1OR3A

Apolipoprotein e3 (apoe3), trigonal truncation mutant 165
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
143
structure length
136
Chain Sequence
SGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords PROTEIN (APOLIPOPROTEIN E)
publication title Conformational flexibility in the apolipoprotein E amino-terminal domain structure determined from three new crystal forms: implications for lipid binding.
pubmed rcsb
source organism Homo sapiens
total genus 58
structure length 136
sequence length 143
ec nomenclature
pdb deposition date 1998-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1or3A00
1LS4A 1LE2A 1OR3A 3R2PA 1NFNA 1BZ4A 1NFOA 1B68A 1YA9A 1H7IA 3S84A 1AEPA 1EA8A 1EQ1A 1GS9A 2KC3A 1OR2A 1LE4A 1LPEA
chains in the Genus database with same CATH superfamily
2OU6A 2CGEA 2Q9BA 2VC9A 4YN0B 4KNWA 3DM9B 5L0GA 3I4UA 2Q9CA 2IOQA 2V3CC 5B3SC 4YL3A 3C18A 3UMIA 4DRIB 4Q5SF 2A6HF 2Y3HA 4U5GA 3TJ6A 3O39A 2IM8A 4JEBA 4YK5A 4OIOF 3RYLA 4E7ZA 2XL6A 3L34A 1UG7A 1M2VA 4DVZA 4DBRA 1PCXA 5KYNA 1E83A 2VASA 4AX2A 2A68F 5L0HA 2GA0A 4E18A 2FAPB 4Q7CA 2CDQA 3K66A 4EKWA 4GYTA 3B0UX 4ZLCA 1QVXA 3W8HA 1JOGA 3FMSA 3EGXA 2KQ9A 3PDMP 2P61A 1NU9C 1QKRA 2LFFA 4E0HA 2I15A 3J06A 4BG0A 1T6IA 2R7RA 5D91A 3B0VC 2OJED 1I4YA 1Q0GA 3C7JA 3V7OA 1YJGA 1Z23A 1ZU4A 2XLHA 4CS8A 5L0FA 1MNDA 2JPUA 2Y39A 3VRCA 1H9GA 1VK5A 2LP4A 2MHRA 4JTAB 1OCOC 2YKZA 4K0DA 4PR9A 5JSLA 5L0IA 2YZSA 5HV9A 3T6JA 4RBNA 3AGUA 1YAUO 3RIPA 1MNEA 3JRMO 3DD7A 1D0YA 2R03A 3U3FA 2YEVA 4O6YA 2XM0A 1HMDA 3K1IC 4CIPA 3EHNA 3F47A 4IB4A 2HJMA 4MVZA 3C8GA 1ZW3A 2L81A 2J9UA 4JEAA 1JPNA 3LJBA 4E7SA 2OJQA 2RD9A 3POVA 4D4XA 3EGDB 2CW0F 2BE5F 5E3AA 3KMIA 2J9WA 2NPUA 3T6BA 1YZCA 1N1CA 4JCHA 4ANJA 1TFOB 2XLDA 2VB6A 4CBEA 2G3KA 2OKUA 3MYIA 3O6XA 1K05A 1ZYRF 4IAOA 1A0BA 2O9XA 3B71A 3JSEO 2YLGA 5DS4A 2KNHA 4MVRA 1XZQA 3U3BA 2ZXPA 3S9OA 2GWWA 4U5DE 2R05A 2L6FA 4N06A 5JP7A 4K7BA 1GM5A 3C8GD 2M4EA 4LLEA 3DM5A 1O5HA 5CI9A 3TQOA 2QE9A 3SEOA 2YWAA 1LE4A 3KKBA 4IARA 4EUKB 2CNWA 3DE8A 4EBKA 1L7CA 1JRAA 2LFDA 3GM2A 3KH2A 1Q0MA 1CGME 4JRZA 3IQ5A 1SF8A 5L0DA 4OINF 2KK1A 4CS8C 1FFHA 1TWGA 4U5EE 4WJ0A 5B3IA 1XWJA 3JYHA 3B29A 4MVQA 3S29A 4MS2A 5A69A 4U9DA 4YT2A 1QPUA 5JLIA 5KYWB 2A6EF 1I5NA 1J8MF 2R9RB 3SXZA 1M56C 3LNMB 1OXKA 1HMOA 2HFIA 2C03A 3WAQA 4YT4A 3ABLC 2R7WA 3DXJF 256BA 2J0WA 1E86A 3EPVA 2HV7A 1W2WA 4ULVA 1Y4CA 3ZVRA 1MMGA 2WZFA 1LPEA 4OIRF 4PJNA 1LS4A 1CGNA 1RKCA 