1OR3A

Apolipoprotein e3 (apoe3), trigonal truncation mutant 165
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
143
structure length
136
Chain Sequence
SGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (APOLIPOPROTEIN E)
publication title Conformational flexibility in the apolipoprotein E amino-terminal domain structure determined from three new crystal forms: implications for lipid binding.
pubmed rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 58
structure length 136
sequence length 143
ec nomenclature
pdb deposition date 1998-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1or3A00
1YA9A 1NFNA 1H7IA 1LE4A 1LS4A 1BZ4A 3R2PA 3S84A 1EA8A 1AEPA 1NFOA 1LE2A 2KC3A 1B68A 1LPEA 1OR3A 1GS9A 1EQ1A 1OR2A
chains in the Genus database with same CATH superfamily
4HFFB 3UMHA 5KYUB 2L9JA 4O7GA 1OXKA 3IPMO 2J8WA 3I4UA 4NTBA 2J9WA 3EGDA 2XS1A 3RFYA 5DLJA 5A6AA 5CI8A 2I15A 5FZTA 5L0HA 3EG9B 2EILC 4LLCA 4XTKA 2W4MA 3LNRA 4C7OB 3Q7GA 3DI5A 3X2QC 3K7DA 1MMAA 1F1MA 2XL6A 1AEPA 4JKVA 1ZHYA 2A69F 2R9RB 2XLMA 4JEBA 4A2NB 5K0IA 1HW2A 4O6MA 3RQEA 3IQCA 4U9DA 4K0DA 5COMA 1MNDA 1XWJA 3MLGA 1OR3A 3ATPA 3DAGA 3GANA 4NCQA 4CS9C 3S0XA 2Y3HA 1JOGA 1HW1A 5D91A 2Q3TA 2P7VA 4E0IA 3UR3C 3FDQA 3UGPA 2HUJA 1OKKA 2HKVA 3FOOA 2YLGA 3B71A 3FOPA 4MVOA 3GEEA 4R32A 1K05A 2YL7A 1PD0A 2LK4A 2OJED 5CI9A 4C3EA 3ZIBA 2PX3A 3U3FA 5HV9A 1ZHTA 4E7ZA 5JVEA 3IQTA 4XLPF 5KYXB 2P0NA 1JPNA 1G5ZA 2J7PD 2FGYA 3RVZA 2OEVA 2BE5F 1OCRC 4CSAA 1ZZPA 1PCXA 3C8GA 3L1MA 1ZHXA 1HE9A 2HMZA 3LLIA 2I8BA 1D1BA 3EHNA 1R5ID 1D0XA 1VLSA 2MYSA 2KQ9A 4RBNA 3ITFA 3ZDLA 3WHNA 5L0FA 4QI2A 4OD5A 1D0YA 2YVKA 3MX3A 1M2VB 1TKNA 2OQMA 3AG2C 3DZAA 4LERA 4CDYA 1A7DA 1Z3IX 5COFA 4Z9JA 4Q4ZF 4HFKB 4JJGA 3FAPB 4J7TA 4MQ9F 4DXWA 1CPRA 2ZXRA 1Q0FA 1ZU5A 1O5HA 5L3QA 4H4KC 3NKDA 2QNLA 1O3UA 4JVSA 2X0CA 2Q4FA 2WVOA 3G4ZA 1ZHWA 2J7PA 3JYYA 1TWCA 4RDAA 4EBJA 1IZMA 3LLKA 4YWQA 2ZXPA 4NY3A 5AGFA 3TJ5A 2GA0A 3JT1A 2AVKA 2P6VA 3TK0A 5A6BD 3HNIA 3I5PA 2LIGA 1M56C 1U89A 1VB5A 4I3MA 4ZLDA 3C18A 4LLEA 3AJMA 3A11A 4YT5A 1NLXA 3G4XA 2AU5A 1V54C 3F47A 2G3VA 2VCCA 3RVYA 1WWPA 4XPYA 1NG1A 3RYLA 1MMNA 3S29A 1Q0DA 2IYLD 4KI2A 4G7ZF 2IXNA 2YWAA 1YZAA 3EH1A 4KNWA 3W8HA 2Y3DA 4GEHA 3EH2A 3IQ6A 5A6BA 2R7TA 3OA1A 4JCZA 1YVIA 2RSEB 2FFHA 3EPVA 4E18A 1YARO 3VRCA 1ZYRF 2A0BA 2ZPAA 3GEHA 4Z9IA 3TQOA 1I5NA 3AQCA 2YLIA 4PR9A 3T4RA 4CJGA 3JSEO 3U2MA 4U5DE 1CPQA 5DS6A 4I44A 1FTSA 1QVXA 2KNHA 