1OR3A

Apolipoprotein e3 (apoe3), trigonal truncation mutant 165
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
143
structure length
136
Chain Sequence
SGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (APOLIPOPROTEIN E)
publication title Conformational flexibility in the apolipoprotein E amino-terminal domain structure determined from three new crystal forms: implications for lipid binding.
pubmed rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 58
structure length 136
sequence length 143
ec nomenclature
pdb deposition date 1998-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1or3A00
1LE4A 1EA8A 1LE2A 3R2PA 1LPEA 1EQ1A 1NFNA 1NFOA 1B68A 1YA9A 2KC3A 3S84A 1OR2A 1AEPA 1LS4A 1GS9A 1BZ4A 1H7IA 1OR3A
chains in the Genus database with same CATH superfamily
3JTLO 4YN0B 3X2QC 3NMIA 5BQHA 4MS2A 2GFHA 5IY5C 2R25A 2HS5A 4U5CE 3LEVA 5EGYA 4BJ5A 4EKWA 2OJQA 5KYXB 2R7XA 2QLAA 1MMGA 1D1AA 3NKEA 4XPXA 1OCOC 4I1MA 3ZDLA 1O5HA 2XL6A 1BR1A 4G7OF 1LPEA 3H2VA 2UUIA 4XLNF 3SNHA 1OKKA 3GM3A 3NMJA 4PJJA 3FOPA 5L0HA 1JMWA 1B68A 2ZD9A 1RKEB 1NBBA 5A6JA 5KYWB 1UG7A 2YL1A 3NRHA 2G3VA 5F5FA 1CPRA 3RVYA 1AEPA 2P61A 3NYJA 5B3SC 3M4BA 4YJWA 4ER9A 4DRHB 4BEJA 3L1MA 3DZAA 3MYFA 4YL3A 2NUTB 4CSAA 4CIPA 1LI5A 5JT4A 1ZW3A 2R7UA 3K66A 4CS9C 3M79A 4QI0A 1ORSC 2OOCA 2YQYA 3MFNA 2IM8A 3OEOA 2GA0A 1JRAA 4HEAJ 4QDLA 1VK5A 4MTGA 2OQMA 4R32A 3NYMA 5DVWA 3AG4C 3CQZA 4RBNA 4K0DA 1YZAA 2NPUA 5B1AC 3S9OA 2J7PA 5A6BA 4C7OB 3B9QA 3DE8A 2DYRC 4U9EA 3WAQA 4P6IC 5DQTA 1SR2A 5BUOA 2XS1A 3T6JA 2J9BA 2HMQA 3AOUA 3QTHA 4MQ9F 2XM0A 4XLPF 3W2WA 1NU7D 1OR2A 2LD6A 1LVKA 4XWJA 4BJTA 3U0CA 1AVOB 4M63A 2R7TA 1XZQA 2VCCA 2CW0F 2Q9CA 1RKCA 4AE4A 3SXMA 5L0DA 2WL8A 3S27A 2PF4E 1HW2A 1DOVA 1MMDA 3ABKC 3E9VA 2CNWD 1VB5A 2XLDA 3ABMC 3LLIA 4BPMA 2MYSA 1FFTC 1JPJA 1TQGA 4FX5A 2J8WA 3RQGA 1YZCA 3ZTMA 4F4BA 2NSFA 2CGEA 5L0IA 1KTMA 3IPMO 1MQVA 3TD7A 1VLTA 1GGQA 1NG1A 1ORYA 3C8GA 2A69F 3FOOA 2Z15A 3FXHA 1HY5A 1CGOA 3TOMA 1XZPA 4W8PA 1LI7A 2Q00A 4H54A 4EBJA 1H9TA 2XLMA 4HE8D 3SXYA 3FAJA 3KL4A 3VRCA 1CGNA 3LAYA 3M4CA 2A6HF 3HNKA 2A0BA 3KYJA 3M1CB 3HNLA 5KYYB 3O39A 2PFDA 4E18A 2IBFA 2ICWG 1M57C 2KSFA 3LESA 2PBEA 3N2ZB 4XQ1A 2R7OA 3NG1A 1CGME 1PV3A 5E33A 1VOMA 2IXOA 3ASNC 4J30B 1A7EA 3WODF 4Q5SF 4JW1A 1DOWA 1OR3A 2IXNA 3V7OA 4YK5A 4AX2A 1A7DA 5L0CA 3EH2A 1QKRA 1D1CA 1G5ZA 1U6HA 3KH2A 1ST6A 2B0HA 2FFHA 2DGJA 2VCBA 3O6XA 4PK4A 3SP1A 1WN0A 1FMWA 3LS0A 