3TOMA 2BL2A 5L0JA 1WATA 4DJ9A 2J7PD 4PJMA 2LD6A 1LI5A 3A11A 1HY5A 3DZAA 3EHMA 4XWJA 2MWQA 4BEMJ 5CIVA 4OD4A 3CZ6A 4HFFB 3IQ6A 2EPMX 2HSBA 2L9JA 4EIYA 4AL0A 3EFOA 2KSFA 3SXKA 1RMVA 1G4US 2HV6A 3JTLO 2R25A 3MFNA 3WODF 3TULA 5TJ5E 2B0HA 3EZIA 1V74B 1A7EA 3Q7LA 1HE1A 1PD0A 1OKKA 1HW1A 3ITFA 3NG1A 1VLTA 4U9EA 1NLXA 2XM4A 3AG1C 3N24A 4M63A 2Y3DA 3NMJA 3N0TA 3I5QA 3V5XA 1E2XA 3X1OA 4FX5A 4X0RA 2LK4A 4ER9A 1AUEA 2ZXRA 3DAGA 3GEIA 1RJ9A 1Z6AA 2IYLD 2XXAB 2J9VA 2PFDA 2NSGA 4BJ6A 4O79A 3KPHA 1G4WR 2P6VA 4LERA 5AC5A 2ZXWC 2R02A 2HJ3A 1FR0A 5IY5C 4G7HF 1Z5ZA 4U5CE 3L8JA 4P9FA 5JRAA 4JTDB 4Z9JA 2OEVA 3ZG1A 3SNHA 4NTAA 1E85A 1U0BB 2VCBA 4CJOA 1E84A 4MW3A 4N4WA 3S84A 1MQVA 1OW6A 2B0JA 1AEPA 2VCCA 2WVNA 4LACB 1ZZPA 3OEOA 1MMAA 4W8PA 3CEXA 4FAPB 2DB4A 1YVIA 3LNRA 2KYHA 4FESA 5D92A 4XEKA 4J7TA 5KYWA 1T5OA 1VB5A 4JTCB 4LDKA 1G8XA 3HNLA 2R7QA 4NTFA 5EK0A 5L0CA 1QQ3A 3U5SA 4IJJA 1XZPA 3UNGC 1AVOB 1RCPA 3OA1A 4MTGA 1YARO 2G3VA 3GEEA 2NG1A 2DYRC 4I1MA 4JJFA 1S7ZA 4PFPA 2E87A 2W9YA 3RVYA 3Q6MA 3AQBA 5E33A 5L3QA 5COMA 1ZU5A 3H65A 1OW7A 1H6GA 4AE4B 5F5FA 2YQYA 1RKEB 1HE9A 2IBFA 3ATPA 3FHDA 3NMIA 4MTFA 4NY3A 3RQEA 4MVOA 1A7DA 1WN0A 3FXHA 1WGWA 4CIHA 3M4CA 3G4ZA 4YJWA 3DJUB 1A41A 2LSEA 2NUTA 5KYYA 2QY9A 2H7VC 2V26A 4G0HA 4XLNF 3GODA 3U8VA 3KYJA 5BQHA 4KC9A 3U0CA 2VCAA 3BEHA 2A0UA 3FAPB 1CPRA 2VH3A 1EQ1A 4JJGA 2NUPB 4XPXA 3IQTA 3S28A 3EG9B 1YYJA 4LDQA 1ZHTA 2YL3A 2EPOA 3AJMA 4O7GA 3W2VA 2ETSA 3AG4C 5FCLA 5HSWA 1OR3A 1TFKB 2HSQA 3QMKA 3R2PA 2F22A 2GFHA 1FMVA 2WVOA 3JCUQ 5KYUB 3AG3C 3K1HA 4BJ6C 1R4TA 1V55C 1C02A 3ABKC 1YYXA 3H2VA 4I44A 4BPMA 2A0BA 2RSEB 3IQCA 4YL1A 4W8KA 2YVKA 4CS7A 2Q4FA 1JAFA 3M79A 2L7AA 1BR4A 3GM1A 5DQZA 1O3UA 1SZIA 3FVYA 2PNOA 3FOPA 1ZW2A 2YLIA 2R7TA 2XLVA 2XS8A 2W45A 2X51A 4H54A 4MVSA 5DS6A 5JT4A 3HNIA 3GORA 2KC3A 1SMYF 2W4MA 4A4AA 4EBBA 3F46A 4MNDA 1Q0DA 3EZHA 1TWAA 2HS5A 3T4RA 3JRTA 1V54C 3LEOA 5BQIA 2IXMA 5BUOA 2P0NA 4K1OA 3Q7GA 4WGZA 3KL4A 4NQFA 4MVMA 1ZVZA 1SYQA 4BJ1A 4BJ5A 4XPYA 2G62A 4OIPF 2IXNA 2XS1A 1B68A 3CSKA 1K40A 3O55A 1DOWA 2GAQA 3QVYA 3UR3C 2R7OA 2J8WA 3ECSA 2PX0A 1T6QA 2AU5A 2X0CA 4G7ZF 4XLPF 5A6JA 3VF0A 1WOLA 3JSZA 2J9BA 5JVEA 1NG1A 5EHHA 1YZAA 1PV3A 2EPKX 2LIGA 4XEFA 3B9QA 2PX3A 1JR8A 3DI5A 4IRUA 2AVKA 4O6NA 3HLZA 1VTMP 4QI2A 1FAPB 2CNWD 3QZCA 2Q00A 1R5ID 3LUTB 3AG2C 3JZ0A 4WABA 5B1BC 1M2VB 3GWNA 3PHF2 4F4BA 2CCYA 3QTHA 4MW8A 3T6GB 5DS5A 1WASA 4U5FE 4GEHA 1Q0FA 1LVKA 1SR2A 4C7OB 3WHNA 