3EGXB 2EPNA 3T6BA 3DKAA 4P9FA 1EA8A 2EIKC 1D0ZA 4YJWA 2VASA 1H6GA 2CW0F 2VCBA 3EQLF 4U5EE 3SZRA 1BBHA 1L3PA 2A68F 4DBRA 5BUOA 4BJ6A 2MHRA 1LI5A 3DAFA 4JTCB 5DQTA 1NU9C 5JSLA 1FR0A 2HV6A 1ZW2A 4OIOF 1S05A 2XLOA 3V5XA 3K66A 3K1IC 3RF3A 3IEEA 2KGOA 3SXZA 2HSQA 1D1AA 2KSFA 2UUIA 1APCA 2PP4A 4NTFA 4DRJB 1VOMA 4U9EA 4XPWA 3B0UX 3HLZA 5A6KA 2JX0A 1LS4A 3EFOA 3ZTZA 5DS5A 3AG4C 3DD7A 5KYUA 1CGOA 4O6YA 2XLHA 1YYXA 3JYHA 1ZVZA 4MTOA 3B29A 3N24A 1L7CA 3AOUA 2ZD9A 2H7OA 3NMJA 4IB4A 3EZHA 2PFDA 1E83A 1TFOB 2L81A 4Z9HA 2Q9BA 1JRAA 4JJFA 3W4YA 3FAJA 1G4US 4C7OA 1BDJB 3ZQVA 2WVQA 3MFNA 1GS9A 2A6EF 1OCCC 2OEXA 5B3IA 2Y3GA 4JZAA 2G62A 3K1HA 4N06A 4NTAA 4EBBA 2A6HF 4G78A 4J30B 4O79A 4L6RA 3CEXA 4XEFA 5T3WA 4YT8A 1VYIA 1H7IA 3US6A 2W45A 5JP7A 5A69A 4ONSA 3ECSA 2EIMC 3SXMA 3FMSA 5DQZA 1MQVA 2C03A 3PMRA 4CS8A 5L0IA 3S84A 2W4BA 4U5GA 4JURI 1YAUO 2R03A 3TJ6A 2HSBA 4E17A 4Q7CA 2DGJA 2L6HA 4PK4A 1WTYA 4NC3A 3MBGA 4DRIB 3L0IA 1W2WA 1VLTA 1A41A 4B6IA 3K6BA 2GAQA 4N6HA 2HJ3A 3QMKA 3KL4A 3R7CA 2NUTB 3DWWA 4CBEA 3E9VA 3IQ5A 3LJBA 4WABA 2LSEA 2PF4E 4LACB 1LKXA 2Y3BA 1ZU4A 3ZVRA 4DVZA 5JUAA 1M2VA 4H54A 4KNVA 4PJNA 5L0JA 5BQIA 2GFHA 3BEHA 3CAXA 3DJNB 2NSFA 2J9UA 3NG1A 1LS1A 3FXHA 2VC9A 2R7RA 2XL8A 3SXKA 4MNDA 3LUTB 3CZ6A 1WATA 2DYRC 1MMGA 2V26A 5L3VA 2WZLA 4FWVA 3S27A 4HEAJ 5A6JA 3ZTMA 4CDVA 3CSKA 1RKCA 3LS1A 3ABMC 1B68A 2H7VC 3FVYA 3N0TA 4BJ5C 1HMOA 3VAYA 1TFKB 2ETSA 2LQGA 4WJ0A 2H8AA 5COGA 2IXOA 3ZWIA 4BPMA 3NRHA 5CIVA 1Z63A 1BR1A 2YHSA 3J06A 1CGNA 2EPLX 3RIPA 3B0VC 1K40A 1T9KA 1VYKA 1NFNA 2KW3C 2LD6A 2OU6A 3H2UA 3KMIA 4CX9A 3S28A 3U3BA 4ER9A 4EIYA 2PX0A 5JT4A 1LE4A 1E85A 5JS5A 2QTVA 5EHHA 1C03A 4YT2A 3TULA 3ASOC 2R7VA 3M1CB 2R02A 2WVNA 1V74B 3RKOF 3MYIA 2HJMA 1E2XA 1S7ZA 3NYMA 2IXPA 5HSWA 4FX5A 4U5CE 2AP3A 3A9CA 1BR2A 2WZGA 1QSPA 1WASA 3GM3A 1HY5A 1FMWA 3SYNA 1LE2A 5FCLA 2R7UA 3EHMA 4XEKA 1Z23A 1V55C 3EGXA 3TOLA 1A7EA 2YLDA 3L34A 1OR2A 2M4EA 4LDRA 2WL8A 2A1DD 3DJUB 3OWTA 5BQGA 3G50A 3LNMB 4JIOA 4DBQA 4QDLA 4JW1A 4FAPB 3DM9B 5F28E 3UGOA 3SEOA 1QKRA 4BG0A 1Y4CA 2QLAA 2VH3A 3DE9A 3EJNA 4IAOA 5F5HA 1U0BB 3ASNC 2ASRA 4MVQA 2Q7RA 3NKEA 1RJ9A 5IY5C 1A0BA 1ORSC 3IHUA 3SNHA 3F46A 4G7HF 3BRJA 3JRMO 2J45A 1IW7F 4MTGA 4K7BA 1RMVA 4O6NA 4XEVA 5F5FA 1UG7A 3KH2A 5E3AA 4X0RA 4E7SA 1EKYA 1T5OA 4CS9A 3CQZA 4KC9A 4EWCA 2Z15A 3GORA 5AC5A 2R7XA 2XXAB 3B0PA 2XRHA 3V5ZA 1EQ1A 2YQYA 3VF0A 1D1CA 1RKEB 2J0WA 3AG3C 3U9JA 3W2WA 1RJ9B 4AK9A 3RW0A 5KYYA 