1OW8A

Paxillin ld2 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Molecular Recognition of Paxillin LD Motifs by the Focal Adhesion Targeting Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 60
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow8A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow8A02
3AEFC 3GM2A 1ZP0C 3O10A 1OW6A 1JOGA 3C8GD 1QVXA 3AE8C 2Q00A 1ZZPA 4XEKA 1PV3A 2JX0A 4YTPC 1KNYA 2L6GA 3AJMA 3SFEC 3S9OA 3C18A 3C8GB 3JZ0A 4EBKA 4R32A 1K05A 1WOLA 4XEFA 3L8IA 2H88C 2KK1A 3RQFA 1K04A 2L6FA 5F28E 2JPUA 3SFDC 3ABVC 3AE6C 1KTMA 2WQYC 3RQGA 1OW8A 4YXDC 3B71A 1OW7A 4EBJA 3BRJA 3MFNA 3AEEC 3AEDC 3RQEA 1V4AA 1K40A 3K7DA 1UFBA 3L8JA 3AE2C 4XEVA 3JYYA 3AEGC 1YQ3C 3AE7C 2PBEA 3AE4C 1O3UA 3C8GA 3U0CA 1WTYA 1ZOYC 2LK4A 3AECC 3U3FA 2YWAA 1WWPA 3AE1C 2H89C 3AEAC 2FBWC 2L6HA 4NQFA 3AE5C 3AE9C 3AEBC 2HSBA 3GM1A 3GM3A 1YQ4C 3TULA 2G3AA 3AE3C
chains in the Genus database with same CATH superfamily
3AEFC 4Y99B 1SQPJ 2YKPA 2AWYA 5L3QA 1ZP0C 5KLIB 5BU8B 1HY5A 2HYNA 4OGQD 2J9VA 3T6JA 1AA0A 2P6VA 2E87A 1N73A 2H43A 1EA8A 3KYIA 4U9EA 3CZ6A 1I4ZA 2KZIA 2XLEA 2PP6A 1SQQJ 3LS1A 2XS1A 1NTZD 3B0PA 1M2OA 1S7ZA 2W6JH 1ZHZA 2P0NA 5A6JA 1NFNA 3AG2C 4PFPA 4CS8A 3C9IA 2V4HA 3KMIA 3EG9A 3WG7C 2NPSD 1LGHB 3GANA 3PTZA 3ZDMA 4H0LC 5AVUB 4QI2A 2CNWD 1HWTC 256BA 2R7OA 2OCCC 1HJ0A 3NFQA 1DH3A 2L7AA 3DJNB 4NY3A 5APSA 3WODF 2KOGA 4TLFA 2E5TA 4EWCA 2Y0DA 3PH0A 4U3FD 3BCCD 3SXYA 1KYOH 3SXKA 2YHSA 4IGGA 1OQCA 3EJNA 2KK7A 1YQ3C 2WMMA 1BSNA 3H1KD 4L75A 2FYUE 2Q3EA 3MHVA 2W4BA 4MVOA 5CCGA 3JC22 1WTYA 3MYIA 2LXCB 5BU5A 4J32B 3N4XA 4YPCA 1RY3A 4NQFA 1GQAA 3RGUA 3FHDA 1TFOB 1YLMA 1D1CA 4HKZH 3S84A 2J9BA 3PJSK 5KKZC 3H1IG 4EKWA 5L0DA 4NTFA 3CCEP 3I5CA 2ZXPA 3E1RA 1S9KD 3NG1A 3NDBB 3CPWO 3AQBA 3D6ZA 1H88A 2K9YA 1JY3O 5TISE 3RK3D 2IXNA 2DGJA 1HTLC 2Y69C 2ZVNB 4O7GA 1OW6A 4JTCB 2G62A 1NG1A 3SXZA 3JRMO 3E70C 1UIXA 1EDLA 4C46A 1EZVD 1L0LJ 5GPGB 2QIWA 1U0BB 3CX5I 3RBZA 2EIJC 3DAGA 3CWBJ 4CSAA 1MKMA 3FDQA 1LWUC 1A41A 3KQGA 1FOSE 1N2DC 4L74A 1Z56A 4C3EA 4C7NB 1PP9D 2RH0A 1DIPA 2FKWB 2EIMC 4XFJA 2C04A 3CQZA 4DOJA 5AW3B 1H0TB 4XPWA 3QTHA 1E84A 3L0IA 5APXA 3POVA 3C63A 5L0CA 1KTMA 5DS6A 1ZHYA 4Y99C 2J7PA 3USSA 2JWAA 1NTZG 1NU1E 1O87A 1W2WA 3V4WA 4HJGH 1SQBG 2KNCA 4K1OA 2HG5D 1PD1A 2W9YA 1GU4A 1NTMD 4JTDB 4EBJA 4L73A 1SQVK 3WUVA 1WT6A 3BRJA 4P9TA 4PJLA 4O79A 2D2CB 3OW2O 4I44A 3K1HA 1QSPA 2AXTH 3CEXA 3QW1A 3UMIA 2E74C 5FZTA 5APVA 2R44A 5L0GA 1NAYA 1EQ1A 2NUPB 5T1DB 3PLNA 3VP8A 1EXIA 2IBZI 3NKDA 3OWTA 2XV5A 1IJDB 3ZQYA 2HV6A 2HLOA 2ITAA 1FFTC 2H89C 4U3FG 3L71J 3BCCG 1NU7D 2UWJE 1FZFA 4GOEA 3O8ZA 1HE9A 1ZHWA 4JQ0D 3AEBC 1T01A 4IL6X 3SXMA 2YLIA 2WSSH 4FESA 2E5YA 4N6JA 1DD3A 5AVXB 3RH3A 2KC3A 1D7MA 2AWCA 3L72E 2EPNA 4NTAA 3TK1A 5L0HA 3GF7A 2P10A 4Z9JA 5TJHA 3A2AA 1NVOA 2CW0F 4JVSA 5COFA 2NUTA 1JOCA 4UB6E 4YTPC 1E5WA 4GDOA 4ASWA 5KYXB 3JT1A 2XXAB 1SFCA 1OCZC 2XL6A 1LPEA 3C8GB 3F47A 4A2NB 3R7CA 2HFED 3TDKA 3U9MA 4G7OF 1YTZT 5EK0A 1G1IA 3JTLO 1BCCE 2IXPA 2A45G 3I5PA 3G9RA 5A6BD 1TWAA 1I4YA 5JRAA 5KYYA 2ZXEB 3C8VA 3DE9A 3OA7A 1IC2A 2WSCH 4WBAA 3SFDC 1SMYF 4BJ6A 2DW3A 3CC7P 2QJYB 1I5NA 3T6GB 3MZWB 1YA7O 1FU1A 2M5AA 1W2BO 4E0HA 3RQGA 1T2KC 1GGQA 2J0WA 1VQ6P 1L0NK 1KB9H 4KNWA 2N1TB 2VB6A 1YI2P 3SYNA 3LESA 2XM0A 2JWDA 3B71A 3RF3A 1APCA 1EDKA 1OW7A 1X9VA 2Y3HA 4Q5SF 2A45I 1PP9G 4H0LD 2YIUB 1FAPB 4GT1A 4W80A 1Z23A 3ZC4A 1KILA 2P7VA 4NPDA 5AVWB 1EZVI 1XZPA 5F5FA 1JR8A 3L75E 4DRHB 1NTKK 2QE9A 4DJGA 1OX3A 2OEVA 3CLQA 2B89A 4DOZA 1S72P 1WN0A 2QSIA 3ZDLA 1NTMG 4YT4A 1A7DA 4BWNA 1GZLA 4U5EE 2J8WA 2HODB 1S4XA 4F4BA 1ZVZA 5DVWA 3TQOA 2VCBA 2FYUD 2HSQA 3RYLA 4RO0A 1JMBA 5CIVA 2KI7B 1NGMB 2B88A 4OD4A 1E86A 2K1AA 3K6BA 2YVKA 4NPEA 2W6BA 1VF5B 3NRHA 4EI2A 3C1LA 3H1IJ 1VQNP 2NPSA 1RH5B 3VP9A 3U2LA 3IFMA 4AL1A 3O6QB 2V7QH 2B0HA 1RF1B 1JY2P 3QZCA 4OIRF 2BC5A 2P58A 1MQVA 2M64A 5T3TA 1OIPA 2J58A 1SVFA 3LIEA 3V7OA 4EBKA 2VCCA 3HNJA 4JE9A 4IFFA 1J8MF 1X79B 1USEA 1HH0A 1WOLA 1QQ3A 4FAPB 3A5TA 3K1IC 1Q0MA 4LERA 3HE5A 1YITP 3GORA 3CL3D 1FNTc 3L73G 1G4US 1YHQP 2C03A 1X22A 1SQBE 3CCVP 1J8YF 1SS1A 3AG4C 1L4AC 5F28E 1U89A 3M0DC 1MMNA 4RESB 3W2WA 1GL2B 3DKAA 3FOPA 1LS4A 3EZIA 3W8HA 2FFDA 2R7WA 4G78A 1RCPA 3NMJA 1Z63A 5AVTB 2R02A 1MZ9A 4ZKUA 4MNDA 2J45A 1YYCA 1RE4A 1NTZJ 1IFIA 5BUOA 1P84E 5APTA 1CI6B 1FDIA 3SWYA 2ZJSE 1SQBJ 2FXMA 1TU3F 1SQXE 1V4AA 3L70E 1NU1D 1OCOC 1YJNP 1N7SA 2OEXA 1SLQA 1PPJE 3PP5A 3TGUE 2Y3GA 3DD7A 1T8ZA 3L71D 3EGDB 1AV1A 2X0CA 2WL8A 2YKZA 1ZOYC 1R4TA 2LK4A 1LTJB 4G7ZF 3ABKC 2YL7A 2NSGA 3E9VA 4KI2A 1M7LA 1MUUA 4HH2A 3N0TA 1SQXJ 2XU6A 3B0UX 2QM8A 1AVOB 1T6UA 2DYSC 1Y4CA 3SNHA 1LTGC 3GM1A 4U3FJ 5K5GB 1JTHB 3BCCJ 5CJ0A 3TGUJ 2D4UA 3MLGA 1CGNA 5B5EH 5E79E 1NJIQ 4W7YA 3CAXA 1X8YA 4N6HA 1GD2E 2KYHA 1ZZPA 1A02F 2QUPA 3G4XA 1RKCA 4QI0A 3FAJA 1LVKA 3SWFA 3L72D 3BRVB 2FYUG 2HPCB 1M57C 2WSEJ 4DBQA 2M0BA 3Q6MA 4J7YA 4Z9HA 3M9BA 2IFNA 4ZKPA 1OKKA 2WT7A 2KZJA 2WZFA 2IX7C 3IR9A 4C7OB 2OTLP 3Q5RA 2RMZA 1S2EA 2OYOA 2EPMX 5APWA 3QH9A 3VTPC 5KTBA 3H1LE 1DEEG 2EPKX 1FZGA 2W83C 3LEVA 3SP1A 3LEOA 2OYHC 1ORSC 1VDFA 3RK2B 5AW9B 2J9WA 1HVVA 2MKVA 4ULWA 3K5BA 1OW8A 1VF5C 1LIHA 1FC2C 3PHLA 3HTKA 4HB1A 2ETSA 2XRHA 3ZWIA 3R4YA 3B4SA 1N73B 3VMAA 2JR8A 2W90A 3BASA 4C7RA 4H44C 1RF1C 4U5GA 4KNVA 3H1LJ 1QL2A 1S05A 3QVZA 4ASVA 1KFNA 2O1KA 4BJ5A 1K40A 3JSVC 4CDVA 3WMM0 4YT8A 5L0IA 1T2KD 4CS7A 2KLUA 3EQLF 3DXJF 1SQVE 3JYYA 3AEGC 5AC4A 3U2MA 3MTUE 4RD9A 2M3BA 3UGPA 2YKOA 3EG9B 2JJLA 3Q7GA 3O6XA 1NWQA 3M9QA 1VQMP 1S1CX 1M56C 5DQTA 3SSUA 4WJ0A 1LTIC 1GL2C 1T6QA 1KYOE 3L75D 