3RFYA 2R7UA 3PCVA 3C8ZA 2XLEA 3GWLA 3EGXB 3EGDA 4DRHB 3EG9A 2OEXA 4U5HA 4Z9HA 3U9JA 3LEVA 4P6IC 2D4UA 3X2QC 2AWYA 2XLOA 1YLMA 5KYUA 4A2NB 2OQMA 1FNTc 3JT1A 1QSPA 1V4AA 3NKEA 2ZXOA 2Y3GA 4IGGA 2R7SA 1T9KA 1GS9A 4XQ1A 1ORYA 1OR2A 4RD9A 3ASNC 5T3TA 3MBGA 3HJCA 4N6HA 3ZTZA 4ONSA 4B6IA 3W8IA 1QLEC 3UGOA 4PJLA 2IXPA 2PP4A 4XPWA 4DRJB 2NSFA 4NC3A 1NFNA 1FTSA 4QDLA 4U5BE 1LI7A 4AL1A 1IW7F 2EILC 1OQCA 3C8GB 3LLIA 3S0XA 1NU7D 3GANA 4HEAJ 2EPLX 3RF3A 3LS0A 5JUAA 5BQGA 3KYIA 4BJ5C 3CQZA 3ZSUA 1T01A 3MX3A 4AK9A 3C63A 1ZHYA 2JD3A 3MLGA 4CJGA 2M64A 3ZQYA 2OG2A 4KBLA 3UGPA 2YRFA 3M15A 3G50A 1M57C 1OKKD 2YL7A 1D1BA 1MMDA 3QW0A 3ZTMA 2OCCC 2FFHA 1OXBA 2WL8A 2AP3A 3FDQA 1EA8A 2JX0A 5AGFA 2XL4A 1YA7O 2YLDA 4KNVA 4DOZA 2QTVA 3TOLA 3MYFA 1D0XA 2J46A 5COFA 3SZRA 1OCZC 1ZHWA 2LQGA 2H8AA 5DQTA 3DMDA 4WGYA 5T3WA 2YL0A 3TK0A 1NFOA 4PJJA 4CDVA 3PMRA 5KYXB 2EINC 2Y3BA 3H2UA 3HKKA 3L0IA 3U2LA 5A6BA 2XLMA 1H7IA 1LKXA 1VYKA 2H7BA 1GQAA 1ORSC 2HKVA 4P9TA 3EH2A 3V5ZA 1TR2A 4C7OA 1HW2A 3T9OA 3U9MA 1J8YF 2EIJC 3U8PA 4CSAA 1BR2A 1NSGB 1U6HA 1Q0KA 3W4YA 3DAFA 3S90A 3E70C 1L3PA 3VAYA 2ASRA 2KGOA 3EJNA 3M4BA 4MVUA 3UMHA 1KNYA 3RKOF 1ORJA 1OW8A 4J7YA 3E9VA 4HFKB 4JC7A 1RXQA 4DXWA 2W4BA 1VYIA 4EWCA 4CS9A 3B0PA 2XL8A 1BBHA 2C04A 2HZ8A 4JE9A 3ZQVA 4LLCA 3TD7A 4C3DA 2TMVP 5F28E 4UDVA 1FFTC 1BR1A 3LS1A 2MYSA 4I3MA 2ZD9A 4BEJA 5JS5A 3A9CA 5B1AC 3ZC4A 3AOUA 5COGA 4Q4ZF 3OWTA 3NRHA 4NCQA 4JZAA 4L6RA 1D1CA 3DE9A 5A6BD 3L8IA 4ULWA 1WTYA 2WZLA 1YA9A 2I8BA 2WB7A 3K7DA 2XXAA 2HMZA 1DOVA 2J0XA 3AQCA 1M2OA 3EH1A 2Q3TA 3W2WA 3NMKA 4G78A 4YT5A 4Z9IA 1S05A 2FGYA 1BDJB 3DWWA 4YWQA 2UUHA 2EPNA 3FAJA 3RQFA 3VYWA 5EGYA 3ASOC 4C3EA 1GGQA 1ZHZA 3EFOB 4CDAA 3K33A 3RH3A 4CX9A 1PD1A 4E17A 4J30B 3R7CA 2XSEA 1TQGA 3IPMO 3CAXA 4C3BA 2EIKC 5E3CA 2HMQA 2QUPA 2HUJA 1IZMA 4FWVA 4PACA 3RW0A 3ZWIA 5T1DB 1ZHXA 4CDYA 3ZIBA 1F1MA 3SYNA 1K04A 3C62A 4IWBA 3SXMA 3SP1A 2IXOA 1A7VA 3NYJA 4N6CA 1MMNA 2A69F 1TKNA 4BJTA 1D0ZA 1TWHA 5DLJA 2DYSC 2P1AA 4JURI 2UUIA 2A1DD 2XLWA 2R7XA 5GPGB 1JPJA 3AGTA 3G4XA 1RJ9B 2GDCA 1Z63A 5AC4A 4OIQF 3TJ5A 5KYXA 1C03A 2YL1A 4DBQA 1NZEA 1CPQA 4AE4A 1RKEA 2KW3C 2WZGA 4CSAC 4JVSA 4GQHA 1VMAA 3QVZA 4YL0A 1OCCC 2QNLA 1G5ZA 4EHPA 1LIHA 1QZXA 1U89A 3EQLF 2Q9AA 3NKDA 2R7VA 3LAYA 3HNJA 2LCHA 2J7PA 3N2ZB 4IAQA 4YT8A 4CS9C 4JIOA 1NBBA 3HNKA 5E2QA 2PF4E 1O87A 3O10A 3IHUA 2NUPA 2BC5A 3K6BA 4J32B 4PFOA 1CGOA 2QLAA 4G7OF 3RQGA 3L1MA 3HTKC 3DKAA 1ST6A 3NDBB 2CYDA 