1OW8A

Paxillin ld2 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
134
structure length
134
Chain Sequence
b'NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Molecular Recognition of Paxillin LD Motifs by the Focal Adhesion Targeting Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 60
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow8A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow8A02
5F28E 2HSBA 3AE3C 3RQEA 1YQ3C 3L8IA 3C18A 1K04A 3L8JA 1ZZPA 3AEBC 3AE9C 1UFBA 3C8GB 3U0CA 3AEDC 4YXDC 2H88C 3U3FA 1OW8A 1QVXA 1PV3A 1JOGA 3RQGA 3TULA 3MFNA 3BRJA 3O10A 4R32A 2FBWC 2KK1A 3B71A 2YWAA 3C8GA 3AE7C 3AECC 3GM2A 3SFEC 2Q00A 3JYYA 1KTMA 4EBJA 4EBKA 3ABVC 1V4AA 1O3UA 3JZ0A 2WQYC 3GM3A 1K05A 3S9OA 3AE1C 1WOLA 2G3AA 3GM1A 1K40A 3AEFC 2LK4A 3AEGC 2L6FA 4XEFA 3K7DA 3AE4C 3RQFA 1OW7A 1KNYA 3AEAC 2L6GA 2JX0A 2L6HA 2PBEA 3AE8C 4XEVA 1YQ4C 2H89C 2JPUA 4XEKA 3C8GD 3AE5C 3AJMA 1WWPA 1ZP0C 1OW6A 3AE6C 4YTPC 3AE2C 3AEEC 1WTYA 1ZOYC 3SFDC 4NQFA
chains in the Genus database with same CATH superfamily
4XQ1A 2A68F 3DE9A 1FZEA 2H7BA 4P9FA 4XFJA 1W2WA 3C18A 2R25A 1JEKA 1JCDA 4CPGA 2Z5HA 2L7AA 2YKPA 1UFBA 2XNDH 3R7CA 3HD7B 1NU1E 3RGUA 5FCLA 4MNDA 3TGUE 3AGUA 1QL2A 5KYXB 1HE1A 1Q0GA 1PV3A 2AWCA 2XDJA 3L72G 3TULA 1JM0A 4I6MC 1KMIZ 5AVUB 4UB6E 5CBOA 2WPVB 5TJ5E 3L1MA 1LM3B 1G1JA 5IY5C 2Y39A 3JCUH 3PDMP 1HJBA 1KYOD 1H89A 1FDIA 5KYWB 2XL4A 1RF1A 1CI6A 3CCEP 3DZAA 3BCCJ 3LIDA 3EZIA 4IJJA 3PTZA 2KGOA 1MMGA 5APSA 1PPJG 4PJ0E 2BL2A 1OVUA 2H7HA 3L73G 2CNWA 3GM3A 1AA0A 4KJMA 2JEEA 3TYYA 2PNOA 2CK3H 4YK5A 2ZVNB 3W68A 1VF5B 4JCZA 4ASVA 3HJCA 4EYYQ 3CC4P 3IFMA 4H13D 3POVA 2H8AA 3H32B 5B3SC 1HVVA 4JYCA 1FR0A 4H54A 5FZTA 3H1JJ 2POHA 2W9YA 2XKMA 5E79H 1X79B 1YQ4C 1KN7A 3US6A 1YJNP 4OINF 3H1IE 1HW1A 1J1EC 5AVRB 3M06A 4BRYA 1VQOP 2PF4E 2VB6A 3BRTB 3AJMA 3EGXA 3CCUP 3LJBA 3IQCA 4EIYA 4LLCA 3IEEA 4H13B 3W67A 2BE5F 4OIOF 1V74B 2N1TC 1D1CA 1M56C 3O8ZA 1GL2D 5DS5A 