3LEOA 3KPHA 256BA 4IRUA 2ICWG 2J0XA 1E86A 4K1OA 1SYQA 3C62A 3U2LA 4JE9A 4RD9A 2EPOA 4XWJA 4YK5A 4AL0A 4WGZA 1YA7O 2AWYA 4N6CA 1Z5ZA 3AG1C 3JZ0A 4BEMJ 5BQHA 2L7AA 1RXQA 3HNLA 3UNGC 4C3DA 4DRHB 2YEVA 4W8PA 4I1OB 2JPUA 4P6IC 1FFHA 4G0HA 3ZQYA 3NDBB 1NFOA 4G7OF 2MWQA 2CGEA 5KYYB 4CSAC 2DI3A 1DOWA 3M4BA 3WG7C 1DOVA 4E0HA 3T6JA 1WGWA 5T3TA 4JTDB 3T9OA 2HZ8A 3DXJF 1Q0MA 4IGGA 3WODF 2YZSA 3OEOA 1A7VA 2OOCA 1YA9A 1VMAA 3DM5A 4IWBA 1JR8A 1N1CA 3S9OA 1M57C 2B0JA 4MW3A 3FHDA 1RCPA 3M4CA 2XSEA 3W2VA 1NBBA 2IM8A 2LFFA 2Q9AA 2XLVA 1C02A 1G4WR 2Y69C 3RH3A 2HFIA 2X51A 2EPKX 2NUTA 3WAQA 1YLMA 3R2PA 2J9BA 4MW8A 1QPUA 2LFDA 4EUKB 3PDMP 1AUEA 4JC7A 3GEIA 1V4AA 3ABLC 1GQAA 1O87A 2Q9CA 2XL4A 4M63A 1LI7A 4CDAA 2BC5A 3W8IA 2YL0A 4YN0B 4MVMA 2OKUA 2G3KA 2C04A 2QE9A 4JTAB 2KYHA 1YYJA 3GM2A 4LDKA 1CGME 2VB6A 2DYSC 3LAYA 3VYWA 3E70C 4AE4B 3GM1A 3I5QA 3ZG1A 4D4NA 5E3CA 3TD7A 5AC4A 2GDCA 3SP1A 3AQBA 1H9TA 4DOZA 3B9QA 2O9XA 2XM4A 4MS2A 4ULWA 2J9VA 4DVYP 1OKKD 2HV7A 1Z6AA 5T1DB 1R4TA 1ZW3A 1T6IA 5KYWA 5KYXA 1ZHZA 2NUPB 1LVKA 3M15A 2L6GA 3POVA 5B1AC 1LIHA 2EPMX 2UUHA 1MMDA 3H2VA 5DS4A 1Z7Qc 3KYIA 1PD1A 4AX2A 2YL1A 3C7JA 5EK0A 4HE8D 4N4WA 3M79A 5TJ5E 2V3CC 2CCYA 3EGDB 5KYNA 1LPEA 1U6HA 2F22A 1UFBA 4KBLA 3K1IA 1ORYA 2CNWD 3C8GD 3JSZA 1SR2A 4W8KA 4WGYA 3TOMA 4BJ6C 2VCAA 4PJLA 1XZQA 1WOLA 2QY9A 3HTKC 4U5HA 1SZIA 4GQHA 5DVWA 2B0HA 2D4UA 2EIJC 2GWWA 2QUPA 2RD9A 3JCUQ 4PFPA 2L6FA 4XLNF 1GGQA 1HE1A 2HS5A 5KYWB 1TWGA 3GWNA 5L0CA 1TWHA 3QW0A 2Q00A 3HJCA 3HKKA 4IJJA 2XLWA 3U8VA 2BL2A 1NZEA 1Q0GA 2CDQA 2Y39A 4U5BE 1I4ZA 3LS0A 1MNEA 1FMVA 3GODA 4JRZA 2A0UA 3O55A 3U5SA 1LM3B 4FESA 3C63A 2CNWA 3C8ZA 1HMDA 4OIRF 1OXBA 4YL0A 1KU2A 1SMYF 1WN0A 1YZCA 2LP4A 2YL3A 4OD4A 1YJGA 2KK1A 5GPGB 3T6GB 1T6QA 4OIQF 1TWAA 2WZFA 3NMKA 3QTHA 3JTLO 4PFOA 3N2ZB 1PV3A 4CS7A 4Q5SF 3GWLA 2DB4A 3QZCA 1ORJA 1K04A 1ST6A 4MTFA 3Q7LA 2FAPB 2XXAA 1YDIA 4XQ1A 3O39A 4OINF 2PNOA 3LEVA 3NYLA 2XS8A 1RKEA 3PCVA 1GM5A 1BZ4A 3C8GB 4A4AA 2IXMA 5E2QA 3ZSUA 4EBKA 4MVZA 5JLIA 3DMDA 4EKWA 2LCHA 1C17M 1I4YA 3Q6MA 2ZXOA 2D5RB 1OW6A 2R7OA 3QVYA 4DJ9A 1VK5A 4PJMA 3O6XA 4PJJA 4U5FE 1FAPB 4BJTA 4CS8C 2EINC 1J8YF 3UMKA 3NYJA 1EI7A 3L8JA 2ZXWC 2IBFA 4J32B 2TMVP 4YT4A 4CIHA 1JAFA 4BJ1A 3Q6NA 4XPXA 4ANJA 1QQ3A 2NG1A 3RQGA 1G8XA 3AGUA 3U8PA 3ZC4A 3QW1A 2HMQA 1T01A 1J8MF 1JMWA 2XLDA 2YKZA 3HNJA 4IARA 1M6TA 1Y6DA 1QLEC 4AL1A 4CJOA 2W9YA 2KJGA 3KYJA 2XM0A 3O10A 2NPUA 3U0CA 3MYFA 3ABKC 1AVOB 3S90A 