1YDIA 2KJGA 4R32A 2DGJA 2L6HA 2Z15A 4I1OB 2Y69C 3V5YA 4E0IA 4HE8D 5A6KA 3ABMC 2P7VA 4RDAA 4D4NA 4OD5A 1FMWA 1Z3IX 2WVQA 2L6GA 3DJNB 5L3VA 4NTBA 2Q7RA 4MQ9F 1T6UA 1TWCA 3NYMA 2PBEA 4PK4A 4KI2A 3UMKA 1M6TA 3QW1A 1LM3B 2AWCA 4JCZA 3SXYA 1LE2A 2YHSA 5DVWA 3LLKA 4H4KC 3RVZA 1KTMA 3GEHA 1KU2A 2D5RB 2NUTB 3GM3A 5KYYB 2OOCA 1C17M 1LS1A 3U2MA 1BZ4A 4O6MA 1VLSA 5CI8A 2H7OA 4LDRA 1I4ZA 3S27A 3IEEA 5K0IA 1EI7A 1Z7Qc 4MTOA 4XTKA 4JW1A 3K1IA 4QI0A 1UFBA 4ZLDA 3JYYA 3LESA 3Q6NA 5FZTA 1H9TA 1WWPA 4DVYP 2ICWG 2ZPAA 3US6A 3VM6A 2J45A 1EKYA 4EBJA 3NYLA 2EIMC 5F5HA 1D1AA 1OCRC 4XEVA 3I5PA 1VOMA 3M1CB 3ZDLA 5A6AA 3BRJA 1APCA 3FOOA 2XRHA 1JMWA 2DI3A 3WG7C 1Y6DA 4JKVA
chains in the Genus database with same CATH topology
1LS4A 1LE2A 1OR3A 3R2PA 1NFNA 1BZ4A 1NFOA 1B68A 1YA9A 1H7IA 3S84A 1AEPA 1EA8A 1EQ1A 1GS9A 2KC3A 1OR2A 1LE4A 1LPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LS4 A;  1LE2 A;  1OR3 A;  3R2P A;  1NFN A;  1BZ4 A;  1NFO A;  1B68 A;  1YA9 A;  1H7I A;  3S84 A;  1AEP A;  1EA8 A;  1EQ1 A;  1GS9 A;  2KC3 A;  1OR2 A;  1LE4 A;  1LPE A; 
#chains in the Genus database with same CATH topology
 2OU6 A;  2CGE A;  2Q9B A;  2VC9 A;  4YN0 B;  4KNW A;  3DM9 B;  5L0G A;  3I4U A;  2Q9C A;  2IOQ A;  2V3C C;  5B3S C;  4YL3 A;  3C18 A;  3UMI A;  4DRI B;  4Q5S F;  2A6H F;  2Y3H A;  4U5G A;  3TJ6 A;  3O39 A;  2IM8 A;  4JEB A;  4YK5 A;  4OIO F;  3RYL A;  4E7Z A;  2XL6 A;  3L34 A;  1UG7 A;  1M2V A;  4DVZ A;  4DBR A;  1PCX A;  5KYN A;  1E83 A;  2VAS A;  4AX2 A;  2A68 F;  5L0H A;  2GA0 A;  4E18 A;  2FAP B;  4Q7C A;  2CDQ A;  3K66 A;  4EKW A;  4GYT A;  3B0U X;  4ZLC A;  1QVX A;  3W8H A;  1JOG A;  3FMS A;  3EGX A;  2KQ9 A;  3PDM P;  2P61 A;  1NU9 C;  1QKR A;  2LFF A;  4E0H A;  2I15 A;  3J06 A;  4BG0 A;  1T6I A;  2R7R A;  5D91 A;  3B0V C;  2OJE D;  1I4Y A;  1Q0G A;  3C7J A;  3V7O A;  1YJG A;  1Z23 A;  1ZU4 A;  2XLH A;  4CS8 A;  5L0F A;  1MND A;  2JPU A;  2Y39 A;  3VRC A;  1H9G A;  1VK5 A;  2LP4 A;  2MHR A;  4JTA B;  1OCO C;  2YKZ A;  4K0D A;  4PR9 A;  5JSL A;  5L0I A;  2YZS A;  5HV9 A;  3T6J A;  4RBN A;  3AGU A;  1YAU O;  3RIP A;  1MNE A;  3JRM O;  3DD7 A;  1D0Y A;  2R03 A;  3U3F A;  2YEV A;  4O6Y A;  2XM0 A;  1HMD A;  3K1I C;  4CIP A;  3EHN A;  3F47 A;  4IB4 A;  2HJM A;  4MVZ A;  3C8G A;  1ZW3 A;  2L81 A;  2J9U A;  4JEA A;  1JPN A;  3LJB A;  4E7S A;  2OJQ A;  2RD9 A;  3POV A;  4D4X A;  3EGD B;  2CW0 F;  2BE5 F;  5E3A A;  3KMI