1OR3A

Apolipoprotein e3 (apoe3), trigonal truncation mutant 165
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
143
structure length
136
Chain Sequence
SGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational flexibility in the apolipoprotein E amino-terminal domain structure determined from three new crystal forms: implications for lipid binding.
pubmed rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords PROTEIN (APOLIPOPROTEIN E)
total genus 58
structure length 136
sequence length 143
ec nomenclature
pdb deposition date 1998-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1or3A00
1H7IA 1BZ4A 1GS9A 1NFNA 1OR3A 2KC3A 1AEPA 1OR2A 1LS4A 1LE2A 1YA9A 1LE4A 1EA8A 3R2PA 1B68A 3S84A 1LPEA 1NFOA 1EQ1A
chains in the Genus database with same CATH superfamily
3G50A 3IPMO 1AVOB 3ZG1A 1QSPA 1JPJA 3T6GB 4AL1A 2G3KA 3E70C 3GORA 4CSAA 1Y6DA 4D4XA 4KNVA 2Y69C 3C8GD 1TKNA 4ANJA 2IBFA 1QVXA 1XZPA 1ZHZA 3LNMB 4DBQA 3IEEA 1IZMA 5L0HA 1IW7F 2D4UA 3W8IA 5KYXA 2KGOA 4YT2A 1YVIA 1T6QA 4Z9JA 1PCXA 2LSEA 1ZHTA 1S7ZA 2XM0A 3KKBA 3SXZA 3NG1A 2DGJA 4ULVA 4R32A 2PP4A 5T1DB 2YLDA 3ZQYA 3V7OA 4MVOA 2PX3A 5DQTA 5L0GA 5KYYB 2YL7A 4MW3A 3TJ6A 2EIKC 2C03A 2OOCA 3CAXA 4LACB 2EPNA 4YT4A 1CPRA 3L8IA 2EPKX 3DJUB 4IB4A 3MFNA 1E2XA 4HEAJ 4LERA 2WVQA 2L7AA 4WGYA 3C18A 5A6BD 2W4MA 1FR0A 4MVQA 4RDAA 4BJ6A 2GDCA 4I1OB 3TD7A 3W4YA 1YJGA 2VCCA 1ZW2A 2R9RB 4K0DA 3HJCA 1VB5A 1NU9C 3M79A 4JCHA 1T6IA 1C02A 4U5DE 3EJNA 4XTKA 3S84A 1G5ZA 1ZHWA 4JRZA 2XLDA 1F1MA 1WN0A 3RQEA 1LM3B 1TWGA 2LP4A 2PF4E 3NYJA 4CBEA 3UR3C 1YLMA 4LLCA 4G7ZF 4EBBA 4O79A 2WVNA 5A6KA 1MMDA 2B0JA 2XLEA 2V26A 4G78A 4XEKA 3ZVRA 4P9TA 3EPVA 4J7YA 4ONSA 3NKEA 2L6FA 4AE4B 1GQAA 1RJ9A 1YA9A 3B9QA 4MVUA 4DVZA 2W4BA 1ZU4A 5KYWA 3VAYA 3US6A 3LJBA 2QTVA 3MBGA 1OQCA 1DOWA 1T01A 3LLIA 3QW1A 2R7UA 2LCHA 3O6XA 5DVWA 2A0UA 4PFPA 3HNKA 1H7IA 2XL6A 3PHF2 1VOMA 1NSGB 2ZXWC 3RVYA 4OIRF 3Q6MA 5DS6A 2ICWG 3U3BA 2HS5A 1QPUA 4MQ9F 3IQ5A 1LI7A 2Q4FA 3HNJA 1OKKD 2H7BA 4A4AA 1RMVA 4Q5SF 1VLSA 1YDIA 1Z23A 2W45A 3FVYA 3K33A 1N1CA 4QDLA 3DAFA 2Q7RA 3KH2A 3RQGA 4BEJA 1HY5A 2J9UA 4PJJA 3A9CA 3SYNA 2I8BA 3PDMP 4L6RA 4JJFA 2KQ9A 2KSFA 2OEVA 5KYNA 1Y4CA 1M2VA 1T6UA 3LLKA 2VCAA 3L8JA 1A7VA 1Z6AA 3NYMA 2M64A 3O55A 2YRFA 3QVZA 2A1DD 2D5RB 3B71A 1YA7O 3C7JA 3SXYA 256BA 1BDJB 1JOGA 2Q9CA 3AG3C 1MNEA 1AUEA 3BRJA 3C8GB 3K1IC 3U0CA 2XL4A 1OR3A 5L0DA 2DYSC 4EWCA 1J8MF 3DZAA 4BJ6C 3TK0A 1U6HA 