 A;  1NFO A;  1OR2 A;  1LE2 A;  1YA9 A;  2KC3 A;  1GS9 A;  1EA8 A;  1NFN A;  1OR3 A;  1BZ4 A;  1EQ1 A;  1LE4 A;  3R2P A;  3S84 A;  1LS4 A;  1LPE A; 
#chains in the Genus database with same CATH topology
 3AG1 C;  4CJG A;  1ZHW A;  4P9T A;  4K0D A;  4YT8 A;  2XM0 A;  4ZLD A;  1RJ9 B;  1ZU4 A;  4JJF A;  1L7C A;  3T6J A;  4EWC A;  1WGW A;  3SXY A;  4AL1 A;  4U5H A;  2D4U A;  5L3Q A;  4ER9 A;  2XXA B;  4OIN F;  4OIR F;  3SNH A;  1BR4 A;  3JSE O;  3HJC A;  4XPY A;  4MW3 A;  5E3C A;  1IZM A;  2XXA A;  1XWJ A;  5DVW A;  1Z6A A;  5COM A;  3U5S A;  1OCZ C;  1AEP A;  4Q5S F;  1E2X A;  3NKE A;  1G4U S;  2IXO A;  1PD1 A;  2R05 A;  2I8B A;  2QUP A;  3EQL F;  1I5N A;  2Y39 A;  4O7G A;  2OG2 A;  4BJ5 A;  2FGY A;  3T6B A;  4DBR A;  1H6G A;  2ZD9 A;  3CSK A;  3K7D A;  4QI0 A;  3O10 A;  3FAP B;  2EPM X;  3C8G B;  3IQC A;  4JTC B;  3W2W A;  4ULW A;  4MVR A;  2Q7R A;  3Q7L A;  4XEV A;  2DYR C;  1D1C A;  5A6J A;  1YYJ A;  3U2L A;  2WZG A;  4YJW A;  2Z15 A;  2R7X A;  4JZA A;  3UGP A;  1T6Q A;  2Y3H A;  4DBQ A;  3MLG A;  1OW8 A;  1FFT C;  1TFK B;  1CPR A;  3KH2 A;  4E0H A;  2LCH A;  3FOO A;  4JKV A;  2XLE A;  5JVE A;  3VAY A;  5K0I A;  2J9V A;  2WVN A;  2M4E A;  4YWQ A;  1FMV A;  3EGD A;  4L6R A;  3ZTZ A;  4IGG A;  1EQ1 A;  2IXN A;  1OQC A;  3NYM A;  4JE9 A;  2Q00 A;  3VYW A;  2KC3 A;  1YYX A;  2C04 A;  4G0H A;  4JTA B;  4ONS A;  1HMD A;  1VTM P;  2CNW A;  2EPO A;  1YZC A;  1LE4 A;  1OXB A;  3RQE A;  1D0Y A;  1FAP B;  1FMW A;  1SYQ A;  4E0I A;  5DS4 A;  1PCX A;  4CS8 C;  3LUT B;  1JRA A;  3B71 A;  4U5B E;  3TOM A;  1E84 A;  2WVQ A;  3DJN B;  4CJO A;  3ATP A;  3EFO B;  2GFH A;  2WL8 A;  3DM5 A;  2P61 A;  3G50 A;  3OEO A;  4WGY A;  4XQ1 A;  3S29 A;  3U2M A;  2YZS A;  1XZP A;  3AGT A;  3NRH A;  4H4K C;  4YN0 B;  5DLJ A;  4LDQ A;  4EKW A;  1ZVZ A;  1SF8 A;  4E17 A;  4YT5 A;  4ZLC A;  2XL8 A;  1WN0 A;  1PD0 A;  3UNG C;  2KK1 A;  4P9F A;  1Q0K A;  2R7W A;  3PMR A;  3W8I A;  3V7O A;  1ZYR F;  1V74 B;  3KKB A;  1DOW A;  4MND A;  2IM8 A;  2W9Y A;  3K66 A;  2J0W A;  5KYY A;  4LER A;  2Y69 C;  3MYI A;  3ASN C;  5KYX B;  3DXJ F;  4C3D A;  3M15 A;  4IAO A;  1YZA A;  1QKR A;  2BL2 A;  1MQV A;  2WVO A;  4U5D E;  1KTM A;  1JAF A;  3PCV A;  5KYU B;  2H7V C;  