A;  2J9W A;  2NPU A;  3T6B A;  1YZC A;  1N1C A;  4JCH A;  4ANJ A;  1TFO B;  2XLD A;  2VB6 A;  4CBE A;  2G3K A;  2OKU A;  3MYI A;  3O6X A;  1K05 A;  1ZYR F;  4IAO A;  1A0B A;  2O9X A;  3B71 A;  3JSE O;  2YLG A;  5DS4 A;  2KNH A;  4MVR A;  1XZQ A;  3U3B A;  2ZXP A;  3S9O A;  2GWW A;  4U5D E;  2R05 A;  2L6F A;  4N06 A;  5JP7 A;  4K7B A;  1GM5 A;  3C8G D;  2M4E A;  4LLE A;  3DM5 A;  1O5H A;  5CI9 A;  3TQO A;  2QE9 A;  3SEO A;  2YWA A;  1LE4 A;  3KKB A;  4IAR A;  4EUK B;  2CNW A;  3DE8 A;  4EBK A;  1L7C A;  1JRA A;  2LFD A;  3GM2 A;  3KH2 A;  1Q0M A;  1CGM E;  4JRZ A;  3IQ5 A;  1SF8 A;  5L0D A;  4OIN F;  2KK1 A;  4CS8 C;  1FFH A;  1TWG A;  4U5E E;  4WJ0 A;  5B3I A;  1XWJ A;  3JYH A;  3B29 A;  4MVQ A;  3S29 A;  4MS2 A;  5A69 A;  4U9D A;  4YT2 A;  1QPU A;  5JLI A;  5KYW B;  2A6E F;  1I5N A;  1J8M F;  2R9R B;  3SXZ A;  1M56 C;  3LNM B;  1OXK A;  1HMO A;  2HFI A;  2C03 A;  3WAQ A;  4YT4 A;  3ABL C;  2R7W A;  3DXJ F;  256B A;  2J0W A;  1E86 A;  3EPV A;  2HV7 A;  1W2W A;  4ULV A;  1Y4C A;  3ZVR A;  1MMG A;  2WZF A;  1LPE A;  4OIR F;  4PJN A;  1LS4 A;  1CGN A;  1RKC A;  3TOM A;  2BL2 A;  5L0J A;  1WAT A;  4DJ9 A;  2J7P D;  4PJM A;  2LD6 A;  1LI5 A;  3A11 A;  1HY5 A;  3DZA A;  3EHM A;  4XWJ A;  2MWQ A;  4BEM J;  5CIV A;  4OD4 A;  3CZ6 A;  4HFF B;  3IQ6 A;  2EPM X;  2HSB A;  2L9J A;  4EIY A;  4AL0 A;  3EFO A;  2KSF A;  3SXK A;  1RMV A;  1G4U S;  2HV6 A;  3JTL O;  2R25 A;  3MFN A;  3WOD F;  3TUL A;  5TJ5 E;  2B0H A;  3EZI A;  1V74 B;  1A7E A;  3Q7L A;  1HE1 A;  1PD0 A;  1OKK A;  1HW1 A;  3ITF A;  3NG1 A;  1VLT A;  4U9E A;  1NLX A;  2XM4 A;  3AG1 C;  3N24 A;  4M63 A;  2Y3D A;  3NMJ A;  3N0T A;  3I5Q A;  3V5X A;  1E2X A;  3X1O A;  4FX5 A;  4X0R A;  2LK4 A;  4ER9 A;  1AUE A;  2ZXR A;  3DAG A;  3GEI A;  1RJ9 A;  1Z6A A;  2IYL D;  2XXA B;  2J9V A;  2PFD A;  2NSG A;  4BJ6 A;  4O79 A;  3KPH A;  1G4W R;  2P6V A;  4LER A;  5AC5 A;  2ZXW C;  2R02 A;  2HJ3 A;  1FR0 A;  5IY5 C;  4G7H F;  1Z5Z A;  4U5C E;  3L8J A;  4P9F A;  5JRA A;  4JTD B;  4Z9J A;  2OEV A;  3ZG1 A;  3SNH A;  4NTA A;  1E85 A;  1U0B B;  2VCB A;  4CJO A;  1E84 A;  4MW3 A;  4N4W A;  3S84 A;  1MQV A;  1OW6 A;  2B0J A;  1AEP A;  2VCC A;  2WVN A;  4LAC B;  1ZZP A;  3OEO A;  1MMA A;  4W8P A;  3CEX A;  4FAP B;  2DB4 A;  1YVI A;  3LNR A;  2KYH A;  4FES A;  5D92 A;  4XEK A;  4J7T A;  5KYW A;  1T5O A;  1VB5 A;  4JTC B;  4LDK A;  1G8X A;  3HNL A;  2R7Q A;  4NTF A;  