1OW8A

Paxillin ld2 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Molecular Recognition of Paxillin LD Motifs by the Focal Adhesion Targeting Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 60
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow8A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow8A02
3JZ0A 1OW6A 1WOLA 1K04A 1V4AA 5F28E 4EBKA 1OW8A 2L6HA 3O10A 4XEVA 3BRJA 1JOGA 3AE9C 3AECC 3C8GD 4NQFA 4YXDC 1KNYA 1WWPA 3AE3C 3ABVC 3U3FA 3AEEC 3AE5C 1QVXA 4XEFA 1K40A 1OW7A 3AE6C 3B71A 4R32A 3RQFA 1WTYA 3K7DA 3JYYA 3C8GA 3AEAC 3S9OA 4XEKA 3AEGC 1ZZPA 3C8GB 1ZP0C 4YTPC 3SFEC 3C18A 3U0CA 3TULA 1KTMA 3AEDC 2H88C 1K05A 1UFBA 1ZOYC 2L6FA 2PBEA 3SFDC 4EBJA 3AE7C 2L6GA 1YQ4C 3AEBC 2LK4A 3AE4C 2KK1A 3RQEA 3AE8C 3RQGA 3GM2A 2JPUA 2Q00A 3AJMA 2H89C 2JX0A 2HSBA 3AEFC 3GM1A 3L8JA 1PV3A 2WQYC 2FBWC 1YQ3C 3L8IA 3AE1C 3GM3A 2YWAA 2G3AA 1O3UA 3MFNA 3AE2C
chains in the Genus database with same CATH superfamily
5M1BA 3QTHA 4LLHA 3D70A 4H4KC 1QEXA 1WOLA 1YTZI 1OW8A 2E75B 3F46A 1UG7A 2YO3A 3V4QA 3VMAA 3I4UA 1NTMD 1FZFA 5DQTA 1JTHA 2XLVA 2YVKA 2G3KA 2JWAA 5KLVD 1AQTA 2FAPB 3IAOA 4XLPF 1NYHA 1QVFO 5CBNA 4P9TA 2KB7P 1TU3F 3M1CB 3MBGA 1FZEA 1TWAA 3V5ZA 3RH3A 1JEKA 1ZMEC 5KYUA 3CWBJ 1TR2A 4Z9JA 2OCCC 1BE3G 4A4AA 5K0IA 3IQCA 3KYIA 3DJUB 2YMYA 3W8HA 1ZLLA 3F47A 1RCPA 4JZAA 4GEHA 3RVZA 3Q3DA 2Q1KA 4PD4H 3EQLF 2ZT9C 1ZZPA 3L73E 4E0IA 2Q3EA 1YZAA 2J0XA 2PP4A 3U8VA 1I5NA 5AVRB 2Y3BA 2OTLP 4EYYQ 2IXMA 4K3AA 3GWLA 1N7LA 4JC7A 4K0DA 1I4YA 4WGZA 1JY2O 1XTGB 4IFDK 3T6JA 2WSCH 4H44C 1YLMA 2W45A 2PBEA 4EBJA 3AE7C 3V2RA 2DB4A 5D92A 2P67A 1L0NK 4ASWA 2KK1A 4XQ1A 1FZCB 1FZBA 1ZXGA 4I2LC 2Y3DA 2NPSD 1VL2A 1SQXD 2WTYA 3EZIA 1OFCX 4A7PA 3L72J 2KP8A 4PV1C 2O01J 3WAQA 2L9JA 2E75D 5GTHH 1QX8A 2WSEH 3FGAD 1FDOA 2J0WA 1G4US 2R7UA 2QE7H 2H8AA 1AVYA 1DEEG 3L8JA 3O6XA 2YNYA 2FBWC 1T2KC 3SNHA 2FFHA 3NKDA 2ZD9A 1GL2C 1SQQK 3VN0A 1FTSA 1L0NG 1M1JB 5KYYA 2K9YA 1JCDA 3BCCG 3FX0A 4B86A 2KS1A 5TJ5E 1PP9D 1L4AA 2WVQA 4DJ9A 1SFCC 2OARA 2MWQA 3KH2A 2YKOA 3O6QB 3O55A 4YT8A 2BASA 2I8BA 3OWTA 1P84H 3FWNA 2HMQA 1FMVA 3AG3C 4U9DA 3JRTA 1SQVK 3SEOA 1Q2NA 1UIIA 3JRMO 2PRRA 5B1BC 2HKVA 4GODA 1H9GA 2YKZA 1YDIA 5APTA 1E79H 1NBBA 4AL1A 1SQQG 1IFMA 4M3LA 4XE5B 1FOSE 1G5ZA 1KNYA 2J45A 2YKQA 3M79A 3TNUB 2C0XA 1OVRA 1Z6AA 4C3BA 1Z7Qc 1NO4A 3V2QA 5GPGB 2BCCJ 4C7RA 2QNLA 1OCCC 3H2VA 1FJPA 4AX2A 1P84I 1SQVG 4BJ5A 1FR0A 3ZC4A 1DD4A 2KUBA 1SQPJ 3JYYA 3EHNA 1AV1A 1A41A 5AVVB 4MNDA 1KB9H 1YI2P 1LJ2A 3N2ZB 1IK9A 2ZT9B 4MTGA 1EZVD 3H1LD 2R7WA 2FXOA 1Y8AA 3L74E 1NTKD 1MMNA 3NYLA 1X0TA 4TLFA 1ZOYC 2Q9CA 2L6FA 2D2CD 2J46A 3GEIA 4D6TE 2P10A 3L71D 3U1AA 4H44B 3T97B 1KFMA 1Y4CA 4W8PA 2DI3A 1WRGA 3CZ6A 3VYIA 1NU1J 5TISH 1IFDA 2B87A 1L7CA 2YL0A 2X51A 3B5NC 2KXPB 4L74A 1URQC 1Q0KA 1M7LA 2OEVA 4JEBA 2JO1A 2M5AB 2HG5D 3L70J 3H2UA 2A6HF 1SR2A 4LLEA 4C7OB 5BUOA 2HSBA 4XA4A 3V2NA 3Q5PA 3JC22 3L72D 4EUKB 3CXHE 3H1IJ 4HYTB 3DM9B 3NRHA 3VMXA 4QMAA 3TOMA 1YJGA 1SP4A 4K7BA 1SQBJ 3WU2E 2KLVA 2R32A 3WUTA 2M64A 4BPMA 1NVOA 2H7VC 4P9FA 1KILC 2JR8A 1GS9A 1IZMA 2XM0A 5B3IA 1BCCG 4J7TA 1ZW0A 4C7NA 2QJKB 1L4AC 3JCUE 3VTPC 1OKKA 3LIEA 3TSIA 4UB8H 1NFOA 4WBAA 4HFKB 4OIQF 1HH0A 5APQA 4JJGA 3A9CA 1V4AA 3H1JJ 1NJIQ 2R02A 2XLDA 5KAIE 5BVZA 2HFIA 2YZSA 1DD3A 5EHHA 1NTZJ 2L81A 2NSFA 3ECSA 3JSVC 1FC2C 2ZT9D 1LKXA 2Q4FA 1JTHB 2IBZE 1Q7YQ 1BR2A 3KL4A 1TQGA 2ITAA 5AGFA 4G78A 1J1DC 3CCQP 4MVMA 4YK5A 1KU2A 3CEXA 3L75G 4H44D 3V5XA 4DVZA 1LTBC 3FXEA 4G7HF 2XLMA 4I3MA 5KYUB 4BJ5C 3M4BA 3KYJA 3HTKA 2R7OA 3C8GA 4NTAA 3SXYA 2O1JA 1ZYRF 1YARO 2OQMA 1NLXA 5JSLA 4O79A 1ZHYA 3GHGA 2FGYA 4LACB 2EIJC 4PV1D 2Q7RA 2E74B 4OD5A 1TFKB 3MUDC 2CK3H 4EHPA 3L70E 1S72P 2AXTE 4G7ZF 1T2KD 2KZJA 1LWUC 1PPJG 3EFOA 1KYOD 3EWKA 3VMYA 3DD7A 3RQGA 1W5CE 2HFED 1SFCD 1NKZB 3OAKA 2WZFA 1GM5A 3TDKA 1Z56A 1JMMA 2XKMA 1YHQP 1NOHA 1EQ1A 4U5CE 5BU8B 2W6AA 2B9BA 1LS1A 4JRZA 4K1OA 4JTCB 3TYYA 1VQPP 2TMVP 2OYHA 1DOVA 4JTDB 1XTCC 2DW3A 1IK7A 1T6UA 2C04A 4JKVA 3A2AA 1D0ZA 3NDBB 1IZNB 5KYYB 2PX3A 3TGUD 3ITKA 2KS1B 1L4AB 4OGQB 3EJNA 2P1JA 2MHRA 1EXIA 2R7TA 5KJ7C 3DAFA 3H1KJ 2QJPC 2HJ3A 3L73G 4LC1A 5COGA 3KKBA 2A0BA 1PD0A 3QMKA 2GUVA 2XNXA 2Z4EA 5A6JA 3IQTA 3E70C 4PJNA 1N2DC 4YXDC 1JMBA 1FBMA 4CSAA 2XZRA 2LFFA 3ABVC 4GYTA 3GANA 4GKGA 1T6IA 4CS8C 3N7NA 1IW7F 1SS1A 1LTJA 1BE3D 1J1EB 3TQOA 4MTFA 1BGYJ 2WZ7A 1L0LJ 2M4EA 3R4YA 2A1DD 2KK7A 3B5ND 1G8XA 1URQD 2XM4A 3GHGC 5CHXA 3NKEA 5APXA 3C18A 4EIJA 2OJQA 1UIXA 3AEDC 4LGDE 3RYLA 3TOLA 1GGQA 1OCOC 3RK3E 2ETSA 3FOPA 4AYCA 5T1DB 3A5TA 1A02J 3MIWA 2YL3A 5CCHA 1Q0DA 1YQ4C 3WHNA 2K3RA 1JNMA 4DRHB 1NAYA 3UGPA 2K9JA 2ZPAA 2WSCJ 1KYOH 1L4AD 4OGQD 2P6VA 3OA1A 2VASA 3KMIA 2B87B 3H65A 4GQHA 3VYWA 5DS4A 2QLAA 3GM1A 2YLDA 1RF1A 1ZHTA 4WWIA 1U7JA 1OZHA 3RL0g 1HVVA 2QA4P 3HLZA 4JVSA 1R4TA 3B0VC 2O01N 3Q6NA 1L0ND 3DMDA 4JF7A 4N6JA 1RJ9B 3BCCD 5HV9A 1O3UA 1HW2A 3ABKC 3SWYA 3ZQYA 5T3TA 4CIHA 4HH2A 1BBHA 3II6A 1KQLA 4C7NB 1GK4A 5JUAA 2XSEA 1NFNA 1KYOI 2FYNC 1HF9A 1QL2A 5L0IA 1CGNA 1VF5C 3Q7LA 3F89A 3G3ZA 2FXPA 3EH2A 2R5BA 5AW3B 3R7CA 2JDIH 5F5HA 1OWAA 4W8KA 1H88A 3J06A 3O6QA 1T6AA 3IHUA 1KQFB 2NPSC 2J9BA 1SQQD 3L74G 1EI7A 5GTIE 2IXOA 4XTKA 5A6AA 1WWPA 2A06E 2LIGA 4D6TG 5CCGC 3AEEC 1NTMJ 4N06A 1GTWA 1QVXA 4XFJA 1GDTA 2XNDH 4JEAA 3OW2O 1SQVD 2O3JA 4BJ6A 2IPPA 1ZR4A 3S4RA 1S9KE 3S0XA 5APUA 3M06A 2V7QJ 3HTKB 2OTJP 4IARA 3C8GB 3H32A 5KAFH 2I1JA 4DBQA 3IN6A 3CX5I 1W2EA 1PZQA 1E5WA 3GHGB 1AFOA 3HRNA 3D6YA 1K05A 1LPEA 4PACA 3RF3A 1IC2A 5CCHC 3D6ZA 1Z5ZA 2HJMA 3P8CD 4PD4D 1SZIA 2YO2A 2FYUK 5EK0A 2YQYA 5TJHA 3EG9A 