1B68A 5KYXB 1T9KA 3CZ6A 3EH2A 3DXJF 4C3EA 3ATPA 2AP3A 2KC3A 1JPNA 4MW8A 5JT4A 3QVYA 2MWQA 2IOQA 2XL8A 4DJ9A 2VASA 3N0TA 4CS9C 4PJLA 1V74B 5CI9A 1D1AA 3SP1A 1L7CA 2J7PD 4XPYA 1Q0GA 3H65A 5L3QA 3GM3A 4U9DA 4CIPA 4CS7A 1NBBA 1SZIA 1HMDA 1FTSA 2XLOA 4JEAA 3L34A 4CX9A 1K05A 3M4BA 4U5EE 4OD4A 4LDKA 3KYJA 2FAPB 3LS0A 3S90A 1E85A 2QNLA 1ORSC 4U9EA 2OEXA 3L0IA 5A6AA 4EBJA 1FMWA 2HJ3A 1A7EA 1OKKA 4DXWA 3FAJA 5HV9A 1Q0KA 3IHUA 2AU5A 3LEVA 1ZHYA 4W8PA 2YZSA 4B6IA 1NFNA 3GODA 2LD6A 2E87A 2HV7A 2OJQA 4WGZA 2KNHA 4J30B 3GWLA 1TQGA 4E0HA 3TULA 2YLIA 3S29A 5JRAA 5HSWA 3EGXB 3RQFA 3M4CA 4U5GA 1Z7Qc 3ASNC 3UGOA 2NSFA 3LAYA 1D1BA 1FMVA 1TWAA 3OEOA 2XXAB 1W2WA 3OA1A 3UMKA 1K40A 4C3BA 4LLEA 2OKUA 3HLZA 3B29A 5KYWB 4BG0A 3X2QC 4M63A 1HE1A 2Q9AA 3AGTA 1JMWA 4FWVA 5B3IA 3POVA 2IYLD 1XWJA 1CGOA 2Q9BA 2VCBA 1QLEC 3FXHA 3PCVA 4P6IC 4E18A 1JR8A 4DVYP 4Q4ZF 3CQZA 4XEVA 2BC5A 1JAFA 4H54A 3SZRA 3LS1A 2DI3A 3NYLA 4MVRA 4EBKA 4EIYA 2DB4A 2V3CC 2J0WA 5E2QA 1H9TA 1YYJA 3JRTA 2HKVA 2OQMA 3C62A 1K04A 1OXBA 2YL3A 3T6JA 1CGNA 1M57C 4BJ5C 1C17M 3S0XA 2AWYA 4H4KC 2XLMA 2JD3A 4KI2A 3GANA 2HJMA 2R7OA 1RXQA 4XEFA 4C7OA 3NKDA 1A0BA 5CIVA 3X1OA 3I5PA 1M2OA 3JSZA 3NMKA 4F4BA 1E83A 3OWTA 2J45A 4DBRA 3HTKC 3DJNB 3R2PA 2EINC 2LK4A 5FZTA 3NDBB 1FAPB 4HFKB 1WATA 2ZXPA 3DM5A 2HSBA 2R7TA 5F5FA 3C8ZA 3DD7A 3EGDB 4HE8D 3TOMA 1E86A 4J32B 2LFFA 4OIQF 4G0HA 4YT5A 1RCPA 4DOZA 3KYIA 1PD0A 4UDVA 1V55C 3AOUA 5COMA 1HW2A 3V5XA 1OCCC 3GM1A 2UUHA 4O6MA 2ZXRA 4YL0A 5JUAA 4PJMA 3SNHA 3K6BA 2YVKA 3DWWA 3FHDA 1LPEA 5DLJA 2LQGA 3MYFA 3K66A 3V5YA 1RJ9B 4QI2A 3U8PA 3M1CB 3EG9A 2R7VA 1YYXA 3WAQA 2H7OA 4U5BE 2X0CA 2BE5F 3JZ0A 5A6BA 3K1HA 4O6YA 3B0VC 4NQFA 4C7OB 2YWAA 2EIMC 4EKWA 5COGA 2ASRA 4BJ1A 5JP7A 2M4EA 3DM9B 4CIHA 1HW1A 2DYRC 1LS1A 1LS4A 1LE4A 1QKRA 3M15A 3EHMA 4IRUA 2VB6A 2YL1A 3ZIBA 5TJ5E 4EUKB 2NG1A 1TWHA 3VRCA 2XLVA 2P61A 3JT1A 3GM2A 1FFHA 1ST6A 2CDQA 3C8GA 4IJJA 3S9OA 4CDVA 1MMNA 2HV6A 3DE8A 3EGXA 2J7PA 2FGYA 2L6GA 3ABKC 1ORYA 4E7ZA 1WWPA 4MNDA 1O87A 3U9MA 2NSGA 2J9WA 2HFIA 1OCRC 3HNIA 2VH3A 3T4RA 2J8WA 2F22A 5COFA 2GFHA 2ZD9A 4LDRA 4Z9HA 5K0IA 2XXAA 2XM4A 2HMQA 3GEEA 3NMJA 5DS5A 4OINF 1Q0FA 2RD9A 3T9OA 2P6VA 3ABMC 5KYUA 4G7HF 3ZQVA 1BBHA 3TJ5A 5L0CA 3BEHA 2YL0A 4AX2A 4D4NA 4WJ0A 1NG1A 4MVZA 2YLGA 2YEVA 4W8KA 1KU2A 5DS4A 3N2ZB 1LE2A 2C04A 4GYTA 1NLXA 4JTCB 3JRMO 3RF3A 3DAGA 1OW6A 3ITFA 1A41A 5JS5A 4KBLA 1O3UA 4WABA 2XLWA 4IAQA 2KJGA 3AQBA 2KYHA 4X0RA 2AVKA 