4J32 B;  5BUO A;  1OKK A;  5EHH A;  1YAU O;  2EPL X;  2XL4 A;  1ST6 A;  4IB4 A;  3VM6 A;  4AK9 A;  1YDI A;  3NMK A;  2AWC A;  1R5I D;  3KPH A;  3EH2 A;  4JRZ A;  3Q7G A;  4JVS A;  4YL3 A;  1JOG A;  3G4Z A;  5HSW A;  1OW6 A;  2NUP B;  2YRF A;  2KGO A;  2IXM A;  2P7V A;  4NTB A;  1A7E A;  4CS9 C;  1TKN A;  2LQG A;  3BRJ A;  4HE8 D;  3NDB B;  4CSA C;  5CI8 A;  3O6X A;  1WAT A;  4XLP F;  4M63 A;  4HEA J;  3MFN A;  1AUE A;  3I5P A;  3S28 A;  3TD7 A;  3A11 A;  1LS1 A;  1E83 A;  2J7P A;  4C7O A;  3LNR A;  1LE2 A;  4JJG A;  4PAC A;  5JSL A;  3NMJ A;  3RKO F;  3GWL A;  3DI5 A;  2PBE A;  2NUT B;  3U9M A;  3HLZ A;  4E18 A;  4RBN A;  2XLM A;  3WOD F;  2Q3T A;  2XS8 A;  1VLS A;  3GOD A;  5KYU A;  1L3P A;  2W4B A;  4N4W A;  1Q0M A;  1Y4C A;  2P6V A;  2H7O A;  3EG9 B;  3U3F A;  3G4X A;  3H2V A;  2H7B A;  4E7Z A;  5EK0 A;  5DQZ A;  2W4M A;  2Y3G A;  3LES A;  2LSE A;  4U5E E;  3B9Q A;  3B0V C;  3ZVR A;  2ZXP A;  1T6I A;  2EIK C;  4W8P A;  3AOU A;  4OD4 A;  2A6H F;  1RCP A;  1BZ4 A;  3C18 A;  3LEV A;  2CGE A;  2NSG A;  5AGF A;  2XL6 A;  1H7I A;  3O39 A;  3EGD B;  2OU6 A;  3DKA A;  3MYF A;  3UMI A;  1CPQ A;  1WAS A;  2PX3 A;  2X51 A;  4XEF A;  4JIO A;  3JCU Q;  3L8I A;  3AQB A;  2YHS A;  2RSE B;  1I4Z A;  3DD7 A;  3GOR A;  2PP4 A;  4LLE A;  3HNI A;  5JP7 A;  1R4T A;  1LS4 A;  4DVY P;  1Q0F A;  3DE9 A;  3W2V A;  1NFO A;  2P1A A;  4D4N A;  1AVO B;  4QI2 A;  1A0B A;  1EA8 A;  1HW2 A;  1M56 C;  4WAB A;  3BEH A;  3UGO A;  2VC9 A;  1W2W A;  4FX5 A;  4CDA A;  1QVX A;  4OIQ F;  1WWP A;  2XSE A;  4OIO F;  3LAY A;  3Q6N A;  3KYJ A;  1VOM A;  1BBH A;  3V5Z A;  3EH1 A;  3DAF A;  1ZHX A;  5E3A A;  2A1D D;  3Q6M A;  1OXK A;  3B29 A;  4XLN F;  1OCR C;  4IAR A;  4C3B A;  5JLI A;  5JRA A;  3IEE A;  5BQI A;  3R2P A;  2EIM C;  1S05 A;  2OEV A;  3K33 A;  2HFI A;  5BQG A;  1Y6D A;  3GWN A;  5KYY B;  1V55 C;  2C03 A;  2HKV A;  3ECS A;  3SXZ A;  4AL0 A;  3F47 A;  3FVY A;  4XWJ A;  5DQT A;  1SR2 A;  5T1D B;  2J46 A;  5KYW B;  3DJU B;  2DI3 A;  4MW8 A;  3RQF A;  3RVY A;  2ICW G;  2MWQ A;  2A0U A;  4B6I A;  1A7V A;  2HZ8 A;  3U8V A;  2HJ3 A;  1TFO B;  5L0D A;  3H65 A;  3LS0 A;  1OR2 A;  2ZXO A;  2LP4 A;  3FAJ A;  3N2Z B;  5JT4 A;  4DXW A;  3B0U X;  1J8Y F;  