2LKMA 4Q7CA 1GM5A 4BJTA 1NU1G 2WPSA 3L74E 1NTMJ 1NBBA 3HJCA 4PD4H 3H1ID 3ITFA 3FX0A 1TWGA 2KJGA 2HZ8A 2J9UA 4YXWH 3J06A 3P7KA 5GTHH 2PFDA 4ANJA 3RVZA 5A6BA 3ABMC 3VMXA 3HLZA 4XWJA 3DZAA 1VQOP 3FWLA 4XTKA 3JRTA 2QE7H 2FXOA 5JSLA 1Q0GA 1Y8AA 1JO5A 1MMGA 3I55P 3L73E 5KYNA 1Q0FA 1IK9A 2KYVA 4JCHA 3QVYA 1E2XA 2GFHA 4JF7A 3H25A 2LCHA 2YXQB 1ZR2A 4OVNF 3U3BA 3OJAB 1LTJC 1H9TA 1DOWA 4P9FA 3BEHA 1RKEA 1LTBC 2VH3A 4JIOA 1WASA 2LD6A 5H2FH 3AQCA 2NSFA 3N7NA 1YTZI 1FZCC 3VYWA 3UR3C 1OVVA 1HMDA 2QTVA 3B5NA 5KJ7C 4E17A 2L5GB 3L72G 3L73J 3NYMA 4BPMA 4AL0A 2R03A 5KYWA 5AVQB 2V26A 3TOMA 2JD3A 1Z6AA 2J46A 1D0YA 2NRGA 1YYXA 1SQBD 2H7OA 3IHUA 5A69A 3Q1MA 1IW7F 2R7VA 1EI7A 3W4YA 1L4AD 1PGOA 4J7TA 3I4UA 3ZSUA 3WUTA 3K33A 2YRFA 4PJJA 4A4AA 3HE4A 3Q2YA 1ZHTA 1VQLP 3PDMP 5AVSB 5KYUA 4KT0J 2B0JA 1BCCG 1VLTA 2X51A 1CZQA 1FJKA 2QY9A 1P84D 1LP1A 3KDPB 2QRXA 4JYBA 2P67A 4R4MA 1SQXD 3G71P 3LLKA 3V5YA 2KXPB 3HD7C 3L70D 3TK0A 3RK2C 1RQUA 2R7QA 4EIYA 4DVZA 3FVYA 1NTKE 1PPJD 4IFMA 3ABLC 3TGUD 2OU6A 1FMWA 3ASNC 4RBNA 2CPSA 2WPVB 1Q0DA 1YZAA 4ER9A 2KNCB 2AXTE 3B9QA 2Q9IA 3RVYA 4YJWA 1QL1A 1ZW0A 2FXPA 3VRCA 2ZXOA 1K8AQ 3NYLA 4EOTA 2M8RA 1GTWA 3GF3A 2Q9AA 1U7MA 2QEXP 3GM2A 3V2NA 2AEJA 4W7ZA 1S3JA 3AE8C 3H2UA 5E2QA 4EHPA 2B87A 1LE4A 1FE6A 3D71A 1NTKJ 1N1CA 4XLPF 3A0HH 1NO4A 3L75G 1RQVA 1BGYE 4Z1MH 3HUSA 3S9OA 4H4KC 2YNYA 1LNQA 1M1JC 4CS8C 2I1JA 2E76B 3EFFK 3A7OA 1HGZA 1URQC 1VQPP 3D70A 2ZFCA 1MFTA 1FFHA 2A69F 1L3PA 1C03A 3M91A 2FYUJ 3N2ZB 2KGOA 3DMDA 4QDLA 3WUUA 2A06G 2PAJA 4HYTB 2CK3H 3GWLA 2ZXXA 4GEHA 2WZGA 2A1DD 2JDIH 3R2PA 3JCUH 2L6FA 3ATPA 1M57D 2WSFH 3GODA 3ZTZA 1JCDA 2I15A 3JYHA 2HJ3A 2YL1A 3SEOA 4MQ9F 1Q7YQ 4WWIA 2WB7A 1NOHA 4WY4A 2A68F 1CSBA 2H8AA 3LW5J 3M0AA 3H1LD 2NUTB 3B29A 4X0RA 5KAIH 1OXKA 1FR0A 3C8ZA 2Q7RA 4YL3A 1O5HA 2OGUA 4N78E 4K35A 5HSWA 1SFCB 1S5LH 4I1OB 3TJ5A 1YYJA 5CCGC 1RE3C 1NYHA 2E43A 3K7DA 4BXLA 3CC2P 4DT0A 1VF5D 1ST6A 1MNDA 1LTAC 4A7PA 2C0XA 1ZW3A 1GW3A 2O01J 3AE7C 3EQ2A 4NC3A 5L3VA 1KB9E 5KLIC 1AQ5A 5KYYB 3U1AA 2HS5A 3U0CA 3RL0B 1AEPA 1USDA 4H44D 1HW1A 2ICWG 1J1DB 3G4SP 2XKMA 3KYQA 2ZYAA 2M5AB 4U9DA 2ZT9B 4PV1B 2CCYA 2GWWA 1TWCA 1M8OB 4NCQA 1GK4A 4BRYA 4XLNF 2WSCJ 1MNEA 3X1OA 3AGTA 3UGOA 2HSBA 1T5OA 3HNIA 3ECSA 3H32A 1T3JA 1HMOA 3FMSA 1VQ9P 4CPGA 2EINC 2VC9A 5AVRB 1NU1J 3CSKA 4LLHA 2KW3C 1M56D 2AVKA 3B0VC 1KYOD 1SQXG 1GL2D 3O10A 1KILB 3L70G 3H65A 4CSAC 3RKOF 1PPJG 3A11A 4JC7A 3TGUG 1QLEC 1Q2NA 2BEQD 2M3EA 1Q86Q 3Q7LA 5AVZB 3JZ0A 3S28A 1G2CA 4OGQB 3T97A 3V4QA 4PJ0H 4MN4C 1L7CA 3IPMO 5DJTB 1H7IA 1VB5A 5AGFA 2BEZF 1OCCC 2EPOA 2C0WA 2R32A 2YL3A 1VPCA 1PD0A 3GG2A 3CMAP 1TR2A 2XNDH 3L73D 2H7BA 3FXHA 1T6IA 3MX3A 4ZLCA 1A0BA 1JB0J 2JPUA 1SQPK 1UIIA 1PGQA 5KLVE 4KHXA 5AW1B 2OJED 1Q81Q 2NPSB 1RXQA 1EDIA 1W5CE 4YXDC 3L72J 4W8PA 3U8VA 1SQQK 4RDAA 4DBRA 1AUEA 1EKYA 3O55A 3CCLP 2QM7A 3MFNA 5KJ7D 2HJMA 4HEAJ 1JY3P 3VAYA 2E76C 2V7QJ 4FX5A 4N4WA 2WVRA 2LR2A 5KLVJ 2ZXRA 1JM0A 2LP4A 3HE5B 3IAOA 1YJ9P 4PK4A 3H1LG 3LLIA 2PX3A 1QVGO 1G5ZA 4N3YB 1BCCJ 4L6RA 2XLHA 1BE3E 2RSEB 3WAQA 1JEKA 3IQCA 2EPLX 3L35A 3WU2H 2FFDB 2YMYA 2GA0A 1FAVA 1PGPA 3W8IA 2IM8A 1BR4A 1HGVA 1KQGB 3HD7D 1SFCC 3K66A 4MS2A 4YWQA 5IY5C 1NTKD 3RK2D 3CXHH 4JCZA 5COMA 1OXZA 2WVOA 3EH1A 2R7RA 1QVXA 1IFDA 1N7SB 2OTJP 5COGA 4E7ZA 4CS9C 1SQVG 1VLSA 2V3CC 2VRSA 3QMKA 2XLVA 3S29A 2XLDA 3M06A 4IAQA 1Z5ZA 2A06E 5JT4A 2LFFA 3RL0C 3U8PA 4YK5A 1NZEA 3GHGA 2XSEA 1NKZB 2IXMA 3EHMA 2BL2A 2MJZA 4DJ9A 4BJ6C 3L75J 4H13B 1C02A 3F46A 3KH2A 4JEBA 1L4AA 2OARA 2YLGA 5B5EE 3RBXA 5DS4A 5B3IA 3T6BA 2ZT9C 4LDRA 2D2CC 1BGYD 1YA9A 1YZCA 1R8EA 1KC8Q 3L74G 2KLVA 2ZXWC 1VL2A 2CNWA 1OFCX 2IBFA 2P7JA 3ABVC 1URQD 3AE6C 2K3RA 1IO4A 1RJ9A 1LKXA 3U9JA 2WQYC 4JJGA 5DLJA 4D6TE 3W2VA 4CIPA 1JY2N 1M90Q 5KYXA 3JCUQ 1KILC 3RW0A 2P61A 4M63A 2QJPB 1L0LK 4OIPF 1KILE 5EHHA 4MTOA 4AYCA 1M2VB 1MFZA 3KKBA 3H1HE 2QVAA 1FZBA 2OYIA 1IZNB 3OAKA 2OTKE 2FFHA 2GAQA 3IN6A 2WT7B 4IFDK 1U7JA 2XNXA 2Z5HA 1CW5A 4IARA 2Q7CA 4YT5A 4N78D 3E1IA 1AFOA 2K37A 4PJMA 5JP7A 5K0IA 5APUA 1KQLA 2CPBA 1E85A 2W45A 3IQ6A 3IF4A 2IBZE 4XA4A 5CCGD 1G1JA 2KSFA 3AOUA 5B1BC 2L81A 4IRUA 1HF9A 4WGZA 3AGUA 4U5FE 5JUAA 2OOCA 1NH4A 3HKKA 1KB9D 5CBOA 2HR3A 5FCLA 3MUDA 3Q5PA 5CI8A 3MBGA 2I8DA 4CDYA 4LACB 3EPVA 2CGEA 1L0NG 4RJTA 1HJBA 2HV7A 3CI9A 1JCCA 5EGYA 1YARO 1M1KQ 5BQHA 3T9OA 2PF4E 2QJYC 1KNYA 2FYNB 3S27A 3CCJP 2LIGA 1R5SA 3L70J 4O6NA 2N1TC 2QA4P 4XPYA 3HNLA 2MHRA 4MVZA 4PD4E 3CX5H 1VYKA 4J30B 3UMKA 2OYHA 3V5XA 5GTHE 1BR1A 1NTKG 2YIUC 2QJKB 1BSHA 1CPRA 1ZLLA 3L8IA 2FFDC 1QLED 4JEAA 2ZYGA 3FWNA 1MV8A 2Y0CA 1VMAA 1HBWA 2CDQA 1KMIZ 5KAFH 3O39A 2KS1A 4O6YA 4NPFX 1RE4C 4TT3H 1C17M 1G8XA 1NU9C 3CCMP 1A7VA 4YN0B 2LSEA 3G50A 1N7LA 3AG3C 5A6AA 3S90A 1R5ID 3C7JA 2J7PD 1OXBA 1N7SC 1RHZB 2IYOA 2D5RB 3G6EP 5H2FE 1BGYG 5CCHC 2R25A 2L91A 4JBZA 5KLVD 2K88A 2K9JA 1Z3IX 2O3JA 2AXCA 3KZIH 3X2QC 1IFJA 4EDFA 2AEFA 1T6AA 3Q6NA 2PP4A 4H13C 2OJQA 1RKEB 2Q3TA 3L8JA 3PHF2 1ZV8A 1KD1Q 3ZQVA 1BCCD 1BBHA 1XTCC 2ZAEB 1HW2A 1EZVE 5M1BA 3GEIA 2Q1KA 2VCAA 2W8ZA 2XLOA 3U59A 3V5ZA 2JEEA 3VMYA 2W27A 4IWBA 2J5UA 3VYIA 3B5NB 4U7JA 1OR2A 2E76D 3CCQP 3PCVA 4ZMDA 1XTGB 1WWPA 1WMKA 4KBLA 3EFOA 3LNRA 5KYWB 2VASA 1X0TA 4CBEA 3SZRA 1FZEA 3V2PA 3AE9C 2OKUA 3EGXA 3EFGA 2JP3A 1YQ4C 2ASRA 3S4RA 1BE3D 2SPZA 2L9JA 4I1MA 4E0IA 3B8EB 1JOGA 2Q5UA 1OZHA 1LT9A 1RF0A 4PR9A 1EXJA 2XLWA 3HE4B 1LJ2A 3ZVRA 1PV3A 5KYUB 4LGDE 2L6GA 1V54C 1LTJA 2A0UA 3FAPB 1WGWA 3LS0A 3TNUA 1LP1B 2KUBA 2YMKA 2J0XA 1GMJA 4EBBA 1SFCD 4DCKA 1AVOA 1SQVJ 1Y6DA 2YO2A 4OWFA 1FZCA 1UG7A 1SP4A 4OIOF 3M4CA 4IJJA 1TWHA 