3OWTA 4LDRA 3ZQVA 2HSBA 1E86A 2R7RA 2P7VA 3S0XA 2ZXPA 2HUJA 1TFKB 1JPNA 2WZGA 3DXJF 1HE9A 3AQCA 4GQHA 4U5HA 4BJ5C 5CIVA 4G7HF 5JP7A 1TWAA 2LCHA 2V26A 5F5HA 3U5SA 1NSGB 3G4XA 4XPWA 4BJ1A 5FCLA 3K33A 2XM4A 3BEHA 3OA1A 1Q0KA 2MWQA 4JCZA 5CI9A 3IQ6A 3RVZA 1J8MF 1WTYA 4N06A 2LSEA 4K7BA 1IZMA 2EPMX 4O6MA 5COFA 3IQCA 1WASA 2CCYA 2R7WA 1RJ9B 2L6GA 4QI2A 2DYSC 3DI5A 2HJMA 3UR3C 1R4TA 1IW7F 1LIHA 3LJBA 5CI8A 1YA7O 1RCPA 3EG9A 3M15A 1K04A 4EHPA 3Q6NA 4K1OA 5T3WA 4E17A 1Z63A 2VB6A 3T6BA 2Q3TA 4WABA 4FESA 4U5EE 1TKNA 2H7OA 4PFOA 1ZHYA 2RD9A 3UMIA 4PJMA 2W4BA 1OCZC 1SMYF 2P1AA 3U9MA 4A2NB 3NDBB 4OIPF 5HSWA 3MBGA 3UGOA 2YWAA 1Q0MA 1G4US 2OG2A 4PFPA 5K0IA 3Q7LA 4DJ9A 3O55A 4WGYA 3VF0A 4CIHA 5L0GA 4NY3A 4IRUA 3I5PA 2R05A 3JT1A 3T4RA 3ZC4A 4O6NA 3K1IA 1C02A 4HFFB 4JCHA 4MVUA 2ETSA 1APCA 1D0ZA 2A0UA 2CYDA 2Y3GA 3AJMA 2W9YA 2L7AA 5DLJA 2PNOA 3UMKA 1ZZPA 3R7CA 3LLKA 1OW7A 1V54C 1I4ZA 1Z23A 3EZHA 4JURI 4KC9A 2C03A 1WATA 1QVXA 2KK1A 2YHSA 2ZXOA 4ZLDA 2XLWA 3L8IA 4EWCA 1YYJA 1O3UA 4E0IA 5D91A 2J9WA 3C7JA 4AL0A 1T6UA 2KQ9A 2QNLA 1WGWA 1U89A 4CS8A 1T9KA 5EHHA 4ZLCA 4YWQA 2GDCA 3G50A 4CDVA 4DVYP 3VM6A 4JRZA 2Y39A 1AUEA 4EUKB 5AC4A 2DB4A 1FFHA 4J7TA 4ULWA 2W4MA 4DBQA 5T3TA 3B0VC 3DWWA 2LFFA 2HFIA 3GORA 4XEVA 3AGUA 3RIPA 5E3AA 3SXZA 1MMNA 5FZTA 2P6VA 3U2LA 2QUPA 5L0FA 3DJUB 4MTOA 4U5GA 3V5YA 4ONSA 2G3KA 4E7SA 2ZXWC 3FVYA 1EA8A 1V74B 4MVMA 4CDYA 1JOGA 3KMIA 4Z9HA 3EGDB 3C18A 3JCUQ 1WOLA 1E2XA 2P0NA 2YZSA 3HTKC 4MVRA 5KYUA 4OIQF 1GQAA 2YLGA 5B3IA 3JZ0A 1BDJB 3S28A 2XL8A 3BRJA 3J06A 2Y69C 2A68F 1Z5ZA 2PP4A 3RH3A 4D4XA 1OW8A 2D5RB 4J7YA 1HMDA 1M2OA 2Y3DA 4MVQA 3S84A 4DOZA 5F28E 2EPKX 2J7PD 2XLEA 3JSZA 1YVIA 4LDQA 4A4AA 3ATPA 1LS4A 2JPUA 1Q0FA 3B29A 3K6BA 4CJOA 5COMA 4OIRF 1BZ4A 3C8ZA 3A9CA 1K05A 1YARO 4MW8A 3JRMO 4P9TA 2L6HA 4DBRA 2WB7A 4G0HA 3GM1A 4MTFA 1LM3B 3EJNA 1C03A 1L7CA 4GYTA 1S7ZA 2L6FA 4IWBA 3ZTZA 4ULVA 2EPOA 1D0XA 3EZIA 3O10A 5KYNA 1RMVA 3L8JA 4BJ6A 1ZHXA 3QW1A 4EBKA 2A6EF 1YLMA 3U3FA 3VYWA 5EK0A 3ZWIA 4O7GA 3MYIA 2AVKA 1ZHTA 3C62A 1EQ1A 4KNVA 5DQZA 5D92A 1QLEC 4XEFA 3T9OA 4IJJA 1G8XA 1L3PA 1ORJA 1YA9A 2R9RB 3E70C 3EQLF 3GEEA 2B0JA 2VCAA 3LEOA 3TOLA 3FDQA 2XSEA 2NG1A 2FAPB 2AU5A 3SXKA 2KJGA 2YLDA 3DKAA 4GEHA 3JSEO 1TWHA 3HKKA 1M56C 2H8AA 3CEXA 1MMAA 3GWNA 2EIJC 4W8KA 3K1IC 3SYNA 3HNJA 5L3VA 2AWCA 1ZHWA 1PCXA 1QPUA 2WVOA 3KKBA 2HJ3A 4JTDB 1G4WR 4LLEA 3ZVRA 2AP3A 2YL7A 4JC7A 2H7VC 1D0YA 3ZG1A 3GANA 3MX3A 5B1BC 3V5XA 