5EK0 A;  5L0C A;  1QQ3 A;  3U5S A;  4IJJ A;  1XZP A;  3UNG C;  1AVO B;  1RCP A;  3OA1 A;  4MTG A;  1YAR O;  2G3V A;  3GEE A;  2NG1 A;  2DYR C;  4I1M A;  4JJF A;  1S7Z A;  4PFP A;  2E87 A;  2W9Y A;  3RVY A;  3Q6M A;  3AQB A;  5E33 A;  5L3Q A;  5COM A;  1ZU5 A;  3H65 A;  1OW7 A;  1H6G A;  4AE4 B;  5F5F A;  2YQY A;  1RKE B;  1HE9 A;  2IBF A;  3ATP A;  3FHD A;  3NMI A;  4MTF A;  4NY3 A;  3RQE A;  4MVO A;  1A7D A;  1WN0 A;  3FXH A;  1WGW A;  4CIH A;  3M4C A;  3G4Z A;  4YJW A;  3DJU B;  1A41 A;  2LSE A;  2NUT A;  5KYY A;  2QY9 A;  2H7V C;  2V26 A;  4G0H A;  4XLN F;  3GOD A;  3U8V A;  3KYJ A;  5BQH A;  4KC9 A;  3U0C A;  2VCA A;  3BEH A;  2A0U A;  3FAP B;  1CPR A;  2VH3 A;  1EQ1 A;  4JJG A;  2NUP B;  4XPX A;  3IQT A;  3S28 A;  3EG9 B;  1YYJ A;  4LDQ A;  1ZHT A;  2YL3 A;  2EPO A;  3AJM A;  4O7G A;  3W2V A;  2ETS A;  3AG4 C;  5FCL A;  5HSW A;  1OR3 A;  1TFK B;  2HSQ A;  3QMK A;  3R2P A;  2F22 A;  2GFH A;  1FMV A;  2WVO A;  3JCU Q;  5KYU B;  3AG3 C;  3K1H A;  4BJ6 C;  1R4T A;  1V55 C;  1C02 A;  3ABK C;  1YYX A;  3H2V A;  4I44 A;  4BPM A;  2A0B A;  2RSE B;  3IQC A;  4YL1 A;  4W8K A;  2YVK A;  4CS7 A;  2Q4F A;  1JAF A;  3M79 A;  2L7A A;  1BR4 A;  3GM1 A;  5DQZ A;  1O3U A;  1SZI A;  3FVY A;  2PNO A;  3FOP A;  1ZW2 A;  2YLI A;  2R7T A;  2XLV A;  2XS8 A;  2W45 A;  2X51 A;  4H54 A;  4MVS A;  5DS6 A;  5JT4 A;  3HNI A;  3GOR A;  2KC3 A;  1SMY F;  2W4M A;  4A4A A;  4EBB A;  3F46 A;  4MND A;  1Q0D A;  3EZH A;  1TWA A;  2HS5 A;  3T4R A;  3JRT A;  1V54 C;  3LEO A;  5BQI A;  2IXM A;  5BUO A;  2P0N A;  4K1O A;  3Q7G A;  4WGZ A;  3KL4 A;  4NQF A;  4MVM A;  1ZVZ A;  1SYQ A;  4BJ1 A;  4BJ5 A;  4XPY A;  2G62 A;  4OIP F;  2IXN A;  2XS1 A;  1B68 A;  3CSK A;  1K40 A;  3O55 A;  1DOW A;  2GAQ A;  3QVY A;  3UR3 C;  2R7O A;  2J8W A;  3ECS A;  2PX0 A;  1T6Q A;  2AU5 A;  2X0C A;  4G7Z F;  4XLP F;  5A6J A;  3VF0 A;  1WOL A;  3JSZ A;  2J9B A;  5JVE A;  1NG1 A;  5EHH A;  1YZA A;  1PV3 A;  2EPK X;  2LIG A;  4XEF A;  3B9Q A;  2PX3 A;  1JR8 A;  3DI5 A;  4IRU A;  2AVK A;  4O6N A;  3HLZ A;  1VTM P;  4QI2 A;  1FAP B;  2CNW D;  3QZC A;  2Q00 A;  1R5I D;  3LUT B;  3AG2 C;  3JZ0 A;  4WAB A;  5B1B C;  1M2V B;  3GWN A;  3PHF 2;  4F4B A;  2CCY A;  3QTH A;  4MW8 A;  3T6G B;  5DS5 A;  1WAS A;  4U5F E;  4GEH A;  1Q0F A;  1LVK A;  1SR2 A;  4C7O B;  3WHN A;  3RFY A;  2R7U A;  3PCV A;  3C8Z A;  2XLE A;  3GWL A;  3EGX B;  3EGD A;  4DRH B;  3EG9 A;  