1OR3A

Apolipoprotein e3 (apoe3), trigonal truncation mutant 165
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
143
structure length
136
Chain Sequence
SGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational flexibility in the apolipoprotein E amino-terminal domain structure determined from three new crystal forms: implications for lipid binding.
pubmed rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords PROTEIN (APOLIPOPROTEIN E)
total genus 58
structure length 136
sequence length 143
ec nomenclature
pdb deposition date 1998-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1or3A00
3R2PA 1NFNA 1EQ1A 1NFOA 3S84A 1GS9A 1EA8A 1OR3A 2KC3A 1LE4A 1B68A 1YA9A 1LS4A 1LE2A 1LPEA 1H7IA 1OR2A 1BZ4A 1AEPA
chains in the Genus database with same CATH superfamily
3LEOA 2KYHA 2HV6A 3AG2C 4J7TA 3NKEA 3VAYA 3M4CA 5L3VA 4CSAC 5COMA 2L6GA 3CZ6A 3S9OA 1JMWA 5L3QA 4JURI 1Q0KA 4HEAJ 4N4WA 2A69F 1EQ1A 2AP3A 4KNWA 2XS1A 4EBJA 1XZPA 3DAFA 1NG1A 3JSEO 3ABLC 2CYDA 1ORSC 1M6TA 2J45A 2M64A 3S27A 1Q0FA 1E2XA 2XLMA 3JZ0A 3KL4A 1EA8A 4JVSA 4I44A 1ZHYA 3RYLA 2PX0A 2CDQA 1SR2A 1R5ID 1ZHWA 2P0NA 2XLDA 3HNLA 4N06A 4R32A 4WJ0A 1TFKB 4XPWA 3RKOF 3ZDLA 5T3TA 3C8GB 3W2WA 5L0GA 1ZU5A 4GQHA 4AX2A 3DD7A 1LI7A 4AE4A 2MYSA 2G3VA 1T6IA 2VH3A 1CPQA 2QE9A 5E2QA 3OA1A 3U0CA 4DBQA 1M56C 3DJUB 3ZTMA 1A41A 1YA7O 2EIKC 2DYSC 5KYYB 4HE8D 2I15A 3NMIA 4QI2A 2IBFA 2PFDA 3DI5A 1CPRA 4CS9C 2YKZA 1Y6DA 4G0HA 4FX5A 1G4WR 4CS7A 1MNDA 4O6MA 3OWTA 3SXMA 5DS4A 2OQMA 3L0IA 1I4ZA 3EPVA 4NTAA 4WABA 3W2VA 1SMYF 2HUJA 4KC9A 5B1AC 4BJ5A 4DRHB 2R7RA 1EKYA 3Q6MA 3FDQA 2GWWA 2W9YA 2LCHA 3SYNA 1LM3B 5KYXA 1XZQA 1YAUO 1MNEA 1BDJB 1Q0MA 3ECSA 4OD4A 4YT8A 1QZXA 1S7ZA 2P1AA 4H4KC 2J8WA 3R2PA 1T9KA 3PMRA 2LP4A 4QDLA 2C03A 3C62A 3NDBB 3DM5A 4JJFA 3FHDA 3GODA 3MYFA 1BR4A 1NU9C 3C8GA 5T1DB 5A6KA 5A6BA 1Z63A 1FMWA 2H7OA 3ABKC 3QVYA 5JVEA 2ASRA 2EPNA 4OIRF 1KU2A 2Q00A 1YARO 4MVMA 3K33A 1D0ZA 1IW7F 2DYRC 3Q7LA 2RSEB 4IARA 2O9XA 5KYNA 2R7TA 3HKKA 3K1HA 4ZLDA 3S84A 3H2UA 1EI7A 1LS4A 2NSFA 3FAJA 1K05A 2VB6A 2VCBA 3FVYA 1BR1A 1YYXA 4PR9A 3UGPA 5KYUB 3L8IA 4E7SA 2I8BA 2EIMC 3U9MA 3RQGA 2KSFA 3DE9A 2CW0F 3FMSA 1MMDA 5COFA 1V74B 3KYIA 4FWVA 4E18A 4EUKB 2B0JA 3ABMC 3HLZA 3S0XA 2XXAB 2Q9AA 3JRMO 1RJ9A 1LIHA 2OOCA 2CNWD 3B71A 3DWWA 1NBBA 2NUTA 1F1MA 4WGYA 1VYIA 2F22A 1C17M 1VOMA 3EGXB 2HMQA 4JC7A 3ZG1A 2YQYA 2ZPAA 2KJGA 1WTYA 4C3EA 3EFOA 3JYHA 4GEHA 2FFHA 2E87A 