2A06D 1JPJA 3ZG1A 2HMQA 3H1JE 3V5BA 3HNKA 2FY8A 3A0HE 3RL0D 3BVHA 2Y3BA 5AVYB 1KN7A 3G3ZA 1IFNA 3L74J 4GYTA 1FBMA 5CMZA 1M6TA 2ZT9D 1SQPE 2D2CD 2B87B 2XLMA 3ASOC 1IK7A 2BCCE 2FYNC 4D4NA 2OQQA 4K0DA 1OWAA 5B3SC 3HUSB 3VN0A 4XQ1A 2WWWA 1NHLA 2A45H 3M9HA 2PX0A 5E3AA 3AG1C 1KZUB 3JCUE 2ZD9A 1EQ7A 5D91A 2KP8A 1SQQE 4QMAA 1KILD 2FGYA 1ORJA 3HD7A 2N9BA 3AE2C 1TQGA 4RKUJ 4E18A 1NAFA 1QZXA 1Z7Qc 4CIHA 3TOLA 3VMZA 1SYQA 1CGME 3H1HD 2G3KA 5KAIE 1DOVA 4FWVA 2BCCJ 2GDCA 2WITA 3LAYA 1S5LE 5KLVG 4E7SA 1L0NE 1LE2A 1LI5A 4U5BE 3SWKA 4WY4B 2R5BA 5HV9A 2WSFJ 1NTZK 4BG0A 1ZXGA 1PCXA 1T3UA 2YO3A 1SQBK 1MMDA 2IBZD 2R3CA 4ZNCA 1DEBA 2E74B 3Q3DA 3LNMB 1CPQA 4U5CE 3C8GD 4DXWA 1M1JA 1WATA 4U5HA 1OVUA 1LS1A 1URQA 4NTBA 2HMZA 4IL6H 3IQ5A 2I8BA 4DZOA 1L0NJ 3QW0A 3AJMA 4IAOA 3UMHA 3NXSA 1SR2A 1D1BA 2KNHA 3DI5A 2R9RB 3C18A 4MW8A 4R32A 1PGJA 4WABA 1SF8A 1N73C 1BE3G 3B5NC 1SQXK 3A0BH 3GEEA 4B86A 1ZHXA 4XEFA 3MYFA 3N24A 3FXEA 2DB4A 1E79H 4OD5A 4ULVA 3E7KA 4BRYB 1EC5A 2H7VC 4Q4ZF 1HE1A 2F22A 1ZRTE 4I1LA 5L0FA 4UB8H 4PD4D 1JNMA 2N1TD 3H32B 1GU5A 1QVFO 1K73Q 3V2RA 1LWUA 4AE4A 1PL5A 4W8KA 1CGOA 4PJ0E 2R3SA 2WPQA 1RE3A 4R4LA 3PRJA 4WB4A 2IYLD 2OG2A 1ZYRF 3GW6A 3CCRP 5DS5A 3AEEC 5AW5B 1AVYA 1G2CB 3T97B 2B9BA 3M4BA 1L0LE 1YJGA 4IB4A 1BGYJ 3I56P 1FTSA 1D0ZA 3VF0A 3CWBE 1N7SD 3FXDA 1IFMA 3US6A 3CCSP 2BASA 1DD4A 2YXRB 5CCHD 4LLEA 2M4EA 2XM4A 1VK5A 2E42A 5CI9A 3U5SA 3U1CA 3P8CE 2TMVP 3V2QA 4JPZB 4H13D 3DE8A 4D6TG 3AE5C 4WVZA 2BE5F 2KB7P 1FOSF 2HUJA 4KJMA 3L36A 1A7EA 2E75B 4LDKA 1JMWA 1BDDA 2Q9CA 4N06A 3HUSC 4DRJB 3H1HG 5AW7B 5JVEA 4I7ZB 2Q00A 2W4MA 2JX0A 5L8RJ 2PFXA 2PGDA 1SQVD 2R7SA 3WU2E 3UIAA 5E33A 2A6EF 1G4WR 3GEHA 4P6IC 4M3LA 4O6MA 1ORYA 1HUCA 2RN0A 3GLMA 4GODA 2XL4A 2QNLA 1ZW2A 3NMDA 3RL0g 2IBZG 3LUTB 1OKKD 2MYSA 1NTMK 2C9NY 3CXHE 5GTIE 1IFPA 3L71E 4WY4C 2YKQA 4PACA 2O9XA 3L74D 1LTTC 1K04A 2OQMA 1SZIA 3F5HA 3WHNA 5AW0B 1Q82Q 1T9KA 4HE8D 2Y9YA 1WRGA 3G4ZA 3H1JD 1P84I 3TD7A 1AJYA 1JY2O 2XDJA 1VQKP 3RQEA 1XWJA 2R05A 3CCUP 4MVUA 3GHGB 4BEJA 3H2VA 2IZ1A 1SQPD 1L4AB 2BCCD 2IDBA 1K9MQ 1D1AA 1FDMA 3LW5H 1KU2A 1KORA 2FAPB 3H1KG 1O3UA 4K3AA 3NMKA 5F5HA 1LI7A 5TISH 4MTFA 4N6CA 1H89A 1KQSO 1ZU4A 5JLIA 1RJ9B 1SQQD 4KC9A 3M1CB 3NYJA 1OMIA 3L37A 1BDJB 1QEXA 4C7NA 4PD4I 4YL0A 5AC5A 1VOMA 1JY3N 3V6IA 4JKVA 4AUWA 2O01H 2Z4EA 2IYPA 1EDJA 1VQ4P 1H0TA 1V74B 1LT1A 2Q3IA 1VQ8P 3AE3C 3ITKA 2IZ0A 4CS9A 4MVSA 3DM5A 4G7HF 3ZTMA 1L0ND 2OYIB 3KXDA 3M79A 1NKNA 1Y47A 1J1EB 2YEVA 3L34A 2Y0EA 1Q90D 1EZVG 2I1KA 5DJUB 1FMVA 3SFEC 4C3BA 3CMEP 4GIFA 3DWWA 2P1JA 1ZU5A 1BR2A 3GWNA 3IQTA 3ZIBA 1QX8A 3CC4P 1JPNA 3I5QA 1U57A 3FOOA 3EZHA 1H9GA 2Y9ZA 1QGKB 1VTMP 5GTIH 3S1KA 4GQHA 1YAUO 1ZR4A 2IOQA 2NUPA 1BE3J 3IEEA 1RMVA 2E75C 2GUSA 1S5LX 3P32A 3RK3B 1GW4A 1R5LA 5APYA 1KV4A 3T4RA 2QG4A 3K1IA 3A9CA 3B5ND 4AK9A 3TYYA 1TKNA 1FJPA 3CX5E 2H8PD 1J1DC 4I7ZC 3CD6P 1ZRTD 3H1IE 2R5DA 4D4XA 1VQ7P 1OR3A 3M0DA 1VQ5P 4PV1C 2AEMA 2AU5A 1FDOA 3F89A 3AEDC 1NLXA 3W67A 1OCRC 5DQZA 2WZLA 5KAFE 2FYUK 2N9YB 2Q6QA 3FGAD 2OYHB 1PZQA 2KQ9A 1IZMA 1N8RQ 3OEOA 4XEVA 4H54A 5E3CA 2CYDA 2XXAA 3NTNA 3C8GA 4JTAB 4L76A 2IPPA 4EIJA 3H1JG 4O9BA 1D0XA 4MVQA 1L0LD 2KS1B 1JUNA 3NMIA 1KYOI 4UB6H 2L6HA 2XS8A 3CWBD 3KZIE 4H44B 4OGQC 4MVMA 4DRIB 3TF5A 4I3MA 4BJ1A 1L2PA 1H6GA 1SQPG 2DI3A 2BCCG 3W68A 2RD9A 1J2JB 4D6TJ 4MW3A 2FYZA 2PRRA 3RFYA 3P8CD 1YVIA 2K9JB 1YIJP 3LJBA 1NTZE 4LC1A 1YJWP 2AP3A 1PIXA 3GHGC 2N1TA 5C39A 1SQQG 4I2LC 1GK6A 2O01N 1Q0KA 5AW6B 1LTSC 3H1HJ 3HRNA 5AVVB 2RKLA 5B66E 2NPSC 3HTKB 5AW4B 3RIPA 1GS9A 3VM6A 1YDIA 1TFKB 3EFOB 3D6YA 1NSGB 2Y39A 5CHXA 3MP7B 5CBNA 4G0HA 4ONSA 3EGXB 2H88C 3RQFA 1NU1K 4HFFB 2JKVA 2DYRC 2YQYA 2LXBA 4JZAA 4ZLDA 1FZAA 4U3FE 2G8YA 3BCCE 2R7TA 3MGNA 5L0JA 3CXHD 5CCHA 2OYIC 3L1MA 2HODA 5D92A 1B68A 1LT9B 1Y9BA 2NG1A 2KSEA 4JW1A 1J1EC 2QLAA 4B6IA 3LIDA 2R7UA 2IXOA 4WY4D 3NKEA 4UDVA 2J59M 1NFOA 1V55C 1VYIA 4XE5B 1ZN5A 3H1KE 2P1AA 3TNUB 2WVNA 2WTYA 2JO1A 1MMAA 5B1AC 2P2UA 2XL8A 2E74D 4U5DE 1W2EA 4C3DA 1KFMA 1FZCB 1JAFA 5AW8B 4LLCA 5TJ5E 5BQGA 3O6QA 3KYJA 2G3VA 2Q9BA 1JRAA 1RF1A 3KPHA 2A0BA 2R7XA 2POHA 3MUDC 1XZQA 2O1JA 2ZPAA 3II6A 2MWQA 3KL4A 2YWAA 3H1KJ 2H7HA 3RK3C 1S9KE 4PFOA 4JJFA 2FBWC 2C9LY 2LFDA 3MIWA 5APQA 3RK3E 2EIKC 1M2VA 2ZVOB 1PFIA 2WPRA 3OA1A 4AQRD 1OVRA 5AW2B 4H0LB 4MTGA 3TULA 2G3AA 4GKGA 3EH2A 1A02J 1GL2A 4CX9A 2LQGA 3EHNA 4CJGA 5KLVK 3KHUA 4I6MC 1ZMEC 3PMRA 1L0LG 1FS0E 1QPUA 1GDTA 3DM9B 4XEKA 3DAFA 3HD7B 4LDQA 3CWBG 3EWKA 2A6HF 2UUHA 5CJ4A 5B66H 4HFKB 3Q5SA 1PP9E 1CI6A 1BZ4A 2W6AA 2KIKA 2QJPC 1H8AA 2Q4FA 1K05A 5T3WA 2Y3DA 4IOIH 3P8MC 1E83A 2WZ7A 1P84H 1N86A 3EGDA 2KK1A 1BDCA 3C62A 3JSZA 4MVRA 1YBKA 4IL6E 1U6HA 5BQIA 3A3YB 1NTME 3L4FA 2EILC 5JS5A 2ZYDA 1PP9J 3QWOC 3H6PA 1F1MA 2YLDA 5EFWB 4XPXA 2PNOA 1M1JB 2HKVA 2NPUA 3A0BE 1URQB 2NZ2A 5KKZB 5A6KA 1JTHA 2Z15A 4CJOA 5KJ7A 2YL0A 2XZRA 1QKRA 2E75D 4GOFA 4YT2A 1DX7A 3HTKC 4Z9IA 4OINF 4OIQF 4UB8E 2Z5IA 4JURI 4K7BA 1KQFB 3JSEO 2YZSA 3CX5D 1UFBA 2KSJA 3TSIA 2WSEH 4JYCA 4PJNA 4EYYQ 1KB9I 3BRTB 3S0XA 3M15A 4BJ5C 3GMAA 2PBEA 3AE4C 3L71G 5E79H 4JRZA 2HPCA 4PV1D 2GA1A 1LM3B 3AECC 4CDAA 2GUVA 3U3FA 1LWUB 4AE4B 3UNGC 3MD0A 3AE1C 3AEAC 4C7OA 2HFIA 3KPEA 4D6TD 3VOPA 4Y28J 3H1JJ 1LT9C 1RF0C 2UUIA 3TJ6A 4AX2A 3GM3A 2IFMA 2WVQA 4OH8B 4YL1A 3BATA 4EUKB 2QJKC 4WGYA 3CXHI 5BVZA 2GM4A 3DJUB 1JMMA 4BEMJ 1AQTA 4DVYP
chains in the Genus database with same CATH topology