3MZWB 1ZU5A 5JLIA 3EFOB 3Q7GA 1VQNP 1OKKD 2Y3HA 3SXMA 1T3JA 2KIKA 4PJ0H 2E76C 1VLSA 2B89A 3QZCA 3T97A 2D4UA 2WQYC 2ZYDA 2MYSA 3T6GB 2WPQA 2W90A 3H6PA 3L8IA 5H2FE 2IBZG 3AE1C 2PGDA 4YPCA 3GF7A 1SQXJ 5DQZA 1F1MA 1NGMB 3IFMA 4L76A 3MYFA 4CS7A 2FYUG 1BCCD 2OYHB 1ZW3A 2E87A 4BJTA 2OGUA 2QSIA 1FOSF 1ZRTE 2XL4A 2L6HA 4MS2A 3IPMO 3PRJA 2V4HA 1KQGB 1V55C 4DJGA 1BZ4A 1M1JC 1JR8A 2BEQD 3C8GD 2AWYA 2N1TA 2OYOA 1DIPA 5KLVE 2J8WA 4MVZA 2HODA 1W2WA 2GA0A 1VQ6P 4MVRA 3U1CA 3B0UX 2RMZA 5EGYA 4N6HA 3H1HE 1JCCA 3L75D 1FZAA 3Q1MA 3GLMA 2IXPA 5DS5A 1WN0A 2M3BA 3BRVB 4C3DA 3NMDA 5KTBA 5AW5B 1LTJB 1U89A 1JY2N 4O6NA 4H54A 4BWNA 5AVSB 4Z9HA 2YXRB 3LW5H 2AU5A 4ZLDA 4AUWA 3F5HA 4YTPC 3S84A 2Z15A 3RK2B 1MFTA 3U0CA 4YT2A 1RE3A 4BEJA 2FXMA 2NG1A 1USEA 2PNOA 5JS5A 2H8PD 3O39A 1QVGO 3SFDC 1D1AA 2KGOA 4ZKPA 5KYNA 3CCSP 3T9OA 3JT1A 3AEBC 4IAQA 1PPJD 2XL8A 1KB9D 3RFYA 1MMGA 2IZ1A 1K9MQ 1HJBA 3NMIA 3UR3C 3H1LJ 1DEBA 4CPGA 1NTKJ 2K9JB 3C62A 1A0BA 1QSPA 1OVVA 2LFDA 3PTZA 3WG7C 3P8MC 4BXLA 2KW3C 2CPSA 2HZ8A 1S5LX 3L71J 2G3VA 4I1MA 2IBFA 2E76B 1VF5D 1NU7D 1JAFA 1RF1B 2HMZA 3A0HH 4GOEA 2A45G 1ST6A 1WATA 3MFNA 1RH5B 1PP9E 1QKRA 4J30B 1RF0C 3FHDA 4PD4I 1MV8A 5DS6A 5CCGD 1CZQA 2HV6A 4WABA 4U5BE 1HE1A 3G4XA 3CCJP 4PK4A 3KZIE 4RJTA 1GW4A 5D91A 3L73D 4IL6E 1X8YA 3DAGA 3AOUA 1VPCA 2QJKC 3RK2D 2N1TC 2CPBA 1ORYA 4NQFA 1LT9A 1VYIA 3L4FA 5E79E 1NG1A 1RE4A 2VCBA 3LLKA 1S4XA 1OIPA 5B66E 3SXKA 4OIOF 2Q9IA 2LSEA 1W2BO 4XLNF 3U3FA 2EPOA 3N24A 2X0CA 3T6BA 3AE5C 4JJFA 4XEFA 5CCHD 1U6HA 3AQCA 4I7ZC 3CC2P 5BQGA 3LNRA 3L35A 2ZXPA 1O87A 1M6TA 2P61A 3CWBE 3NMKA 2C9LY 1T8ZA 3B0PA 2A6EF 3AG4C 2OTKE 1RHZB 1D1CA 3G4SP 4DVYP 3KXDA 2G8YA 1LP1A 5JVEA 5KKZB 3M91A 3TULA 1NAFA 2E76D 3H32B 2V7QH 1RE3C 4IOIH 1LM3B 2QEXP 3A0BE 2F22A 4ZLCA 1CPQA 1DOWA 1M8OB 4ULVA 4MN4C 3Q5SA 2W83C 1JPJA 2VB6A 3B8EB 5AW0B 2AEFA 3DWWA 2CYDA 2Y39A 4U3FJ 4Z9IA 3M4CA 3OEOA 2E74C 1YJ9P 2ZYAA 4L73A 4H0LB 5E2QA 3EG9B 3VMZA 2B0HA 5L0GA 1N86A 4HJGH 2ZXWC 3AG2C 1DX7A 1HMDA 2Z5IA 3L72E 2XV5A 4JQ0D 3QW1A 4L75A 1Q82Q 1A7DA 3BRTB 2R3CA 4PFOA 4D4NA 2DYRC 2LKMA 2YWAA 5JRAA 2A06G 3HE5A 2FYZA 3NTNA 1J8MF 4TT3H 4RO0A 1N1CA 1KB9I 1M90Q 1A7EA 1NWQA 3N4XA 1RJ9A 3AECC 3M0DA 3K1HA 3TGUJ 1KC8Q 1LT9C 1R5SA 2WWWA 3L74D 4OGQC 2N1TB 1JY3P 4KNWA 4EWCA 4WB4A 1HTLC 3BVHA 4G7OF 4KBLA 2HSQA 2HODB 4D6TD 3B9QA 4OIRF 3W68A 1YAUO 4IFFA 1NZEA 1TFOB 1J8YF 1YITP 5KYWA 2M8RA 4I7ZB 4U5DE 3U9MA 2BCCE 2LP4A 4OVNF 4UB6E 1IFIA 5APWA 1ORJA 4MW3A 1SQPE 3U59A 4KHXA 1MNDA 3CXHD 1OMIA 3SZRA 5L3QA 3IQ5A 2H43A 1BE3J 2XS8A 1J1EC 1UFBA 3QVZA 3FMSA 3GWNA 2QTVA 2CNWA 1HUCA 3L37A 5FCLA 1G4WR 3RVYA 3SSUA 4O6YA 2IXNA 4HEAJ 4PR9A 5AW2B 1EDKA 5E33A 2RSEB 1KYOE 5JT4A 3PDMP 1VB5A 3ABMC 3LLIA 4MTOA 4U3FD 4DZOA 4Y99C 1AA0A 1X79B 3HUSA 1NU1E 3NG1A 1KD1Q 1RMVA 4Q5SF 1LI5A 3M9BA 2QM8A 1QLED 3W2WA 3G71P 3S27A 1HBWA 3VOPA 3BASA 4JW1A 2V3CC 1VDFA 2HUJA 5KLVG 2IBZD 2GWWA 3H1IE 2XLHA 2N1TD 4KI2A 3PMRA 1J2JB 2WSFH 1SQBE 2FYUD 2YL1A 1FDMA 2WSSH 3C1LA 3H1HG 1ZV8A 1D7MA 2Q3TA 4IGGA 3C8VA 1MNEA 1VOMA 1EXJA 2P7VA 3FVYA 1PGQA 2LQGA 3ASNC 3CI9A 1VQ4P 3O10A 4XEVA 1N8RQ 3GG2A 5L0FA 1L0NJ 3D71A 4YWQA 3CX5E 1JOGA 3BCCJ 2R7XA 3S28A 3H1JE 1EZVI 3AG1C 1U7MA 4YXWH 3M0DC 3U8PA 4NY3A 1RQVA 1WT6A 1VQ7P 5B5EE 1NTZE 2KNCA 1MMDA 1LT9B 3ASOC 4CS9A 5C39A 3B29A 1TKNA 1AVOA 2HS5A 5CMZA 2XDJA 3ATPA 5E3AA 2L5GB 5BQIA 1K40A 2FFDA 1MMAA 1U0BB 1SQQJ 1MFZA 2W6JH 1BR1A 1TWCA 4ANJA 4OH8B 1OQCA 5HSWA 1HGVA 3GODA 4ULWA 2E74D 2C03A 4W7YA 1H8AA 1BR4A 3NYJA 1YBKA 1LP1B 2K1AA 3RK3B 3LS1A 3A3YB 4JIOA 3CXHH 1LTIC 2FY8A 1Q0GA 3Q2YA 3PHF2 1SQVJ 3LW5J 3CC4P 2QE9A 2YIUB 1NSGB 3Q6MA 3JSZA 2OEXA 2XL6A 3HTKC 2CGEA 1PGPA 3E1IA 1CPRA 2BC5A 1PP9G 1ZR2A 5L0JA 1M1KQ 1G2CA 1KILE 3RGUA 4CBEA 4OWFA 2Q00A 1LT1A 3ZG1A 1HMOA 1AEPA 2GA1A 3WMM0 1S3JA 4RESB 1Y6DA 3C7JA 4I44A 4Y99B 2R7VA 5KAIH 2YL7A 1YQ3C 3C8ZA 3ZWIA 2PF4E 3I5PA 1PL5A 1VQOP 3DE8A 1JY2P 1QQ3A 2AEJA 3QVYA 1G1JA 4H13C 3K6BA 2IX7C 3EFGA 1YYCA 4PFPA 2G62A 3CL3D 1N73A 3HE5B 3JZ0A 4NPDA 4GIFA 1YYXA 3EPVA 3NXSA 2WL8A 3BRJA 3CWBG 4AL0A 1N7SA 1JM0A 3O8ZA 2JD3A 1HW1A 3NYMA 1BCCJ 1GW3A 2OYHC 2I1KA 4N78E 4Z1MH 2AXCA 3T4RA 3H1KE 1Q86Q 2UUIA 3AE3C 1RY3A 3RK3D 2IFMA 2K88A 1USDA 1S5LH 5AVQB 4CS9C 4EBBA 3NFQA 5CJ0A 3I56P 2AXTH 3TD7A 3VP9A 2FFDC 1FE6A 1LNQA 3LESA 5KLIB 2J9UA 3B4SA 2A69F 4PJJA 3PCVA 5KYWB 2R7SA 2KI7B 1BGYE 1M2VA 3UMKA 3PHLA 1H6GA 1L0LE 4EDFA 4CSAC 1T01A 4JBZA 4U5HA 4CDVA 2AWCA 1RQUA 3L75J 4O9BA 2VH3A 3M15A 1FU1A 1YTZT 2DYSC 2R03A 4WY4A 4FWVA 3MD0A 1XZPA 1LTJC 1EQ7A 3OA7A 3G4ZA 3LEVA 4DRJB 1VQ8P 1FMWA 4I6MC 1D0XA 4JYBA 4N4WA 4PD4E 5FZTA 3RK2C 2AP3A 1E84A 1OCZC 4XPWA 5AVWB 2WZGA 1CGME 2ZVOB 1RXQA 2CCYA 4DRIB 2KLUA 2K37A 4YJWA 4IRUA 2Y9YA 2W9YA 1LTSC 3AEFC 3P32A 2DGJA 1ZHZA 3HUSB 3DM5A 2O9XA 1PV3A 3W4YA 5AC5A 5F5FA 2WZLA 4U5GA 1GQAA 2RN0A 2BE5F 3G6EP 1SQPK 1VQLP 5AVUB 2MJZA 4U5FE 2PAJA 5AVYB 4MVSA 2YXQB 1TWGA 1LE2A 2RKLA 2A06D 2OQQA 2WPRA 4LDKA 4BG0A 256BA 2A45H 1D1BA 4D4XA 1PFIA 4H13B 1YVIA 2OG2A 5GTHE 1D0YA 2EIMC 3CMEP 1VQKP 2XRHA 2I15A 1RF1C 3GEHA 4IJJA 2OU6A 1S9KD 3FDQA 2BCCG 1CSBA 1X9VA 4OINF 2VCCA 3CCMP 1NU1K 2EPNA 1SYQA 3U3BA 1SQPG 2OJED 2GM4A 1LIHA 4P6IC 1GZLA 1P84E 4JURI 4PJLA 2RH0A 3FWLA 4WJ0A 2A0UA 2KNCB 1YA9A 1H9TA 1EC5A 1V54C 3L73J 4E0HA 1SQBK 1O5HA 2A45I 2CNWD 4NTBA 3AE6C 1AVOB 4R32A 3HD7A 1QGKB 3TF5A 1JMWA 3GORA 2B0JA 1NTME 3AEGC 2GUSA 3ITFA 3HNLA 3KQGA 2FFDB 5AW4B 3SWFA 2P0NA 1NU1G 4RDAA 1Y9BA 2PX0A 3UNGC 1C03A 3ZIBA 4Y28J 3L70G 3JTLO 2UUHA 4XPXA 2R5DA 3V7OA 4EKWA 3OJAB 2IYPA 5APSA 4WY4C 4BRYA 2HV7A 1PCXA 3PH0A 3H1IG 2EILC 1NU9C 1LS4A 