4IAQA 4LACB 4MW3A 3SXKA 3EGDB 3SEOA 1M2VA 4CDAA 4PJLA 1H9TA 3BRJA 3L8JA 5B3SC 2L6FA 3JSZA 2Q9CA 1YVIA 2J9VA 2DGJA 3F47A 1VB5A 1MQVA 1NU7D 5BQGA 3ZQYA 3JYYA 3PDMP 3UGOA 2HS5A 4IAOA 2L7AA 2J0XA 2TMVP 1GGQA 3DE8A 1T6QA 4JEBA 2HKVA 4G7ZF 5JUAA 1NLXA 5AGFA 2XLWA 4YT2A 3I5PA 1ORYA 1Y4CA 2FAPB 2J9WA 2AVKA 2OJED 2VC9A 2EIJC 2MWQA 4C3DA 4LLCA 2PX3A 1FTSA 1OW7A 1YA9A 3LNRA 3O55A 5DS6A 1AVOB 2XLEA 2V26A 2BE5F 3TK0A 2EPOA 3MFNA 1E86A 3M1CB 1Q0GA 3RF3A 3SXZA 3IQ6A 1Q0DA 2ZXPA 5FZTA 4O79A 1PCXA 3ZVRA 3SXYA 1NFNA 2B0HA 1OQCA 1A7DA 1XWJA 1O87A 2IM8A 5DLJA 3EZIA 2R7OA 2W4MA 1UG7A 1R4TA 3KH2A 4MVSA 4CDYA 1SF8A 4KBLA 4HFKB 1MMNA 4MVUA 4ULVA 4LDKA 2WVQA 2UUHA 3IHUA 3K66A 3K1IC 2A0UA 2G62A 3AGTA 4MVQA 2CNWA 4U9DA 2J0WA 1CGNA 1FNTc 1JAFA 2OU6A 4QI0A 3RH3A 2A1DD 5F28E 3S28A 2J7PA 3UNGC 1VTMP 4WGZA 4EWCA 2WVOA 4PK4A 1SYQA 3F46A 3JT1A 5L0IA 4MQ9F 3H2VA 3M15A 2WZLA 3VM6A 5CIVA 1OR3A 4IWBA 4OIOF 3R7CA 2HSBA 5IY5C 3CEXA 1VYKA 1GM5A 3NRHA 3NG1A 2Y39A 2HFIA 4BEMJ 4P9FA 1FMVA 4AL0A 2Q7RA 1PD0A 4ANJA 5FCLA 2NUPA 1UFBA 3TOLA 1B68A 5EHHA 2AWCA 2ZXOA 4UDVA 3EGXA 4NY3A 4J30B 4JCZA 3POVA 2R7VA 4EHPA 1Z5ZA 2QY9A 3FAPB 2R03A 3LESA 1ZU4A 3O39A 3K6BA 3KPHA 2G3KA 4IB4A 4W8KA 3NMKA 4AE4B 5BUOA 4JEAA 1HW2A 1E84A 2R7XA 2EINC 3BEHA 1A7EA 1O5HA 3C8GD 3EHNA 3IQ5A 3J06A 4Z9HA 5JP7A 2P6VA 2H8AA 2V3CC 3QZCA 4DVYP 4KI2A 1L3PA 1J8YF 2YZSA 2Q4FA 3UR3C 1HY5A 1TKNA 2Y69C 3U3FA 2XSEA 4D4NA 2KGOA 5KYWB 5K0IA 3NYJA 3V5YA 4PFPA 3I4UA 2IXNA 3NKDA 4K0DA 4LDQA 3ZIBA 4XTKA 2VASA 3FOPA 3LUTB 3HNKA 2Y3GA 3ATPA 1OCCC 1ZHXA 2ZD9A 3EH1A 4JRZA 4MTFA 1LS1A 1KTMA 3JRTA 3X1OA 4MVZA 4U5GA 3SZRA 4Z9IA 4AK9A 1RXQA 5JLIA 2HJMA 1APCA 1Z3IX 3AQCA 3JTLO 3O6XA 3KMIA 5DVWA 4BJTA 4EKWA 4P6IC 4HFFB 4U5BE 4XWJA 1OCZC 2D5RB 5L0FA 3LNMB 3VYWA 1U89A 4U5DE 3EHMA 2Z15A 2GA0A 3EH2A 2MHRA 3EZHA 4GYTA 3L1MA 4E0HA 3LS0A 2PP4A 2IXMA 4BEJA 2IXOA 4I3MA 2XRHA 4CS8C 5KYYA 4U5FE 4CBEA 1I5NA 3ZTZA 2YHSA 2R7WA 4IRUA 1G5ZA 2EPKX 2R9RB 3V5XA 2L6HA 1RKEA 1TWCA 2WL8A 3LEVA 2J9UA 2ZXWC 3C63A 2W45A 3W8HA 2X51A 1LKXA 1HW1A 2JX0A 2LFDA 1OR2A 1TWAA 1JRAA 3GEEA 3ZC4A 4JW1A 3SP1A 5EGYA 4BG0A 3S90A 2YVKA 1LE2A 1NZEA 3DM9B 3M4BA 4PFOA 3ZQVA 2XL4A 3SNHA 1TQGA 4Q5SF 1YZCA 2OCCC 2XL8A 4RBNA 1JR8A 1HE9A 1M2VB 1A7VA 3FOOA 4I1OB 3IQCA 3DZAA 4J32B 2XLVA 3OEOA 1FAPB 4MNDA 1DOVA 1H7IA 3T9OA 3B9QA 4B6IA 5L0DA 2EPLX 2XS8A 3RIPA 5HSWA 2AWYA 2HZ8A 1JOGA 1JPJA 3DAGA 3U2MA 4JKVA 2KQ9A 4PJJA 2R02A 1TFOB 4U5EE 5E3AA 3C18A 