2ASRA 1YDIA 1KNYA 2R02A 4AE4B 4CS7A 3FAPB 3L34A 3N0TA 5JVEA 3RYLA 1E85A 3HNIA 3GEHA 4CS8C 4E7ZA 1U0BB 4C3BA 2Y3BA 3B71A 3U8PA 2XXAA 4XEKA 4PACA 2J45A 1SZIA 3HJCA 4N4WA 3EGXA 3GWLA 3RQFA 3C8GB 1QQ3A 2OJED 2UUHA 3DMDA 4JJGA 4KNWA 4Q7CA 1T5OA 2AWYA 4H4KC 4LDKA 1FAPB 1ZW2A 2Y3HA 3H2UA 4LERA 4MVZA 4YL0A 3U9JA 4DRIB 1YJGA 1LE4A 3CAXA 1V55C 1WWPA 3IHUA 4PJLA 5HV9A 4O79A 4JE9A 4CSAC 2M4EA 1SYQA 4JJFA 1E84A 4X0RA 5JLIA 3NYLA 2ZPAA 2YL0A 2YVKA 2HKVA 1OXKA 4YT4A 2J0XA 4AL1A 4JTCB 3AQBA 1NFNA 3L0IA 2EIMC 2QE9A 2Q4FA 3QMKA 4KI2A 2R7VA 4YT8A 5COGA 3TJ5A 4WGZA 4C3DA 4KBLA 3WHNA 4NTAA 3SEOA 4Z9JA 2D4UA 3UMHA 4AK9A 2J9VA 3QVYA 4NQFA 1H7IA 2EINC 4PR9A 1Q0DA 3DM5A 1QSPA 2LIGA 2X0CA 2QY9A 3ITFA 1OQCA 3Q6MA 4DVZA 1OW6A 4HFKB 1H6GA 3C63A 1Z3IX 2WZFA 1VMAA 1RXQA 1SF8A 2XLHA 5AC5A 2A1DD 4JZAA 1JR8A 3EGXB 1Q0GA 1V4AA 2IXMA 3QW0A 2NUTA 1K40A 1I4YA 3N24A 1J8YF 1FR0A 4OINF 1Z7Qc 1HMOA 1C17M 1OCRC 3WG7C 3FMSA 3RF3A 5A6AA 1Y6DA 3NKDA 5DS6A 1OXBA 5JS5A 2V3CC 3SZRA 4OIOF 2J46A 2QTVA 3EG9B 3I4UA 4BEMJ 3TULA 1FTSA 5BQIA 2IYLD 4CJGA 2XLOA 2XLVA 1ZU5A 4L6RA 5JRAA 2R7SA 3MLGA 1OKKD 4JVSA 3PHF2 4JTAB 1H9GA 4CBEA 2EPNA 1T01A 2I15A 5E2QA 2PX3A 3ZQYA 3LUTB 3A11A 1XWJA 2IOQA 2LP4A 1BR4A 3PMRA 3ECSA 2YL3A 4E0HA 3W4YA 4U9DA 3F47A 2LQGA 4C3EA 4N6HA 4NTFA 3AG1C 4D4NA 2BE5F 1ZU4A 2HZ8A 2VH3A 2X51A 4JEBA 256BA 5GPGB 4IARA 4NCQA 1E83A 2OU6A 3IEEA 2KC3A 4WJ0A 3V5ZA 1I5NA 2KNHA 3EFOA 1ZYRF 3DAFA 3Q7GA 1EKYA 5A6BD 3U2MA 3QZCA 4DXWA 1VYIA 5KYYA 4JIOA 2VC9A 1QZXA 3PDMP 1KU2A 1EI7A 1PD1A 4P9FA 4RDAA 3TQOA 4MW3A 3W8HA 2HMZA 1TFOB 2ZXRA 4I3MA 1LE2A 2EILC 3GM2A 4G7ZF 2R03A 2HV6A 3PCVA 4NTBA 1A7VA 1S05A 4OD5A 3H65A 1M2VA 1TWCA 3GODA 2YEVA 3IQ5A 4XPYA 3VAYA 1NLXA 3RQEA 2KW3C 4EBBA 1TR2A 3LNMB 2CNWA 2OKUA 1VLSA 3C8GD 2XRHA 3TJ6A 2Q9AA 4YL1A 2JD3A 3RW0A 2VASA 1Z6AA 1NU9C 2LK4A 2GWWA 4I44A 4I1OB 4LLCA 3KPHA 3U3BA 3ZIBA 5KYUB 5AGFA 2I8BA 2LFDA 2YRFA 4J32B 4JEAA 5T1DB 3RKOF 2F22A 4FAPB 2GAQA 1UFBA 3EHMA 1LKXA 3UNGC 3HLZA 2R7QA 3EFOB 3S90A 3RFYA 3F46A 1RJ9A 3G4ZA 2G62A 3IQTA 3QVZA 3W8IA 1MNEA 4UDVA 2EPLX 3JYHA 2OEVA 2L9JA 2KGOA 2PX0A 5L3QA 2C04A 4IAQA 1O87A 3S29A 1NZEA 2IXPA 2OCCC 2NUPA 3B0UX 4CS9A 2MHRA 1HE1A 3CSKA 3DM9B 2JX0A 3X1OA 1R5ID 2J0WA 4IGGA 5JSLA 4DRJB 5A6KA 1BBHA 3AGTA 1M2VB 4MVSA 5DS5A 3EH1A 4JKVA 3ASOC 1T6IA 1ZHZA 4N6CA 2EIKC 2FGYA 4NC3A 5L0JA 1YYXA 3T6GB 3GEIA 3TK0A 4ANJA 1FMVA 3POVA 2M64A 4U5DE 4G78A 4XTKA 5BQGA 1F1MA 1OCCC 4CX9A 3UGPA 1PD0A 