3R7CA 3S27A 4FAPB 2YKZA 3EZHA 4JZAA 2EILC 2LIGA 2P0NA 5D92A 3RVZA 4Z9IA 5L0FA 1G4US 2P1AA 1OW8A 3G4ZA 2L9JA 3UNGC 5A69A 1S05A 5FCLA 2A68F 2MHRA 1YZAA 2J9VA 3V5ZA 5BUOA 2Y3BA 3EGDA 2OCCC 4CS9A 1Q0MA 1RKEB 2A6HF 3LEOA 5GPGB 2CW0F 3SXMA 3UGPA 5BQIA 3MYIA 1XZQA 3U3FA 2NUPB 3QW0A 3F47A 1TFKB 2J9BA 3UMIA 4BJTA 1SYQA 4JE9A 3FAPB 4N6HA 4CSAC 1D1CA 3G4XA 4NCQA 2WZGA 3EG9B 2CNWD 2O9XA 4CJOA 3VYWA 2H7VC 2EPOA 2G3VA 5F5HA 1PD1A 3EFOA 3AGUA 4EHPA 1Z3IX 5AGFA 1ZHXA 4IARA 2QUPA 4MTGA 2HSQA 1LVKA 4OIOF 2PX0A 3EQLF 3H2VA 4A2NB 1AEPA 1V4AA 2ETSA 4AL0A 1U89A 3DI5A 1I4YA 1TFOB 4DRJB 1VTMP 1LI5A 3ABLC 4YWQA 3VF0A 3FMSA 1MMAA 3EZIA 4JJGA 4NTAA 3VM6A 4NY3A 3FDQA 1LIHA 2I15A 2Y39A 1MMGA 4E7SA 3GWNA 3RYLA 3AG1C 4PACA 4MTOA 2PNOA 2Q3TA 1MQVA 4JC7A 3E9VA 3ZTZA 4JKVA 2WL8A 5IY5C 4FX5A 2R7QA 4G7OF 1Z5ZA 3JYYA 4Q7CA 1WTYA 3ZWIA 1EKYA 2XS1A 2OG2A 4CDAA 2R7WA 2H8AA 3JSEO 3JTLO 5E3AA 2CCYA 4GQHA 4JCZA 4CJGA 2CYDA 5JSLA 1YAUO 1VK5A 2UUIA 3C63A 3LUTB 4JEBA 1ZW3A 4XLNF 5L0IA 3O10A 3EH1A 1M56C 1APCA 3J06A 4PK4A 2BL2A 1FFTC 2EPMX 1EA8A 1UG7A 1DOVA 3EFOB 3MLGA 4BPMA 5DQZA 2R7SA 4BJ5A 3PMRA 2A6EF 2VC9A 2R02A 4BEMJ 4LDQA 2IXOA 2YQYA 3T6BA 2ZPAA 2IXNA 4I44A 2JX0A 2WVOA 3UMHA 4O6NA 1D0XA 2A69F 3KPHA 1GS9A 2NUTB 4U5FE 5BQGA 2EIJC 2YHSA 5A6JA 1R4TA 1Q0DA 2PBEA 2MYSA 3LESA 2XS8A 2GA0A 5B1AC 3RH3A 1SF8A 5E33A 1GGQA 4U5HA 2QLAA 4YL3A 3HNLA 1D0YA 1ZYRF 4NTFA 4YK5A 3LNRA 2XSEA 2Q00A 4U5CE 3U8VA 1E84A 1NZEA 2EPLX 1Z63A 2RSEB 2GAQA 1KNYA 3W2WA 4XLPF 4MVMA 5EGYA 1G8XA 3QZCA 3B0UX 2WB7A 4FESA 4IAOA 1H9GA 1PV3A 2NUPA 4RBNA 4PJNA 5AC5A 1L3PA 3Q7GA 3NRHA 2HMZA 3F46A 2OJED 3HKKA 3IQTA 3NMIA 4J7TA 1WASA 4XQ1A 3U2LA 1BZ4A 1TR2A 4CS8A 4YN0B 1OCOC 1WGWA 5T3TA 5B3SC 3KMIA 1RKEA 4N4WA 1CPQA 3AJMA 4AE4A 2CNWA 2GWWA 2Y3HA 1OW7A 4XPXA 2R7RA 1BR4A 4DRIB 3AQCA 2NUTA 1G4WR 1VLTA 3U9JA 2NPUA 3WG7C 2QY9A 2XLHA 3MX3A 4OD5A 5D91A 4GEHA 3W2VA 1VYKA 1QZXA 2OU6A 4IWBA 2G62A 5BQHA 3TQOA 3K1IA 3L1MA 4MS2A 3Q6NA 1CGME 2W9YA 1KTMA 3WODF 2J0XA 3H2UA 2FFHA 3RFYA 2L6HA 3EHNA 4ZLCA 4PFOA 1H6GA 3CSKA 1NFOA 1EI7A 3I4UA 4JTAB 4KNWA 5KYYA 1U0BB 4ZLDA 1EQ1A 1TWCA 3N24A 1ZU5A 2HZ8A 3U2MA 1VMAA 4CDYA 1OR2A 1ORJA 1M6TA 1J8YF 1O5HA 4ER9A 4YT8A 3DE9A 3B0PA 1D0ZA 1V54C 2XRHA 4I1MA 4K1OA 3SXKA 5JVEA 1M2VB 4HFFB 2J46A 2PFDA 2R25A 4QI0A 3FOPA 5AC4A 2CGEA 2WZLA 2IM8A 1WOLA 4IGGA 1I5NA 2Y3DA 3FOOA 4OIPF 1ZZPA 3A11A 4RD9A 4I3MA 3ZDLA 1OCZC 3IQCA 2R03A 3S28A 5JLIA 3KL4A 4KC9A 1R5ID 3QTHA 2IXPA 