3G4XA 4MW8A 3V5ZA 3VF0A 1MMAA 1T5OA 1VMAA 3GANA 1RKEB 3LLKA 4DVZA 2W4BA 3LS1A 4K1OA 1LPEA 3WHNA 2P61A 1IZMA 1YDIA 2YL0A 3MBGA 5F5HA 5DQTA 1JPNA 1S05A 5A6AA 4P9TA 4PACA 4BJ6C 1LI5A 4O6YA 1H9GA 1QPUA 4PJNA 2Q9BA 2AU5A 4JIOA 4LDRA 1QSPA 5A69A 3U5SA 1RJ9B 2BL2A 1QVXA 4KNVA 1D0XA 1O3UA 1VLSA 2YLIA 1WWPA 3EQLF 1BZ4A 1ORJA 4O6NA 4PJMA 4J7YA 3IEEA 3K7DA 5HV9A 4IGGA 2KW3C 3N2ZB 3V7OA 1J8MF 4M63A 2HJ3A 2KC3A 1QKRA 2OKUA 4YT4A 2OJQA 1RKCA 3AQBA 1NFOA 3ASOC 1ZYRF 3LJBA 2VCCA 4K7BA 1OXKA 2XLHA 4DBRA 1Z23A 2JPUA 4OINF 4YWQA 1G4US 3K1IA 3EGDA 5KYWA 3E70C 4LERA 4E17A 1KNYA 4CS8A 3B0PA 2WB7A 3QW1A 4JE9A 2YL7A 2NSGA 5A6JA 4DRJB 5KYXB 4MTOA 1BBHA 3ZWIA 2Y3BA 4H54A 1K04A 1U6HA 4YL0A 4CIPA 2XL6A 2PF4E 3HJCA 4IJJA 1K40A 1Z6AA 3H65A 3I5QA 3AG1C 3B29A 4I1MA 4XEVA 3RFYA 3X2QC 2XLOA 4XQ1A 1GQAA 4C7OB 2PBEA 3T6JA 3FXHA 2NG1A 3QTHA 2NUPB 3JCUQ 5A6BD 1T6UA 2WZGA 3G4ZA 4XPXA 3ASNC 1GS9A 4MS2A 5JSLA 2FGYA 2GAQA 3PCVA 2IXPA 4RDAA 3W4YA 4OIQF 2M4EA 3N0TA 5T3WA 4JZAA 3T4RA 1E85A 4DRIB 2P7VA 2OG2A 1ZVZA 3E9VA 4D4XA 2YLDA 2J46A 1G8XA 4Q7CA 2X0CA 3PHF2 2HSQA 5DS5A 4CSAA 5F5FA 4MVRA 1RMVA 2NPUA 4DJ9A 256BA 2H7VC 2LD6A 3ZSUA 2D4UA 4YL3A 3G50A 3N24A 4N6HA 3RVYA 2YEVA 3T6BA 4E7ZA 3UMHA 4JCHA 4XPYA 2YL1A 1WGWA 3HTKC 3MX3A 2L9JA 4JTDB 3T6GB 5L0CA 3HNIA 2LFFA 4C7OA 3B0VC 2CCYA 2NUTB 3EJNA 1TWGA 1WOLA 2J7PD 1VK5A 3AOUA 3C7JA 3DKAA 1LE4A 4OIPF 2YLGA 2XM4A 3GORA 2A68F 2QUPA 3Q7GA 3IPMO 4NTBA 5CI8A 4YT5A 4EBBA 1U0BB 1WATA 4G7OF 3U8PA 2OEXA 3KKBA 1V4AA 4NCQA 4G78A 4XEFA 3HNJA 2C04A 4Q4ZF 4G7HF 5JS5A 1YLMA 4JTCB 3A11A 4JJGA 2H7BA 5JT4A 1OCRC 2WZFA 1M2OA 4CS9A 3IQTA 4EBKA 5D91A 5BQHA 3GM1A 3WG7C 1CGOA 4A2NB 1D0YA 1HE1A 4C3BA 1ZW3A 1DOWA 3GM3A 3WODF 1WN0A 3TJ5A 4YJWA 4U5CE 3C8ZA 4XLNF 3U3BA 1N1CA 1ZW2A 3RVZA 2A6EF 4U9EA 3RW0A 2XXAA 3GWLA 1T01A 2XM0A 4ONSA 3TQOA 4A4AA 1YJGA 1E83A 5JRAA 1TR2A 1W2WA 1A0BA 1ST6A 1TWHA 3TOMA 3UMIA 2GDCA 2ZXRA 3U8VA 3MYIA 2R7UA 1PD1A 2EPMX 4CX9A 5B1BC 3GWNA 2A0BA 4BJ1A 3DXJF 5AC5A 2IOQA 1H6GA 3AGUA 2EILC 4N6CA 2KK1A 5TJ5E 4OD5A 1CGME 1AUEA 1D1CA 3EG9B 1OXBA 2JD3A 2CGEA 1OW8A 3CQZA 4CJGA 3NMJA 1QLEC 4X0RA 3QVZA 2LSEA 1ZHZA 3WAQA 1OW6A 5CI9A 1C02A 2YRFA 1L7CA 5EK0A 5KYUA 3TJ6A 1HMDA 2VCAA 3AG3C 4FESA 1BR2A 4Z9JA 2ETSA 2A6HF 5GPGB 2HMZA 3L34A 2PNOA 2YWAA 3QW0A 4MTGA 3QMKA 4ER9A 3B0UX 4EIYA 5L0HA 2UUIA 3A9CA 4JTAB 1I4YA 3US6A 2LQGA 1RCPA 2QLAA 4F4BA 2L81A 2Y3DA 2KNHA 3VRCA 3W8IA 2R7SA 3NYMA 5D92A 1D1AA 1YYJA 4NQFA 4NTFA 