4N4WA 3H1LE 1G4WR 4H0LC 2KYVA 1VQ4P 4G7OF 1Y8AA 2A6EF 2D5RB 3RW0A 1HW2A 4CS9C 1NVOA 2DYSC 2QJKB 4IOIH 1HMOA 1L4AD 3SZRA 5CMZA 2R5DA 4N78D 5B5EE 3S28A 4MTOA 3U3FA 2M3EA 2WSCH 4O9BA 1PD1A 3MGNA 3RK3D 3A5TA 3JCUQ 2YMYA 2V4HA 4JIOA 2L91A 4QMAA 2JKVA 1BGYE 1R8EA 3B71A 1GL2B 3SP1A 5B3IA 4U7JA 3OWTA 1VTMP 1JY3N 3MTUE 1VQKP 4C46A 2EPMX 2VCAA 2XLWA 5H2FH 1L4AB 4K3AA 4UDVA 1KTMA 5EFWB 3TNUA 4YT4A 1OWAA 1X8YA 4XPYA 2SPZA 3RK3B 3ZTZA 1SR2A 2XV5A 3CXHE 5CCHC 3WODF 1ZN5A 2BEQD 5KTBA 1OVRA 4MVZA 1BBHA 2V7QH 2Q7CA 2C03A 3UNGC 3C8VA 5APWA 2OYHB 5CCGC 2P10A 1Z23A 5GTHE 2R3SA 2EPNA 3B8EB 1KQLA 3HNJA 4I7ZC 1KILA 1EDIA 3M0DA 1CGME 2A45G 2RKLA 2XM0A 2PX3A 3H1IG 1ZHWA 4BWNA 2RSEB 1MQVA 2YKZA 3ZWIA 2W27A 1EZVE 2AEJA 4D6TG 3MHVA 3GODA 1FE6A 4LERA 4PJNA 4XE5B 3DD7A 1D1BA 5AC4A 2GA1A 1FZCA 1OW6A 4Q4ZF 1OX3A 1LE2A 4BJ5C 4IL6E 1OR2A 2ZXOA 3SWYA 5L0JA 1RF0A 2KUBA 3H1LG 3I5QA 2E5TA 1NTZG 1LP1B 2J7PD 1ZHYA 2HSBA 3HE5A 4Q5SF 3H2UA 1SQVD 1TWGA 2YL1A 2KB7P 1S4XA 5B1AC 3RFYA 3CAXA 1N7SA 4I1MA 2QRXA 4FX5A 3NG1A 3CL3D 1W2BO 1E83A 1YARO 4U5DE 4DJ9A 5AC5A 5L0HA 3CQZA 4UB6H 1M90Q 1LTJC 3RQGA 2IOQA 2A1DD 1C02A 4Z9JA 2QE9A 3L72D 3X1OA 2LP4A 4XPXA 5KJ7A 3EH2A 2B9BA 3GF7A 3QWOC 1RKEA 3U9MA 3BASA 3V5YA 3C9IA 3GM2A 2IM8A 3Q7LA 1ZRTE 4U5GA 2VC9A 1BCCG 2OQQA 2A0BA 1H0TB 2KJGA 4PJ0H 3P8CE 3JYYA 1M2VA 1MZ9A 2KOGA 1OFCX 2WB7A 4JJGA 3IQTA 2E74C 4N6HA 3C1LA 3TOLA 1PPJD 2ICWG 1ZYRF 2OYIA 2J0WA 1ZXGA 3EHMA 2R3CA 1LWUA 3NXSA 5KYUA 4EOTA 3MD0A 3S9OA 5CJ0A 3S90A 2X51A 5DJTB 3L73J 3G71P 3GM1A 1NU1K 4RO0A 2FXOA 4U3FD 2OYOA 3PRJA 3AEGC 3H6PA 2WZ7A 1SQBD 1NG1A 3NTNA 2A45H 1PP9D 2OCCC 5EGYA 3BCCE 2J58A 3WMM0 2PBEA 2GFHA 4WY4D 2OTLP 2VCBA 1Q0FA 5AVZB 4CIPA 4OVNF 2M8RA 2OQMA 4UB8E 3U1AA 2O1JA 3CWBJ 2YNYA 1NFOA 2HKVA 2UUIA 3VN0A 3MLGA 4AYCA 1FZGA 2WT7A 5L3VA 2WSFJ 1HJ0A 3EGDB 3V4WA 1VLSA 4Y99C 3I56P 4JC7A 2EIJC 4BJ6C 1TWCA 3KYIA 4WY4B 3H1JE 1NU1D 3AG1C 5B5EH 3TGUD 1UIIA 3HKKA 1YIJP 1GK6A 1Q0MA 4LDQA 