4O7GA 2TMVP 1YARO 3JYHA 3GEHA 3RIPA 4JW1A 4JVSA 2P7VA 4MVSA 1C03A 5B1BC 1QQ3A 1VYIA 2KK1A 1MNDA 2QE9A 2ZXOA 2IXMA 3IQ6A 5T3WA 2JPUA 3ASOC 1GM5A 2WZFA 4K7BA 3AG4C 4CS8C 5EHHA 2AWCA 3ZC4A 2HUJA 3DMDA 1A7DA 4PR9A 5CI8A 4N06A 3RW0A 3Q7LA 4ULWA 2LFDA 4JTDB 3AG2C 4JURI 5F28E 4E0IA 5KYUB 1BR1A 2B0HA 2X51A 1LKXA 2Y3GA 2Z15A 2KW3C 3ECSA 3QMKA 4XPWA 3U5SA 4NC3A 2L81A 1BR2A 1T5OA 2A0BA 1FNTc 3CEXA 2R7XA 1I4ZA 1SR2A 1NU7D 4JIOA 4P9FA 1SMYF 1RKCA 1UFBA 4DRHB 5E3CA 4YJWA 3ZSUA 5EK0A 1JRAA 3K7DA 5L0JA 5L3VA 1HMOA 4NTBA 4C3DA 3W8HA 4E17A 4AK9A 2R05A 3DKAA 4YL1A 1ZVZA 4N6CA 3SEOA 3JCUQ 4XWJA 1OXKA 4MTFA 3RKOF 3ZTMA 1YZCA 3TOLA 1HE9A 3WHNA 3I5QA 3GEIA 3O39A
chains in the Genus database with same CATH topology
1H7IA 1BZ4A 1GS9A 1NFNA 1OR3A 2KC3A 1AEPA 1OR2A 1LS4A 1LE2A 1YA9A 1LE4A 1EA8A 3R2PA 1B68A 3S84A 1LPEA 1NFOA 1EQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7I A;  1BZ4 A;  1GS9 A;  1NFN A;  1OR3 A;  2KC3 A;  1AEP A;  1OR2 A;  1LS4 A;  1LE2 A;  1YA9 A;  1LE4 A;  1EA8 A;  3R2P A;  1B68 A;  3S84 A;  1LPE A;  1NFO A;  1EQ1 A; 
#chains in the Genus database with same CATH topology
 3G50 A;  3IPM O;  1AVO B;  3ZG1 A;  1QSP A;  1JPJ A;  3T6G B;  4AL1 A;  2G3K A;  3E70 C;  3GOR A;  4CSA A;  1Y6D A;  4D4X A;  4KNV A;  2Y69 C;  3C8G D;  1TKN A;  4ANJ A;  2IBF A;  1QVX A;  1XZP A;  1ZHZ A;  3LNM B;  4DBQ A;  3IEE A;  1IZM A;  5L0H A;  1IW7 F;  2D4U A;  3W8I A;  5KYX A;  2KGO A;  4YT2 A;  1YVI A;  1T6Q A;  4Z9J A;  1PCX A;  2LSE A;  1ZHT A;  1S7Z A;  2XM0 A;  3KKB A;  3SXZ A;  3NG1 A;  2DGJ A;  4ULV A;  4R32 A;  2PP4 A;  5T1D B;  2YLD A;  3ZQY A;  3V7O A;  4MVO A;  2PX3 A;  5DQT A;  5L0G A;  5KYY B;  2YL7 A;  4MW3 A;  3TJ6 A;  2EIK C;  2C03 A;  2OOC A;  3CAX A;  4LAC B;  2EPN A;  4YT4 A;  1CPR A;  3L8I A;  2EPK X;  3DJU B;  4IB4 A;  3MFN A;  1E2X A;  4HEA J;  4LER A;  2WVQ A;  2L7A A;  4WGY A;  3C18 A;  5A6B D;  2W4M A;  1FR0 A;  4MVQ A;  4RDA A;  4BJ6 A;  2GDC A;  4I1O B;  3TD7 A;  3W4Y A;  1YJG A;  2VCC A;  1ZW2 A;  2R9R B;  4K0D A;  3HJC A;  1VB5 A;  1NU9 C;  3M79 A;  4JCH A;  1T6I A;  1C02 A;  4U5D E;  3EJN A;  4XTK A;  3S84 A;  1G5Z A;  1ZHW A;  4JRZ A;  2XLD A;  1F1M A;  1WN0 A;  3RQE A;  1LM3 B;  1TWG A;  2LP4 A;  2PF4 E;  3NYJ A;  4CBE A;  3UR3 C;  1YLM A;  4LLC A;  4G7Z F;  4EBB A;  4O79 A;  2WVN A;  5A6K A;  1MMD A;  2B0J A;  2XLE A;  2V26 A;  4G78 A;  4XEK A;  3ZVR A;  4P9T A;  3EPV A;  4J7Y A;  