4FAPB 1V54C 1ZHTA 2YL3A 2BC5A 5E3CA 4NC3A 1M57C 1YZAA 4BJ6A 4DOZA 3LAYA 3U2LA 4ZLCA 3Q6NA 5B3IA 4ULWA 3AJMA 2RD9A 3GM2A 2LIGA 5BQIA 4MVOA 3LLIA 4BPMA 1C03A 2OEVA 3EFOB 4CJOA 4YN0B 1LVKA 2QTVA 3RQFA 1D1BA 3KYJA 1Z7Qc 2J9BA 1PV3A 3TD7A 4E0IA 2HV7A 4LLEA 1WASA 4U5HA 3CAXA 4DXWA 2WVNA 1NSGB 3EG9A 2R05A 4XLPF 1SZIA 2DB4A 2Q3TA 1AEPA 3TULA 1V55C 2LK4A 4XEKA 3MLGA 4CDVA 4CIHA 3DJNB 4AL1A 5DQZA 1MMGA 3U9JA 4RD9A 1FFHA 3AG4C 3DMDA 3ITFA 3UMKA 2IYLD 5AC4A 3O10A 5E33A 3GEHA 3S29A 2R25A 2Y3HA 4O7GA 3RQEA 4L6RA 1OCOC 2GFHA 1OKKA 2QNLA 3CSKA 1FR0A 1HMOA 5COGA 1VLTA 3M79A 1OKKD 4W8PA 2ICWG 4BJ5C 5L0JA 2DI3A 4YK5A 1FFTC 1QQ3A 3NYLA 3GEIA 2R7QA 1ZZPA 4YL1A
chains in the Genus database with same CATH topology
3R2PA 1NFNA 1EQ1A 1NFOA 3S84A 1GS9A 1EA8A 1OR3A 2KC3A 1LE4A 1B68A 1YA9A 1LS4A 1LE2A 1LPEA 1H7IA 1OR2A 1BZ4A 1AEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R2P A;  1NFN A;  1EQ1 A;  1NFO A;  3S84 A;  1GS9 A;  1EA8 A;  1OR3 A;  2KC3 A;  1LE4 A;  1B68 A;  1YA9 A;  1LS4 A;  1LE2 A;  1LPE A;  1H7I A;  1OR2 A;  1BZ4 A;  1AEP A; 
#chains in the Genus database with same CATH topology
 3LEO A;  2KYH A;  2HV6 A;  3AG2 C;  4J7T A;  3NKE A;  3VAY A;  3M4C A;  5L3V A;  4CSA C;  5COM A;  2L6G A;  3CZ6 A;  3S9O A;  1JMW A;  5L3Q A;  4JUR I;  1Q0K A;  4HEA J;  4N4W A;  2A69 F;  1EQ1 A;  2AP3 A;  4KNW A;  2XS1 A;  4EBJ A;  1XZP A;  3DAF A;  1NG1 A;  3JSE O;  3ABL C;  2CYD A;  1ORS C;  1M6T A;  2J45 A;  2M64 A;  3S27 A;  1Q0F A;  1E2X A;  2XLM A;  3JZ0 A;  3KL4 A;  1EA8 A;  4JVS A;  4I44 A;  1ZHY A;  3RYL A;  2PX0 A;  2CDQ A;  1SR2 A;  1R5I D;  1ZHW A;  2P0N A;  2XLD A;  3HNL A;  4N06 A;  4R32 A;  4WJ0 A;  1TFK B;  4XPW A;  3RKO F;  3ZDL A;  5T3T A;  3C8G B;  3W2W A;  5L0G A;  1ZU5 A;  4GQH A;  4AX2 A;  3DD7 A;  1LI7 A;  4AE4 A;  2MYS A;  2G3V A;  1T6I A;  2VH3 A;  1CPQ A;  2QE9 A;  5E2Q A;  3OA1 A;  3U0C A;  4DBQ A;  1M56 C;  3DJU B;  3ZTM A;  1A41 A;  1YA7 O;  2EIK C;  2DYS C;  5KYY B;  4HE8 D;  2I15 A;  3NMI A;  4QI2 A;  2IBF A;  2PFD A;  3DI5 A;  1CPR A;  4CS9 C;  2YKZ A;  1Y6D A;  4G0H A;  4FX5 A;  1G4W R;  4CS7 A;  1MND A;  4O6M A;  3OWT A;  3SXM A;  5DS4 A;  2OQM A;  3L0I A;  1I4Z A;  3EPV A;  4NTA A;  4WAB A;  3W2V A;  1SMY F;  2HUJ A;  4KC9 A;  5B1A C;  4BJ5 A;  4DRH B;  2R7R A;  1EKY A;  3Q6M A;  3FDQ A;  2GWW A;  2W9Y A;  2LCH A;  3SYN A;  1LM3 B;  5KYX A;  1XZQ A;  1YAU O;  1MNE A;  1BDJ B;  1Q0M A;  