2OEX A;  4U5H A;  4Z9H A;  3U9J A;  3LEV A;  4P6I C;  2D4U A;  3X2Q C;  2AWY A;  2XLO A;  1YLM A;  5KYU A;  4A2N B;  2OQM A;  1FNT c;  3JT1 A;  1QSP A;  1V4A A;  3NKE A;  2ZXO A;  2Y3G A;  4IGG A;  2R7S A;  1T9K A;  1GS9 A;  4XQ1 A;  1ORY A;  1OR2 A;  4RD9 A;  3ASN C;  5T3T A;  3MBG A;  3HJC A;  4N6H A;  3ZTZ A;  4ONS A;  4B6I A;  3W8I A;  1QLE C;  3UGO A;  4PJL A;  2IXP A;  2PP4 A;  4XPW A;  4DRJ B;  2NSF A;  4NC3 A;  1NFN A;  1FTS A;  4QDL A;  4U5B E;  1LI7 A;  4AL1 A;  1IW7 F;  2EIL C;  1OQC A;  3C8G B;  3LLI A;  3S0X A;  1NU7 D;  3GAN A;  4HEA J;  2EPL X;  3RF3 A;  3LS0 A;  5JUA A;  5BQG A;  3KYI A;  4BJ5 C;  3CQZ A;  3ZSU A;  1T01 A;  3MX3 A;  4AK9 A;  3C63 A;  1ZHY A;  2JD3 A;  3MLG A;  4CJG A;  2M64 A;  3ZQY A;  2OG2 A;  4KBL A;  3UGP A;  2YRF A;  3M15 A;  3G50 A;  1M57 C;  1OKK D;  2YL7 A;  1D1B A;  1MMD A;  3QW0 A;  3ZTM A;  2OCC C;  2FFH A;  1OXB A;  2WL8 A;  2AP3 A;  3FDQ A;  1EA8 A;  2JX0 A;  5AGF A;  2XL4 A;  1YA7 O;  2YLD A;  4KNV A;  4DOZ A;  2QTV A;  3TOL A;  3MYF A;  1D0X A;  2J46 A;  5COF A;  3SZR A;  1OCZ C;  1ZHW A;  2LQG A;  2H8A A;  5DQT A;  3DMD A;  4WGY A;  5T3W A;  2YL0 A;  3TK0 A;  1NFO A;  4PJJ A;  4CDV A;  3PMR A;  5KYX B;  2EIN C;  2Y3B A;  3H2U A;  3HKK A;  3L0I A;  3U2L A;  5A6B A;  2XLM A;  1H7I A;  1LKX A;  1VYK A;  2H7B A;  1GQA A;  1ORS C;  2HKV A;  4P9T A;  3EH2 A;  3V5Z A;  1TR2 A;  4C7O A;  1HW2 A;  3T9O A;  3U9M A;  1J8Y F;  2EIJ C;  3U8P A;  4CSA A;  1BR2 A;  1NSG B;  1U6H A;  1Q0K A;  3W4Y A;  3DAF A;  3S90 A;  3E70 C;  1L3P A;  3VAY A;  2ASR A;  2KGO A;  3EJN A;  3M4B A;  4MVU A;  3UMH A;  1KNY A;  3RKO F;  1ORJ A;  1OW8 A;  4J7Y A;  3E9V A;  4HFK B;  4JC7 A;  1RXQ A;  4DXW A;  2W4B A;  1VYI A;  4EWC A;  4CS9 A;  3B0P A;  2XL8 A;  1BBH A;  2C04 A;  2HZ8 A;  4JE9 A;  3ZQV A;  4LLC A;  3TD7 A;  4C3D A;  2TMV P;  5F28 E;  4UDV A;  1FFT C;  1BR1 A;  3LS1 A;  2MYS A;  4I3M A;  2ZD9 A;  4BEJ A;  5JS5 A;  3A9C A;  5B1A C;  3ZC4 A;  3AOU A;  5COG A;  4Q4Z F;  3OWT A;  3NRH A;  4NCQ A;  4JZA A;  4L6R A;  1D1C A;  3DE9 A;  5A6B D;  3L8I A;  4ULW A;  1WTY A;  2WZL A;  1YA9 A;  2I8B A;  2WB7 A;  3K7D A;  2XXA A;  2HMZ A;  1DOV A;  2J0X A;  3AQC A;  1M2O A;  3EH1 A;  2Q3T A;  3W2W A;  3NMK A;  4G78 A;  4YT5 A;  4Z9I A;  1S05 A;  2FGY A;  1BDJ B;  3DWW A;  4YWQ A;  2UUH A;  2EPN A;  3FAJ A;  3RQF A;  3VYW A;  5EGY A;  3ASO C;  4C3E A;  1GGQ A;  1ZHZ A;  3EFO B;  4CDA