5F5H A;  1D0Z A;  1KU2 A;  3GM2 A;  4A2N B;  1V4A A;  2J8W A;  2Q9A A;  4K7B A;  3E9V A;  4I44 A;  3EGX A;  4KBL A;  3ZSU A;  1S7Z A;  2QTV A;  5KYN A;  3PDM P;  5DS6 A;  3VF0 A;  2P0N A;  4KC9 A;  4YK5 A;  1TWH A;  3ZWI A;  1C02 A;  1RJ9 A;  4NY3 A;  2B0H A;  1TQG A;  4O79 A;  4BPM A;  3DZA A;  1QLE C;  2R7Q A;  1A7D A;  3JRT A;  4HFF B;  3SZR A;  2VH3 A;  3LS1 A;  5D92 A;  3H2U A;  4C3E A;  1MMD A;  2Q4F A;  4H54 A;  5L0C A;  3TJ5 A;  4G7O F;  4G7Z F;  4MVS A;  3LJB A;  1GQA A;  1CGM E;  3SYN A;  1HW1 A;  1JPJ A;  3FOP A;  4J7T A;  2DYS C;  4CDV A;  2V3C C;  2OQM A;  2OJQ A;  3EHN A;  3M79 A;  2BE5 F;  5A6A A;  1RMV A;  1WOL A;  3S9O A;  2D5R B;  2ZXR A;  3B0P A;  3KMI A;  4XTK A;  3S27 A;  1Z3I X;  5AC5 A;  1BR2 A;  3C8G A;  2Q9B A;  1JR8 A;  1NSG B;  1QPU A;  3DWW A;  2OCC C;  4JC7 A;  1TWC A;  1VMA A;  4AE4 B;  4EIY A;  4CSA A;  3EZI A;  4FAP B;  2CYD A;  1VYK A;  4MTF A;  3WHN A;  5B1A C;  2JPU A;  4MTO A;  5T3T A;  4XPX A;  4P6I C;  3GEI A;  3MBG A;  2HMZ A;  3ABM C;  4LAC B;  2AU5 A;  4CS8 A;  4DRI B;  2HUJ A;  3U3B A;  1JMW A;  2G3V A;  5D91 A;  4K1O A;  1M2V B;  1U0B B;  4WGZ A;  1EKY A;  3GEE A;  1QSP A;  2LK4 A;  4PFO A;  3CQZ A;  1T6U A;  3V5X A;  5L0J A;  4JEA A;  4FES A;  2XS1 A;  2GDC A;  4N6C A;  5A6B D;  3RIP A;  3CEX A;  2G3K A;  4KI2 A;  2XM4 A;  3FHD A;  3LLK A;  1H9T A;  2IYL D;  1OCO C;  2AP3 A;  1V54 C;  2HV7 A;  4PJJ A;  2HS5 A;  2FFH A;  2PNO A;  1HY5 A;  1I4Y A;  3NYJ A;  3QVZ A;  4JCH A;  1Q0G A;  2WZF A;  4ULV A;  3CAX A;  2KW3 C;  3EPV A;  3WAQ A;  1RXQ A;  5B3S C;  2O9X A;  2XLD A;  5FZT A;  3S0X A;  4C7O B;  4MVQ A;  1OCC C;  3LLI A;  2CDQ A;  1NG1 A;  5GPG B;  1QZX A;  2E87 A;  3C8G D;  4N6H A;  4JW1 A;  2GAQ A;  4NCQ A;  4NTA A;  3W8H A;  4D4X A;  4CBE A;  5A6K A;  3KYI A;  1LPE A;  2NG1 A;  3MX3 A;  3FMS A;  1JPN A;  4U5C E;  1YA9 A;  1ZHZ A;  5COF A;  4CDY A;  1O3U A;  2EIL C;  4BJT A;  4UDV A;  2NUP A;  1BDJ B;  5L0H A;  1LIH A;  2L6F A;  4PJM A;  4DRJ B;  2A69 F;  1CGO A;  2ASR A;  2PFD A;  4WJ0 A;  1FTS A;  5T3W A;  2Y3D A;  1LI7 A;  3GAN A;  1OR3 A;  1C03 A;  2BC5 A;  1U6H A;  1TWG A;  4U5F E;  3V5Y A;  4NQF A;  2R7U A;  3AJM A;  4IRU A;  3U0C A;  2JD3 A;  2VCB A;  3ABK C;  2YL7 