3ECS A;  4OD4 A;  4YT8 A;  1QZX A;  1S7Z A;  2P1A A;  4H4K C;  2J8W A;  3R2P A;  1T9K A;  3PMR A;  2LP4 A;  4QDL A;  2C03 A;  3C62 A;  3NDB B;  3DM5 A;  4JJF A;  3FHD A;  3GOD A;  3MYF A;  1BR4 A;  1NU9 C;  3C8G A;  5T1D B;  5A6K A;  5A6B A;  1Z63 A;  1FMW A;  2H7O A;  3ABK C;  3QVY A;  5JVE A;  2ASR A;  2EPN A;  4OIR F;  1KU2 A;  2Q00 A;  1YAR O;  4MVM A;  3K33 A;  1D0Z A;  1IW7 F;  2DYR C;  3Q7L A;  2RSE B;  4IAR A;  2O9X A;  5KYN A;  2R7T A;  3HKK A;  3K1H A;  4ZLD A;  3S84 A;  3H2U A;  1EI7 A;  1LS4 A;  2NSF A;  3FAJ A;  1K05 A;  2VB6 A;  2VCB A;  3FVY A;  1BR1 A;  1YYX A;  4PR9 A;  3UGP A;  5KYU B;  3L8I A;  4E7S A;  2I8B A;  2EIM C;  3U9M A;  3RQG A;  2KSF A;  3DE9 A;  2CW0 F;  3FMS A;  1MMD A;  5COF A;  1V74 B;  3KYI A;  4FWV A;  4E18 A;  4EUK B;  2B0J A;  3ABM C;  3HLZ A;  3S0X A;  2XXA B;  2Q9A A;  3JRM O;  1RJ9 A;  1LIH A;  2OOC A;  2CNW D;  3B71 A;  3DWW A;  1NBB A;  2NUT A;  1F1M A;  4WGY A;  1VYI A;  2F22 A;  1C17 M;  1VOM A;  3EGX B;  2HMQ A;  4JC7 A;  3ZG1 A;  2YQY A;  2ZPA A;  2KJG A;  1WTY A;  4C3E A;  3EFO A;  3JYH A;  4GEH A;  2FFH A;  2E87 A;  4IAQ A;  4LAC B;  4MW3 A;  3SXK A;  3EGD B;  3SEO A;  1M2V A;  4CDA A;  4PJL A;  1H9T A;  3BRJ A;  3L8J A;  5B3S C;  2L6F A;  3JSZ A;  2Q9C A;  1YVI A;  2J9V A;  2DGJ A;  3F47 A;  1VB5 A;  1MQV A;  1NU7 D;  5BQG A;  3ZQY A;  3JYY A;  3PDM P;  3UGO A;  2HS5 A;  4IAO A;  2L7A A;  2J0X A;  2TMV P;  1GGQ A;  3DE8 A;  1T6Q A;  4JEB A;  2HKV A;  4G7Z F;  5JUA A;  1NLX A;  5AGF A;  2XLW A;  4YT2 A;  3I5P A;  1ORY A;  1Y4C A;  2FAP B;  2J9W A;  2AVK A;  2OJE D;  2VC9 A;  2EIJ C;  2MWQ A;  4C3D A;  4LLC A;  2PX3 A;  1FTS A;  1OW7 A;  1YA9 A;  3LNR A;  3O55 A;  5DS6 A;  1AVO B;  2XLE A;  2V26 A;  2BE5 F;  3TK0 A;  2EPO A;  3MFN A;  1E86 A;  3M1C B;  1Q0G A;  3RF3 A;  3SXZ A;  3IQ6 A;  1Q0D A;  2ZXP A;  5FZT A;  4O79 A;  1PCX A;  3ZVR A;  3SXY A;  1NFN A;  2B0H A;  1OQC A;  1A7D A;  1XWJ A;  1O87 A;  2IM8 A;  5DLJ A;  3EZI A;  2R7O A;  2W4M A;  1UG7 A;  1R4T A;  3KH2 A;  4MVS A;  4CDY A;  1SF8 A;  4KBL A;  4HFK B;  1MMN A;  4MVU A;  4ULV A;  4LDK A;  2WVQ A;  2UUH A;  3IHU A;  3K66 A;  3K1I C;  2A0U A;  2G62 A;  3AGT A;  4MVQ A;  2CNW A;  4U9D A;  2J0W A;  1CGN A;  1FNT c;  1JAF A;  2OU6 A;  4QI0 A;  3RH3 A;  2A1D D;  5F28 E;  3S28 A;  2J7P A;  3UNG C;  1VTM P;  4WGZ A;  4EWC A;  2WVO A;  4PK4 A;  1SYQ A;  3F46 A;  3JT1 A;  5L0I A;  4MQ9 F;  