3LNRA 1MNDA 3B0PA 4U5BE 1FNTc 3K1HA 4YT5A 4YT2A 1NFOA 2DI3A 2Q9BA 3AG3C 1CPQA 2BC5A 2WVNA 3NMKA 5TJ5E 1HW1A 2W45A 5KYXA 1A0BA 2WZLA 4RD9A 2YLIA 1VTMP 2O9XA 3JYYA 2BL2A 2J9UA 2NSGA 4U5FE 5JUAA 1D1BA 1GS9A 1W2WA 3K7DA 4Z9IA 2WVQA 3DAGA 4PJNA 4BG0A 3JRTA 1A41A 1T6QA 1YAUO 4LACB 4OD4A 1RKEA 4MNDA 4EIYA 4IB4A 5KYWA 2L81A 3CZ6A 1N1CA 2XS8A 3EHNA 2XXAB 3I5QA 2Q7RA 3ABLC 4B6IA 3FHDA 2NUPB 3DJNB 5E3CA 3U8VA 3AG2C 2HV7A 4IAOA 1Y4CA 2TMVP 3R2PA 4O6YA 5A69A 2OEXA 3DE9A 1GM5A 2CDQA 4CDAA 4FWVA 2KYHA 1VYKA 2HSQA 2RSEB 3LS1A 3W2VA 4BJ6C 4Q4ZF 1LS1A 2XL4A 2YKZA 3EGDA 3ZSUA 1ZVZA 1BR2A 4MVOA 1TWGA 5DS4A 3EPVA 1M6TA 1JAFA 4C7OA 3DD7A 3KYIA 3US6A 2E87A 2H7BA
chains in the Genus database with same CATH topology
1LE4A 1EA8A 1LE2A 3R2PA 1LPEA 1EQ1A 1NFNA 1NFOA 1B68A 1YA9A 2KC3A 3S84A 1OR2A 1AEPA 1LS4A 1GS9A 1BZ4A 1H7IA 1OR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LE4 A;  1EA8 A;  1LE2 A;  3R2P A;  1LPE A;  1EQ1 A;  1NFN A;  1NFO A;  1B68 A;  1YA9 A;  2KC3 A;  3S84 A;  1OR2 A;  1AEP A;  1LS4 A;  1GS9 A;  1BZ4 A;  1H7I A;  1OR3 A; 
#chains in the Genus database with same CATH topology
 3JTL O;  4YN0 B;  3X2Q C;  3NMI A;  5BQH A;  4MS2 A;  2GFH A;  5IY5 C;  2R25 A;  2HS5 A;  4U5C E;  3LEV A;  5EGY A;  4BJ5 A;  4EKW A;  2OJQ A;  5KYX B;  2R7X A;  2QLA A;  1MMG A;  1D1A A;  3NKE A;  4XPX A;  1OCO C;  4I1M A;  3ZDL A;  1O5H A;  2XL6 A;  1BR1 A;  4G7O F;  1LPE A;  3H2V A;  2UUI A;  4XLN F;  3SNH A;  1OKK A;  3GM3 A;  3NMJ A;  4PJJ A;  3FOP A;  5L0H A;  1JMW A;  1B68 A;  2ZD9 A;  1RKE B;  1NBB A;  5A6J A;  5KYW B;  1UG7 A;  2YL1 A;  3NRH A;  2G3V A;  5F5F A;  1CPR A;  3RVY A;  1AEP A;  2P61 A;  3NYJ A;  5B3S C;  3M4B A;  4YJW A;  4ER9 A;  4DRH B;  4BEJ A;  3L1M A;  3DZA A;  3MYF A;  4YL3 A;  2NUT B;  4CSA A;  4CIP A;  1LI5 A;  5JT4 A;  1ZW3 A;  2R7U A;  3K66 A;  4CS9 C;  3M79 A;  4QI0 A;  1ORS C;  2OOC A;  2YQY A;  3MFN A;  2IM8 A;  3OEO A;  2GA0 A;  1JRA A;  4HEA J;  4QDL A;  1VK5 A;  4MTG A;  2OQM A;  4R32 A;  3NYM A;  5DVW A;  3AG4 C;  3CQZ A;  4RBN A;  4K0D A;  1YZA A;  2NPU A;  5B1A C;  3S9O A;  2J7P A;  5A6B A;  4C7O B;  3B9Q A;  3DE8 A;  2DYR C;  4U9E A;  3WAQ A;  4P6I C;  5DQT A;  1SR2 A;  5BUO A;  2XS1 A;  3T6J A;  2J9B A;  2HMQ A;  3AOU A;  3QTH A;  4MQ9 F;  2XM0 A;  4XLP F;  3W2W A;  1NU7 D;  1OR2 A;  2LD6 A;  1LVK A;  4XWJ A;  4BJT A;  3U0C A;  1AVO B;  4M63 A;  2R7T A;  1XZQ A;  2VCC A;  2CW0 F;  