1OW7A 2OG2A 4BEJA 1FNTc 4OIPF 5L0DA 1KNYA 4F4BA 4I1MA 5JRAA 1E84A 4PACA 4P9TA 5B1BC 4IAQA 2J46A 4MVUA 4J7YA 4MVRA 5L0GA 4MVSA 3V5YA 4BJ5A 2CYDA 4QI0A 4LDQA 1OQCA 4ZLCA 1NSGB 2JD3A 3PHF2 2E87A 5B3SC 1OW8A 4YL3A 3NMIA 2XLEA 1T6UA 4D4XA 2R7WA 3UMIA 2PBEA 4CIPA 1TQGA 1H9GA 3VM6A 2R7QA 1QZXA 1JPJA 3EZIA 3LESA 4EHPA 2M64A 1KTMA 4NQFA 3HNKA 1TR2A 1XZPA 2OCCC 3DE8A 3JRTA 3QVZA 2IOQA 3AGTA 5D92A 5EGYA 1M2OA 1BR4A 4GYTA 1VTMP 1FFTC 2P1AA 3V7OA 4AE4A 4ULVA 1Q0KA 2AWCA 5E33A 1OCZC 2H7BA 2WB7A 3H65A 4JEAA 3RQFA 2OJQA 3EG9A 3K33A 4UDVA 2YRFA 1OCOC 2P61A 4YL1A 2R7SA 2NSGA 3X1OA 4C3BA 2R05A 3SXYA 2R25A 2KC3A 3U9MA 4JCHA 1SF8A 2NUPA 3L8IA 1NU7D 3EFOB 3KKBA
chains in the Genus database with same CATH topology
1YA9A 1NFNA 1H7IA 1LE4A 1LS4A 1BZ4A 3R2PA 3S84A 1EA8A 1AEPA 1NFOA 1LE2A 2KC3A 1B68A 1LPEA 1OR3A 1GS9A 1EQ1A 1OR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YA9 A;  1NFN A;  1H7I A;  1LE4 A;  1LS4 A;  1BZ4 A;  3R2P A;  3S84 A;  1EA8 A;  1AEP A;  1NFO A;  1LE2 A;  2KC3 A;  1B68 A;  1LPE A;  1OR3 A;  1GS9 A;  1EQ1 A;  1OR2 A; 
#chains in the Genus database with same CATH topology
 4HFF B;  3UMH A;  5KYU B;  2L9J A;  4O7G A;  1OXK A;  3IPM O;  2J8W A;  3I4U A;  4NTB A;  2J9W A;  3EGD A;  2XS1 A;  3RFY A;  5DLJ A;  5A6A A;  5CI8 A;  2I15 A;  5FZT A;  5L0H A;  3EG9 B;  2EIL C;  4LLC A;  4XTK A;  2W4M A;  3LNR A;  4C7O B;  3Q7G A;  3DI5 A;  3X2Q C;  3K7D A;  1MMA A;  1F1M A;  2XL6 A;  1AEP A;  4JKV A;  1ZHY A;  2A69 F;  2R9R B;  2XLM A;  4JEB A;  4A2N B;  5K0I A;  1HW2 A;  4O6M A;  3RQE A;  3IQC A;  4U9D A;  4K0D A;  5COM A;  1MND A;  1XWJ A;  3MLG A;  1OR3 A;  3ATP A;  3DAG A;  3GAN A;  4NCQ A;  4CS9 C;  3S0X A;  2Y3H A;  1JOG A;  1HW1 A;  5D91 A;  2Q3T A;  2P7V A;  4E0I A;  3UR3 C;  3FDQ A;  3UGP A;  2HUJ A;  1OKK A;  2HKV A;  3FOO A;  2YLG A;  3B71 A;  3FOP A;  4MVO A;  3GEE A;  4R32 A;  1K05 A;  2YL7 A;  1PD0 A;  2LK4 A;  2OJE D;  5CI9 A;  4C3E A;  3ZIB A;  2PX3 A;  3U3F A;  5HV9 A;  1ZHT A;  4E7Z A;  5JVE A;  3IQT A;  4XLP F;  5KYX B;  2P0N A;  1JPN A;  1G5Z A;  2J7P D;  2FGY A;  3RVZ A;  2OEV A;  2BE5 F;  1OCR C;  4CSA A;  1ZZP A;  1PCX A;  3C8G A;  3L1M A;  1ZHX A;  1HE9 A;  2HMZ A;  3LLI A;  2I8B A;  1D1B A;  3EHN A;  1R5I D;  1D0X A;  1VLS A;  2MYS A;  2KQ9 A;  4RBN A;  3ITF A;  3ZDL A;  3WHN A;  5L0F A;  4QI2 A;  4OD5 A;  1D0Y A;  2YVK A;  3MX3 A;  1M2V B;  1TKN A;  2OQM A;  3AG2 C;  3DZA A;  