3H2V A;  3M15 A;  2WZL A;  3VM6 A;  5CIV A;  1OR3 A;  4IWB A;  4OIO F;  3R7C A;  2HSB A;  5IY5 C;  3CEX A;  1VYK A;  1GM5 A;  3NRH A;  3NG1 A;  2Y39 A;  2HFI A;  4BEM J;  4P9F A;  1FMV A;  4AL0 A;  2Q7R A;  1PD0 A;  4ANJ A;  5FCL A;  2NUP A;  1UFB A;  3TOL A;  1B68 A;  5EHH A;  2AWC A;  2ZXO A;  4UDV A;  3EGX A;  4NY3 A;  4J30 B;  4JCZ A;  3POV A;  2R7V A;  4EHP A;  1Z5Z A;  2QY9 A;  3FAP B;  2R03 A;  3LES A;  1ZU4 A;  3O39 A;  3K6B A;  3KPH A;  2G3K A;  4IB4 A;  4W8K A;  3NMK A;  4AE4 B;  5BUO A;  4JEA A;  1HW2 A;  1E84 A;  2R7X A;  2EIN C;  3BEH A;  1A7E A;  1O5H A;  3C8G D;  3EHN A;  3IQ5 A;  3J06 A;  4Z9H A;  5JP7 A;  2P6V A;  2H8A A;  2V3C C;  3QZC A;  4DVY P;  4KI2 A;  1L3P A;  1J8Y F;  2YZS A;  2Q4F A;  3UR3 C;  1HY5 A;  1TKN A;  2Y69 C;  3U3F A;  2XSE A;  4D4N A;  2KGO A;  5KYW B;  5K0I A;  3NYJ A;  3V5Y A;  4PFP A;  3I4U A;  2IXN A;  3NKD A;  4K0D A;  4LDQ A;  3ZIB A;  4XTK A;  2VAS A;  3FOP A;  3LUT B;  3HNK A;  2Y3G A;  3ATP A;  1OCC C;  1ZHX A;  2ZD9 A;  3EH1 A;  4JRZ A;  4MTF A;  1LS1 A;  1KTM A;  3JRT A;  3X1O A;  4MVZ A;  4U5G A;  3SZR A;  4Z9I A;  4AK9 A;  1RXQ A;  5JLI A;  2HJM A;  1APC A;  1Z3I X;  3AQC A;  3JTL O;  3O6X A;  3KMI A;  5DVW A;  4BJT A;  4EKW A;  4P6I C;  4HFF B;  4U5B E;  4XWJ A;  1OCZ C;  2D5R B;  5L0F A;  3LNM B;  3VYW A;  1U89 A;  4U5D E;  3EHM A;  2Z15 A;  2GA0 A;  3EH2 A;  2MHR A;  3EZH A;  4GYT A;  3L1M A;  4E0H A;  3LS0 A;  2PP4 A;  2IXM A;  4BEJ A;  2IXO A;  4I3M A;  2XRH A;  4CS8 C;  5KYY A;  4U5F E;  4CBE A;  1I5N A;  3ZTZ A;  2YHS A;  2R7W A;  4IRU A;  1G5Z A;  2EPK X;  2R9R B;  3V5X A;  2L6H A;  1RKE A;  1TWC A;  2WL8 A;  3LEV A;  2J9U A;  2ZXW C;  3C63 A;  2W45 A;  3W8H A;  2X51 A;  1LKX A;  1HW1 A;  2JX0 A;  2LFD A;  1OR2 A;  1TWA A;  1JRA A;  3GEE A;  3ZC4 A;  4JW1 A;  3SP1 A;  5EGY A;  4BG0 A;  3S90 A;  2YVK A;  1LE2 A;  1NZE A;  3DM9 B;  3M4B A;  4PFO A;  3ZQV A;  2XL4 A;  3SNH A;  1TQG A;  4Q5S F;  1YZC A;  2OCC C;  2XL8 A;  4RBN A;  1JR8 A;  1HE9 A;  1M2V B;  1A7V A;  3FOO A;  4I1O B;  3IQC A;  3DZA A;  4J32 B;  2XLV A;  3OEO A;  1FAP B;  4MND A;  1DOV A;  1H7I A;  3T9O A;  3B9Q A;  4B6I A;  5L0D A;  2EPL X;  2XS8 A;  3RIP A;  5HSW A;  2AWY A;  2HZ8 A;  1JOG A;  1JPJ A;  3DAG A;  3U2M A;  4JKV A;  2KQ9 A;  4PJJ A;  2R02 A;  1TFO B;  4U5E E;  5E3A A;  3C18 A;  3G4X A;  4MW8 A;  3V5Z A;  3VF0 A;  1MMA A;  1T5O A;  1VMA A;  3GAN A;  1RKE B;  