2Q9C A;  1RKC A;  4AE4 A;  3SXM A;  5L0D A;  2WL8 A;  3S27 A;  2PF4 E;  1HW2 A;  1DOV A;  1MMD A;  3ABK C;  3E9V A;  2CNW D;  1VB5 A;  2XLD A;  3ABM C;  3LLI A;  4BPM A;  2MYS A;  1FFT C;  1JPJ A;  1TQG A;  4FX5 A;  2J8W A;  3RQG A;  1YZC A;  3ZTM A;  4F4B A;  2NSF A;  2CGE A;  5L0I A;  1KTM A;  3IPM O;  1MQV A;  3TD7 A;  1VLT A;  1GGQ A;  1NG1 A;  1ORY A;  3C8G A;  2A69 F;  3FOO A;  2Z15 A;  3FXH A;  1HY5 A;  1CGO A;  3TOM A;  1XZP A;  4W8P A;  1LI7 A;  2Q00 A;  4H54 A;  4EBJ A;  1H9T A;  2XLM A;  4HE8 D;  3SXY A;  3FAJ A;  3KL4 A;  3VRC A;  1CGN A;  3LAY A;  3M4C A;  2A6H F;  3HNK A;  2A0B A;  3KYJ A;  3M1C B;  3HNL A;  5KYY B;  3O39 A;  2PFD A;  4E18 A;  2IBF A;  2ICW G;  1M57 C;  2KSF A;  3LES A;  2PBE A;  3N2Z B;  4XQ1 A;  2R7O A;  3NG1 A;  1CGM E;  1PV3 A;  5E33 A;  1VOM A;  2IXO A;  3ASN C;  4J30 B;  1A7E A;  3WOD F;  4Q5S F;  4JW1 A;  1DOW A;  1OR3 A;  2IXN A;  3V7O A;  4YK5 A;  4AX2 A;  1A7D A;  5L0C A;  3EH2 A;  1QKR A;  1D1C A;  1G5Z A;  1U6H A;  3KH2 A;  1ST6 A;  2B0H A;  2FFH A;  2DGJ A;  2VCB A;  3O6X A;  4PK4 A;  3SP1 A;  1WN0 A;  1FMW A;  3LS0 A;  3OWT A;  4LDR A;  3ZQV A;  2HSB A;  1E86 A;  2R7R A;  2P7V A;  3S0X A;  2ZXP A;  2HUJ A;  1TFK B;  1JPN A;  2WZG A;  3DXJ F;  1HE9 A;  3AQC A;  4GQH A;  4U5H A;  4BJ5 C;  5CIV A;  4G7H F;  5JP7 A;  1TWA A;  2LCH A;  2V26 A;  5F5H A;  3U5S A;  1NSG B;  3G4X A;  4XPW A;  4BJ1 A;  5FCL A;  3K33 A;  2XM4 A;  3BEH A;  3OA1 A;  1Q0K A;  2MWQ A;  4JCZ A;  5CI9 A;  3IQ6 A;  3RVZ A;  1J8M F;  1WTY A;  4N06 A;  2LSE A;  4K7B A;  1IZM A;  2EPM X;  4O6M A;  5COF A;  3IQC A;  1WAS A;  2CCY A;  2R7W A;  1RJ9 B;  2L6G A;  4QI2 A;  2DYS C;  3DI5 A;  2HJM A;  3UR3 C;  1R4T A;  1IW7 F;  1LIH A;  3LJB A;  5CI8 A;  1YA7 O;  1RCP A;  3EG9 A;  3M15 A;  1K04 A;  4EHP A;  3Q6N A;  4K1O A;  5T3W A;  4E17 A;  1Z63 A;  2VB6 A;  3T6B A;  2Q3T A;  4WAB A;  4FES A;  4U5E E;  1TKN A;  2H7O A;  4PFO A;  1ZHY A;  2RD9 A;  3UMI A;  4PJM A;  2W4B A;  1OCZ C;  1SMY F;  2P1A A;  3U9M A;  4A2N B;  3NDB B;  4OIP F;  5HSW A;  3MBG A;  3UGO A;  2YWA A;  1Q0M A;  1G4U S;  2OG2 A;  4PFP A;  5K0I A;  3Q7L A;  4DJ9 A;  3O55 A;  4WGY A;  3VF0 A;  4CIH A;  5L0G A;  4NY3 A;  4IRU A;  3I5P A;  2R05 A;  3JT1 A;  3T4R A;  3ZC4 A;  4O6N A;  3K1I A;  1C02 A;  4HFF B;  4JCH A;  4MVU A;  2ETS A;  1APC A;  1D0Z A;  2A0U A;  2CYD A;  2Y3G A;  3AJM A;  2W9Y A;  2L7A A;  5DLJ A;  2PNO A;  