4LER A;  4CDY A;  1A7D A;  1Z3I X;  5COF A;  4Z9J A;  4Q4Z F;  4HFK B;  4JJG A;  3FAP B;  4J7T A;  4MQ9 F;  4DXW A;  1CPR A;  2ZXR A;  1Q0F A;  1ZU5 A;  1O5H A;  5L3Q A;  4H4K C;  3NKD A;  2QNL A;  1O3U A;  4JVS A;  2X0C A;  2Q4F A;  2WVO A;  3G4Z A;  1ZHW A;  2J7P A;  3JYY A;  1TWC A;  4RDA A;  4EBJ A;  1IZM A;  3LLK A;  4YWQ A;  2ZXP A;  4NY3 A;  5AGF A;  3TJ5 A;  2GA0 A;  3JT1 A;  2AVK A;  2P6V A;  3TK0 A;  5A6B D;  3HNI A;  3I5P A;  2LIG A;  1M56 C;  1U89 A;  1VB5 A;  4I3M A;  4ZLD A;  3C18 A;  4LLE A;  3AJM A;  3A11 A;  4YT5 A;  1NLX A;  3G4X A;  2AU5 A;  1V54 C;  3F47 A;  2G3V A;  2VCC A;  3RVY A;  1WWP A;  4XPY A;  1NG1 A;  3RYL A;  1MMN A;  3S29 A;  1Q0D A;  2IYL D;  4KI2 A;  4G7Z F;  2IXN A;  2YWA A;  1YZA A;  3EH1 A;  4KNW A;  3W8H A;  2Y3D A;  4GEH A;  3EH2 A;  3IQ6 A;  5A6B A;  2R7T A;  3OA1 A;  4JCZ A;  1YVI A;  2RSE B;  2FFH A;  3EPV A;  4E18 A;  1YAR O;  3VRC A;  1ZYR F;  2A0B A;  2ZPA A;  3GEH A;  4Z9I A;  3TQO A;  1I5N A;  3AQC A;  2YLI A;  4PR9 A;  3T4R A;  4CJG A;  3JSE O;  3U2M A;  4U5D E;  1CPQ A;  5DS6 A;  4I44 A;  1FTS A;  1QVX A;  2KNH A;  3EGX B;  2EPN A;  3T6B A;  3DKA A;  4P9F A;  1EA8 A;  2EIK C;  1D0Z A;  4YJW A;  2VAS A;  1H6G A;  2CW0 F;  2VCB A;  3EQL F;  4U5E E;  3SZR A;  1BBH A;  1L3P A;  2A68 F;  4DBR A;  5BUO A;  4BJ6 A;  2MHR A;  1LI5 A;  3DAF A;  4JTC B;  5DQT A;  1NU9 C;  5JSL A;  1FR0 A;  2HV6 A;  1ZW2 A;  4OIO F;  1S05 A;  2XLO A;  3V5X A;  3K66 A;  3K1I C;  3RF3 A;  3IEE A;  2KGO A;  3SXZ A;  2HSQ A;  1D1A A;  2KSF A;  2UUI A;  1APC A;  2PP4 A;  4NTF A;  4DRJ B;  1VOM A;  4U9E A;  4XPW A;  3B0U X;  3HLZ A;  5A6K A;  2JX0 A;  1LS4 A;  3EFO A;  3ZTZ A;  5DS5 A;  3AG4 C;  3DD7 A;  5KYU A;  1CGO A;  4O6Y A;  2XLH A;  1YYX A;  3JYH A;  1ZVZ A;  4MTO A;  3B29 A;  3N24 A;  1L7C A;  3AOU A;  2ZD9 A;  2H7O A;  3NMJ A;  4IB4 A;  3EZH A;  2PFD A;  1E83 A;  1TFO B;  2L81 A;  4Z9H A;  2Q9B A;  1JRA A;  4JJF A;  3W4Y A;  3FAJ A;  1G4U S;  4C7O A;  1BDJ B;  3ZQV A;  2WVQ A;  3MFN A;  1GS9 A;  2A6E F;  1OCC C;  2OEX A;  5B3I A;  2Y3G A;  4JZA A;  2G62 A;  3K1H A;  4N06 A;  4NTA A;  4EBB A;  2A6H F;  4G78 A;  4J30 B;  4O79 A;  4L6R A;  3CEX A;  4XEF A;  5T3W A;  4YT8 A;  1VYI A;  1H7I A;  3US6 A;  2W45 A;  5JP7 A;  5A69 A;  4ONS A;  3ECS A;  2EIM C;  3SXM A;  3FMS A;  5DQZ A;  1MQV A;  2C03 A;  3PMR A;  4CS8 A;  5L0I A;  3S84 A;  2W4B A;  4U5G A;  4JUR I;  1YAU O;  