3DI5A 3SYNA 1GL2A 1NTZK 3QWOC 1WMKA 1ZN5A 3GF3A 4GDOA 1M57C 1SQBG 2ZYGA 1ZHXA 4BJ6C 4FESA 1T9KA 1YA7O 3TJ6A 1PPJE 2JWDA 3L1MA 2E5YA 1VQ5P 5KKZC 4YL3A 1SFCA 1KB9E 3CPWO 2D5RB 4H13D 4E18A 4JYCA 2R25A 4M63A 2J5UA 1G2CB 2KSJA 5IY5C 3S1KA 2YHSA 2HYNA 4CJGA 2JKVA 2VRSA 1M56C 1Z23A 1E83A 2Y0CA 3KPEA 4MW8A 3K66A 3H1JG 1FFHA 2YLIA 1VMAA 1AQ5A 4RBNA 3ZTZA 3VF0A 2R3SA 3IR9A 4R4LA 3CAXA 4LERA 1NTZG 5TISE 4JE9A 1OXKA 5A6KA 5A6BA 1EDIA 4AE4B 4KT0J 4H0LC 4BJ1A 5GTIH 2P7JA 2WPVB 4DCKA 3CCVP 3H1HD 1SQXE 3W2VA 3H25A 4MQ9F 4E17A 1KV4A 3FAPB 4G0HA 5AW1B 3BATA 3I5QA 4EBKA 2MKVA 1N73B 1QPUA 3C63A 3ZSUA 1KZUB 2WSFJ 2OYIA 4CX9A 5E3CA 1C17M 1PGOA 3AE9C 2LXCB 3MP7B 2XS1A 1N7SB 4MVOA 5JP7A 1EKYA 1IJDB 4UB8E 1H0TA 2POHA 1MKMA 4CDYA 2J7PA 3VRCA 2ZXRA 4KC9A 4LDQA 4DBRA 1QLEC 4DOJA 3B71A 3RQFA 3HD7C 1WTYA 3E7KA 2WVRA 5K5GB 3AEAC 2P58A 3L74J 3B5NA 3QH9A 1URQA 2XXAA 3AQBA 2XU6A 2KQ9A 2M0BA 1ZP0C 3HNIA 3HE4A 3V4WA 2OKUA 1VQMP 4D6TJ 5DJUB 1SF8A 1R8EA 3C9IA 4YT4A 1Y47A 1M2VB 2I8DA 2KSEA 3I55P 1Q0FA 5AVXB 3CC7P 1M2OA 1QZXA 2JJLA 2QUPA 1RKEA 4Q7CA 2D2CB 4U7JA 4XPYA 4WY4B 5H2FH 3ZQVA 3E1RA 3ZTMA 1FFTC 1KILA 3K33A 1NKNA 3LJBA 3DJNB 4N3YB 1IO4A 3PP5A 4E7ZA 4E7SA 4DOZA 2WVNA 1EZVE 3H1LE 2BEZF 2Q7CA 3G50A 3BEHA 1NTKE 2PP6A 1FAPB 2R9RB 2HLOA 5APVA 3HJCA 2Y9ZA 2E5TA 1YJNP 1FDIA 1L0LK 1N7SD 2WB7A 2ZXXA 3H1KG 3E9VA 3L71E 3L0IA 1H89A 1PGJA 1GMJA 2XLEA 1OXBA 5CBOA 1LTGC 3WODF 3VAYA 3AE2C 2KJGA 3FXDA 1OW6A 3MLGA 1K04A 5CI8A 1S05A 1MUUA 2W6BA 1A7VA 4KNVA 4YL1A 2NUTA 3CWBD 3CCUP 2OYIC 4NPEA 2W4MA 1OR3A 2FYUJ 1OR2A 1BGYG 4PJMA 4AQRD 3RL0C 1WGWA 1L0LG 1PD1A 2WITA 1NHLA 3MYIA 1EDLA 1Q81Q 2Q9AA 1XZQA 5KYXA 2LXBA 3MUDA 4LLCA 4QI0A 1APCA 1HGZA 1RKCA 2AVKA 4WY4D 5L3VA 4BEMJ 4CIPA 3W67A 1Q0MA 1BSHA 4UDVA 1LWUA 4YT5A 3A7OA 3K7DA 1YIJP 1LI7A 3TK1A 1M57D 4XEKA 2EIKC 4I1LA 3HD7B 3HNJA 2Y0EA 4JPZB 3U2MA 4J32B 1S1CX 2XLOA 2N9YB 2ASRA 3SFEC 1RE4C 2P1AA 4JCZA 5AW6B 4X0RA 2ICWG 2M3EA 1OCRC 2HR3A 3CLQA 4PV1B 2YRFA 2NSGA 2QVAA 1AJYA 1ZVZA 4O7GA 1KMIZ 1M56D 2E43A 5DVWA 3V2PA 1X22A 5B1AC 4BRYB 5EFWB 3RQEA 3TJ5A 1HJ0A 1GL2B 3GM2A 4A2NB 1NH4A 4H0LD 5AVTB 4C3EA 3PJSK 5DJTB 2PFXA 2H89C 3RK3C 2JX0A 1SFCB 1SLQA 4U3FE 3EZHA 1NTMK 5BQHA 5KJ7A 2A68F 2YIUC 3Q5RA 5CI9A 3KZIH 5KLVK 3FAJA 3RW0A 2NRGA 4MVQA 4IL6H 3KDPB 2IZ0A 2ZVNB 2H7HA 1MQVA 5E79H 4NCQA 2GFHA 5COMA 2FYUE 4HKZH 3GEEA 1CGOA 2J59M 5B66H 4CS8A 1K73Q 2V26A 3WUVA 1GD2E 1OXZA 2W4BA 3RBZA 4WVZA 4QI2A 2VC9A 1NTMG 3LUTB 3HD7D 2BCCD 2QY9A 4B6IA 2EPLX 1JB0J 3U2LA 2YKPA 2OYIB 4ONSA 1PIXA 1SQPD 5L8RJ 2JP3A 5AW8B 4IFMA 3M0AA 3MTUE 3RL0B 5L0HA 3CD6P 2P2UA 3CQZA 1Z63A 1S5LE 3I5CA 3TGUE 5BU5A 1HWTC 3A0BH 1YYJA 1H0TB 1VK5A 3WUUA 3AGUA 3X1OA 1OW7A 3V5YA 1GL2D 4ZNCA 3IQ6A 1SQXK 4K35A 1VTMP 3MHVA 3DZAA 2E42A 1A02F 1LTAC 3P7KA 3IF4A 3K1IA 1AUEA 1R5LA 3EGXA 1NU1D 3VP8A 3B5NB 2KYHA 2Y69C 3IEEA 1IFNA 1URQB 2JEEA 2XXAB 4ZKUA 5COFA 3L70D 3CCEP 3HE4B 2NUPA 1C02A 3JSEO 2OOCA 4NC3A 2O01H 5KLIC 2N9BA 3H1ID 1KN7A 3AE4C 3ABLC 1BE3E 4CJOA 1I4ZA 5AC4A 3KHUA 1RKEB 4YL0A 1SQBD 4KJMA 1WASA 1FJKA 1ZW2A 3EQ2A 3HKKA 3POVA 1SQXG 5L0DA 2Y3GA 5A6BD 1TWHA 4EIYA 1KILB 5KAFE 3JYHA 1CI6A 4LDRA 1JUNA 2EINC 3A11A 2ZXOA 1FZGA 2GDCA 5AW9B 3DXJF 1JPNA 3LAYA 3PLNA 1GU5A 1QL1A 3EGDA 5CJ4A 4N6CA 3CX5D 1ZU4A 1HE9A 3H1JD 2HPCA 4ER9A 3WU2H 3GMAA 3LIDA 3TK0A 2IYLD 4I1OB 2IDBA 1S7ZA 3RL0D 2NPSA 1NTZD 2WT7A 4OIPF 1LVKA 2QM7A 2LCHA 3RBXA 3JCUH 3N0TA 3KYQA 3M9QA 2J9VA 4PJ0E 3LNMB 5CCGA 3HUSC 2QIWA 2L7AA 5F28E 2J7PD 1J1DB 4C46A 5DLJA 1ORSC 1JRAA 1LTTC 1KORA 4CDAA 1LGHB 3M9HA 4AE4A 2NUTB 1YZCA 2YMKA 2CDQA 3CXHI 2ZAEB 3UIAA 2BL2A 4NPFX 2B88A 3V6IA 4UB6H 1L0NE 1GK6A 1NTKK 1VQ9P 3BCCE 2CW0F 1L2PA 3SWKA 1BSNA 2QJYC 1T6QA 4WGYA 5KYXB 3UGOA 4W7ZA 1FNTc 2PFDA 1KILD 1EDJA 1U57A 1LWUB 1K8AQ 1JY3N 4ASVA 3K1IC 3EH1A 1BDDA 2QG4A 5T3WA 3VM6A 4J7YA 1EZVG 3H1LG 2KOGA 1SQQE 3SP1A 1NTKG 2XLWA 2H88C 1B68A 2UWJE 2IBZI 2R05A 2EPKX 4GOFA 3NMJA 1FZCA 3L34A 3L71G 3G9RA 1KQSO 4OD4A 1SQVE 3GW6A 2WSEJ 2IFNA 5B3SC 4IL6X 2IYOA 2KZIA 5AVZB 1YJWP 1Z3IX 2JPUA 3W8IA 1DH3A 1CW5A 2KNHA 3EHMA 3AJMA 2IM8A 3K5BA 4IAOA 2KYVA 1JOCA 3L72G 2WVOA 2KSFA 1IFJA 1JY3O 1T3UA 5APYA 1GU4A 1M1JA 4RD9A 3S90A 4N78D 3CX5H 2NZ2A 2ZJSE 3SXZA 2QJPB 3H1KD 3GM3A 3R2PA 3P8CE 3CCLP 2R7QA 3RIPA 4AK9A 5B5EH 2ZXEB 4GT1A 1E86A 3FOOA 1BDJB 1G1IA 1JO5A 4XWJA 2E75C 3USSA 1L3PA 4QDLA 3CMAP 4O6MA 2W8ZA 5CIVA 5KLVJ 4U9EA 4EOTA 3X2QC 2J58A 1IFPA 3A0HE 3L36A 2C0WA 1BGYD 4HB1A 1H7IA 1MZ9A 1L0LD 2YEVA 2AEMA 2O1KA 3S29A 3H1HJ 3KPHA 3TNUA 3QW0A 2R7RA 2WPSA 2Q9BA 3ZDLA 1BCCE 4HFFB 4L6RA 2Q6QA 3AGTA 1N73C 3CCRP 1T5OA 2H7OA 4R4MA 2QJYB 4DT0A 4DXWA 2WMMA 1EA8A 3ZDMA 4F4BA 4JCHA 4U5EE 1N7SC 2L91A 3U9JA 1Q90D 1VYKA 1SVFA 3S9OA 1HY5A 4NTFA 3RKOF 2LD6A 4U3FG 4W80A 4YN0B 2Q3IA 4ZMDA 2FKWB 1KTMA 3EGXB 5A69A 2Q5UA 1E2XA 2ZFCA 1LE4A 5KJ7D 3V5BA 1XWJA 1SMYF 1ZHWA 2EPMX 1FZCC 2L6GA 3CSKA 1OX3A 3L75E 2H7BA 2NUPB 3UMIA 3MGNA 1S2EA 2LK4A 2R44A 3AE8C 3HNKA 2M5AA 3EFFK 2RD9A 1KFNA 2IOQA 4C7OA 5AW7B 2LR2A 4FX5A 3DE9A 1RF0A 3ZVRA 1E85A 1FS0E 3MX3A 2YLGA 4RKUJ 3UMHA 1CI6B 4IB4A 2GAQA 2NPUA 4HE8D 4EI2A 2D2CC 4JTAB 2SPZA 1BDCA 4FAPB 2W27A 2VCAA 4Q4ZF 3JCUQ 2FYNB 3US6A 3U5SA 3EGDB 3LEOA 1VF5B 4MVUA 1PP9J 2KC3A 1V74B 1R5ID 2Y0DA 2C9NY 2HPCB 3LS0A 1VLTA 1FAVA 2G3AA 5L0CA 1P84D 4IWBA 3DKAA 3TGUG 3FXHA 2NPSB 2J9WA 1OVUA 2WT7B 2QRXA 2Z5HA 1ZRTD
chains in the Genus database with same CATH topology