3UMK A;  1ZZP A;  3R7C A;  3LLK A;  1OW7 A;  1V54 C;  1I4Z A;  1Z23 A;  3EZH A;  4JUR I;  4KC9 A;  2C03 A;  1WAT A;  1QVX A;  2KK1 A;  2YHS A;  2ZXO A;  4ZLD A;  2XLW A;  3L8I A;  4EWC A;  1YYJ A;  1O3U A;  4E0I A;  5D91 A;  2J9W A;  3C7J A;  4AL0 A;  1T6U A;  2KQ9 A;  2QNL A;  1WGW A;  1U89 A;  4CS8 A;  1T9K A;  5EHH A;  4ZLC A;  4YWQ A;  2GDC A;  3G50 A;  4CDV A;  4DVY P;  3VM6 A;  4JRZ A;  2Y39 A;  1AUE A;  4EUK B;  5AC4 A;  2DB4 A;  1FFH A;  4J7T A;  4ULW A;  2W4M A;  4DBQ A;  5T3T A;  3B0V C;  3DWW A;  2LFF A;  2HFI A;  3GOR A;  4XEV A;  3AGU A;  3RIP A;  5E3A A;  3SXZ A;  1MMN A;  5FZT A;  2P6V A;  3U2L A;  2QUP A;  5L0F A;  3DJU B;  4MTO A;  4U5G A;  3V5Y A;  4ONS A;  2G3K A;  4E7S A;  2ZXW C;  3FVY A;  1EA8 A;  1V74 B;  4MVM A;  4CDY A;  1JOG A;  3KMI A;  4Z9H A;  3EGD B;  3C18 A;  3JCU Q;  1WOL A;  1E2X A;  2P0N A;  2YZS A;  3HTK C;  4MVR A;  5KYU A;  4OIQ F;  1GQA A;  2YLG A;  5B3I A;  3JZ0 A;  1BDJ B;  3S28 A;  2XL8 A;  3BRJ A;  3J06 A;  2Y69 C;  2A68 F;  1Z5Z A;  2PP4 A;  3RH3 A;  4D4X A;  1OW8 A;  2D5R B;  4J7Y A;  1HMD A;  1M2O A;  2Y3D A;  4MVQ A;  3S84 A;  4DOZ A;  5F28 E;  2EPK X;  2J7P D;  2XLE A;  3JSZ A;  1YVI A;  4LDQ A;  4A4A A;  3ATP A;  1LS4 A;  2JPU A;  1Q0F A;  3B29 A;  3K6B A;  4CJO A;  5COM A;  4OIR F;  1BZ4 A;  3C8Z A;  3A9C A;  1K05 A;  1YAR O;  4MW8 A;  3JRM O;  4P9T A;  2L6H A;  4DBR A;  2WB7 A;  4G0H A;  3GM1 A;  4MTF A;  1LM3 B;  3EJN A;  1C03 A;  1L7C A;  4GYT A;  1S7Z A;  2L6F A;  4IWB A;  3ZTZ A;  4ULV A;  2EPO A;  1D0X A;  3EZI A;  3O10 A;  5KYN A;  1RMV A;  3L8J A;  4BJ6 A;  1ZHX A;  3QW1 A;  4EBK A;  2A6E F;  1YLM A;  3U3F A;  3VYW A;  5EK0 A;  3ZWI A;  4O7G A;  3MYI A;  2AVK A;  1ZHT A;  3C62 A;  1EQ1 A;  4KNV A;  5DQZ A;  5D92 A;  1QLE C;  4XEF A;  3T9O A;  4IJJ A;  1G8X A;  1L3P A;  1ORJ A;  1YA9 A;  2R9R B;  3E70 C;  3EQL F;  3GEE A;  2B0J A;  2VCA A;  3LEO A;  3TOL A;  3FDQ A;  2XSE A;  2NG1 A;  2FAP B;  2AU5 A;  3SXK A;  2KJG A;  2YLD A;  3DKA A;  4GEH A;  3JSE O;  1TWH A;  3HKK A;  1M56 C;  2H8A A;  3CEX A;  1MMA A;  3GWN A;  2EIJ C;  4W8K A;  3K1I C;  3SYN A;  3HNJ A;  5L3V A;  2AWC A;  1ZHW A;  1PCX A;  1QPU A;  2WVO A;  3KKB A;  2HJ3 A;  4JTD B;  1G4W R;  4LLE A;  3ZVR A;  2AP3 A;  2YL7 A;  4JC7 A;  2H7V C;  1D0Y A;  3ZG1 A;  3GAN A;  3MX3 A;  5B1B C;  3V5X A;  2ASR A;  1YDI A;  1KNY A;  2R02 A;  4AE4 B;  4CS7 A;  3FAP B;  3L34 A;  3N0T A;  