A;  3K33 A;  3RH3 A;  4CX9 A;  1PD1 A;  4E17 A;  4J30 B;  3R7C A;  2XSE A;  1TQG A;  3IPM O;  3CAX A;  4C3B A;  2EIK C;  5E3C A;  2HMQ A;  2QUP A;  2HUJ A;  1IZM A;  4FWV A;  4PAC A;  3RW0 A;  3ZWI A;  5T1D B;  1ZHX A;  4CDY A;  3ZIB A;  1F1M A;  3SYN A;  1K04 A;  3C62 A;  4IWB A;  3SXM A;  3SP1 A;  2IXO A;  1A7V A;  3NYJ A;  4N6C A;  1MMN A;  2A69 F;  1TKN A;  4BJT A;  1D0Z A;  1TWH A;  5DLJ A;  2DYS C;  2P1A A;  4JUR I;  2UUI A;  2A1D D;  2XLW A;  2R7X A;  5GPG B;  1JPJ A;  3AGT A;  3G4X A;  1RJ9 B;  2GDC A;  1Z63 A;  5AC4 A;  4OIQ F;  3TJ5 A;  5KYX A;  1C03 A;  2YL1 A;  4DBQ A;  1NZE A;  1CPQ A;  4AE4 A;  1RKE A;  2KW3 C;  2WZG A;  4CSA C;  4JVS A;  4GQH A;  1VMA A;  3QVZ A;  4YL0 A;  1OCC C;  2QNL A;  1G5Z A;  4EHP A;  1LIH A;  1QZX A;  1U89 A;  3EQL F;  2Q9A A;  3NKD A;  2R7V A;  3LAY A;  3HNJ A;  2LCH A;  2J7P A;  3N2Z B;  4IAQ A;  4YT8 A;  4CS9 C;  4JIO A;  1NBB A;  3HNK A;  5E2Q A;  2PF4 E;  1O87 A;  3O10 A;  3IHU A;  2NUP A;  2BC5 A;  3K6B A;  4J32 B;  4PFO A;  1CGO A;  2QLA A;  4G7O F;  3RQG A;  3L1M A;  3HTK C;  3DKA A;  1ST6 A;  3NDB B;  2CYD A;  1YDI A;  2KJG A;  4R32 A;  2DGJ A;  2L6H A;  2Z15 A;  4I1O B;  2Y69 C;  3V5Y A;  4E0I A;  4HE8 D;  5A6K A;  3ABM C;  2P7V A;  4RDA A;  4D4N A;  4OD5 A;  1FMW A;  1Z3I X;  2WVQ A;  2L6G A;  3DJN B;  5L3V A;  4NTB A;  2Q7R A;  4MQ9 F;  1T6U A;  1TWC A;  3NYM A;  2PBE A;  4PK4 A;  4KI2 A;  3UMK A;  1M6T A;  3QW1 A;  1LM3 B;  2AWC A;  4JCZ A;  3SXY A;  1LE2 A;  2YHS A;  5DVW A;  3LLK A;  4H4K C;  3RVZ A;  1KTM A;  3GEH A;  1KU2 A;  2D5R B;  2NUT B;  3GM3 A;  5KYY B;  2OOC A;  1C17 M;  1LS1 A;  3U2M A;  1BZ4 A;  4O6M A;  1VLS A;  5CI8 A;  2H7O A;  4LDR A;  1I4Z A;  3S27 A;  3IEE A;  5K0I A;  1EI7 A;  1Z7Q c;  4MTO A;  4XTK A;  4JW1 A;  3K1I A;  4QI0 A;  1UFB A;  4ZLD A;  3JYY A;  3LES A;  3Q6N A;  5FZT A;  1H9T A;  1WWP A;  4DVY P;  2ICW G;  2ZPA A;  3US6 A;  3VM6 A;  2J45 A;  1EKY A;  4EBJ A;  3NYL A;  2EIM C;  5F5H A;  1D1A A;  1OCR C;  4XEV A;  3I5P A;  1VOM A;  3M1C B;  3ZDL A;  5A6A A;  3BRJ A;  1APC A;  3FOO A;  2XRH A;  1JMW A;  2DI3 A;  3WG7 C;  1Y6D A;  4JKV A; 
#chains in the Genus database with same CATH homology
 1LS4 A;  1LE2 A;  1OR3 A;  3R2P A;  1NFN A;  1BZ4 A;  1NFO A;  1B68 A;  1YA9 A;  1H7I A;  3S84 A;  1AEP A;  1EA8 A;  1EQ1 A;  1GS9 A;  2KC3 A;  1OR2 A;  1LE4 A;  1LPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...