3AEFC 3D6ZA 1VF5B 3Q3DA 2K9YA 3GM2A 3GF7A 1ZP0C 2P10A 1ZMEC 1PIXA 1OW6A 3O10A 1JOGA 3C8GD 1QVXA 4I7ZB 3AE8C 1EXJA 4OGQD 1ZZPA 2Q00A 4XEKA 1PV3A 5L8RJ 2JX0A 3D71A 2QJYC 1UIXA 4YTPC 1KNYA 3EWKA 2L6GA 3AJMA 1RQVA 1Q90D 2BEQD 4GDOA 4Z1MH 3SFEC 3Q5SA 3S9OA 3C18A 2QIWA 3C8GB 3JZ0A 2YMKA 1GMJA 2E76B 2WSEJ 4OGQB 4EBKA 3GLMA 4R32A 3H25A 2QJPC 3D70A 1K05A 3RL0g 1MKMA 4H13B 2BEZF 1U57A 1WOLA 4XEFA 3Q5RA 3D6YA 2YIUC 3L8IA 2ZT9C 3G9RA 2D2CC 1R8EA 1DIPA 2H88C 2KK1A 3RQFA 3C8VA 1ZRTE 4XFJA 1VL2A 1JB0J 1K04A 1KMIZ 2L6FA 5F28E 2E75C 4H0LC 2JPUA 3SFDC 3ABVC 1S5LX 3AE6C 4TT3H 2G8YA 1PL5A 2MKVA 1KTMA 2WQYC 3RQGA 1HJ0A 1OW8A 1VF5C 1Y9BA 3LW5J 4I7ZC 2ZT9D 2D2CD 3R4YA 4YXDC 2NZ2A 1KILE 1IK7A 4R4LA 3B71A 2FYNC 3Q1MA 2OQQA 1OW7A 4EBJA 4PV1C 1AJYA 3BRJA 1FDOA 4H44C 2E75D 2JO1A 4H0LD 1FDIA 3AEEC 3AEDC 3MFNA 3RQEA 3T97B 2D2CB 2E76C 1TU3F 2E74D 1K40A 1V4AA 1NYHA 2V7QJ 3IN6A 1KQFB 3K7DA 3FGAD 1UFBA 1VF5D 4H13C 3Q2YA 2E74C 3L8JA 3AE2C 2IDBA 3O6QA 4KT0J 4RKUJ 3IAOA 4XEVA 3JYYA 3AEGC 1KORA 1YQ3C 2O01J 3AE7C 5M1BA 3GMAA 2PBEA 3AE4C 5KLIC 1O3UA 3C8GA 1DD4A 3U0CA 1EXIA 4R4MA 4PV1D 4H44D 1WTYA 1ZOYC 2J5UA 2QSIA 2LK4A 4U7JA 3AECC 2E76D 3U3FA 1S1CX 1RQUA 2YWAA 1WWPA 1WMKA 2H89C 3AE1C 3AEAC 2FBWC 2L6HA 1HF9A 4NQFA 4H13D 3RK3E 2ZT9B 4PV1B 3AE5C 1OMIA 4OGQC 4H44B 4Y28J 2WPVB 3AE9C 2WSCJ 2WSFJ 3AEBC 4IL6X 2HSBA 2JP3A 3GM1A 3Q5PA 2FXPA 5KKZC 3GM3A 2E75B 4H0LB 1YQ4C 3TULA 1NGMB 1DD3A 2G3AA 2QJKC 3AE3C 2E74B 1KQGB 3GF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEF C;  3GM2 A;  1ZP0 C;  3O10 A;  1OW6 A;  1JOG A;  3C8G D;  1QVX A;  3AE8 C;  2Q00 A;  1ZZP A;  4XEK A;  1PV3 A;  2JX0 A;  4YTP C;  1KNY A;  2L6G A;  3AJM A;  3SFE C;  3S9O A;  3C18 A;  3C8G B;  3JZ0 A;  4EBK A;  4R32 A;  1K05 A;  1WOL A;  4XEF A;  3L8I A;  2H88 C;  2KK1 A;  3RQF A;  1K04 A;  2L6F A;  5F28 E;  2JPU A;  3SFD C;  3ABV C;  3AE6 C;  1KTM A;  2WQY C;  3RQG A;  1OW8 A;  4YXD C;  3B71 A;  1OW7 A;  4EBJ A;  3BRJ A;  3MFN A;  3AEE C;  3AED C;  3RQE A;  1V4A A;  1K40 A;  3K7D A;  1UFB A;  3L8J A;  3AE2 C;  4XEV A;  3JYY A;  3AEG C;  1YQ3 C;  3AE7 C;  2PBE A;  3AE4 C;  1O3U A;  3C8G A;  3U0C A;  1WTY A;  1ZOY C;  2LK4 A;  3AEC C;  3U3F A;  2YWA A;  1WWP A;  3AE1 C;  2H89 C;  3AEA C;  2FBW C;  2L6H A;  4NQF A;  3AE5 C;  3AE9 C;  3AEB C;  2HSB A;  3GM1 A;  3GM3 A;  1YQ4 C;  3TUL A;  2G3A A;  3AE3 C; 
#chains in the Genus database with same CATH topology
 3AEF C;  4Y99 B;  1SQP J;  2YKP A;  2AWY A;  5L3Q A;  1ZP0 C;  5KLI B;  5BU8 B;  1HY5 A;  2HYN A;  4OGQ D;  2J9V A;  3T6J A;  1AA0 A;  2P6V A;  2E87 A;  1N73 A;  2H43 A;  1EA8 A;  3KYI A;  4U9E A;  3CZ6 A;  1I4Z A;  2KZI A;  2XLE A;  2PP6 A;  1SQQ J;  3LS1 A;  2XS1 A;  1NTZ D;  3B0P A;  1M2O A;  1S7Z A;  2W6J H;  1ZHZ A;  2P0N A;  5A6J A;  1NFN A;  3AG2 C;  4PFP A;  4CS8 A;  3C9I A;  2V4H A;  3KMI A;  3EG9 A;  3WG7 C;  2NPS D;  1LGH B;  3GAN A;  3PTZ A;  3ZDM A;  4H0L C;  5AVU B;  4QI2 A;  2CNW D;  1HWT C;  256B A;  2R7O A;  2OCC C;  1HJ0 A;  3NFQ A;  1DH3 A;  2L7A A;  3DJN B;  4NY3 A;  5APS A;  3WOD F;  2KOG A;  4TLF A;  2E5T A;  4EWC A;  2Y0D A;  3PH0 A;  4U3F D;  3BCC D;  3SXY A;  1KYO H;  3SXK A;  2YHS A;  4IGG A;  1OQC A;  3EJN A;  2KK7 A;  1YQ3 C;  2WMM A;  1BSN A;  3H1K D;  4L75 A;  2FYU E;  2Q3E A;  3MHV A;  2W4B A;  4MVO A;  5CCG A;  3JC2 2;  1WTY A;  3MYI A;  2LXC B;  5BU5 A;  4J32 B;  3N4X A;  4YPC A;  1RY3 A;  4NQF A;  1GQA A;  3RGU A;  3FHD A;  1TFO B;  1YLM A;  1D1C A;  4HKZ H;  3S84 A;  2J9B A;  3PJS K;  5KKZ C;  3H1I G;  4EKW A;  5L0D A;  4NTF A;  3CCE P;  3I5C A;  2ZXP A;  3E1R A;  1S9K D;  3NG1 A;  3NDB B;  3CPW O;  3AQB A;  3D6Z A;  1H88 A;  2K9Y A;  1JY3 O;  5TIS E;  3RK3 D;  2IXN A;  2DGJ A;  1HTL C;  2Y69 C;  2ZVN B;  4O7G A;  1OW6 A;  4JTC B;  2G62 A;  1NG1 A;  3SXZ A;  3JRM O;  3E70 C;  1UIX A;  1EDL A;  4C46 A;  1EZV D;  1L0L J;  5GPG B;  2QIW A;  1U0B B;  3CX5 I;  3RBZ A;  2EIJ C;  3DAG A;  3CWB J;  4CSA A;  1MKM A;  3FDQ A;  1LWU C;  1A41 A;  3KQG A;  1FOS E;  1N2D C;  4L74 A;  1Z56 A;  4C3E A;  4C7N B;  1PP9 D;  2RH0 A;  1DIP A;  2FKW B;  2EIM C;  4XFJ A;  2C04 A;  3CQZ A;  4DOJ A;  5AW3 B;  1H0T B;  4XPW A;  3QTH A;  1E84 A;  3L0I A;  5APX A;  3POV A;  3C63 A;  5L0C A;  1KTM A;  5DS6 A;  1ZHY A;  4Y99 C;  2J7P A;  3USS A;  2JWA A;  1NTZ G;  1NU1 E;  1O87 A;  1W2W A;  3V4W A;  4HJG H;  1SQB G;  2KNC A;  4K1O A;  2HG5 D;  1PD1 A;  2W9Y A;  1GU4 A;  1NTM D;  4JTD B;  4EBJ A;  4L73 A;  1SQV K;  3WUV A;  1WT6 A;  3BRJ A;  4P9T A;  4PJL A;  4O79 A;  2D2C B;  3OW2 O;  4I44 A;  3K1H A;  1QSP A;  2AXT H;  3CEX A;  3QW1 A;  3UMI A;  2E74 C;  5FZT A;  5APV A;  2R44 A;  5L0G A;  1NAY A;  1EQ1 A;  2NUP B;  5T1D B;  3PLN A;  3VP8 A;  1EXI A;  2IBZ I;  3NKD A;  3OWT A;  2XV5 A;  1IJD B;  3ZQY A;  2HV6 A;  2HLO A;  2ITA A;  1FFT C;  2H89 C;  4U3F G;  3L71 J;  3BCC G;  1NU7 D;  2UWJ E;  1FZF A;  4GOE A;  3O8Z A;  1HE9 A;  1ZHW A;  4JQ0 D;  3AEB C;  1T01 A;  4IL6 X;  3SXM A;  2YLI A;  2WSS H;  4FES A;  2E5Y A;  4N6J A;  1DD3 A;  5AVX B;  3RH3 A;  2KC3 A;  1D7M A;  2AWC A;  3L72 E;  2EPN A;  4NTA A;  3TK1 A;  5L0H A;  3GF7 A;  2P10 A;  4Z9J A;  5TJH A;  3A2A A;  1NVO A;  2CW0 F;  4JVS A;  5COF A;  2NUT A;  1JOC A;  4UB6 E;  4YTP C;  1E5W A;  4GDO A;  4ASW A;  5KYX B;  3JT1 A;  2XXA B;  1SFC A;  1OCZ C;  2XL6 A;  1LPE A;  3C8G B;  3F47 A;  4A2N B;  3R7C A;  2HFE D;  3TDK A;  3U9M A;  4G7O F;  1YTZ T;  5EK0 A;  1G1I A;  3JTL O;  1BCC E;  2IXP A;  2A45 G;  3I5P A;  3G9R A;  5A6B D;  1TWA A;  1I4Y A;  5JRA A;  5KYY A;  2ZXE B;  3C8V A;  3DE9 A;  3OA7 A;  1IC2 A;  2WSC H;  4WBA A;  3SFD C;  1SMY F;  4BJ6 A;  2DW3 A;  3CC7 P;  2QJY B;  1I5N A;  3T6G B;  3MZW B;  