5JVE A;  3RYL A;  1E85 A;  3HNI A;  3GEH A;  4CS8 C;  4E7Z A;  1U0B B;  4C3B A;  2Y3B A;  3B71 A;  3U8P A;  2XXA A;  4XEK A;  4PAC A;  2J45 A;  1SZI A;  3HJC A;  4N4W A;  3EGX A;  3GWL A;  3RQF A;  3C8G B;  1QQ3 A;  2OJE D;  2UUH A;  3DMD A;  4JJG A;  4KNW A;  4Q7C A;  1T5O A;  2AWY A;  4H4K C;  4LDK A;  1FAP B;  1ZW2 A;  2Y3H A;  3H2U A;  4LER A;  4MVZ A;  4YL0 A;  3U9J A;  4DRI B;  1YJG A;  1LE4 A;  3CAX A;  1V55 C;  1WWP A;  3IHU A;  4PJL A;  5HV9 A;  4O79 A;  4JE9 A;  4CSA C;  2M4E A;  1SYQ A;  4JJF A;  1E84 A;  4X0R A;  5JLI A;  3NYL A;  2ZPA A;  2YL0 A;  2YVK A;  2HKV A;  1OXK A;  4YT4 A;  2J0X A;  4AL1 A;  4JTC B;  3AQB A;  1NFN A;  3L0I A;  2EIM C;  2QE9 A;  2Q4F A;  3QMK A;  4KI2 A;  2R7V A;  4YT8 A;  5COG A;  3TJ5 A;  4WGZ A;  4C3D A;  4KBL A;  3WHN A;  4NTA A;  3SEO A;  4Z9J A;  2D4U A;  3UMH A;  4AK9 A;  2J9V A;  3QVY A;  4NQF A;  1H7I A;  2EIN C;  4PR9 A;  1Q0D A;  3DM5 A;  1QSP A;  2LIG A;  2X0C A;  2QY9 A;  3ITF A;  1OQC A;  3Q6M A;  4DVZ A;  1OW6 A;  4HFK B;  1H6G A;  3C63 A;  1Z3I X;  2WZF A;  1VMA A;  1RXQ A;  1SF8 A;  2XLH A;  5AC5 A;  2A1D D;  4JZA A;  1JR8 A;  3EGX B;  1Q0G A;  1V4A A;  2IXM A;  3QW0 A;  2NUT A;  1K40 A;  1I4Y A;  3N24 A;  1J8Y F;  1FR0 A;  4OIN F;  1Z7Q c;  1HMO A;  1C17 M;  1OCR C;  3WG7 C;  3FMS A;  3RF3 A;  5A6A A;  1Y6D A;  3NKD A;  5DS6 A;  1OXB A;  5JS5 A;  2V3C C;  3SZR A;  4OIO F;  2J46 A;  2QTV A;  3EG9 B;  3I4U A;  4BEM J;  3TUL A;  1FTS A;  5BQI A;  2IYL D;  4CJG A;  2XLO A;  2XLV A;  1ZU5 A;  4L6R A;  5JRA A;  2R7S A;  3MLG A;  1OKK D;  4JVS A;  3PHF 2;  4JTA B;  1H9G A;  4CBE A;  2EPN A;  1T01 A;  2I15 A;  5E2Q A;  2PX3 A;  3ZQY A;  3LUT B;  3A11 A;  1XWJ A;  2IOQ A;  2LP4 A;  1BR4 A;  3PMR A;  3ECS A;  2YL3 A;  4E0H A;  3W4Y A;  4U9D A;  3F47 A;  2LQG A;  4C3E A;  4N6H A;  4NTF A;  3AG1 C;  4D4N A;  2BE5 F;  1ZU4 A;  2HZ8 A;  2VH3 A;  2X51 A;  4JEB A;  256B A;  5GPG B;  4IAR A;  4NCQ A;  1E83 A;  2OU6 A;  3IEE A;  2KC3 A;  4WJ0 A;  3V5Z A;  1I5N A;  2KNH A;  3EFO A;  1ZYR F;  3DAF A;  3Q7G A;  1EKY A;  5A6B D;  3U2M A;  3QZC A;  4DXW A;  1VYI A;  5KYY A;  4JIO A;  2VC9 A;  1QZX A;  3PDM P;  1KU2 A;  1EI7 A;  1PD1 A;  4P9F A;  4RDA A;  3TQO A;  4MW3 A;  3W8H A;  2HMZ A;  1TFO B;  2ZXR A;  4I3M A;  1LE2 A;  2EIL C;  3GM2 A;  4G7Z F;  2R03 A;  2HV6 A;  3PCV A;  4NTB A;  1A7V A;  1S05 A;  4OD5 A;  3H65 A;  1M2V A;  1TWC A;  3GOD A;  2YEV A;  3IQ5 