5M1BA 3JZ0A 1OW6A 2QIWA 3D70A 1WOLA 1EXJA 4TT3H 1K04A 1V4AA 1ZRTE 2FYNC 1EXIA 1HF9A 5F28E 1OW8A 2E75B 2MKVA 4EBKA 2L6HA 3O10A 4XEVA 3BRJA 1VF5C 1KQGB 2WSFJ 2QJPC 1KORA 3D71A 1DD3A 2FXPA 2BEQD 1JOGA 3AE9C 3AECC 3C8GD 1JB0J 2QJKC 2YMKA 2ZT9D 4Z1MH 1PIXA 3O6QA 3IAOA 1DIPA 1KQFB 1NYHA 1RQVA 5L8RJ 4NQFA 2JP3A 4YXDC 1TU3F 4OGQC 1KNYA 1WWPA 3AE3C 3ABVC 1MKMA 2QJYC 3U3FA 1ZMEC 3AEEC 4R4MA 4H44D 3Q1MA 3AE5C 3GLMA 1QVXA 4XFJA 4XEFA 1K40A 1OW7A 4I7ZC 3AE6C 3B71A 4R32A 3RQFA 1WTYA 3K7DA 1DD4A 3Q3DA 3JYYA 3C8GA 1Q90D 3AEAC 3S9OA 4XEKA 3AEGC 4I7ZB 2ZT9C 1U57A 1ZZPA 2V7QJ 3R4YA 2G8YA 3C8GB 1ZP0C 4YTPC 1S1CX 2ZT9B 2E74D 3IN6A 3SFEC 3C18A 1Y9BA 3U0CA 1RQUA 4PV1D 1R8EA 3TULA 1OMIA 1UIXA 3AEDC 2E76D 2H88C 2E74B 4Y28J 1KTMA 3RK3E 3D6YA 1K05A 4PV1B 4H44C 1ZOYC 1UFBA 1AJYA 3Q2YA 1KMIZ 2L6FA 2D2CD 3SFDC 2PBEA 4EBJA 3AE7C 3LW5J 4OGQB 2L6GA 3Q5SA 3D6ZA 5KLIC 2P10A 3G9RA 4H44B 1YQ4C 2D2CB 3AEBC 4U7JA 3T97B 2LK4A 3AE4C 2KK1A 1WMKA 3GF3A 4GDOA 3RQEA 3AE8C 3EWKA 2WSEJ 1HJ0A 3RQGA 3GM2A 1VL2A 4IL6X 5KKZC 2WSCJ 4H0LD 1KILE 4H13D 2JPUA 4OGQD 2JO1A 2Q00A 2E74C 4H0LB 3AJMA 2J5UA 2H89C 2O01J 4PV1C 2JX0A 2E75D 2HSBA 2E76C 3Q5PA 3FGAD 1FDOA 4RKUJ 2BEZF 3AEFC 1S5LX 2D2CC 2YIUC 2E76B 3AE2C 3Q5RA 3GM1A 3L8JA 1PV3A 2WQYC 1VF5D 2FBWC 1YQ3C 3RL0g 1FDIA 3GMAA 3L8IA 3AE1C 1VF5B 3GF7A 2NZ2A 1PL5A 2IDBA 1NGMB 3GM3A 4R4LA 2K9YA 1IK7A 1GMJA 2YWAA 2G3AA 4H0LC 4KT0J 1O3UA 4H13C 3MFNA 2OQQA 2WPVB 2QSIA 3H25A 2E75C 4H13B 3C8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JZ0 A;  1OW6 A;  1WOL A;  1K04 A;  1V4A A;  5F28 E;  4EBK A;  1OW8 A;  2L6H A;  3O10 A;  4XEV A;  3BRJ A;  1JOG A;  3AE9 C;  3AEC C;  3C8G D;  4NQF A;  4YXD C;  1KNY A;  1WWP A;  3AE3 C;  3ABV C;  3U3F A;  3AEE C;  3AE5 C;  1QVX A;  4XEF A;  1K40 A;  1OW7 A;  3AE6 C;  3B71 A;  4R32 A;  3RQF A;  1WTY A;  3K7D A;  3JYY A;  3C8G A;  3AEA C;  3S9O A;  4XEK A;  3AEG C;  1ZZP A;  3C8G B;  1ZP0 C;  4YTP C;  3SFE C;  3C18 A;  3U0C A;  3TUL A;  1KTM A;  3AED C;  2H88 C;  1K05 A;  1UFB A;  1ZOY C;  2L6F A;  2PBE A;  3SFD C;  4EBJ A;  3AE7 C;  2L6G A;  1YQ4 C;  3AEB C;  2LK4 A;  3AE4 C;  2KK1 A;  3RQE A;  3AE8 C;  3RQG A;  3GM2 A;  2JPU A;  2Q00 A;  3AJM A;  2H89 C;  2JX0 A;  2HSB A;  3AEF C;  3GM1 A;  3L8J A;  1PV3 A;  2WQY C;  2FBW C;  1YQ3 C;  3L8I A;  3AE1 C;  3GM3 A;  2YWA A;  2G3A A;  1O3U A;  3MFN A;  3AE2 C; 
#chains in the Genus database with same CATH topology
 5M1B A;  3QTH A;  4LLH A;  3D70 A;  4H4K C;  1QEX A;  1WOL A;  1YTZ I;  1OW8 A;  2E75 B;  3F46 A;  1UG7 A;  2YO3 A;  3V4Q A;  3VMA A;  3I4U A;  1NTM D;  1FZF A;  5DQT A;  1JTH A;  2XLV A;  2YVK A;  2G3K A;  2JWA A;  5KLV D;  1AQT A;  2FAP B;  3IAO A;  4XLP F;  1NYH A;  1QVF O;  5CBN A;  4P9T A;  2KB7 P;  1TU3 F;  3M1C B;  3MBG A;  1FZE A;  1TWA A;  3V5Z A;  3RH3 A;  1JEK A;  1ZME C;  5KYU A;  3CWB J;  1TR2 A;  4Z9J A;  2OCC C;  1BE3 G;  4A4A A;  5K0I A;  3IQC A;  3KYI A;  3DJU B;  2YMY A;  3W8H A;  1ZLL A;  3F47 A;  1RCP A;  4JZA A;  4GEH A;  3RVZ A;  3Q3D A;  2Q1K A;  4PD4 H;  3EQL F;  2ZT9 C;  1ZZP A;  3L73 E;  4E0I A;  2Q3E A;  1YZA A;  2J0X A;  2PP4 A;  3U8V A;  1I5N A;  5AVR B;  2Y3B A;  2OTL P;  4EYY Q;  2IXM A;  4K3A A;  3GWL A;  1N7L A;  4JC7 A;  4K0D A;  1I4Y A;  4WGZ A;  1JY2 O;  1XTG B;  4IFD K;  3T6J A;  2WSC H;  4H44 C;  1YLM A;  2W45 A;  2PBE A;  4EBJ A;  3AE7 C;  3V2R A;  2DB4 A;  5D92 A;  2P67 A;  1L0N K;  4ASW A;  2KK1 A;  4XQ1 A;  1FZC B;  1FZB A;  1ZXG A;  4I2L C;  2Y3D A;  2NPS D;  1VL2 A;  1SQX D;  2WTY A;  3EZI A;  1OFC X;  4A7P A;  3L72 J;  2KP8 A;  4PV1 C;  2O01 J;  3WAQ A;  2L9J A;  2E75 D;  5GTH H;  1QX8 A;  2WSE H;  3FGA D;  1FDO A;  2J0W A;  1G4U S;  2R7U A;  2QE7 H;  2H8A A;  1AVY A;  1DEE G;  3L8J A;  3O6X A;  2YNY A;  2FBW C;  1T2K C;  3SNH A;  2FFH A;  3NKD A;  2ZD9 A;  1GL2 C;  1SQQ K;  3VN0 A;  1FTS A;  1L0N G;  1M1J B;  5KYY A;  2K9Y A;  1JCD A;  3BCC G;  3FX0 A;  4B86 A;  2KS1 A;  5TJ5 E;  1PP9 D;  1L4A A;  2WVQ A;  4DJ9 A;  1SFC C;  2OAR A;  2MWQ A;  3KH2 A;  2YKO A;  3O6Q B;  3O55 A;  4YT8 A;  2BAS A;  2I8B A;  3OWT A;  1P84 H;  3FWN A;  2HMQ A;  1FMV A;  3AG3 C;  4U9D A;  3JRT A;  1SQV K;  3SEO A;  1Q2N A;  1UII A;  3JRM O;  2PRR A;  5B1B C;  2HKV A;  4GOD A;  1H9G A;  2YKZ A;  1YDI A;  5APT A;  1E79 H;  1NBB A;  4AL1 A;  1SQQ G;  1IFM A;  4M3L A;  4XE5 B;  1FOS E;  1G5Z A;  1KNY A;  2J45 A;  2YKQ A;  3M79 A;  3TNU B;  2C0X A;  1OVR A;  1Z6A A;  4C3B A;  1Z7Q c;  1NO4 A;  3V2Q A;  5GPG B;  2BCC J;  4C7R A;  2QNL A;  1OCC C;  3H2V A;  1FJP A;  4AX2 A;  1P84 I;  1SQV G;  4BJ5 A;  1FR0 A;  3ZC4 A;  1DD4 A;  2KUB A;  1SQP J;  3JYY A;  3EHN A;  1AV1 A;  1A41 A;  5AVV B;  4MND A;  1KB9 H;  1YI2 P;  1LJ2 A;  3N2Z B;  1IK9 A;  2ZT9 B;  4MTG A;  1EZV D;  3H1L D;  2R7W A;  2FXO A;  1Y8A A;  3L74 E;  1NTK D;  1MMN A;  3NYL A;  1X0T A;  4TLF A;  1ZOY C;  2Q9C A;  2L6F A;  2D2C D;  2J46 A;  3GEI A;  4D6T E;  2P10 A;  3L71 D;  3U1A A;  4H44 B;  3T97 B;  1KFM A;  1Y4C A;  4W8P A;  2DI3 A;  1WRG A;  3CZ6 A;  3VYI A;  1NU1 J;  5TIS H;  1IFD A;  2B87 A;  1L7C A;  2YL0 A;  2X51 A;  3B5N C;  2KXP B;  4L74 A;  1URQ C;  1Q0K A;  1M7L A;  2OEV A;  4JEB A;  2JO1 A;  2M5A B;  2HG5 D;  3L70 J;  3H2U A;  2A6H F;  1SR2 A;  4LLE A;  4C7O B;  5BUO A;  2HSB A;  4XA4 A;  3V2N A;  3Q5P A;  3JC2 2;  3L72 D;  4EUK B;  3CXH E;  3H1I J;  4HYT B;  3DM9 B;  3NRH A;  3VMX A;  4QMA A;  3TOM A;  1YJG A;  1SP4 A;  4K7B A;  1SQB J;  3WU2 E;  2KLV A;  2R32 A;  3WUT A;  2M64 A;  4BPM A;  1NVO A;  2H7V C;  4P9F A;  1KIL C;  2JR8 A;  1GS9 A;  1IZM A;  2XM0 A;  5B3I A;  1BCC G;  4J7T A;  1ZW0 A;  4C7N A;  2QJK B;  1L4A C;  3JCU E;  3VTP C;  1OKK A;  3LIE A;  3TSI A;  4UB8 H;  