1YA7 O;  1FU1 A;  2M5A A;  1W2B O;  4E0H A;  3RQG A;  1T2K C;  1GGQ A;  2J0W A;  1VQ6 P;  1L0N K;  1KB9 H;  4KNW A;  2N1T B;  2VB6 A;  1YI2 P;  3SYN A;  3LES A;  2XM0 A;  2JWD A;  3B71 A;  3RF3 A;  1APC A;  1EDK A;  1OW7 A;  1X9V A;  2Y3H A;  4Q5S F;  2A45 I;  1PP9 G;  4H0L D;  2YIU B;  1FAP B;  4GT1 A;  4W80 A;  1Z23 A;  3ZC4 A;  1KIL A;  2P7V A;  4NPD A;  5AVW B;  1EZV I;  1XZP A;  5F5F A;  1JR8 A;  3L75 E;  4DRH B;  1NTK K;  2QE9 A;  4DJG A;  1OX3 A;  2OEV A;  3CLQ A;  2B89 A;  4DOZ A;  1S72 P;  1WN0 A;  2QSI A;  3ZDL A;  1NTM G;  4YT4 A;  1A7D A;  4BWN A;  1GZL A;  4U5E E;  2J8W A;  2HOD B;  1S4X A;  4F4B A;  1ZVZ A;  5DVW A;  3TQO A;  2VCB A;  2FYU D;  2HSQ A;  3RYL A;  4RO0 A;  1JMB A;  5CIV A;  2KI7 B;  1NGM B;  2B88 A;  4OD4 A;  1E86 A;  2K1A A;  3K6B A;  2YVK A;  4NPE A;  2W6B A;  1VF5 B;  3NRH A;  4EI2 A;  3C1L A;  3H1I J;  1VQN P;  2NPS A;  1RH5 B;  3VP9 A;  3U2L A;  3IFM A;  4AL1 A;  3O6Q B;  2V7Q H;  2B0H A;  1RF1 B;  1JY2 P;  3QZC A;  4OIR F;  2BC5 A;  2P58 A;  1MQV A;  2M64 A;  5T3T A;  1OIP A;  2J58 A;  1SVF A;  3LIE A;  3V7O A;  4EBK A;  2VCC A;  3HNJ A;  4JE9 A;  4IFF A;  1J8M F;  1X79 B;  1USE A;  1HH0 A;  1WOL A;  1QQ3 A;  4FAP B;  3A5T A;  3K1I C;  1Q0M A;  4LER A;  3HE5 A;  1YIT P;  3GOR A;  3CL3 D;  1FNT c;  3L73 G;  1G4U S;  1YHQ P;  2C03 A;  1X22 A;  1SQB E;  3CCV P;  1J8Y F;  1SS1 A;  3AG4 C;  1L4A C;  5F28 E;  1U89 A;  3M0D C;  1MMN A;  4RES B;  3W2W A;  1GL2 B;  3DKA A;  3FOP A;  1LS4 A;  3EZI A;  3W8H A;  2FFD A;  2R7W A;  4G78 A;  1RCP A;  3NMJ A;  1Z63 A;  5AVT B;  2R02 A;  1MZ9 A;  4ZKU A;  4MND A;  2J45 A;  1YYC A;  1RE4 A;  1NTZ J;  1IFI A;  5BUO A;  1P84 E;  5APT A;  1CI6 B;  1FDI A;  3SWY A;  2ZJS E;  1SQB J;  2FXM A;  1TU3 F;  1SQX E;  1V4A A;  3L70 E;  1NU1 D;  1OCO C;  1YJN P;  1N7S A;  2OEX A;  1SLQ A;  1PPJ E;  3PP5 A;  3TGU E;  2Y3G A;  3DD7 A;  1T8Z A;  3L71 D;  3EGD B;  1AV1 A;  2X0C A;  2WL8 A;  2YKZ A;  1ZOY C;  1R4T A;  2LK4 A;  1LTJ B;  4G7Z F;  3ABK C;  2YL7 A;  2NSG A;  3E9V A;  4KI2 A;  1M7L A;  1MUU A;  4HH2 A;  3N0T A;  1SQX J;  2XU6 A;  3B0U X;  2QM8 A;  1AVO B;  1T6U A;  2DYS C;  1Y4C A;  3SNH A;  1LTG C;  3GM1 A;  4U3F J;  5K5G B;  1JTH B;  3BCC J;  5CJ0 A;  3TGU J;  2D4U A;  3MLG A;  1CGN A;  5B5E H;  5E79 E;  1NJI Q;  4W7Y A;  3CAX A;  1X8Y A;  4N6H A;  1GD2 E;  2KYH A;  1ZZP A;  1A02 F;  2QUP A;  3G4X A;  1RKC A;  4QI0 A;  3FAJ A;  1LVK A;  3SWF A;  3L72 D;  3BRV B;  2FYU G;  2HPC B;  1M57 C;  2WSE J;  4DBQ A;  2M0B A;  3Q6M A;  4J7Y A;  4Z9H A;  3M9B A;  2IFN A;  4ZKP A;  1OKK A;  2WT7 A;  2KZJ A;  2WZF A;  2IX7 C;  3IR9 A;  4C7O B;  2OTL P;  3Q5R A;  2RMZ A;  1S2E A;  2OYO A;  2EPM X;  5APW A;  3QH9 A;  3VTP C;  5KTB A;  3H1L E;  1DEE G;  2EPK X;  1FZG A;  2W83 C;  3LEV A;  3SP1 A;  3LEO A;  2OYH C;  1ORS C;  1VDF A;  3RK2 B;  5AW9 B;  2J9W A;  1HVV A;  2MKV A;  4ULW A;  3K5B A;  1OW8 A;  1VF5 C;  1LIH A;  1FC2 C;  3PHL A;  3HTK A;  4HB1 A;  2ETS A;  2XRH A;  3ZWI A;  3R4Y A;  3B4S A;  1N73 B;  3VMA A;  2JR8 A;  2W90 A;  3BAS A;  4C7R A;  4H44 C;  1RF1 C;  4U5G A;  4KNV A;  3H1L J;  1QL2 A;  1S05 A;  3QVZ A;  4ASV A;  1KFN A;  2O1K A;  4BJ5 A;  1K40 A;  3JSV C;  4CDV A;  3WMM 0;  4YT8 A;  5L0I A;  1T2K D;  4CS7 A;  2KLU A;  3EQL F;  3DXJ F;  1SQV E;  3JYY A;  3AEG C;  5AC4 A;  3U2M A;  3MTU E;  4RD9 A;  2M3B A;  3UGP A;  2YKO A;  3EG9 B;  2JJL A;  3Q7G A;  3O6X A;  1NWQ A;  3M9Q A;  1VQM P;  1S1C X;  1M56 C;  5DQT A;  3SSU A;  4WJ0 A;  1LTI C;  1GL2 C;  1T6Q A;  1KYO E;  3L75 D;  2LKM A;  4Q7C A;  1GM5 A;  4BJT A;  1NU1 G;  2WPS A;  3L74 E;  1NTM J;  1NBB A;  3HJC A;  4PD4 H;  3H1I D;  3ITF A;  3FX0 A;  1TWG A;  2KJG A;  2HZ8 A;  2J9U A;  4YXW H;  3J06 A;  3P7K A;  5GTH H;  2PFD A;  4ANJ A;  3RVZ A;  5A6B A;  3ABM C;  3VMX A;  3HLZ A;  4XWJ A;  3DZA A;  1VQO P;  3FWL A;  4XTK A;  3JRT A;  2QE7 H;  2FXO A;  5JSL A;  1Q0G A;  1Y8A A;  1JO5 A;  1MMG A;  3I55 P;  3L73 E;  5KYN A;  1Q0F A;  1IK9 A;  2KYV A;  4JCH A;  3QVY A;  1E2X A;  2GFH A;  4JF7 A;  3H25 A;  2LCH A;  2YXQ B;  1ZR2 A;  4OVN F;  3U3B A;  3OJA B;  1LTJ C;  1H9T A;  1DOW A;  4P9F A;  3BEH A;  1RKE A;  1LTB C;  2VH3 A;  4JIO A;  1WAS A;  2LD6 A;  5H2F H;  3AQC A;  2NSF A;  3N7N A;  1YTZ I;  1FZC C;  3VYW A;  3UR3 C;  1OVV A;  1HMD A;  2QTV A;  3B5N A;  5KJ7 C;  4E17 A;  2L5G B;  3L72 G;  3L73 J;  3NYM A;  4BPM A;  4AL0 A;  2R03 A;  5KYW A;  5AVQ B;  2V26 A;  3TOM A;  2JD3 A;  1Z6A A;  2J46 A;  1D0Y A;  2NRG A;  1YYX A;  1SQB D;  2H7O A;  3IHU A;  5A69 A;  3Q1M A;  1IW7 F;  2R7V A;  1EI7 A;  3W4Y A;  1L4A D;  1PGO A;  4J7T A;  3I4U A;  3ZSU A;  3WUT A;  3K33 A;  2YRF A;  4PJJ A;  4A4A A;  3HE4 A;  3Q2Y A;  1ZHT A;  1VQL P;  3PDM P;  5AVS B;  5KYU A;  4KT0 J;  2B0J A;  1BCC G;  1VLT A;  2X51 A;  1CZQ A;  1FJK A;  2QY9 A;  1P84 D;  1LP1 A;  3KDP B;  2QRX A;  4JYB A;  2P67 A;  4R4M A;  1SQX D;  3G71 P;  3LLK A;  3V5Y A;  2KXP B;  3HD7 C;  3L70 D;  3TK0 A;  3RK2 C;  1RQU A;  2R7Q A;  4EIY A;  4DVZ A;  3FVY A;  1NTK E;  1PPJ D;  4IFM A;  3ABL C;  3TGU D;  2OU6 A;  1FMW A;  3ASN C;  4RBN A;  2CPS A;  2WPV B;  1Q0D A;  1YZA A;  4ER9 A;  2KNC B;  2AXT E;  3B9Q A;  2Q9I A;  3RVY A;  4YJW A;  1QL1 A;  1ZW0 A;  2FXP A;  3VRC A;  2ZXO A;  1K8A Q;  3NYL A;  4EOT A;  2M8R A;  1GTW A;  3GF3 A;  2Q9A A;  1U7M A;  2QEX P;  3GM2 A;  3V2N A;  2AEJ A;  4W7Z A;  1S3J A;  3AE8 C;  3H2U A;  5E2Q A;  4EHP A;  2B87 A;  1LE4 A;  1FE6 A;  3D71 A;  1NTK J;  1N1C A;  4XLP F;  3A0H H;  