A;  1APC A;  3EG9 A;  4JUR I;  2DGJ A;  3IQT A;  1KNY A;  4LDK A;  3QTH A;  2PX0 A;  4IJJ A;  3N24 A;  5L0I A;  5KYX A;  3U8P A;  4YT2 A;  2VCC A;  3C62 A;  1TWA A;  3I5Q A;  4PJL A;  5HV9 A;  3IPM O;  2VB6 A;  4BG0 A;  3NMI A;  1ZHY A;  1NU7 D;  1F1M A;  1SMY F;  3RQG A;  1ZZP A;  2Y3B A;  4CX9 A;  2M64 A;  2XRH A;  3RF3 A;  2R03 A;  3JSZ A;  4JCZ A;  2QY9 A;  3HNK A;  4BJ6 A;  5JS5 A;  3JT1 A;  5IY5 C;  3M4B A;  1BR1 A;  4DOZ A;  1GGQ A;  2R7T A;  3IQ5 A;  3AG4 C;  5EGY A;  3DE8 A;  3O55 A;  4OD5 A;  2UUH A;  4U9D A;  3JRM O;  1U89 A;  3L34 A;  1ORJ A;  4PJN A;  4PR9 A;  4R32 A;  4BJ5 C;  3RFY A;  2MYS A;  3J06 A;  4KNW A;  2AWY A;  2EIN C;  2R7S A;  2H8A A;  1LKX A;  4NC3 A;  1D1A A;  2ETS A;  3EJN A;  3SXK A;  3SXM A;  3TOL A;  2YWA A;  2TMV P;  1M6T A;  3SP1 A;  1GM5 A;  2WB7 A;  2XLW A;  5FCL A;  2YVK A;  5TJ5 E;  4PFP A;  2LD6 A;  5L3V A;  4BJ1 A;  1MNE A;  1OW7 A;  3AQC A;  4W8K A;  1T5O A;  2UUI A;  2CCY A;  3QW0 A;  3ZQY A;  2L7A A;  3ZIB A;  3JZ0 A;  2HSB A;  3N0T A;  4MVO A;  4DVZ A;  2L6G A;  4Z9H A;  3PHF 2;  5F28 E;  4N06 A;  3X2Q C;  1NLX A;  2J9W A;  2A0B A;  3C63 A;  4CS9 A;  3QVY A;  5L0G A;  2YL0 A;  5F5F A;  3TJ6 A;  2IBF A;  4BEJ A;  2CNW D;  4LLC A;  1MMN A;  5AC4 A;  1HMO A;  4O6N A;  3U9J A;  3K1I C;  1FNT c;  3L8J A;  1ZW3 A;  5DS5 A;  5COG A;  3OWT A;  2CW0 F;  4IWB A;  5L0F A;  5E33 A;  1PV3 A;  3L1M A;  4MQ9 F;  3HNJ A;  5CI9 A;  4I1O B;  4BJ6 C;  4O6Y A;  3RH3 A;  4CIH A;  2YEV A;  1IW7 F;  3JYY A;  3E70 C;  4J30 B;  1YJG A;  2QE9 A;  2R7O A;  1Z5Z A;  2X0C A;  1YAR O;  2LFD A;  1SZI A;  3F46 A;  1QQ3 A;  4XEK A;  1FR0 A;  1YA7 O;  4JEB A;  1DOV A;  5A6B A;  1LI5 A;  1H9G A;  1ORS C;  1Q0D A;  3L0I A;  5E2Q A;  1Z7Q c;  1MMA A;  4U9E A;  3I4U A;  1ZW2 A;  2VCA A;  3M1C B;  3T4R A;  2NUT A;  1TR2 A;  4CS7 A;  2B0J A;  4AE4 A;  1O87 A;  2LIG A;  2JX0 A;  2QLA A;  2DB4 A;  2FAP B;  4QDL A;  3VRC A;  3TQO A;  4Z9I A;  1RKC A;  3ASO C;  1ZHT A;  3GEH A;  3AG3 C;  2G62 A;  3HTK C;  4G78 A;  1G4W R;  3C8Z A;  3ZTM A;  1G5Z A;  4DJ9 A;  5JUA A;  3ZDL A;  3DMD A;  2R02 A;  1K40 A;  4U5G A;  4EUK B;  3R7C A;  3ZC4 A;  4EHP A;  1YLM A;  256B A;  2HSQ A;  3EFO A;  3HNL A;  4HFK B;  2ZXW C;  1D1B A;  