1NFO A;  4WBA A;  4HFK B;  4OIQ F;  1HH0 A;  5APQ A;  4JJG A;  3A9C A;  1V4A A;  3H1J J;  1NJI Q;  2R02 A;  2XLD A;  5KAI E;  5BVZ A;  2HFI A;  2YZS A;  1DD3 A;  5EHH A;  1NTZ J;  2L81 A;  2NSF A;  3ECS A;  3JSV C;  1FC2 C;  2ZT9 D;  1LKX A;  2Q4F A;  1JTH B;  2IBZ E;  1Q7Y Q;  1BR2 A;  3KL4 A;  1TQG A;  2ITA A;  5AGF A;  4G78 A;  1J1D C;  3CCQ P;  4MVM A;  4YK5 A;  1KU2 A;  3CEX A;  3L75 G;  4H44 D;  3V5X A;  4DVZ A;  1LTB C;  3FXE A;  4G7H F;  2XLM A;  4I3M A;  5KYU B;  4BJ5 C;  3M4B A;  3KYJ A;  3HTK A;  2R7O A;  3C8G A;  4NTA A;  3SXY A;  2O1J A;  1ZYR F;  1YAR O;  2OQM A;  1NLX A;  5JSL A;  4O79 A;  1ZHY A;  3GHG A;  2FGY A;  4LAC B;  2EIJ C;  4PV1 D;  2Q7R A;  2E74 B;  4OD5 A;  1TFK B;  3MUD C;  2CK3 H;  4EHP A;  3L70 E;  1S72 P;  2AXT E;  4G7Z F;  1T2K D;  2KZJ A;  1LWU C;  1PPJ G;  3EFO A;  1KYO D;  3EWK A;  3VMY A;  3DD7 A;  3RQG A;  1W5C E;  2HFE D;  1SFC D;  1NKZ B;  3OAK A;  2WZF A;  1GM5 A;  3TDK A;  1Z56 A;  1JMM A;  2XKM A;  1YHQ P;  1NOH A;  1EQ1 A;  4U5C E;  5BU8 B;  2W6A A;  2B9B A;  1LS1 A;  4JRZ A;  4K1O A;  4JTC B;  3TYY A;  1VQP P;  2TMV P;  2OYH A;  1DOV A;  4JTD B;  1XTC C;  2DW3 A;  1IK7 A;  1T6U A;  2C04 A;  4JKV A;  3A2A A;  1D0Z A;  3NDB B;  1IZN B;  5KYY B;  2PX3 A;  3TGU D;  3ITK A;  2KS1 B;  1L4A B;  4OGQ B;  3EJN A;  2P1J A;  2MHR A;  1EXI A;  2R7T A;  5KJ7 C;  3DAF A;  3H1K J;  2QJP C;  2HJ3 A;  3L73 G;  4LC1 A;  5COG A;  3KKB A;  2A0B A;  1PD0 A;  3QMK A;  2GUV A;  2XNX A;  2Z4E A;  5A6J A;  3IQT A;  3E70 C;  4PJN A;  1N2D C;  4YXD C;  1JMB A;  1FBM A;  4CSA A;  2XZR A;  2LFF A;  3ABV C;  4GYT A;  3GAN A;  4GKG A;  1T6I A;  4CS8 C;  3N7N A;  1IW7 F;  1SS1 A;  1LTJ A;  1BE3 D;  1J1E B;  3TQO A;  4MTF A;  1BGY J;  2WZ7 A;  1L0L J;  2M4E A;  3R4Y A;  2A1D D;  2KK7 A;  3B5N D;  1G8X A;  1URQ D;  2XM4 A;  3GHG C;  5CHX A;  3NKE A;  5APX A;  3C18 A;  4EIJ A;  2OJQ A;  1UIX A;  3AED C;  4LGD E;  3RYL A;  3TOL A;  1GGQ A;  1OCO C;  3RK3 E;  2ETS A;  3FOP A;  4AYC A;  5T1D B;  3A5T A;  1A02 J;  3MIW A;  2YL3 A;  5CCH A;  1Q0D A;  1YQ4 C;  3WHN A;  2K3R A;  1JNM A;  4DRH B;  1NAY A;  3UGP A;  2K9J A;  2ZPA A;  2WSC J;  1KYO H;  1L4A D;  4OGQ D;  2P6V A;  3OA1 A;  2VAS A;  3KMI A;  2B87 B;  3H65 A;  4GQH A;  3VYW A;  5DS4 A;  2QLA A;  3GM1 A;  2YLD A;  1RF1 A;  1ZHT A;  4WWI A;  1U7J A;  1OZH A;  3RL0 g;  1HVV A;  2QA4 P;  3HLZ A;  4JVS A;  1R4T A;  3B0V C;  2O01 N;  3Q6N A;  1L0N D;  3DMD A;  4JF7 A;  4N6J A;  1RJ9 B;  3BCC D;  5HV9 A;  1O3U A;  1HW2 A;  3ABK C;  3SWY A;  3ZQY A;  5T3T A;  4CIH A;  4HH2 A;  1BBH A;  3II6 A;  1KQL A;  4C7N B;  1GK4 A;  5JUA A;  2XSE A;  1NFN A;  1KYO I;  2FYN C;  1HF9 A;  1QL2 A;  5L0I A;  1CGN A;  1VF5 C;  3Q7L A;  3F89 A;  3G3Z A;  2FXP A;  3EH2 A;  2R5B A;  5AW3 B;  3R7C A;  2JDI H;  5F5H A;  1OWA A;  4W8K A;  1H88 A;  3J06 A;  3O6Q A;  1T6A A;  3IHU A;  1KQF B;  2NPS C;  2J9B A;  1SQQ D;  3L74 G;  1EI7 A;  5GTI E;  2IXO A;  4XTK A;  5A6A A;  1WWP A;  2A06 E;  2LIG A;  4D6T G;  5CCG C;  3AEE C;  1NTM J;  4N06 A;  1GTW A;  1QVX A;  4XFJ A;  1GDT A;  2XND H;  4JEA A;  3OW2 O;  1SQV D;  2O3J A;  4BJ6 A;  2IPP A;  1ZR4 A;  3S4R A;  1S9K E;  3S0X A;  5APU A;  3M06 A;  2V7Q J;  3HTK B;  2OTJ P;  4IAR A;  3C8G B;  3H32 A;  5KAF H;  2I1J A;  4DBQ A;  3IN6 A;  3CX5 I;  1W2E A;  1PZQ A;  1E5W A;  3GHG B;  1AFO A;  3HRN A;  3D6Y A;  1K05 A;  1LPE A;  4PAC A;  3RF3 A;  1IC2 A;  5CCH C;  3D6Z A;  1Z5Z A;  2HJM A;  3P8C D;  4PD4 D;  1SZI A;  2YO2 A;  2FYU K;  5EK0 A;  2YQY A;  5TJH A;  3EG9 A;  3MZW B;  1ZU5 A;  5JLI A;  3EFO B;  3Q7G A;  1VQN P;  1OKK D;  2Y3H A;  3SXM A;  1T3J A;  2KIK A;  4PJ0 H;  2E76 C;  1VLS A;  2B89 A;  3QZC A;  3T97 A;  2D4U A;  2WQY C;  2ZYD A;  2MYS A;  3T6G B;  2WPQ A;  2W90 A;  3H6P A;  3L8I A;  5H2F E;  2IBZ G;  3AE1 C;  2PGD A;  4YPC A;  3GF7 A;  1SQX J;  5DQZ A;  1F1M A;  1NGM B;  3IFM A;  4L76 A;  3MYF A;  4CS7 A;  2FYU G;  1BCC D;  2OYH B;  1ZW3 A;  2E87 A;  4BJT A;  2OGU A;  2QSI A;  1FOS F;  1ZRT E;  2XL4 A;  2L6H A;  4MS2 A;  3IPM O;  3PRJ A;  2V4H A;  1KQG B;  1V55 C;  4DJG A;  1BZ4 A;  1M1J C;  1JR8 A;  2BEQ D;  3C8G D;  2AWY A;  2N1T A;  2OYO A;  1DIP A;  5KLV E;  2J8W A;  4MVZ A;  2HOD A;  1W2W A;  2GA0 A;  1VQ6 P;  4MVR A;  3U1C A;  3B0U X;  2RMZ A;  5EGY A;  4N6H A;  3H1H E;  1JCC A;  3L75 D;  1FZA A;  3Q1M A;  3GLM A;  2IXP A;  5DS5 A;  1WN0 A;  2M3B A;  3BRV B;  4C3D A;  3NMD A;  5KTB A;  5AW5 B;  1LTJ B;  1U89 A;  1JY2 N;  4O6N A;  4H54 A;  4BWN A;  5AVS B;  4Z9H A;  2YXR B;  3LW5 H;  2AU5 A;  4ZLD A;  4AUW A;  3F5H A;  4YTP C;  3S84 A;  2Z15 A;  3RK2 B;  1MFT A;  3U0C A;  4YT2 A;  1RE3 A;  4BEJ A;  2FXM A;  2NG1 A;  1USE A;  2PNO A;  5JS5 A;  2H8P D;  3O39 A;  1QVG O;  3SFD C;  1D1A A;  2KGO A;  4ZKP A;  5KYN A;  3CCS P;  3T9O A;  3JT1 A;  3AEB C;  4IAQ A;  1PPJ D;  2XL8 A;  1KB9 D;  3RFY A;  1MMG A;  2IZ1 A;  1K9M Q;  1HJB A;  3NMI A;  3UR3 C;  3H1L J;  1DEB A;  4CPG A;  1NTK J;  2K9J B;  3C62 A;  1A0B A;  1QSP A;  1OVV A;  2LFD A;  3PTZ A;  3WG7 C;  3P8M C;  4BXL A;  2KW3 C;  2CPS A;  2HZ8 A;  1S5L X;  3L71 J;  2G3V A;  4I1M A;  2IBF A;  2E76 B;  1VF5 D;  1NU7 D;  1JAF A;  1RF1 B;  2HMZ A;  3A0H H;  4GOE A;  2A45 G;  1ST6 A;  1WAT A;  3MFN A;  1RH5 B;  1PP9 E;  1QKR A;  4J30 B;  1RF0 C;  3FHD A;  4PD4 I;  1MV8 A;  5DS6 A;  5CCG D;  1CZQ A;  2HV6 A;  4WAB A;  4U5B E;  1HE1 A;  3G4X A;  3CCJ P;  4PK4 A;  3KZI E;  4RJT A;  1GW4 A;  5D91 A;  3L73 D;  4IL6 E;  1X8Y A;  3DAG A;  3AOU A;  