1NO4 A;  3L75 G;  1RQV A;  1BGY E;  4Z1M H;  3HUS A;  3S9O A;  4H4K C;  2YNY A;  1LNQ A;  1M1J C;  4CS8 C;  2I1J A;  2E76 B;  3EFF K;  3A7O A;  1HGZ A;  1URQ C;  1VQP P;  3D70 A;  2ZFC A;  1MFT A;  1FFH A;  2A69 F;  1L3P A;  1C03 A;  3M91 A;  2FYU J;  3N2Z B;  2KGO A;  3DMD A;  4QDL A;  3WUU A;  2A06 G;  2PAJ A;  4HYT B;  2CK3 H;  3GWL A;  2ZXX A;  4GEH A;  2WZG A;  2A1D D;  2JDI H;  3R2P A;  3JCU H;  2L6F A;  3ATP A;  1M57 D;  2WSF H;  3GOD A;  3ZTZ A;  1JCD A;  2I15 A;  3JYH A;  2HJ3 A;  2YL1 A;  3SEO A;  4MQ9 F;  1Q7Y Q;  4WWI A;  2WB7 A;  1NOH A;  4WY4 A;  2A68 F;  1CSB A;  2H8A A;  3LW5 J;  3M0A A;  3H1L D;  2NUT B;  3B29 A;  4X0R A;  5KAI H;  1OXK A;  1FR0 A;  3C8Z A;  2Q7R A;  4YL3 A;  1O5H A;  2OGU A;  4N78 E;  4K35 A;  5HSW A;  1SFC B;  1S5L H;  4I1O B;  3TJ5 A;  1YYJ A;  5CCG C;  1RE3 C;  1NYH A;  2E43 A;  3K7D A;  4BXL A;  3CC2 P;  4DT0 A;  1VF5 D;  1ST6 A;  1MND A;  1LTA C;  4A7P A;  2C0X A;  1ZW3 A;  1GW3 A;  2O01 J;  3AE7 C;  3EQ2 A;  4NC3 A;  5L3V A;  1KB9 E;  5KLI C;  1AQ5 A;  5KYY B;  3U1A A;  2HS5 A;  3U0C A;  3RL0 B;  1AEP A;  1USD A;  4H44 D;  1HW1 A;  2ICW G;  1J1D B;  3G4S P;  2XKM A;  3KYQ A;  2ZYA A;  2M5A B;  4U9D A;  2ZT9 B;  4PV1 B;  2CCY A;  2GWW A;  1TWC A;  1M8O B;  4NCQ A;  1GK4 A;  4BRY A;  4XLN F;  2WSC J;  1MNE A;  3X1O A;  3AGT A;  3UGO A;  2HSB A;  1T5O A;  3HNI A;  3ECS A;  3H32 A;  1T3J A;  1HMO A;  3FMS A;  1VQ9 P;  4CPG A;  2EIN C;  2VC9 A;  5AVR B;  1NU1 J;  3CSK A;  4LLH A;  2KW3 C;  1M56 D;  2AVK A;  3B0V C;  1KYO D;  1SQX G;  1GL2 D;  3O10 A;  1KIL B;  3L70 G;  3H65 A;  4CSA C;  3RKO F;  1PPJ G;  3A11 A;  4JC7 A;  3TGU G;  1QLE C;  1Q2N A;  2BEQ D;  2M3E A;  1Q86 Q;  3Q7L A;  5AVZ B;  3JZ0 A;  3S28 A;  1G2C A;  4OGQ B;  3T97 A;  3V4Q A;  4PJ0 H;  4MN4 C;  1L7C A;  3IPM O;  5DJT B;  1H7I A;  1VB5 A;  5AGF A;  2BEZ F;  1OCC C;  2EPO A;  2C0W A;  2R32 A;  2YL3 A;  1VPC A;  1PD0 A;  3GG2 A;  3CMA P;  1TR2 A;  2XND H;  3L73 D;  2H7B A;  3FXH A;  1T6I A;  3MX3 A;  4ZLC A;  1A0B A;  1JB0 J;  2JPU A;  1SQP K;  1UII A;  1PGQ A;  5KLV E;  4KHX A;  5AW1 B;  2OJE D;  1Q81 Q;  2NPS B;  1RXQ A;  1EDI A;  1W5C E;  4YXD C;  3L72 J;  4W8P A;  3U8V A;  1SQQ K;  4RDA A;  4DBR A;  1AUE A;  1EKY A;  3O55 A;  3CCL P;  2QM7 A;  3MFN A;  5KJ7 D;  2HJM A;  4HEA J;  1JY3 P;  3VAY A;  2E76 C;  2V7Q J;  4FX5 A;  4N4W A;  2WVR A;  2LR2 A;  5KLV J;  2ZXR A;  1JM0 A;  2LP4 A;  3HE5 B;  3IAO A;  1YJ9 P;  4PK4 A;  3H1L G;  3LLI A;  2PX3 A;  1QVG O;  1G5Z A;  4N3Y B;  1BCC J;  4L6R A;  2XLH A;  1BE3 E;  2RSE B;  3WAQ A;  1JEK A;  3IQC A;  2EPL X;  3L35 A;  3WU2 H;  2FFD B;  2YMY A;  2GA0 A;  1FAV A;  1PGP A;  3W8I A;  2IM8 A;  1BR4 A;  1HGV A;  1KQG B;  3HD7 D;  1SFC C;  3K66 A;  4MS2 A;  4YWQ A;  5IY5 C;  1NTK D;  3RK2 D;  3CXH H;  4JCZ A;  5COM A;  1OXZ A;  2WVO A;  3EH1 A;  2R7R A;  1QVX A;  1IFD A;  1N7S B;  2OTJ P;  5COG A;  4E7Z A;  4CS9 C;  1SQV G;  1VLS A;  2V3C C;  2VRS A;  3QMK A;  2XLV A;  3S29 A;  2XLD A;  3M06 A;  4IAQ A;  1Z5Z A;  2A06 E;  5JT4 A;  2LFF A;  3RL0 C;  3U8P A;  4YK5 A;  1NZE A;  3GHG A;  2XSE A;  1NKZ B;  2IXM A;  3EHM A;  2BL2 A;  2MJZ A;  4DJ9 A;  4BJ6 C;  3L75 J;  4H13 B;  1C02 A;  3F46 A;  3KH2 A;  4JEB A;  1L4A A;  2OAR A;  2YLG A;  5B5E E;  3RBX A;  5DS4 A;  5B3I A;  3T6B A;  2ZT9 C;  4LDR A;  2D2C C;  1BGY D;  1YA9 A;  1YZC A;  1R8E A;  1KC8 Q;  3L74 G;  2KLV A;  2ZXW C;  1VL2 A;  2CNW A;  1OFC X;  2IBF A;  2P7J A;  3ABV C;  1URQ D;  3AE6 C;  2K3R A;  1IO4 A;  1RJ9 A;  1LKX A;  3U9J A;  2WQY C;  4JJG A;  5DLJ A;  4D6T E;  3W2V A;  4CIP A;  1JY2 N;  1M90 Q;  5KYX A;  3JCU Q;  1KIL C;  3RW0 A;  2P61 A;  4M63 A;  2QJP B;  1L0L K;  4OIP F;  1KIL E;  5EHH A;  4MTO A;  4AYC A;  1M2V B;  1MFZ A;  3KKB A;  3H1H E;  2QVA A;  1FZB A;  2OYI A;  1IZN B;  3OAK A;  2OTK E;  2FFH A;  2GAQ A;  3IN6 A;  2WT7 B;  4IFD K;  1U7J A;  2XNX A;  2Z5H A;  1CW5 A;  4IAR A;  2Q7C A;  4YT5 A;  4N78 D;  3E1I A;  1AFO A;  2K37 A;  4PJM A;  5JP7 A;  5K0I A;  5APU A;  1KQL A;  2CPB A;  1E85 A;  2W45 A;  3IQ6 A;  3IF4 A;  2IBZ E;  4XA4 A;  5CCG D;  1G1J A;  2KSF A;  3AOU A;  5B1B C;  2L81 A;  4IRU A;  1HF9 A;  4WGZ A;  3AGU A;  4U5F E;  5JUA A;  2OOC A;  1NH4 A;  3HKK A;  1KB9 D;  5CBO A;  2HR3 A;  5FCL A;  3MUD A;  3Q5P A;  5CI8 A;  3MBG A;  2I8D A;  4CDY A;  4LAC B;  3EPV A;  2CGE A;  1L0N G;  4RJT A;  1HJB A;  2HV7 A;  3CI9 A;  1JCC A;  5EGY A;  1YAR O;  1M1K Q;  5BQH A;  3T9O A;  2PF4 E;  2QJY C;  1KNY A;  2FYN B;  3S27 A;  3CCJ P;  2LIG A;  1R5S A;  3L70 J;  4O6N A;  2N1T C;  2QA4 P;  4XPY A;  3HNL A;  2MHR A;  4MVZ A;  4PD4 E;  3CX5 H;  1VYK A;  4J30 B;  3UMK A;  2OYH A;  3V5X A;  5GTH E;  1BR1 A;  1NTK G;  2YIU C;  2QJK B;  1BSH A;  1CPR A;  1ZLL A;  3L8I A;  2FFD C;  1QLE D;  4JEA A;  2ZYG A;  3FWN A;  1MV8 A;  2Y0C A;  1VMA A;  1HBW A;  2CDQ A;  1KMI Z;  5KAF H;  3O39 A;  2KS1 A;  4O6Y A;  4NPF X;  1RE4 C;  4TT3 H;  1C17 M;  1G8X A;  1NU9 C;  3CCM P;  1A7V A;  4YN0 B;  2LSE A;  3G50 A;  1N7L A;  3AG3 C;  5A6A A;  3S90 A;  1R5I D;  3C7J A;  2J7P D;  1OXB A;  1N7S C;  1RHZ B;  2IYO A;  2D5R B;  3G6E P;  5H2F E;  1BGY G;  5CCH C;  2R25 A;  2L91 A;  4JBZ A;  5KLV D;  2K88 A;  2K9J A;  1Z3I X;  2O3J A;  2AXC A;  3KZI H;  3X2Q C;  1IFJ A;  4EDF A;  2AEF A;  1T6A A;  3Q6N A;  2PP4 A;  4H13 C;  2OJQ A;  1RKE B;  2Q3T A;  3L8J A;  3PHF 2;  1ZV8 A;  1KD1 Q;  3ZQV A;  1BCC D;  1BBH A;  1XTC C;  2ZAE B;  1HW2 A;  1EZV E;  5M1B A;  3GEI A;  2Q1K A;  2VCA A;  2W8Z A;  2XLO