4ONS A;  3NKE A;  2L6F A;  4AE4 B;  1GQA A;  1RJ9 A;  1YA9 A;  3B9Q A;  4MVU A;  4DVZ A;  2W4B A;  1ZU4 A;  5KYW A;  3VAY A;  3US6 A;  3LJB A;  2QTV A;  3MBG A;  1OQC A;  1DOW A;  1T01 A;  3LLI A;  3QW1 A;  2R7U A;  2LCH A;  3O6X A;  5DVW A;  2A0U A;  4PFP A;  3HNK A;  1H7I A;  2XL6 A;  3PHF 2;  1VOM A;  1NSG B;  2ZXW C;  3RVY A;  4OIR F;  3Q6M A;  5DS6 A;  2ICW G;  3U3B A;  2HS5 A;  1QPU A;  4MQ9 F;  3IQ5 A;  1LI7 A;  2Q4F A;  3HNJ A;  1OKK D;  2H7B A;  4A4A A;  1RMV A;  4Q5S F;  1VLS A;  1YDI A;  1Z23 A;  2W45 A;  3FVY A;  3K33 A;  1N1C A;  4QDL A;  3DAF A;  2Q7R A;  3KH2 A;  3RQG A;  4BEJ A;  1HY5 A;  2J9U A;  4PJJ A;  3A9C A;  3SYN A;  2I8B A;  3PDM P;  4L6R A;  4JJF A;  2KQ9 A;  2KSF A;  2OEV A;  5KYN A;  1Y4C A;  1M2V A;  1T6U A;  3LLK A;  2VCA A;  3L8J A;  1A7V A;  1Z6A A;  3NYM A;  2M64 A;  3O55 A;  2YRF A;  3QVZ A;  2A1D D;  2D5R B;  3B71 A;  1YA7 O;  3C7J A;  3SXY A;  256B A;  1BDJ B;  1JOG A;  2Q9C A;  3AG3 C;  1MNE A;  1AUE A;  3BRJ A;  3C8G B;  3K1I C;  3U0C A;  2XL4 A;  1OR3 A;  5L0D A;  2DYS C;  4EWC A;  1J8M F;  3DZA A;  4BJ6 C;  3TK0 A;  1U6H A;  1B68 A;  5KYX B;  1T9K A;  3CZ6 A;  3EH2 A;  3DXJ F;  4C3E A;  3ATP A;  2AP3 A;  2KC3 A;  1JPN A;  4MW8 A;  5JT4 A;  3QVY A;  2MWQ A;  2IOQ A;  2XL8 A;  4DJ9 A;  2VAS A;  3N0T A;  4CS9 C;  4PJL A;  1V74 B;  5CI9 A;  1D1A A;  3SP1 A;  1L7C A;  2J7P D;  4XPY A;  1Q0G A;  3H65 A;  5L3Q A;  3GM3 A;  4U9D A;  4CIP A;  4CS7 A;  1NBB A;  1SZI A;  1HMD A;  1FTS A;  2XLO A;  4JEA A;  3L34 A;  4CX9 A;  1K05 A;  3M4B A;  4U5E E;  4OD4 A;  4LDK A;  3KYJ A;  2FAP B;  3LS0 A;  3S90 A;  1E85 A;  2QNL A;  1ORS C;  4U9E A;  2OEX A;  3L0I A;  5A6A A;  4EBJ A;  1FMW A;  2HJ3 A;  1A7E A;  1OKK A;  4DXW A;  3FAJ A;  5HV9 A;  1Q0K A;  3IHU A;  2AU5 A;  3LEV A;  1ZHY A;  4W8P A;  2YZS A;  4B6I A;  1NFN A;  3GOD A;  2LD6 A;  2E87 A;  2HV7 A;  2OJQ A;  4WGZ A;  2KNH A;  4J30 B;  3GWL A;  1TQG A;  4E0H A;  3TUL A;  2YLI A;  3S29 A;  5JRA A;  5HSW A;  3EGX B;  3RQF A;  3M4C A;  4U5G A;  1Z7Q c;  3ASN C;  3UGO A;  2NSF A;  3LAY A;  1D1B A;  1FMV A;  1TWA A;  3OEO A;  2XXA B;  1W2W A;  3OA1 A;  3UMK A;  1K40 A;  4C3B A;  4LLE A;  2OKU A;  3HLZ A;  3B29 A;  5KYW B;  4BG0 A;  3X2Q C;  4M63 A;  1HE1 A;  2Q9A A;  3AGT A;  1JMW A;  4FWV A;  5B3I A;  3POV A;  2IYL D;  1XWJ A;  1CGO A;  2Q9B A;  2VCB A;  1QLE C;  3FXH A;  3PCV A;  4P6I C;  4E18 A;  1JR8 A;  4DVY P;  