2R03 A;  3TJ6 A;  2HSB A;  4E17 A;  4Q7C A;  2DGJ A;  2L6H A;  4PK4 A;  1WTY A;  4NC3 A;  3MBG A;  4DRI B;  3L0I A;  1W2W A;  1VLT A;  1A41 A;  4B6I A;  3K6B A;  2GAQ A;  4N6H A;  2HJ3 A;  3QMK A;  3KL4 A;  3R7C A;  2NUT B;  3DWW A;  4CBE A;  3E9V A;  3IQ5 A;  3LJB A;  4WAB A;  2LSE A;  2PF4 E;  4LAC B;  1LKX A;  2Y3B A;  1ZU4 A;  3ZVR A;  4DVZ A;  5JUA A;  1M2V A;  4H54 A;  4KNV A;  4PJN A;  5L0J A;  5BQI A;  2GFH A;  3BEH A;  3CAX A;  3DJN B;  2NSF A;  2J9U A;  3NG1 A;  1LS1 A;  3FXH A;  2VC9 A;  2R7R A;  2XL8 A;  3SXK A;  4MND A;  3LUT B;  3CZ6 A;  1WAT A;  2DYR C;  1MMG A;  2V26 A;  5L3V A;  2WZL A;  4FWV A;  3S27 A;  4HEA J;  5A6J A;  3ZTM A;  4CDV A;  3CSK A;  1RKC A;  3LS1 A;  3ABM C;  1B68 A;  2H7V C;  3FVY A;  3N0T A;  4BJ5 C;  1HMO A;  3VAY A;  1TFK B;  2ETS A;  2LQG A;  4WJ0 A;  2H8A A;  5COG A;  2IXO A;  3ZWI A;  4BPM A;  3NRH A;  5CIV A;  1Z63 A;  1BR1 A;  2YHS A;  3J06 A;  1CGN A;  2EPL X;  3RIP A;  3B0V C;  1K40 A;  1T9K A;  1VYK A;  1NFN A;  2KW3 C;  2LD6 A;  2OU6 A;  3H2U A;  3KMI A;  4CX9 A;  3S28 A;  3U3B A;  4ER9 A;  4EIY A;  2PX0 A;  5JT4 A;  1LE4 A;  1E85 A;  5JS5 A;  2QTV A;  5EHH A;  1C03 A;  4YT2 A;  3TUL A;  3ASO C;  2R7V A;  3M1C B;  2R02 A;  2WVN A;  1V74 B;  3RKO F;  3MYI A;  2HJM A;  1E2X A;  1S7Z A;  3NYM A;  2IXP A;  5HSW A;  4FX5 A;  4U5C E;  2AP3 A;  3A9C A;  1BR2 A;  2WZG A;  1QSP A;  1WAS A;  3GM3 A;  1HY5 A;  1FMW A;  3SYN A;  1LE2 A;  5FCL A;  2R7U A;  3EHM A;  4XEK A;  1Z23 A;  1V55 C;  3EGX A;  3TOL A;  1A7E A;  2YLD A;  3L34 A;  1OR2 A;  2M4E A;  4LDR A;  2WL8 A;  2A1D D;  3DJU B;  3OWT A;  5BQG A;  3G50 A;  3LNM B;  4JIO A;  4DBQ A;  4QDL A;  4JW1 A;  4FAP B;  3DM9 B;  5F28 E;  3UGO A;  3SEO A;  1QKR A;  4BG0 A;  1Y4C A;  2QLA A;  2VH3 A;  3DE9 A;  3EJN A;  4IAO A;  5F5H A;  1U0B B;  3ASN C;  2ASR A;  4MVQ A;  2Q7R A;  3NKE A;  1RJ9 A;  5IY5 C;  1A0B A;  1ORS C;  3IHU A;  3SNH A;  3F46 A;  4G7H F;  3BRJ A;  3JRM O;  2J45 A;  1IW7 F;  4MTG A;  4K7B A;  1RMV A;  4O6N A;  4XEV A;  5F5F A;  1UG7 A;  3KH2 A;  5E3A A;  4X0R A;  4E7S A;  1EKY A;  1T5O A;  4CS9 A;  3CQZ A;  4KC9 A;  4EWC A;  2Z15 A;  3GOR A;  5AC5 A;  2R7X A;  2XXA B;  3B0P A;  2XRH A;  3V5Z A;  1EQ1 A;  2YQY A;  3VF0 A;  1D1C A;  1RKE B;  2J0W A;  3AG3 C;  3U9J A;  3W2W A;  1RJ9 B;  4AK9 A;  3RW0 A;  5KYY A;  3LEO A;  3KPH A;  256B A;  4IRU A;  2ICW G;  2J0X A;  1E86 A;  4K1O A;  1SYQ A;  