A;  3U59 A;  3V5Z A;  2JEE A;  3VMY A;  2W27 A;  4IWB A;  2J5U A;  3VYI A;  3B5N B;  4U7J A;  1OR2 A;  2E76 D;  3CCQ P;  3PCV A;  4ZMD A;  1XTG B;  1WWP A;  1WMK A;  4KBL A;  3EFO A;  3LNR A;  5KYW B;  2VAS A;  1X0T A;  4CBE A;  3SZR A;  1FZE A;  3V2P A;  3AE9 C;  2OKU A;  3EGX A;  3EFG A;  2JP3 A;  1YQ4 C;  2ASR A;  3S4R A;  1BE3 D;  2SPZ A;  2L9J A;  4I1M A;  4E0I A;  3B8E B;  1JOG A;  2Q5U A;  1OZH A;  1LT9 A;  1RF0 A;  4PR9 A;  1EXJ A;  2XLW A;  3HE4 B;  1LJ2 A;  3ZVR A;  1PV3 A;  5KYU B;  4LGD E;  2L6G A;  1V54 C;  1LTJ A;  2A0U A;  3FAP B;  1WGW A;  3LS0 A;  3TNU A;  1LP1 B;  2KUB A;  2YMK A;  2J0X A;  1GMJ A;  4EBB A;  1SFC D;  4DCK A;  1AVO A;  1SQV J;  1Y6D A;  2YO2 A;  4OWF A;  1FZC A;  1UG7 A;  1SP4 A;  4OIO F;  3M4C A;  4IJJ A;  1TWH A;  2A06 D;  1JPJ A;  3ZG1 A;  2HMQ A;  3H1J E;  3V5B A;  3HNK A;  2FY8 A;  3A0H E;  3RL0 D;  3BVH A;  2Y3B A;  5AVY B;  1KN7 A;  3G3Z A;  1IFN A;  3L74 J;  4GYT A;  1FBM A;  5CMZ A;  1M6T A;  2ZT9 D;  1SQP E;  2D2C D;  2B87 B;  2XLM A;  3ASO C;  1IK7 A;  2BCC E;  2FYN C;  4D4N A;  2OQQ A;  4K0D A;  1OWA A;  5B3S C;  3HUS B;  3VN0 A;  4XQ1 A;  2WWW A;  1NHL A;  2A45 H;  3M9H A;  2PX0 A;  5E3A A;  3AG1 C;  1KZU B;  3JCU E;  2ZD9 A;  1EQ7 A;  5D91 A;  2KP8 A;  1SQQ E;  4QMA A;  1KIL D;  2FGY A;  1ORJ A;  3HD7 A;  2N9B A;  3AE2 C;  1TQG A;  4RKU J;  4E18 A;  1NAF A;  1QZX A;  1Z7Q c;  4CIH A;  3TOL A;  3VMZ A;  1SYQ A;  1CGM E;  3H1H D;  2G3K A;  5KAI E;  1DOV A;  4FWV A;  2BCC J;  2GDC A;  2WIT A;  3LAY A;  1S5L E;  5KLV G;  4E7S A;  1L0N E;  1LE2 A;  1LI5 A;  4U5B E;  3SWK A;  4WY4 B;  2R5B A;  5HV9 A;  2WSF J;  1NTZ K;  4BG0 A;  1ZXG A;  1PCX A;  1T3U A;  2YO3 A;  1SQB K;  1MMD A;  2IBZ D;  2R3C A;  4ZNC A;  1DEB A;  2E74 B;  3Q3D A;  3LNM B;  1CPQ A;  4U5C E;  3C8G D;  4DXW A;  1M1J A;  1WAT A;  4U5H A;  1OVU A;  1LS1 A;  1URQ A;  4NTB A;  2HMZ A;  4IL6 H;  3IQ5 A;  2I8B A;  4DZO A;  1L0N J;  3QW0 A;  3AJM A;  4IAO A;  3UMH A;  3NXS A;  1SR2 A;  1D1B A;  2KNH A;  3DI5 A;  2R9R B;  3C18 A;  4MW8 A;  4R32 A;  1PGJ A;  4WAB A;  1SF8 A;  1N73 C;  1BE3 G;  3B5N C;  1SQX K;  3A0B H;  3GEE A;  4B86 A;  1ZHX A;  4XEF A;  3MYF A;  3N24 A;  3FXE A;  2DB4 A;  1E79 H;  4OD5 A;  4ULV A;  3E7K A;  4BRY B;  1EC5 A;  2H7V C;  4Q4Z F;  1HE1 A;  2F22 A;  1ZRT E;  4I1L A;  5L0F A;  4UB8 H;  4PD4 D;  1JNM A;  2N1T D;  3H32 B;  1GU5 A;  1QVF O;  1K73 Q;  3V2R A;  1LWU A;  4AE4 A;  1PL5 A;  4W8K A;  1CGO A;  4PJ0 E;  2R3S A;  2WPQ A;  1RE3 A;  4R4L A;  3PRJ A;  4WB4 A;  2IYL D;  2OG2 A;  1ZYR F;  3GW6 A;  3CCR P;  5DS5 A;  3AEE C;  5AW5 B;  1AVY A;  1G2C B;  3T97 B;  2B9B A;  3M4B A;  1L0L E;  1YJG A;  4IB4 A;  1BGY J;  3I56 P;  1FTS A;  1D0Z A;  3VF0 A;  3CWB E;  1N7S D;  3FXD A;  1IFM A;  3US6 A;  3CCS P;  2BAS A;  1DD4 A;  2YXR B;  5CCH D;  4LLE A;  2M4E A;  2XM4 A;  1VK5 A;  2E42 A;  5CI9 A;  3U5S A;  3U1C A;  3P8C E;  2TMV P;  3V2Q A;  4JPZ B;  4H13 D;  3DE8 A;  4D6T G;  3AE5 C;  4WVZ A;  2BE5 F;  2KB7 P;  1FOS F;  2HUJ A;  4KJM A;  3L36 A;  1A7E A;  2E75 B;  4LDK A;  1JMW A;  1BDD A;  2Q9C A;  4N06 A;  3HUS C;  4DRJ B;  3H1H G;  5AW7 B;  5JVE A;  4I7Z B;  2Q00 A;  2W4M A;  2JX0 A;  5L8R J;  2PFX A;  2PGD A;  1SQV D;  2R7S A;  3WU2 E;  3UIA A;  5E33 A;  2A6E F;  1G4W R;  3GEH A;  4P6I C;  4M3L A;  4O6M A;  1ORY A;  1HUC A;  2RN0 A;  3GLM A;  4GOD A;  2XL4 A;  2QNL A;  1ZW2 A;  3NMD A;  3RL0 g;  2IBZ G;  3LUT B;  1OKK D;  2MYS A;  1NTM K;  2C9N Y;  3CXH E;  5GTI E;  1IFP A;  3L71 E;  4WY4 C;  2YKQ A;  4PAC A;  2O9X A;  3L74 D;  1LTT C;  1K04 A;  2OQM A;  1SZI A;  3F5H A;  3WHN A;  5AW0 B;  1Q82 Q;  1T9K A;  4HE8 D;  2Y9Y A;  1WRG A;  3G4Z A;  3H1J D;  1P84 I;  3TD7 A;  1AJY A;  1JY2 O;  2XDJ A;  1VQK P;  3RQE A;  1XWJ A;  2R05 A;  3CCU P;  4MVU A;  3GHG B;  4BEJ A;  3H2V A;  2IZ1 A;  1SQP D;  1L4A B;  2BCC D;  2IDB A;  1K9M Q;  1D1A A;  1FDM A;  3LW5 H;  1KU2 A;  1KOR A;  2FAP B;  3H1K G;  1O3U A;  4K3A A;  3NMK A;  5F5H A;  1LI7 A;  5TIS H;  4MTF A;  4N6C A;  1H89 A;  1KQS O;  1ZU4 A;  5JLI A;  1RJ9 B;  1SQQ D;  4KC9 A;  3M1C B;  3NYJ A;  1OMI A;  3L37 A;  1BDJ B;  1QEX A;  4C7N A;  4PD4 I;  4YL0 A;  5AC5 A;  1VOM A;  1JY3 N;  3V6I A;  4JKV A;  4AUW A;  2O01 H;  2Z4E A;  2IYP A;  1EDJ A;  1VQ4 P;  1H0T A;  1V74 B;  1LT1 A;  2Q3I A;  1VQ8 P;  3AE3 C;  3ITK A;  2IZ0 A;  4CS9 A;  4MVS A;  3DM5 A;  4G7H F;  3ZTM A;  1L0N D;  2OYI B;  3KXD A;  3M79 A;  1NKN A;  1Y47 A;  1J1E B;  2YEV A;  3L34 A;  2Y0E A;  1Q90 D;  1EZV G;  2I1K A;  5DJU B;  1FMV A;  3SFE C;  4C3B A;  3CME P;  4GIF A;  3DWW A;  2P1J A;  1ZU5 A;  1BR2 A;  3GWN A;  3IQT A;  3ZIB A;  1QX8 A;  3CC4 P;  1JPN A;  3I5Q A;  1U57 A;  3FOO A;  3EZH A;  1H9G A;  2Y9Z A;  1QGK B;  1VTM P;  5GTI H;  3S1K A;  4GQH A;  1YAU O;  1ZR4 A;  2IOQ A;  2NUP A;  1BE3 J;  3IEE A;  1RMV A;  2E75 C;  2GUS A;  1S5L X;  3P32 A;  3RK3 B;  1GW4 A;  1R5L A;  5APY A;  1KV4 A;  3T4R A;  2QG4 A;  3K1I A;  3A9C A;  3B5N D;  4AK9 A;  3TYY A;  1TKN A;  1FJP A;  3CX5 E;  2H8P D;  1J1D C;  4I7Z C;  3CD6 P;  1ZRT D;  3H1I E;  2R5D A;  4D4X A;  1VQ7 P;  1OR3 A;  3M0D A;  1VQ5 P;  4PV1 C;  2AEM A;  2AU5 A;  1FDO A;  3F89 A;  3AED C;  1NLX A;  3W67 A;  1OCR C;  5DQZ A;  2WZL A;  5KAF E;  2FYU K;  2N9Y B;  2Q6Q A;  3FGA D;  2OYH B;  1PZQ A;  2KQ9 A;  1IZM A;  1N8R Q;  3OEO A;  4XEV A;  4H54 A;  5E3C A;  2CYD A;  2XXA A;  3NTN A;  3C8G A;  4JTA B;  4L76 A;  2IPP A;  4EIJ A;  3H1J G;  4O9B A;  1D0X A;  4MVQ A;  1L0L D;  2KS1 B;  1JUN