4Q4Z F;  3CQZ A;  4XEV A;  2BC5 A;  1JAF A;  4H54 A;  3SZR A;  3LS1 A;  2DI3 A;  3NYL A;  4MVR A;  4EBK A;  4EIY A;  2DB4 A;  2V3C C;  2J0W A;  5E2Q A;  1H9T A;  1YYJ A;  3JRT A;  2HKV A;  2OQM A;  3C62 A;  1K04 A;  1OXB A;  2YL3 A;  3T6J A;  1CGN A;  1M57 C;  4BJ5 C;  1C17 M;  3S0X A;  2AWY A;  4H4K C;  2XLM A;  2JD3 A;  4KI2 A;  3GAN A;  2HJM A;  2R7O A;  1RXQ A;  4XEF A;  4C7O A;  3NKD A;  1A0B A;  5CIV A;  3X1O A;  3I5P A;  1M2O A;  3JSZ A;  3NMK A;  4F4B A;  1E83 A;  3OWT A;  2J45 A;  4DBR A;  3HTK C;  3DJN B;  3R2P A;  2EIN C;  2LK4 A;  5FZT A;  3NDB B;  1FAP B;  4HFK B;  1WAT A;  2ZXP A;  3DM5 A;  2HSB A;  2R7T A;  5F5F A;  3C8Z A;  3DD7 A;  3EGD B;  4HE8 D;  3TOM A;  1E86 A;  4J32 B;  2LFF A;  4OIQ F;  4G0H A;  4YT5 A;  1RCP A;  4DOZ A;  3KYI A;  1PD0 A;  4UDV A;  1V55 C;  3AOU A;  5COM A;  1HW2 A;  3V5X A;  1OCC C;  3GM1 A;  2UUH A;  4O6M A;  2ZXR A;  4YL0 A;  5JUA A;  4PJM A;  3SNH A;  3K6B A;  2YVK A;  3DWW A;  3FHD A;  1LPE A;  5DLJ A;  2LQG A;  3MYF A;  3K66 A;  3V5Y A;  1RJ9 B;  4QI2 A;  3U8P A;  3M1C B;  3EG9 A;  2R7V A;  1YYX A;  3WAQ A;  2H7O A;  4U5B E;  2X0C A;  2BE5 F;  3JZ0 A;  5A6B A;  3K1H A;  4O6Y A;  3B0V C;  4NQF A;  4C7O B;  2YWA A;  2EIM C;  4EKW A;  5COG A;  2ASR A;  4BJ1 A;  5JP7 A;  2M4E A;  3DM9 B;  4CIH A;  1HW1 A;  2DYR C;  1LS1 A;  1LS4 A;  1LE4 A;  1QKR A;  3M15 A;  3EHM A;  4IRU A;  2VB6 A;  2YL1 A;  3ZIB A;  5TJ5 E;  4EUK B;  2NG1 A;  1TWH A;  3VRC A;  2XLV A;  2P61 A;  3JT1 A;  3GM2 A;  1FFH A;  1ST6 A;  2CDQ A;  3C8G A;  4IJJ A;  3S9O A;  4CDV A;  1MMN A;  2HV6 A;  3DE8 A;  3EGX A;  2J7P A;  2FGY A;  2L6G A;  3ABK C;  1ORY A;  4E7Z A;  1WWP A;  4MND A;  1O87 A;  3U9M A;  2NSG A;  2J9W A;  2HFI A;  1OCR C;  3HNI A;  2VH3 A;  3T4R A;  2J8W A;  2F22 A;  5COF A;  2GFH A;  2ZD9 A;  4LDR A;  4Z9H A;  5K0I A;  2XXA A;  2XM4 A;  2HMQ A;  3GEE A;  3NMJ A;  5DS5 A;  4OIN F;  1Q0F A;  2RD9 A;  3T9O A;  2P6V A;  3ABM C;  5KYU A;  4G7H F;  3ZQV A;  1BBH A;  3TJ5 A;  5L0C A;  3BEH A;  2YL0 A;  4AX2 A;  4D4N A;  4WJ0 A;  1NG1 A;  4MVZ A;  2YLG A;  2YEV A;  4W8K A;  1KU2 A;  5DS4 A;  3N2Z B;  1LE2 A;  2C04 A;  4GYT A;  1NLX A;  4JTC B;  3JRM O;  3RF3 A;  3DAG A;  1OW6 A;  3ITF A;  1A41 A;  5JS5 A;  4KBL A;  1O3U A;  4WAB A;  2XLW A;  4IAQ A;  2KJG A;  3AQB A;  2KYH A;  4X0R A;  2AVK A;  3R7C A;  3S27 A;  4FAP B;  2YKZ A;  3EZH A;  4JZA A;  2EIL C;  2LIG A;  2P0N A;  5D92 