1VPC A;  2QJK C;  3RK2 D;  2N1T C;  2CPB A;  1ORY A;  4NQF A;  1LT9 A;  1VYI A;  3L4F A;  5E79 E;  1NG1 A;  1RE4 A;  2VCB A;  3LLK A;  1S4X A;  1OIP A;  5B66 E;  3SXK A;  4OIO F;  2Q9I A;  2LSE A;  1W2B O;  4XLN F;  3U3F A;  2EPO A;  3N24 A;  2X0C A;  3T6B A;  3AE5 C;  4JJF A;  4XEF A;  5CCH D;  1U6H A;  3AQC A;  4I7Z C;  3CC2 P;  5BQG A;  3LNR A;  3L35 A;  2ZXP A;  1O87 A;  1M6T A;  2P61 A;  3CWB E;  3NMK A;  2C9L Y;  1T8Z A;  3B0P A;  2A6E F;  3AG4 C;  2OTK E;  1RHZ B;  1D1C A;  3G4S P;  4DVY P;  3KXD A;  2G8Y A;  1LP1 A;  5JVE A;  5KKZ B;  3M91 A;  3TUL A;  1NAF A;  2E76 D;  3H32 B;  2V7Q H;  1RE3 C;  4IOI H;  1LM3 B;  2QEX P;  3A0B E;  2F22 A;  4ZLC A;  1CPQ A;  1DOW A;  1M8O B;  4ULV A;  4MN4 C;  3Q5S A;  2W83 C;  1JPJ A;  2VB6 A;  3B8E B;  5AW0 B;  2AEF A;  3DWW A;  2CYD A;  2Y39 A;  4U3F J;  4Z9I A;  3M4C A;  3OEO A;  2E74 C;  1YJ9 P;  2ZYA A;  4L73 A;  4H0L B;  5E2Q A;  3EG9 B;  3VMZ A;  2B0H A;  5L0G A;  1N86 A;  4HJG H;  2ZXW C;  3AG2 C;  1DX7 A;  1HMD A;  2Z5I A;  3L72 E;  2XV5 A;  4JQ0 D;  3QW1 A;  4L75 A;  1Q82 Q;  1A7D A;  3BRT B;  2R3C A;  4PFO A;  4D4N A;  2DYR C;  2LKM A;  2YWA A;  5JRA A;  2A06 G;  3HE5 A;  2FYZ A;  3NTN A;  1J8M F;  4TT3 H;  4RO0 A;  1N1C A;  1KB9 I;  1M90 Q;  1A7E A;  1NWQ A;  3N4X A;  1RJ9 A;  3AEC C;  3M0D A;  3K1H A;  3TGU J;  1KC8 Q;  1LT9 C;  1R5S A;  2WWW A;  3L74 D;  4OGQ C;  2N1T B;  1JY3 P;  4KNW A;  4EWC A;  4WB4 A;  1HTL C;  3BVH A;  4G7O F;  4KBL A;  2HSQ A;  2HOD B;  4D6T D;  3B9Q A;  4OIR F;  3W68 A;  1YAU O;  4IFF A;  1NZE A;  1TFO B;  1J8Y F;  1YIT P;  5KYW A;  2M8R A;  4I7Z B;  4U5D E;  3U9M A;  2BCC E;  2LP4 A;  4OVN F;  4UB6 E;  1IFI A;  5APW A;  1ORJ A;  4MW3 A;  1SQP E;  3U59 A;  4KHX A;  1MND A;  3CXH D;  1OMI A;  3SZR A;  5L3Q A;  3IQ5 A;  2H43 A;  1BE3 J;  2XS8 A;  1J1E C;  1UFB A;  3QVZ A;  3FMS A;  3GWN A;  2QTV A;  2CNW A;  1HUC A;  3L37 A;  5FCL A;  1G4W R;  3RVY A;  3SSU A;  4O6Y A;  2IXN A;  4HEA J;  4PR9 A;  5AW2 B;  1EDK A;  5E33 A;  2RSE B;  1KYO E;  5JT4 A;  3PDM P;  1VB5 A;  3ABM C;  3LLI A;  4MTO A;  4U3F D;  4DZO A;  4Y99 C;  1AA0 A;  1X79 B;  3HUS A;  1NU1 E;  3NG1 A;  1KD1 Q;  1RMV A;  4Q5S F;  1LI5 A;  3M9B A;  2QM8 A;  1QLE D;  3W2W A;  3G71 P;  3S27 A;  1HBW A;  3VOP A;  3BAS A;  4JW1 A;  2V3C C;  1VDF A;  2HUJ A;  5KLV G;  2IBZ D;  2GWW A;  3H1I E;  2XLH A;  2N1T D;  4KI2 A;  3PMR A;  1J2J B;  2WSF H;  1SQB E;  2FYU D;  2YL1 A;  1FDM A;  2WSS H;  3C1L A;  3H1H G;  1ZV8 A;  1D7M A;  2Q3T A;  4IGG A;  3C8V A;  1MNE A;  1VOM A;  1EXJ A;  2P7V A;  3FVY A;  1PGQ A;  2LQG A;  3ASN C;  3CI9 A;  1VQ4 P;  3O10 A;  4XEV A;  1N8R Q;  3GG2 A;  5L0F A;  1L0N J;  3D71 A;  4YWQ A;  3CX5 E;  1JOG A;  3BCC J;  2R7X A;  3S28 A;  3H1J E;  1EZV I;  3AG1 C;  1U7M A;  4YXW H;  3M0D C;  3U8P A;  4NY3 A;  1RQV A;  1WT6 A;  1VQ7 P;  5B5E E;  1NTZ E;  2KNC A;  1MMD A;  1LT9 B;  3ASO C;  4CS9 A;  5C39 A;  3B29 A;  1TKN A;  1AVO A;  2HS5 A;  5CMZ A;  2XDJ A;  3ATP A;  5E3A A;  2L5G B;  5BQI A;  1K40 A;  2FFD A;  1MMA A;  1U0B B;  1SQQ J;  1MFZ A;  2W6J H;  1BR1 A;  1TWC A;  4ANJ A;  4OH8 B;  1OQC A;  5HSW A;  1HGV A;  3GOD A;  4ULW A;  2E74 D;  2C03 A;  4W7Y A;  1H8A A;  1BR4 A;  3NYJ A;  1YBK A;  1LP1 B;  2K1A A;  3RK3 B;  3LS1 A;  3A3Y B;  4JIO A;  3CXH H;  1LTI C;  2FY8 A;  1Q0G A;  3Q2Y A;  3PHF 2;  1SQV J;  3LW5 J;  3CC4 P;  2QE9 A;  2YIU B;  1NSG B;  3Q6M A;  3JSZ A;  2OEX A;  2XL6 A;  3HTK C;  2CGE A;  1PGP A;  3E1I A;  1CPR A;  2BC5 A;  1PP9 G;  1ZR2 A;  5L0J A;  1M1K Q;  1G2C A;  1KIL E;  3RGU A;  4CBE A;  4OWF A;  2Q00 A;  1LT1 A;  3ZG1 A;  1HMO A;  1AEP A;  2GA1 A;  3WMM 0;  1S3J A;  4RES B;  1Y6D A;  3C7J A;  4I44 A;  4Y99 B;  2R7V A;  5KAI H;  2YL7 A;  1YQ3 C;  3C8Z A;  3ZWI A;  2PF4 E;  3I5P A;  1PL5 A;  1VQO P;  3DE8 A;  1JY2 P;  1QQ3 A;  2AEJ A;  3QVY A;  1G1J A;  4H13 C;  3K6B A;  2IX7 C;  3EFG A;  1YYC A;  4PFP A;  2G62 A;  3CL3 D;  1N73 A;  3HE5 B;  3JZ0 A;  4NPD A;  4GIF A;  1YYX A;  3EPV A;  3NXS A;  2WL8 A;  3BRJ A;  3CWB G;  4AL0 A;  1N7S A;  1JM0 A;  3O8Z A;  2JD3 A;  1HW1 A;  3NYM A;  1BCC J;  1GW3 A;  2OYH C;  2I1K A;  4N78 E;  4Z1M H;  2AXC A;  3T4R A;  3H1K E;  1Q86 Q;  2UUI A;  3AE3 C;  1RY3 A;  3RK3 D;  2IFM A;  2K88 A;  1USD A;  1S5L H;  5AVQ B;  4CS9 C;  4EBB A;  3NFQ A;  5CJ0 A;  3I56 P;  2AXT H;  3TD7 A;  3VP9 A;  2FFD C;  1FE6 A;  1LNQ A;  3LES A;  5KLI B;  2J9U A;  3B4S A;  2A69 F;  4PJJ A;  3PCV A;  5KYW B;  2R7S A;  2KI7 B;  1BGY E;  1M2V A;  3UMK A;  3PHL A;  1H6G A;  1L0L E;  4EDF A;  4CSA C;  1T01 A;  4JBZ A;  4U5H A;  4CDV A;  2AWC A;  1RQU A;  3L75 J;  4O9B A;  2VH3 A;  3M15 A;  1FU1 A;  1YTZ T;  2DYS C;  2R03 A;  4WY4 A;  4FWV A;  3MD0 A;  1XZP A;  1LTJ C;  1EQ7 A;  3OA7 A;  3G4Z A;  3LEV A;  4DRJ B;  1VQ8 P;  1FMW A;  4I6M C;  1D0X A;  4JYB A;  4N4W A;  4PD4 E;  5FZT A;  3RK2 C;  2AP3 A;  1E84 A;  1OCZ C;  4XPW A;  5AVW B;  2WZG A;  1CGM E;  2ZVO B;  1RXQ A;  2CCY A;  4DRI B;  2KLU A;  2K37 A;  4YJW A;  4IRU A;  2Y9Y A;  2W9Y A;  1LTS C;  3AEF C;  3P32 A;  2DGJ A;  1ZHZ A;  3HUS B;  3DM5 A;  2O9X A;  1PV3 A;  3W4Y A;  5AC5 A;  5F5F A;  2WZL A;  4U5G A;  1GQA A;  2RN0 A;  2BE5 F;  3G6E P;  1SQP K;  1VQL P;  5AVU B;  2MJZ A;  4U5F E;  2PAJ A;  5AVY B;  4MVS A;  2YXQ B;  1TWG A;  1LE2 A;  2RKL A;  2A06 D;  2OQQ A;  2WPR A;  4LDK A;  4BG0 A;  256B A;  2A45 H;  1D1B A;  4D4X A;  1PFI A;  4H13 B;  1YVI A;  2OG2 A;  5GTH E;  1D0Y A;  2EIM C;  3CME P;  1VQK P;  2XRH A;  2I15 A;  1RF1 C;  3GEH