A;  3NMI A;  1KYO I;  4UB6 H;  2L6H A;  2XS8 A;  3CWB D;  3KZI E;  4H44 B;  4OGQ C;  4MVM A;  4DRI B;  3TF5 A;  4I3M A;  4BJ1 A;  1L2P A;  1H6G A;  1SQP G;  2DI3 A;  2BCC G;  3W68 A;  2RD9 A;  1J2J B;  4D6T J;  4MW3 A;  2FYZ A;  2PRR A;  3RFY A;  3P8C D;  1YVI A;  2K9J B;  1YIJ P;  3LJB A;  1NTZ E;  4LC1 A;  1YJW P;  2AP3 A;  1PIX A;  3GHG C;  2N1T A;  5C39 A;  1SQQ G;  4I2L C;  1GK6 A;  2O01 N;  1Q0K A;  5AW6 B;  1LTS C;  3H1H J;  3HRN A;  5AVV B;  2RKL A;  5B66 E;  2NPS C;  3HTK B;  5AW4 B;  3RIP A;  1GS9 A;  3VM6 A;  1YDI A;  1TFK B;  3EFO B;  3D6Y A;  1NSG B;  2Y39 A;  5CHX A;  3MP7 B;  5CBN A;  4G0H A;  4ONS A;  3EGX B;  2H88 C;  3RQF A;  1NU1 K;  4HFF B;  2JKV A;  2DYR C;  2YQY A;  2LXB A;  4JZA A;  4ZLD A;  1FZA A;  4U3F E;  2G8Y A;  3BCC E;  2R7T A;  3MGN A;  5L0J A;  3CXH D;  5CCH A;  2OYI C;  3L1M A;  2HOD A;  5D92 A;  1B68 A;  1LT9 B;  1Y9B A;  2NG1 A;  2KSE A;  4JW1 A;  1J1E C;  2QLA A;  4B6I A;  3LID A;  2R7U A;  2IXO A;  4WY4 D;  3NKE A;  4UDV A;  2J59 M;  1NFO A;  1V55 C;  1VYI A;  4XE5 B;  1ZN5 A;  3H1K E;  2P1A A;  3TNU B;  2WVN A;  2WTY A;  2JO1 A;  1MMA A;  5B1A C;  2P2U A;  2XL8 A;  2E74 D;  4U5D E;  1W2E A;  4C3D A;  1KFM A;  1FZC B;  1JAF A;  5AW8 B;  4LLC A;  5TJ5 E;  5BQG A;  3O6Q A;  3KYJ A;  2G3V A;  2Q9B A;  1JRA A;  1RF1 A;  3KPH A;  2A0B A;  2R7X A;  2POH A;  3MUD C;  1XZQ A;  2O1J A;  2ZPA A;  3II6 A;  2MWQ A;  3KL4 A;  2YWA A;  3H1K J;  2H7H A;  3RK3 C;  1S9K E;  4PFO A;  4JJF A;  2FBW C;  2C9L Y;  2LFD A;  3MIW A;  5APQ A;  3RK3 E;  2EIK C;  1M2V A;  2ZVO B;  1PFI A;  2WPR A;  3OA1 A;  4AQR D;  1OVR A;  5AW2 B;  4H0L B;  4MTG A;  3TUL A;  2G3A A;  4GKG A;  3EH2 A;  1A02 J;  1GL2 A;  4CX9 A;  2LQG A;  3EHN A;  4CJG A;  5KLV K;  3KHU A;  4I6M C;  1ZME C;  3PMR A;  1L0L G;  1FS0 E;  1QPU A;  1GDT A;  3DM9 B;  4XEK A;  3DAF A;  3HD7 B;  4LDQ A;  3CWB G;  3EWK A;  2A6H F;  2UUH A;  5CJ4 A;  5B66 H;  4HFK B;  3Q5S A;  1PP9 E;  1CI6 A;  1BZ4 A;  2W6A A;  2KIK A;  2QJP C;  1H8A A;  2Q4F A;  1K05 A;  5T3W A;  2Y3D A;  4IOI H;  3P8M C;  1E83 A;  2WZ7 A;  1P84 H;  1N86 A;  3EGD A;  2KK1 A;  1BDC A;  3C62 A;  3JSZ A;  4MVR A;  1YBK A;  4IL6 E;  1U6H A;  5BQI A;  3A3Y B;  1NTM E;  3L4F A;  2EIL C;  5JS5 A;  2ZYD A;  1PP9 J;  3QWO C;  3H6P A;  1F1M A;  2YLD A;  5EFW B;  4XPX A;  2PNO A;  1M1J B;  2HKV A;  2NPU A;  3A0B E;  1URQ B;  2NZ2 A;  5KKZ B;  5A6K A;  1JTH A;  2Z15 A;  4CJO A;  5KJ7 A;  2YL0 A;  2XZR A;  1QKR A;  2E75 D;  4GOF A;  4YT2 A;  1DX7 A;  3HTK C;  4Z9I A;  4OIN F;  4OIQ F;  4UB8 E;  2Z5I A;  4JUR I;  4K7B A;  1KQF B;  3JSE O;  2YZS A;  3CX5 D;  1UFB A;  2KSJ A;  3TSI A;  2WSE H;  4JYC A;  4PJN A;  4EYY Q;  1KB9 I;  3BRT B;  3S0X A;  3M15 A;  4BJ5 C;  3GMA A;  2PBE A;  3AE4 C;  3L71 G;  5E79 H;  4JRZ A;  2HPC A;  4PV1 D;  2GA1 A;  1LM3 B;  3AEC C;  4CDA A;  2GUV A;  3U3F A;  1LWU B;  4AE4 B;  3UNG C;  3MD0 A;  3AE1 C;  3AEA C;  4C7O A;  2HFI A;  3KPE A;  4D6T D;  3VOP A;  4Y28 J;  3H1J J;  1LT9 C;  1RF0 C;  2UUI A;  3TJ6 A;  4AX2 A;  3GM3 A;  2IFM A;  2WVQ A;  4OH8 B;  4YL1 A;  3BAT A;  4EUK B;  2QJK C;  4WGY A;  3CXH I;  5BVZ A;  2GM4 A;  3DJU B;  1JMM A;  4BEM J;  1AQT A;  4DVY P; 
#chains in the Genus database with same CATH homology
 3AEF C;  3D6Z A;  1VF5 B;  3Q3D A;  2K9Y A;  3GM2 A;  3GF7 A;  1ZP0 C;  2P10 A;  1ZME C;  1PIX A;  1OW6 A;  3O10 A;  1JOG A;  3C8G D;  1QVX A;  4I7Z B;  3AE8 C;  1EXJ A;  4OGQ D;  1ZZP A;  2Q00 A;  4XEK A;  1PV3 A;  5L8R J;  2JX0 A;  3D71 A;  2QJY C;  1UIX A;  4YTP C;  1KNY A;  3EWK A;  2L6G A;  3AJM A;  1RQV A;  1Q90 D;  2BEQ D;  4GDO A;  4Z1M H;  3SFE C;  3Q5S A;  3S9O A;  3C18 A;  2QIW A;  3C8G B;  3JZ0 A;  2YMK A;  1GMJ A;  2E76 B;  2WSE J;  4OGQ B;  4EBK A;  3GLM A;  4R32 A;  3H25 A;  2QJP C;  3D70 A;  1K05 A;  3RL0 g;  1MKM A;  4H13 B;  2BEZ F;  1U57 A;  1WOL A;  4XEF A;  3Q5R A;  3D6Y A;  2YIU C;  3L8I A;  2ZT9 C;  3G9R A;  2D2C C;  1R8E A;  1DIP A;  2H88 C;  2KK1 A;  3RQF A;  3C8V A;  1ZRT E;  4XFJ A;  1VL2 A;  1JB0 J;  1K04 A;  1KMI Z;  2L6F A;  5F28 E;  2E75 C;  4H0L C;  2JPU A;  3SFD C;  3ABV C;  1S5L X;  3AE6 C;  4TT3 H;  2G8Y A;  1PL5 A;  2MKV A;  1KTM A;  2WQY C;  3RQG A;  1HJ0 A;  1OW8 A;  1VF5 C;  1Y9B A;  3LW5 J;  4I7Z C;  2ZT9 D;  2D2C D;  3R4Y A;  4YXD C;  2NZ2 A;  1KIL E;  1IK7 A;  4R4L A;  3B71 A;  2FYN C;  3Q1M A;  2OQQ A;  1OW7 A;  4EBJ A;  4PV1 C;  1AJY A;  3BRJ A;  1FDO A;  4H44 C;  2E75 D;  2JO1 A;  4H0L D;  1FDI A;  3AEE C;  3AED C;  3MFN A;  3RQE A;  3T97 B;  2D2C B;  2E76 C;  1TU3 F;  2E74 D;  1K40 A;  1V4A A;  1NYH A;  2V7Q J;  3IN6 A;  1KQF B;  3K7D A;  3FGA D;  1UFB A;  1VF5 D;  4H13 C;  3Q2Y A;  2E74 C;  3L8J A;  3AE2 C;  2IDB A;  3O6Q A;  4KT0 J;  4RKU J;  3IAO A;  4XEV A;  3JYY A;  3AEG C;  1KOR A;  1YQ3 C;  2O01 J;  3AE7 C;  5M1B A;  3GMA A;  2PBE A;  3AE4 C;  5KLI C;  1O3U A;  3C8G A;  1DD4 A;  3U0C A;  1EXI A;  4R4M A;  4PV1 D;  4H44 D;  1WTY A;  1ZOY C;  2J5U A;  2QSI A;  2LK4 A;  4U7J A;  3AEC C;  2E76 D;  3U3F A;  1S1C X;  1RQU A;  2YWA A;  1WWP A;  1WMK A;  2H89 C;  3AE1 C;  3AEA C;  2FBW C;  2L6H A;  1HF9 A;  4NQF A;  4H13 D;  3RK3 E;  2ZT9 B;  4PV1 B;  3AE5 C;  1OMI A;  4OGQ C;  4H44 B;  4Y28 J;  2WPV B;  3AE9 C;  2WSC J;  2WSF J;  3AEB C;  4IL6 X;  2HSB A;  2JP3 A;  3GM1 A;  3Q5P A;  2FXP A;  5KKZ C;  3GM3 A;  2E75 B;  4H0L B;  1YQ4 C;  3TUL A;  1NGM B;  1DD3 A;  2G3A A;  2QJK C;  3AE3 C;  2E74 B;  1KQG B;  3GF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...