A;  3RVZ A;  4Z9I A;  5L0F A;  1G4U S;  2P1A A;  1OW8 A;  3G4Z A;  2L9J A;  3UNG C;  5A69 A;  1S05 A;  5FCL A;  2A68 F;  2MHR A;  1YZA A;  2J9V A;  3V5Z A;  5BUO A;  2Y3B A;  3EGD A;  2OCC C;  4CS9 A;  1Q0M A;  1RKE B;  2A6H F;  3LEO A;  5GPG B;  2CW0 F;  3SXM A;  3UGP A;  5BQI A;  3MYI A;  1XZQ A;  3U3F A;  2NUP B;  3QW0 A;  3F47 A;  1TFK B;  2J9B A;  3UMI A;  4BJT A;  1SYQ A;  4JE9 A;  3FAP B;  4N6H A;  4CSA C;  1D1C A;  3G4X A;  4NCQ A;  2WZG A;  3EG9 B;  2CNW D;  2O9X A;  4CJO A;  3VYW A;  2H7V C;  2EPO A;  2G3V A;  5F5H A;  1PD1 A;  3EFO A;  3AGU A;  4EHP A;  1Z3I X;  5AGF A;  1ZHX A;  4IAR A;  2QUP A;  4MTG A;  2HSQ A;  1LVK A;  4OIO F;  2PX0 A;  3EQL F;  3H2V A;  4A2N B;  1AEP A;  1V4A A;  2ETS A;  4AL0 A;  1U89 A;  3DI5 A;  1I4Y A;  1TFO B;  4DRJ B;  1VTM P;  1LI5 A;  3ABL C;  4YWQ A;  3VF0 A;  3FMS A;  1MMA A;  3EZI A;  4JJG A;  4NTA A;  3VM6 A;  4NY3 A;  3FDQ A;  1LIH A;  2I15 A;  2Y39 A;  1MMG A;  4E7S A;  3GWN A;  3RYL A;  3AG1 C;  4PAC A;  4MTO A;  2PNO A;  2Q3T A;  1MQV A;  4JC7 A;  3E9V A;  3ZTZ A;  4JKV A;  2WL8 A;  5IY5 C;  4FX5 A;  2R7Q A;  4G7O F;  1Z5Z A;  3JYY A;  4Q7C A;  1WTY A;  3ZWI A;  1EKY A;  2XS1 A;  2OG2 A;  4CDA A;  2R7W A;  2H8A A;  3JSE O;  3JTL O;  5E3A A;  2CCY A;  4GQH A;  4JCZ A;  4CJG A;  2CYD A;  5JSL A;  1YAU O;  1VK5 A;  2UUI A;  3C63 A;  3LUT B;  4JEB A;  1ZW3 A;  4XLN F;  5L0I A;  3O10 A;  3EH1 A;  1M56 C;  1APC A;  3J06 A;  4PK4 A;  2BL2 A;  1FFT C;  2EPM X;  1EA8 A;  1UG7 A;  1DOV A;  3EFO B;  3MLG A;  4BPM A;  5DQZ A;  2R7S A;  4BJ5 A;  3PMR A;  2A6E F;  2VC9 A;  2R02 A;  4BEM J;  4LDQ A;  2IXO A;  2YQY A;  3T6B A;  2ZPA A;  2IXN A;  4I44 A;  2JX0 A;  2WVO A;  3UMH A;  4O6N A;  1D0X A;  2A69 F;  3KPH A;  1GS9 A;  2NUT B;  4U5F E;  5BQG A;  2EIJ C;  2YHS A;  5A6J A;  1R4T A;  1Q0D A;  2PBE A;  2MYS A;  3LES A;  2XS8 A;  2GA0 A;  5B1A C;  3RH3 A;  1SF8 A;  5E33 A;  1GGQ A;  4U5H A;  2QLA A;  4YL3 A;  3HNL A;  1D0Y A;  1ZYR F;  4NTF A;  4YK5 A;  3LNR A;  2XSE A;  2Q00 A;  4U5C E;  3U8V A;  1E84 A;  1NZE A;  2EPL X;  1Z63 A;  2RSE B;  2GAQ A;  1KNY A;  3W2W A;  4XLP F;  4MVM A;  5EGY A;  1G8X A;  3QZC A;  3B0U X;  2WB7 A;  4FES A;  4IAO A;  1H9G A;  1PV3 A;  2NUP A;  4RBN A;  4PJN A;  5AC5 A;  1L3P A;  3Q7G A;  3NRH A;  2HMZ A;  3F46 A;  2OJE D;  3HKK A;  3IQT A;  3NMI A;  4J7T A;  1WAS A;  4XQ1 A;  3U2L A;  1BZ4 A;  1TR2 A;  4CS8 A;  4YN0 B;  1OCO