4J7Y A;  1K04 A;  2GA0 A;  3EHM A;  2HV6 A;  1LVK A;  3OA1 A;  3LNM B;  3NG1 A;  2XLO A;  2YKZ A;  3TK0 A;  1OKK D;  4E7S A;  4X0R A;  4EBK A;  2RD9 A;  4Q4Z F;  4MVM A;  2NSF A;  2R9R B;  4JTD B;  2J7P D;  1NU9 C;  2MHR A;  1O5H A;  2J9U A;  2AVK A;  3SEO A;  1ORY A;  3S84 A;  2LFF A;  2W45 A;  1FFH A;  4G7H F;  4EBB A;  2OEX A;  2KSF A;  4EBJ A;  3ABL C;  4XPW A;  1M2V A;  3GM1 A;  3DAG A;  3EGX B;  4F4B A;  1E85 A;  1MND A;  1VYI A;  2IOQ A;  4LDR A;  3M4C A;  2A68 F;  3K6B A;  4RDA A;  5CIV A;  2HJM A;  1WTY A;  2ZPA A;  2L9J A;  3GM3 A;  3K1H A;  1Z23 A;  3WG7 C;  2EIJ C;  2YL3 A;  3ZQV A;  3DM9 B;  2R7V A;  2WZL A;  4GQH A;  4KNV A;  5B3I A;  1LM3 B;  2KNH A;  2EPK X;  3FXH A;  4IAQ A;  1B68 A;  2L81 A;  2QNL A;  1VLT A;  2R25 A;  4ANJ A;  4DRH B;  1VK5 A;  2F22 A;  3RYL A;  3CZ6 A;  4FWV A;  1XZQ A;  3NKD A;  1C17 M;  3W4Y A;  3KL4 A;  4I1M A;  1MMG A;  1T9K A;  1D0X A;  3JTL O;  2J45 A;  5BQH A;  2YLI A;  1GS9 A;  4GEH A;  2IXP A;  1A41 A;  1UG7 A;  2KYH A;  2V26 A;  4YL1 A;  1VB5 A;  4Q7C A;  1HE1 A;  2R7R A;  3X1O A;  2YLD A;  5B1B C;  1NFN A;  4MS2 A;  4MVZ A;  2OKU A;  1M57 C;  2L6H A;  3QMK A;  3QW1 A;  4RD9 A;  2VAS A;  1K05 A;  1UFB A;  3AG2 C;  2KJG A;  1E86 A;  3NYL A;  3T9O A;  2J0X A;  1J8M F;  3EZH A;  3S90 A;  4OIP F;  3UR3 C;  3LEO A;  4YL0 A;  2EPN A;  4NTF A;  1G8X A;  1RKE A;  2J9B A;  2OOC A;  2PF4 E;  3ITF A;  3HKK A;  3IQ6 A;  1M2O A;  3RVZ A;  2GWW A;  2KQ9 A;  2NPU A;  2YLG A;  1YVI A;  3US6 A;  4CIP A;  3TUL A;  3FDQ A;  2XLV A;  3POV A;  4O6M A;  4AX2 A;  1CGN A;  4YT4 A;  4I3M A;  3K1I A;  1N1C A;  3AGU A;  2YL1 A;  1Z63 A;  2HMQ A;  3T6G B;  4MVU A;  1NZE A;  4Z9J A;  2A6E F;  2I15 A;  3C7J A;  3UMK A;  5A69 A;  2YQY A;  1T01 A;  1ZU5 A;  1HE9 A;  3JYH A;  3RW0 A;  3A9C A;  2XLH A;  4PK4 A;  4MTG A;  1EI7 A;  2Q9C A;  1RKE B;  4A4A A;  3QZC A;  3UMH A;  4GYT A;  5KYW A;  4BEM J;  3ZG1 A;  2OJE D;  3IHU A;  1NBB A; 
#chains in the Genus database with same CATH homology
 1AEP A;  1H7I A;  1B68 A;  1NFO A;  1OR2 A;  1LE2 A;  1YA9 A;  2KC3 A;  1GS9 A;  1EA8 A;  1NFN A;  1OR3 A;  1BZ4 A;  1EQ1 A;  1LE4 A;  3R2P A;  3S84 A;  1LS4 A;  1LPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...