3C62 A;  3U2L A;  4JE9 A;  4RD9 A;  2EPO A;  4XWJ A;  4YK5 A;  4AL0 A;  4WGZ A;  1YA7 O;  2AWY A;  4N6C A;  1Z5Z A;  3AG1 C;  3JZ0 A;  4BEM J;  5BQH A;  2L7A A;  1RXQ A;  3HNL A;  3UNG C;  4C3D A;  4DRH B;  2YEV A;  4W8P A;  4I1O B;  2JPU A;  4P6I C;  1FFH A;  4G0H A;  3ZQY A;  3NDB B;  1NFO A;  4G7O F;  2MWQ A;  2CGE A;  5KYY B;  4CSA C;  2DI3 A;  1DOW A;  3M4B A;  3WG7 C;  1DOV A;  4E0H A;  3T6J A;  1WGW A;  5T3T A;  4JTD B;  3T9O A;  2HZ8 A;  3DXJ F;  1Q0M A;  4IGG A;  3WOD F;  2YZS A;  3OEO A;  1A7V A;  2OOC A;  1YA9 A;  1VMA A;  3DM5 A;  4IWB A;  1JR8 A;  1N1C A;  3S9O A;  1M57 C;  2B0J A;  4MW3 A;  3FHD A;  1RCP A;  3M4C A;  2XSE A;  3W2V A;  1NBB A;  2IM8 A;  2LFF A;  2Q9A A;  2XLV A;  1C02 A;  1G4W R;  2Y69 C;  3RH3 A;  2HFI A;  2X51 A;  2EPK X;  2NUT A;  3WAQ A;  1YLM A;  3R2P A;  2J9B A;  4MW8 A;  1QPU A;  2LFD A;  4EUK B;  3PDM P;  1AUE A;  4JC7 A;  3GEI A;  1V4A A;  3ABL C;  1GQA A;  1O87 A;  2Q9C A;  2XL4 A;  4M63 A;  1LI7 A;  4CDA A;  2BC5 A;  3W8I A;  2YL0 A;  4YN0 B;  4MVM A;  2OKU A;  2G3K A;  2C04 A;  2QE9 A;  4JTA B;  2KYH A;  1YYJ A;  3GM2 A;  4LDK A;  1CGM E;  2VB6 A;  2DYS C;  3LAY A;  3VYW A;  3E70 C;  4AE4 B;  3GM1 A;  3I5Q A;  3ZG1 A;  4D4N A;  5E3C A;  3TD7 A;  5AC4 A;  2GDC A;  3SP1 A;  3AQB A;  1H9T A;  4DOZ A;  3B9Q A;  2O9X A;  2XM4 A;  4MS2 A;  4ULW A;  2J9V A;  4DVY P;  1OKK D;  2HV7 A;  1Z6A A;  5T1D B;  1R4T A;  1ZW3 A;  1T6I A;  5KYW A;  5KYX A;  1ZHZ A;  2NUP B;  1LVK A;  3M15 A;  2L6G A;  3POV A;  5B1A C;  1LIH A;  2EPM X;  2UUH A;  1MMD A;  3H2V A;  5DS4 A;  1Z7Q c;  3KYI A;  1PD1 A;  4AX2 A;  2YL1 A;  3C7J A;  5EK0 A;  4HE8 D;  4N4W A;  3M79 A;  5TJ5 E;  2V3C C;  2CCY A;  3EGD B;  5KYN A;  1LPE A;  1U6H A;  2F22 A;  1UFB A;  4KBL A;  3K1I A;  1ORY A;  2CNW D;  3C8G D;  3JSZ A;  1SR2 A;  4W8K A;  4WGY A;  3TOM A;  4BJ6 C;  2VCA A;  4PJL A;  1XZQ A;  1WOL A;  2QY9 A;  3HTK C;  4U5H A;  1SZI A;  4GQH A;  5DVW A;  2B0H A;  2D4U A;  2EIJ C;  2GWW A;  2QUP A;  2RD9 A;  3JCU Q;  4PFP A;  2L6F A;  4XLN F;  1GGQ A;  1HE1 A;  2HS5 A;  5KYW B;  1TWG A;  3GWN A;  5L0C A;  1TWH A;  3QW0 A;  2Q00 A;  3HJC A;  3HKK A;  4IJJ A;  2XLW A;  3U8V A;  2BL2 A;  1NZE A;  1Q0G A;  2CDQ A;  2Y39 A;  4U5B E;  1I4Z A;  3LS0 A;  1MNE A;  1FMV A;  3GOD A;  4JRZ A;  2A0U A;  3O55 A;  3U5S A;  1LM3 B;  4FES A;  3C63 A;  2CNW A;  3C8Z A;  1HMD A;  4OIR F;  1OXB A;  4YL0 A;  1KU2 A;  1SMY