C;  1WGW A;  5T3T A;  5B3S C;  3KMI A;  1RKE A;  4N4W A;  1CPQ A;  3AJM A;  4AE4 A;  2CNW A;  2GWW A;  2Y3H A;  1OW7 A;  4XPX A;  2R7R A;  1BR4 A;  4DRI B;  3AQC A;  2NUT A;  1G4W R;  1VLT A;  3U9J A;  2NPU A;  3WG7 C;  2QY9 A;  2XLH A;  3MX3 A;  4OD5 A;  5D91 A;  4GEH A;  3W2V A;  1VYK A;  1QZX A;  2OU6 A;  4IWB A;  2G62 A;  5BQH A;  3TQO A;  3K1I A;  3L1M A;  4MS2 A;  3Q6N A;  1CGM E;  2W9Y A;  1KTM A;  3WOD F;  2J0X A;  3H2U A;  2FFH A;  3RFY A;  2L6H A;  3EHN A;  4ZLC A;  4PFO A;  1H6G A;  3CSK A;  1NFO A;  1EI7 A;  3I4U A;  4JTA B;  4KNW A;  5KYY A;  1U0B B;  4ZLD A;  1EQ1 A;  1TWC A;  3N24 A;  1ZU5 A;  2HZ8 A;  3U2M A;  1VMA A;  4CDY A;  1OR2 A;  1ORJ A;  1M6T A;  1J8Y F;  1O5H A;  4ER9 A;  4YT8 A;  3DE9 A;  3B0P A;  1D0Z A;  1V54 C;  2XRH A;  4I1M A;  4K1O A;  3SXK A;  5JVE A;  1M2V B;  4HFF B;  2J46 A;  2PFD A;  2R25 A;  4QI0 A;  3FOP A;  5AC4 A;  2CGE A;  2WZL A;  2IM8 A;  1WOL A;  4IGG A;  1I5N A;  2Y3D A;  3FOO A;  4OIP F;  1ZZP A;  3A11 A;  4RD9 A;  4I3M A;  3ZDL A;  1OCZ C;  3IQC A;  2R03 A;  3S28 A;  5JLI A;  3KL4 A;  4KC9 A;  1R5I D;  3QTH A;  2IXP A;  4O7G A;  2TMV P;  1YAR O;  3JYH A;  3GEH A;  3RIP A;  4JW1 A;  4JVS A;  2P7V A;  4MVS A;  1C03 A;  5B1B C;  1QQ3 A;  1VYI A;  2KK1 A;  1MND A;  2QE9 A;  2ZXO A;  2IXM A;  3IQ6 A;  5T3W A;  2JPU A;  3ASO C;  1GM5 A;  2WZF A;  4K7B A;  3AG4 C;  4CS8 C;  5EHH A;  2AWC A;  3ZC4 A;  2HUJ A;  3DMD A;  1A7D A;  4PR9 A;  5CI8 A;  4N06 A;  3RW0 A;  3Q7L A;  4ULW A;  2LFD A;  4JTD B;  3AG2 C;  4JUR I;  5F28 E;  4E0I A;  5KYU B;  1BR1 A;  2B0H A;  2X51 A;  1LKX A;  2Y3G A;  2Z15 A;  2KW3 C;  3ECS A;  3QMK A;  4XPW A;  3U5S A;  4NC3 A;  2L81 A;  1BR2 A;  1T5O A;  2A0B A;  1FNT c;  3CEX A;  2R7X A;  1I4Z A;  1SR2 A;  1NU7 D;  4JIO A;  4P9F A;  1SMY F;  1RKC A;  1UFB A;  4DRH B;  5E3C A;  4YJW A;  3ZSU A;  5EK0 A;  1JRA A;  3K7D A;  5L0J A;  5L3V A;  1HMO A;  4NTB A;  4C3D A;  3W8H A;  4E17 A;  4AK9 A;  2R05 A;  3DKA A;  4YL1 A;  1ZVZ A;  4N6C A;  3SEO A;  3JCU Q;  4XWJ A;  1OXK A;  4MTF A;  3RKO F;  3ZTM A;  1YZC A;  3TOL A;  1HE9 A;  3WHN A;  3I5Q A;  3GEI A;  3O39 A; 
#chains in the Genus database with same CATH homology
 1H7I A;  1BZ4 A;  1GS9 A;  1NFN A;  1OR3 A;  2KC3 A;  1AEP A;  1OR2 A;  1LS4 A;  1LE2 A;  1YA9 A;  1LE4 A;  1EA8 A;  3R2P A;  1B68 A;  3S84 A;  1LPE A;  1NFO A;  1EQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...