A;  4IJJ A;  2OU6 A;  1S9K D;  3FDQ A;  2BCC G;  1CSB A;  1X9V A;  4OIN F;  2VCC A;  3CCM P;  1NU1 K;  2EPN A;  1SYQ A;  3U3B A;  1SQP G;  2OJE D;  2GM4 A;  1LIH A;  4P6I C;  1GZL A;  1P84 E;  4JUR I;  4PJL A;  2RH0 A;  3FWL A;  4WJ0 A;  2A0U A;  2KNC B;  1YA9 A;  1H9T A;  1EC5 A;  1V54 C;  3L73 J;  4E0H A;  1SQB K;  1O5H A;  2A45 I;  2CNW D;  4NTB A;  3AE6 C;  1AVO B;  4R32 A;  3HD7 A;  1QGK B;  3TF5 A;  1JMW A;  3GOR A;  2B0J A;  1NTM E;  3AEG C;  2GUS A;  3ITF A;  3HNL A;  3KQG A;  2FFD B;  5AW4 B;  3SWF A;  2P0N A;  1NU1 G;  4RDA A;  1Y9B A;  2PX0 A;  3UNG C;  1C03 A;  3ZIB A;  4Y28 J;  3L70 G;  3JTL O;  2UUH A;  4XPX A;  2R5D A;  3V7O A;  4EKW A;  3OJA B;  2IYP A;  5APS A;  4WY4 C;  4BRY A;  2HV7 A;  1PCX A;  3PH0 A;  3H1I G;  2EIL C;  1NU9 C;  1LS4 A;  3DI5 A;  3SYN A;  1GL2 A;  1NTZ K;  3QWO C;  1WMK A;  1ZN5 A;  3GF3 A;  4GDO A;  1M57 C;  1SQB G;  2ZYG A;  1ZHX A;  4BJ6 C;  4FES A;  1T9K A;  1YA7 O;  3TJ6 A;  1PPJ E;  2JWD A;  3L1M A;  2E5Y A;  1VQ5 P;  5KKZ C;  4YL3 A;  1SFC A;  1KB9 E;  3CPW O;  2D5R B;  4H13 D;  4E18 A;  4JYC A;  2R25 A;  4M63 A;  2J5U A;  1G2C B;  2KSJ A;  5IY5 C;  3S1K A;  2YHS A;  2HYN A;  4CJG A;  2JKV A;  2VRS A;  1M56 C;  1Z23 A;  1E83 A;  2Y0C A;  3KPE A;  4MW8 A;  3K66 A;  3H1J G;  1FFH A;  2YLI A;  1VMA A;  1AQ5 A;  4RBN A;  3ZTZ A;  3VF0 A;  2R3S A;  3IR9 A;  4R4L A;  3CAX A;  4LER A;  1NTZ G;  5TIS E;  4JE9 A;  1OXK A;  5A6K A;  5A6B A;  1EDI A;  4AE4 B;  4KT0 J;  4H0L C;  4BJ1 A;  5GTI H;  2P7J A;  2WPV B;  4DCK A;  3CCV P;  3H1H D;  1SQX E;  3W2V A;  3H25 A;  4MQ9 F;  4E17 A;  1KV4 A;  3FAP B;  4G0H A;  5AW1 B;  3BAT A;  3I5Q A;  4EBK A;  2MKV A;  1N73 B;  1QPU A;  3C63 A;  3ZSU A;  1KZU B;  2WSF J;  2OYI A;  4CX9 A;  5E3C A;  1C17 M;  1PGO A;  3AE9 C;  2LXC B;  3MP7 B;  2XS1 A;  1N7S B;  4MVO A;  5JP7 A;  1EKY A;  1IJD B;  4UB8 E;  1H0T A;  2POH A;  1MKM A;  4CDY A;  2J7P A;  3VRC A;  2ZXR A;  4KC9 A;  4LDQ A;  4DBR A;  1QLE C;  4DOJ A;  3B71 A;  3RQF A;  3HD7 C;  1WTY A;  3E7K A;  2WVR A;  5K5G B;  3AEA C;  2P58 A;  3L74 J;  3B5N A;  3QH9 A;  1URQ A;  2XXA A;  3AQB A;  2XU6 A;  2KQ9 A;  2M0B A;  1ZP0 C;  3HNI A;  3HE4 A;  3V4W A;  2OKU A;  1VQM P;  4D6T J;  5DJU B;  1SF8 A;  1R8E A;  3C9I A;  4YT4 A;  1Y47 A;  1M2V B;  2I8D A;  2KSE A;  3I55 P;  1Q0F A;  5AVX B;  3CC7 P;  1M2O A;  1QZX A;  2JJL A;  2QUP A;  1RKE A;  4Q7C A;  2D2C B;  4U7J A;  4XPY A;  4WY4 B;  5H2F H;  3ZQV A;  3E1R A;  3ZTM A;  1FFT C;  1KIL A;  3K33 A;  1NKN A;  3LJB A;  3DJN B;  4N3Y B;  1IO4 A;  3PP5 A;  4E7Z A;  4E7S A;  4DOZ A;  2WVN A;  1EZV E;  3H1L E;  2BEZ F;  2Q7C A;  3G50 A;  3BEH A;  1NTK E;  2PP6 A;  1FAP B;  2R9R B;  2HLO A;  5APV A;  3HJC A;  2Y9Z A;  2E5T A;  1YJN P;  1FDI A;  1L0L K;  1N7S D;  2WB7 A;  2ZXX A;  3H1K G;  3E9V A;  3L71 E;  3L0I A;  1H89 A;  1PGJ A;  1GMJ A;  2XLE A;  1OXB A;  5CBO A;  1LTG C;  3WOD F;  3VAY A;  3AE2 C;  2KJG A;  3FXD A;  1OW6 A;  3MLG A;  1K04 A;  5CI8 A;  1S05 A;  1MUU A;  2W6B A;  1A7V A;  4KNV A;  4YL1 A;  2NUT A;  3CWB D;  3CCU P;  2OYI C;  4NPE A;  2W4M A;  1OR3 A;  2FYU J;  1OR2 A;  1BGY G;  4PJM A;  4AQR D;  3RL0 C;  1WGW A;  1L0L G;  1PD1 A;  2WIT A;  1NHL A;  3MYI A;  1EDL A;  1Q81 Q;  2Q9A A;  1XZQ A;  5KYX A;  2LXB A;  3MUD A;  4LLC A;  4QI0 A;  1APC A;  1HGZ A;  1RKC A;  2AVK A;  4WY4 D;  5L3V A;  4BEM J;  4CIP A;  3W67 A;  1Q0M A;  1BSH A;  4UDV A;  1LWU A;  4YT5 A;  3A7O A;  3K7D A;  1YIJ P;  1LI7 A;  3TK1 A;  1M57 D;  4XEK A;  2EIK C;  4I1L A;  3HD7 B;  3HNJ A;  2Y0E A;  4JPZ B;  3U2M A;  4J32 B;  1S1C X;  2XLO A;  2N9Y B;  2ASR A;  3SFE C;  1RE4 C;  2P1A A;  4JCZ A;  5AW6 B;  4X0R A;  2ICW G;  2M3E A;  1OCR C;  2HR3 A;  3CLQ A;  4PV1 B;  2YRF A;  2NSG A;  2QVA A;  1AJY A;  1ZVZ A;  4O7G A;  1KMI Z;  1M56 D;  2E43 A;  5DVW A;  3V2P A;  1X22 A;  5B1A C;  4BRY B;  5EFW B;  3RQE A;  3TJ5 A;  1HJ0 A;  1GL2 B;  3GM2 A;  4A2N B;  1NH4 A;  4H0L D;  5AVT B;  4C3E A;  3PJS K;  5DJT B;  2PFX A;  2H89 C;  3RK3 C;  2JX0 A;  1SFC B;  1SLQ A;  4U3F E;  3EZH A;  1NTM K;  5BQH A;  5KJ7 A;  2A68 F;  2YIU C;  3Q5R A;  5CI9 A;  3KZI H;  5KLV K;  3FAJ A;  3RW0 A;  2NRG A;  4MVQ A;  4IL6 H;  3KDP B;  2IZ0 A;  2ZVN B;  2H7H A;  1MQV A;  5E79 H;  4NCQ A;  2GFH A;  5COM A;  2FYU E;  4HKZ H;  3GEE A;  1CGO A;  2J59 M;  5B66 H;  4CS8 A;  1K73 Q;  2V26 A;  3WUV A;  1GD2 E;  1OXZ A;  2W4B A;  3RBZ A;  4WVZ A;  4QI2 A;  2VC9 A;  1NTM G;  3LUT B;  3HD7 D;  2BCC D;  2QY9 A;  4B6I A;  2EPL X;  1JB0 J;  3U2L A;  2YKP A;  2OYI B;  4ONS A;  1PIX A;  1SQP D;  5L8R J;  2JP3 A;  5AW8 B;  4IFM A;  3M0A A;  3MTU E;  3RL0 B;  5L0H A;  3CD6 P;  2P2U A;  3CQZ A;  1Z63 A;  1S5L E;  3I5C A;  3TGU E;  5BU5 A;  1HWT C;  3A0B H;  1YYJ A;  1H0T B;  1VK5 A;  3WUU A;  3AGU A;  3X1O A;  1OW7 A;  3V5Y A;  1GL2 D;  4ZNC A;  3IQ6 A;  1SQX K;  4K35 A;  1VTM P;  3MHV A;  3DZA A;  2E42 A;  1A02 F;  1LTA C;  3P7K A;  3IF4 A;  3K1I A;  1AUE A;  1R5L A;  3EGX A;  1NU1 D;  3VP8 A;  3B5N B;  2KYH A;  2Y69 C;  3IEE A;  1IFN A;  1URQ B;  2JEE A;  2XXA B;  4ZKU A;  5COF A;  3L70 D;  3CCE P;  3HE4 B;  2NUP A;  1C02 A;  3JSE O;  2OOC A;  4NC3 A;  2O01 H;  5KLI C;  2N9B A;  3H1I D;  1KN7 A;  3AE4 C;  3ABL C;  1BE3 E;  4CJO A;  1I4Z A;  5AC4 A;  3KHU A;  1RKE B;  4YL0 A;  1SQB D;  4KJM A;  1WAS A;  1FJK A;  1ZW2 A;  3EQ2 A;  3HKK A;  3POV A;  1SQX G;  5L0D A;  2Y3G A;  5A6B D;  1TWH A;  4EIY A;  1KIL B;  5KAF E;  3JYH A;  1CI6 A;  4LDR A;  1JUN A;  2EIN C;  3A11 A;  2ZXO