3LLK A;  4DVZ A;  2W4B A;  3LS1 A;  4K1O A;  1LPE A;  3WHN A;  2P61 A;  1IZM A;  1YDI A;  2YL0 A;  3MBG A;  5F5H A;  5DQT A;  1JPN A;  1S05 A;  5A6A A;  4P9T A;  4PAC A;  4BJ6 C;  1LI5 A;  4O6Y A;  1H9G A;  1QPU A;  4PJN A;  2Q9B A;  2AU5 A;  4JIO A;  4LDR A;  1QSP A;  5A69 A;  3U5S A;  1RJ9 B;  2BL2 A;  1QVX A;  4KNV A;  1D0X A;  1O3U A;  1VLS A;  2YLI A;  1WWP A;  3EQL F;  1BZ4 A;  1ORJ A;  4O6N A;  4PJM A;  4J7Y A;  3IEE A;  3K7D A;  5HV9 A;  4IGG A;  2KW3 C;  3N2Z B;  3V7O A;  1J8M F;  4M63 A;  2HJ3 A;  2KC3 A;  1QKR A;  2OKU A;  4YT4 A;  2OJQ A;  1RKC A;  3AQB A;  1NFO A;  3ASO C;  1ZYR F;  3LJB A;  2VCC A;  4K7B A;  1OXK A;  2XLH A;  4DBR A;  1Z23 A;  2JPU A;  4OIN F;  4YWQ A;  1G4U S;  3K1I A;  3EGD A;  5KYW A;  3E70 C;  4LER A;  4E17 A;  1KNY A;  4CS8 A;  3B0P A;  2WB7 A;  3QW1 A;  4JE9 A;  2YL7 A;  2NSG A;  5A6J A;  4DRJ B;  5KYX B;  4MTO A;  1BBH A;  3ZWI A;  2Y3B A;  4H54 A;  1K04 A;  1U6H A;  4YL0 A;  4CIP A;  2XL6 A;  2PF4 E;  3HJC A;  4IJJ A;  1K40 A;  1Z6A A;  3H65 A;  3I5Q A;  3AG1 C;  3B29 A;  4I1M A;  4XEV A;  3RFY A;  3X2Q C;  2XLO A;  4XQ1 A;  1GQA A;  4C7O B;  2PBE A;  3T6J A;  3FXH A;  2NG1 A;  3QTH A;  2NUP B;  3JCU Q;  5A6B D;  1T6U A;  2WZG A;  3G4Z A;  4XPX A;  3ASN C;  1GS9 A;  4MS2 A;  5JSL A;  2FGY A;  2GAQ A;  3PCV A;  2IXP A;  4RDA A;  3W4Y A;  4OIQ F;  2M4E A;  3N0T A;  5T3W A;  4JZA A;  3T4R A;  1E85 A;  4DRI B;  2P7V A;  2OG2 A;  1ZVZ A;  3E9V A;  4D4X A;  2YLD A;  2J46 A;  1G8X A;  4Q7C A;  2X0C A;  3PHF 2;  2HSQ A;  5DS5 A;  4CSA A;  5F5F A;  4MVR A;  1RMV A;  2NPU A;  4DJ9 A;  256B A;  2H7V C;  2LD6 A;  3ZSU A;  2D4U A;  4YL3 A;  3G50 A;  3N24 A;  4N6H A;  3RVY A;  2YEV A;  3T6B A;  4E7Z A;  3UMH A;  4JCH A;  4XPY A;  2YL1 A;  1WGW A;  3HTK C;  3MX3 A;  2L9J A;  4JTD B;  3T6G B;  5L0C A;  3HNI A;  2LFF A;  4C7O A;  3B0V C;  2CCY A;  2NUT B;  3EJN A;  1TWG A;  1WOL A;  2J7P D;  1VK5 A;  3AOU A;  3C7J A;  3DKA A;  1LE4 A;  4OIP F;  2YLG A;  2XM4 A;  3GOR A;  2A68 F;  2QUP A;  3Q7G A;  3IPM O;  4NTB A;  5CI8 A;  4YT5 A;  4EBB A;  1U0B B;  1WAT A;  4G7O F;  3U8P A;  2OEX A;  3KKB A;  1V4A A;  4NCQ A;  4G78 A;  4XEF A;  3HNJ A;  2C04 A;  4Q4Z F;  4G7H F;  5JS5 A;  1YLM A;  4JTC B;  3A11 A;  4JJG A;  2H7B A;  5JT4 A;  1OCR C;  2WZF A;  1M2O A;  4CS9 A;  3IQT A;  4EBK A;  5D91 A;  5BQH A;  3GM1 A;  3WG7 C;  1CGO A;  4A2N B;  1D0Y A;  1HE1 A;  4C3B A;  1ZW3 A;  1DOW