A;  4XPY A;  3VAY A;  1NLX A;  3RQE A;  2KW3 C;  4EBB A;  1TR2 A;  3LNM B;  2CNW A;  2OKU A;  1VLS A;  3C8G D;  2XRH A;  3TJ6 A;  2Q9A A;  4YL1 A;  2JD3 A;  3RW0 A;  2VAS A;  1Z6A A;  1NU9 C;  2LK4 A;  2GWW A;  4I44 A;  4I1O B;  4LLC A;  3KPH A;  3U3B A;  3ZIB A;  5KYU B;  5AGF A;  2I8B A;  2LFD A;  2YRF A;  4J32 B;  4JEA A;  5T1D B;  3RKO F;  2F22 A;  4FAP B;  2GAQ A;  1UFB A;  3EHM A;  1LKX A;  3UNG C;  3HLZ A;  2R7Q A;  3EFO B;  3S90 A;  3RFY A;  3F46 A;  1RJ9 A;  3G4Z A;  2G62 A;  3IQT A;  3QVZ A;  3W8I A;  1MNE A;  4UDV A;  2EPL X;  3JYH A;  2OEV A;  2L9J A;  2KGO A;  2PX0 A;  5L3Q A;  2C04 A;  4IAQ A;  1O87 A;  3S29 A;  1NZE A;  2IXP A;  2OCC C;  2NUP A;  3B0U X;  4CS9 A;  2MHR A;  1HE1 A;  3CSK A;  3DM9 B;  2JX0 A;  3X1O A;  1R5I D;  2J0W A;  4IGG A;  5JSL A;  4DRJ B;  5A6K A;  1BBH A;  3AGT A;  1M2V B;  4MVS A;  5DS5 A;  3EH1 A;  4JKV A;  3ASO C;  1T6I A;  1ZHZ A;  4N6C A;  2EIK C;  2FGY A;  4NC3 A;  5L0J A;  1YYX A;  3T6G B;  3GEI A;  3TK0 A;  4ANJ A;  1FMV A;  3POV A;  2M64 A;  4U5D E;  4G78 A;  4XTK A;  5BQG A;  1F1M A;  1OCC C;  4CX9 A;  3UGP A;  1PD0 A;  3LNR A;  1MND A;  3B0P A;  4U5B E;  1FNT c;  3K1H A;  4YT5 A;  4YT2 A;  1NFO A;  2DI3 A;  2Q9B A;  3AG3 C;  1CPQ A;  2BC5 A;  2WVN A;  3NMK A;  5TJ5 E;  1HW1 A;  2W45 A;  5KYX A;  1A0B A;  2WZL A;  4RD9 A;  2YLI A;  1VTM P;  2O9X A;  3JYY A;  2BL2 A;  2J9U A;  2NSG A;  4U5F E;  5JUA A;  1D1B A;  1GS9 A;  1W2W A;  3K7D A;  4Z9I A;  2WVQ A;  3DAG A;  4PJN A;  4BG0 A;  3JRT A;  1A41 A;  1T6Q A;  1YAU O;  4LAC B;  4OD4 A;  1RKE A;  4MND A;  4EIY A;  4IB4 A;  5KYW A;  2L81 A;  3CZ6 A;  1N1C A;  2XS8 A;  3EHN A;  2XXA B;  3I5Q A;  2Q7R A;  3ABL C;  4B6I A;  3FHD A;  2NUP B;  3DJN B;  5E3C A;  3U8V A;  3AG2 C;  2HV7 A;  4IAO A;  1Y4C A;  2TMV P;  3R2P A;  4O6Y A;  5A69 A;  2OEX A;  3DE9 A;  1GM5 A;  2CDQ A;  4CDA A;  4FWV A;  2KYH A;  1VYK A;  2HSQ A;  2RSE B;  3LS1 A;  3W2V A;  4BJ6 C;  4Q4Z F;  1LS1 A;  2XL4 A;  2YKZ A;  3EGD A;  3ZSU A;  1ZVZ A;  1BR2 A;  4MVO A;  1TWG A;  5DS4 A;  3EPV A;  1M6T A;  1JAF A;  4C7O A;  3DD7 A;  3KYI A;  3US6 A;  2E87 A;  2H7B A; 
#chains in the Genus database with same CATH homology
 1LE4 A;  1EA8 A;  1LE2 A;  3R2P A;  1LPE A;  1EQ1 A;  1NFN A;  1NFO A;  1B68 A;  1YA9 A;  2KC3 A;  3S84 A;  1OR2 A;  1AEP A;  1LS4 A;  1GS9 A;  1BZ4 A;  1H7I A;  1OR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...