A;  1FZG A;  2GDC A;  5AW9 B;  3DXJ F;  1JPN A;  3LAY A;  3PLN A;  1GU5 A;  1QL1 A;  3EGD A;  5CJ4 A;  4N6C A;  3CX5 D;  1ZU4 A;  1HE9 A;  3H1J D;  2HPC A;  4ER9 A;  3WU2 H;  3GMA A;  3LID A;  3TK0 A;  2IYL D;  4I1O B;  2IDB A;  1S7Z A;  3RL0 D;  2NPS A;  1NTZ D;  2WT7 A;  4OIP F;  1LVK A;  2QM7 A;  2LCH A;  3RBX A;  3JCU H;  3N0T A;  3KYQ A;  3M9Q A;  2J9V A;  4PJ0 E;  3LNM B;  5CCG A;  3HUS C;  2QIW A;  2L7A A;  5F28 E;  2J7P D;  1J1D B;  4C46 A;  5DLJ A;  1ORS C;  1JRA A;  1LTT C;  1KOR A;  4CDA A;  1LGH B;  3M9H A;  4AE4 A;  2NUT B;  1YZC A;  2YMK A;  2CDQ A;  3CXH I;  2ZAE B;  3UIA A;  2BL2 A;  4NPF X;  2B88 A;  3V6I A;  4UB6 H;  1L0N E;  1GK6 A;  1NTK K;  1VQ9 P;  3BCC E;  2CW0 F;  1L2P A;  3SWK A;  1BSN A;  2QJY C;  1T6Q A;  4WGY A;  5KYX B;  3UGO A;  4W7Z A;  1FNT c;  2PFD A;  1KIL D;  1EDJ A;  1U57 A;  1LWU B;  1K8A Q;  1JY3 N;  4ASV A;  3K1I C;  3EH1 A;  1BDD A;  2QG4 A;  5T3W A;  3VM6 A;  4J7Y A;  1EZV G;  3H1L G;  2KOG A;  1SQQ E;  3SP1 A;  1NTK G;  2XLW A;  2H88 C;  1B68 A;  2UWJ E;  2IBZ I;  2R05 A;  2EPK X;  4GOF A;  3NMJ A;  1FZC A;  3L34 A;  3L71 G;  3G9R A;  1KQS O;  4OD4 A;  1SQV E;  3GW6 A;  2WSE J;  2IFN A;  5B3S C;  4IL6 X;  2IYO A;  2KZI A;  5AVZ B;  1YJW P;  1Z3I X;  2JPU A;  3W8I A;  1DH3 A;  1CW5 A;  2KNH A;  3EHM A;  3AJM A;  2IM8 A;  3K5B A;  4IAO A;  2KYV A;  1JOC A;  3L72 G;  2WVO A;  2KSF A;  1IFJ A;  1JY3 O;  1T3U A;  5APY A;  1GU4 A;  1M1J A;  4RD9 A;  3S90 A;  4N78 D;  3CX5 H;  2NZ2 A;  2ZJS E;  3SXZ A;  2QJP B;  3H1K D;  3GM3 A;  3R2P A;  3P8C E;  3CCL P;  2R7Q A;  3RIP A;  4AK9 A;  5B5E H;  2ZXE B;  4GT1 A;  1E86 A;  3FOO A;  1BDJ B;  1G1I A;  1JO5 A;  4XWJ A;  2E75 C;  3USS A;  1L3P A;  4QDL A;  3CMA P;  4O6M A;  2W8Z A;  5CIV A;  5KLV J;  4U9E A;  4EOT A;  3X2Q C;  2J58 A;  1IFP A;  3A0H E;  3L36 A;  2C0W A;  1BGY D;  4HB1 A;  1H7I A;  1MZ9 A;  1L0L D;  2YEV A;  2AEM A;  2O1K A;  3S29 A;  3H1H J;  3KPH A;  3TNU A;  3QW0 A;  2R7R A;  2WPS A;  2Q9B A;  3ZDL A;  1BCC E;  4HFF B;  4L6R A;  2Q6Q A;  3AGT A;  1N73 C;  3CCR P;  1T5O A;  2H7O A;  4R4M A;  2QJY B;  4DT0 A;  4DXW A;  2WMM A;  1EA8 A;  3ZDM A;  4F4B A;  4JCH A;  4U5E E;  1N7S C;  2L91 A;  3U9J A;  1Q90 D;  1VYK A;  1SVF A;  3S9O A;  1HY5 A;  4NTF A;  3RKO F;  2LD6 A;  4U3F G;  4W80 A;  4YN0 B;  2Q3I A;  4ZMD A;  2FKW B;  1KTM A;  3EGX B;  5A69 A;  2Q5U A;  1E2X A;  2ZFC A;  1LE4 A;  5KJ7 D;  3V5B A;  1XWJ A;  1SMY F;  1ZHW A;  2EPM X;  1FZC C;  2L6G A;  3CSK A;  1OX3 A;  3L75 E;  2H7B A;  2NUP B;  3UMI A;  3MGN A;  1S2E A;  2LK4 A;  2R44 A;  3AE8 C;  3HNK A;  2M5A A;  3EFF K;  2RD9 A;  1KFN A;  2IOQ A;  4C7O A;  5AW7 B;  2LR2 A;  4FX5 A;  3DE9 A;  1RF0 A;  3ZVR A;  1E85 A;  1FS0 E;  3MX3 A;  2YLG A;  4RKU J;  3UMH A;  1CI6 B;  4IB4 A;  2GAQ A;  2NPU A;  4HE8 D;  4EI2 A;  2D2C C;  4JTA B;  2SPZ A;  1BDC A;  4FAP B;  2W27 A;  2VCA A;  4Q4Z F;  3JCU Q;  2FYN B;  3US6 A;  3U5S A;  3EGD B;  3LEO A;  1VF5 B;  4MVU A;  1PP9 J;  2KC3 A;  1V74 B;  1R5I D;  2Y0D A;  2C9N Y;  2HPC B;  3LS0 A;  1VLT A;  1FAV A;  2G3A A;  5L0C A;  1P84 D;  4IWB A;  3DKA A;  3TGU G;  3FXH A;  2NPS B;  2J9W A;  1OVU A;  2WT7 B;  2QRX A;  2Z5H A;  1ZRT D; 
#chains in the Genus database with same CATH homology
 5M1B A;  3JZ0 A;  1OW6 A;  2QIW A;  3D70 A;  1WOL A;  1EXJ A;  4TT3 H;  1K04 A;  1V4A A;  1ZRT E;  2FYN C;  1EXI A;  1HF9 A;  5F28 E;  1OW8 A;  2E75 B;  2MKV A;  4EBK A;  2L6H A;  3O10 A;  4XEV A;  3BRJ A;  1VF5 C;  1KQG B;  2WSF J;  2QJP C;  1KOR A;  3D71 A;  1DD3 A;  2FXP A;  2BEQ D;  1JOG A;  3AE9 C;  3AEC C;  3C8G D;  1JB0 J;  2QJK C;  2YMK A;  2ZT9 D;  4Z1M H;  1PIX A;  3O6Q A;  3IAO A;  1DIP A;  1KQF B;  1NYH A;  1RQV A;  5L8R J;  4NQF A;  2JP3 A;  4YXD C;  1TU3 F;  4OGQ C;  1KNY A;  1WWP A;  3AE3 C;  3ABV C;  1MKM A;  2QJY C;  3U3F A;  1ZME C;  3AEE C;  4R4M A;  4H44 D;  3Q1M A;  3AE5 C;  3GLM A;  1QVX A;  4XFJ A;  4XEF A;  1K40 A;  1OW7 A;  4I7Z C;  3AE6 C;  3B71 A;  4R32 A;  3RQF A;  1WTY A;  3K7D A;  1DD4 A;  3Q3D A;  3JYY A;  3C8G A;  1Q90 D;  3AEA C;  3S9O A;  4XEK A;  3AEG C;  4I7Z B;  2ZT9 C;  1U57 A;  1ZZP A;  2V7Q J;  3R4Y A;  2G8Y A;  3C8G B;  1ZP0 C;  4YTP C;  1S1C X;  2ZT9 B;  2E74 D;  3IN6 A;  3SFE C;  3C18 A;  1Y9B A;  3U0C A;  1RQU A;  4PV1 D;  1R8E A;  3TUL A;  1OMI A;  1UIX A;  3AED C;  2E76 D;  2H88 C;  2E74 B;  4Y28 J;  1KTM A;  3RK3 E;  3D6Y A;  1K05 A;  4PV1 B;  4H44 C;  1ZOY C;  1UFB A;  1AJY A;  3Q2Y A;  1KMI Z;  2L6F A;  2D2C D;  3SFD C;  2PBE A;  4EBJ A;  3AE7 C;  3LW5 J;  4OGQ B;  2L6G A;  3Q5S A;  3D6Z A;  5KLI C;  2P10 A;  3G9R A;  4H44 B;  1YQ4 C;  2D2C B;  3AEB C;  4U7J A;  3T97 B;  2LK4 A;  3AE4 C;  2KK1 A;  1WMK A;  3GF3 A;  4GDO A;  3RQE A;  3AE8 C;  3EWK A;  2WSE J;  1HJ0 A;  3RQG A;  3GM2 A;  1VL2 A;  4IL6 X;  5KKZ C;  2WSC J;  4H0L D;  1KIL E;  4H13 D;  2JPU A;  4OGQ D;  2JO1 A;  2Q00 A;  2E74 C;  4H0L B;  3AJM A;  2J5U A;  2H89 C;  2O01 J;  4PV1 C;  2JX0 A;  2E75 D;  2HSB A;  2E76 C;  3Q5P A;  3FGA D;  1FDO A;  4RKU J;  2BEZ F;  3AEF C;  1S5L X;  2D2C C;  2YIU C;  2E76 B;  3AE2 C;  3Q5R A;  3GM1 A;  3L8J A;  1PV3 A;  2WQY C;  1VF5 D;  2FBW C;  1YQ3 C;  3RL0 g;  1FDI A;  3GMA A;  3L8I A;  3AE1 C;  1VF5 B;  3GF7 A;  2NZ2 A;  1PL5 A;  2IDB A;  1NGM B;  3GM3 A;  4R4L A;  2K9Y A;  1IK7 A;  1GMJ A;  2YWA A;  2G3A A;  4H0L C;  4KT0 J;  1O3U A;  4H13 C;  3MFN A;  2OQQ A;  2WPV B;  2QSI A;  3H25 A;  2E75 C;  4H13 B;  3C8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...