A;  3GM3 A;  3WOD F;  1WN0 A;  3TJ5 A;  4YJW A;  4U5C E;  3C8Z A;  4XLN F;  3U3B A;  1N1C A;  1ZW2 A;  3RVZ A;  2A6E F;  4U9E A;  3RW0 A;  2XXA A;  3GWL A;  1T01 A;  2XM0 A;  4ONS A;  3TQO A;  4A4A A;  1YJG A;  1E83 A;  5JRA A;  1TR2 A;  1W2W A;  1A0B A;  1ST6 A;  1TWH A;  3TOM A;  3UMI A;  2GDC A;  2ZXR A;  3U8V A;  3MYI A;  2R7U A;  1PD1 A;  2EPM X;  4CX9 A;  5B1B C;  3GWN A;  2A0B A;  4BJ1 A;  3DXJ F;  5AC5 A;  2IOQ A;  1H6G A;  3AGU A;  2EIL C;  4N6C A;  2KK1 A;  5TJ5 E;  4OD5 A;  1CGM E;  1AUE A;  1D1C A;  3EG9 B;  1OXB A;  2JD3 A;  2CGE A;  1OW8 A;  3CQZ A;  4CJG A;  3NMJ A;  1QLE C;  4X0R A;  3QVZ A;  2LSE A;  1ZHZ A;  3WAQ A;  1OW6 A;  5CI9 A;  1C02 A;  2YRF A;  1L7C A;  5EK0 A;  5KYU A;  3TJ6 A;  1HMD A;  2VCA A;  3AG3 C;  4FES A;  1BR2 A;  4Z9J A;  2ETS A;  2A6H F;  5GPG B;  2HMZ A;  3L34 A;  2PNO A;  2YWA A;  3QW0 A;  4MTG A;  3QMK A;  4ER9 A;  3B0U X;  4EIY A;  5L0H A;  2UUI A;  3A9C A;  4JTA B;  1I4Y A;  3US6 A;  2LQG A;  1RCP A;  2QLA A;  4F4B A;  2L81 A;  2Y3D A;  2KNH A;  3VRC A;  3W8I A;  2R7S A;  3NYM A;  5D92 A;  1D1A A;  1YYJ A;  4NQF A;  4NTF A;  4FAP B;  1V54 C;  1ZHT A;  2YL3 A;  2BC5 A;  5E3C A;  4NC3 A;  1M57 C;  1YZA A;  4BJ6 A;  4DOZ A;  3LAY A;  3U2L A;  4ZLC A;  3Q6N A;  5B3I A;  4ULW A;  3AJM A;  2RD9 A;  3GM2 A;  2LIG A;  5BQI A;  4MVO A;  3LLI A;  4BPM A;  1C03 A;  2OEV A;  3EFO B;  4CJO A;  4YN0 B;  1LVK A;  2QTV A;  3RQF A;  1D1B A;  3KYJ A;  1Z7Q c;  2J9B A;  1PV3 A;  3TD7 A;  4E0I A;  2HV7 A;  4LLE A;  1WAS A;  4U5H A;  3CAX A;  4DXW A;  2WVN A;  1NSG B;  3EG9 A;  2R05 A;  4XLP F;  1SZI A;  2DB4 A;  2Q3T A;  1AEP A;  3TUL A;  1V55 C;  2LK4 A;  4XEK A;  3MLG A;  4CDV A;  4CIH A;  3DJN B;  4AL1 A;  5DQZ A;  1MMG A;  3U9J A;  4RD9 A;  1FFH A;  3AG4 C;  3DMD A;  3ITF A;  3UMK A;  2IYL D;  5AC4 A;  3O10 A;  5E33 A;  3GEH A;  3S29 A;  2R25 A;  2Y3H A;  4O7G A;  3RQE A;  4L6R A;  1OCO C;  2GFH A;  1OKK A;  2QNL A;  3CSK A;  1FR0 A;  1HMO A;  5COG A;  1VLT A;  3M79 A;  1OKK D;  4W8P A;  2ICW G;  4BJ5 C;  5L0J A;  2DI3 A;  4YK5 A;  1FFT C;  1QQ3 A;  3NYL A;  3GEI A;  2R7Q A;  1ZZP A;  4YL1 A; 
#chains in the Genus database with same CATH homology
 3R2P A;  1NFN A;  1EQ1 A;  1NFO A;  3S84 A;  1GS9 A;  1EA8 A;  1OR3 A;  2KC3 A;  1LE4 A;  1B68 A;  1YA9 A;  1LS4 A;  1LE2 A;  1LPE A;  1H7I A;  1OR2 A;  1BZ4 A;  1AEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...