F;  1WN0 A;  1YZC A;  2LP4 A;  2YL3 A;  4OD4 A;  1YJG A;  2KK1 A;  5GPG B;  3T6G B;  1T6Q A;  4OIQ F;  1TWA A;  2WZF A;  3NMK A;  3QTH A;  3JTL O;  4PFO A;  3N2Z B;  1PV3 A;  4CS7 A;  4Q5S F;  3GWL A;  2DB4 A;  3QZC A;  1ORJ A;  1K04 A;  1ST6 A;  4MTF A;  3Q7L A;  2FAP B;  2XXA A;  1YDI A;  4XQ1 A;  3O39 A;  4OIN F;  2PNO A;  3LEV A;  3NYL A;  2XS8 A;  1RKE A;  3PCV A;  1GM5 A;  1BZ4 A;  3C8G B;  4A4A A;  2IXM A;  5E2Q A;  3ZSU A;  4EBK A;  4MVZ A;  5JLI A;  3DMD A;  4EKW A;  2LCH A;  1C17 M;  1I4Y A;  3Q6M A;  2ZXO A;  2D5R B;  1OW6 A;  2R7O A;  3QVY A;  4DJ9 A;  1VK5 A;  4PJM A;  3O6X A;  4PJJ A;  4U5F E;  1FAP B;  4BJT A;  4CS8 C;  2EIN C;  1J8Y F;  3UMK A;  3NYJ A;  1EI7 A;  3L8J A;  2ZXW C;  2IBF A;  4J32 B;  2TMV P;  4YT4 A;  4CIH A;  1JAF A;  4BJ1 A;  3Q6N A;  4XPX A;  4ANJ A;  1QQ3 A;  2NG1 A;  3RQG A;  1G8X A;  3AGU A;  3U8P A;  3ZC4 A;  3QW1 A;  2HMQ A;  1T01 A;  1J8M F;  1JMW A;  2XLD A;  2YKZ A;  3HNJ A;  4IAR A;  1M6T A;  1Y6D A;  1QLE C;  4AL1 A;  4CJO A;  2W9Y A;  2KJG A;  3KYJ A;  2XM0 A;  3O10 A;  2NPU A;  3U0C A;  3MYF A;  3ABK C;  1AVO B;  3S90 A;  1OW7 A;  2OG2 A;  4BEJ A;  1FNT c;  4OIP F;  5L0D A;  1KNY A;  4F4B A;  4I1M A;  5JRA A;  1E84 A;  4PAC A;  4P9T A;  5B1B C;  4IAQ A;  2J46 A;  4MVU A;  4J7Y A;  4MVR A;  5L0G A;  4MVS A;  3V5Y A;  4BJ5 A;  2CYD A;  4QI0 A;  4LDQ A;  1OQC A;  4ZLC A;  1NSG B;  2JD3 A;  3PHF 2;  2E87 A;  5B3S C;  1OW8 A;  4YL3 A;  3NMI A;  2XLE A;  1T6U A;  4D4X A;  2R7W A;  3UMI A;  2PBE A;  4CIP A;  1TQG A;  1H9G A;  3VM6 A;  2R7Q A;  1QZX A;  1JPJ A;  3EZI A;  3LES A;  4EHP A;  2M64 A;  1KTM A;  4NQF A;  3HNK A;  1TR2 A;  1XZP A;  2OCC C;  3DE8 A;  3JRT A;  3QVZ A;  2IOQ A;  3AGT A;  5D92 A;  5EGY A;  1M2O A;  1BR4 A;  4GYT A;  1VTM P;  1FFT C;  2P1A A;  3V7O A;  4AE4 A;  4ULV A;  1Q0K A;  2AWC A;  5E33 A;  1OCZ C;  2H7B A;  2WB7 A;  3H65 A;  4JEA A;  3RQF A;  2OJQ A;  3EG9 A;  3K33 A;  4UDV A;  2YRF A;  1OCO C;  2P61 A;  4YL1 A;  2R7S A;  2NSG A;  3X1O A;  4C3B A;  2R05 A;  3SXY A;  2R25 A;  2KC3 A;  3U9M A;  4JCH A;  1SF8 A;  2NUP A;  3L8I A;  1NU7 D;  3EFO B;  3KKB A; 
#chains in the Genus database with same CATH homology
 1YA9 A;  1NFN A;  1H7I A;  1LE4 A;  1LS4 A;  1BZ4 A;  3R2P A;  3S84 A;  1EA8 A;  1AEP A;  1NFO A;  1LE2 A;  2KC3 A;  1B68 A;  1LPE A;  1OR3 A;  1GS9 A;  1EQ1 A;  1OR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...