3SEOA 5JSLA 3QTHA 1LTIC 2PGDA 4QI0A 3T4RA 1AQ5A 5APQA 3FWLA 3KZIE 2ZYDA 5AW4B 2ETSA 2JDIH 2A06D 5KLIB 3T9OA 2AEFA 1M57D 4DRJB 3NKDA 2HFIA 4ZLCA 1DOVA 1LI5A 1SF8A 1XTGB 2ZYGA 3AG2C 2XNXA 1T6QA 3HD7A 2WPSA 1JUNA 4C3EA 4H4KC 1NKZB 1KD1Q 1LPEA 4GOFA 5KYXA 3GF3A 2WZFA 3S84A 3N4XA 2FKWB 3CXHH 5DLJA 2GWWA 3E70C 4JVSA 3LEOA 2EPKX 1JRAA 1V4AA 1AVOA 2A45I 4PR9A 4ONSA 4XPWA 3O6QA 4DT0A 5GTHH 3Q2YA 2E75C 1NTZK 3L75G 1H88A 4KT0J 2DYRC 1RE4A 2YKOA 1KQFB 1T6UA 2CCYA 5KYWA 1VDFA 2G3VA 1KC8Q 4CS7A 1HWTC 3PH0A 4CJGA 1K40A 1JTHB 2YHSA 3T97B 2G3KA 3GHGA 4J7TA 1RE3A 3RL0g 5AW5B 1KILB 4MW3A 3K1IA 1GDTA 2XL6A 2WSSH 3UIAA 3S27A 3IHUA 3VRCA 3H1ID 4HKZH 1HUCA 2VCCA 2FFDC 3VYWA 4IL6H 2WPQA 2JPUA 3AE5C 1LT9C 2QM8A 1OKKD 2ZFCA 1YBKA 2Y3HA 1OZHA 5APXA 3H32A 4YTPC 4D6TJ 1NYHA 2C0XA 2K9JB 3F5HA 2JD3A 3H1LD 2G8YA 2K37A 1NO4A 3O6XA 5E33A 3AQCA 4IRUA 3M4CA 2I1JA 1IC2A 1U89A 3WAQA 1NTZJ 3L71G 1SQXG 1QQ3A 3CX5E 3VF0A 3QMKA 2WMMA 3UGOA 3NDBB 3RH3A 3FGAD 1VQPP 2R7RA 4I3MA 4OWFA 3DKAA 4YXDC 1BDCA 1U6HA 3Q6MA 1OCOC 1BGYD 1U7MA 1OXKA 1GM5A 3ZDMA 3WU2E 1S72P 2HMQA 2WVNA 4K1OA 2X0CA 4MN4C 2R7SA 2FYNC 1FS0E 4R32A 4L76A 2KSEA 2R32A 1EXJA 1K73Q 1T6AA 1CGOA 2YZSA 3UMKA 5JVEA 3S1KA 1URQC 4H44C 1XTCC 3W2VA 3VTPC 3CXHD 4PJJA 4HFFB 3VMYA 4MS2A 1LJ2A 2DW3A 1A7VA 1LIHA 1NH4A 1LNQA 1VQ9P 1ZVZA 4NTFA 2D4UA 4DZOA 1BCCJ 1T2KC 1GL2A 4MTFA 3N2ZB 2CGEA 3B4SA 1E84A 5AW6B 2OJED 1USDA 4U5BE 4Z1MH 4CSAA 3PP5A 3OA7A 2W8ZA 3MX3A 4E0HA 1L4AA 1TWAA 4U5EE 4B86A 3SXMA 3IAOA 3FVYA 2P1JA 1ZR4A 3Q6NA 5KYUB 4I1LA 4RD9A 4O6NA 4OIRF 3MUDA 1RH5B 4JYBA 1EZVD 1SS1A 1LT1A 1IFIA 4DVYP 3Q5RA 2WL8A 1PGPA 2HPCB 4UB8H 3R2PA 2OYHA 2JWDA 4JJFA 4O7GA 2B0JA 3EG9B 3A9CA 4O6YA 2M4EA 4XEKA 3HUSC 3A0HE 4ZNCA 2KNHA 2QJYB 3L73E 4A2NB 2LCHA 3J06A 3TJ6A 2Y69C 4K7BA 5APTA 1ZOYC 2K9YA 1H7IA 2KIKA 4YT5A 1JO5A 2B89A 3RQEA 4Q7CA 4NY3A 4DRHB 3T6BA 1NBBA 1KZUB 2P6VA 1L0LG 3KZIH 1S9KE 2P67A 2XM4A 1Q0KA 3IQ5A 1NTMG 3IPMO 3ZTMA 1HH0A 1QEXA 1PL5A 3RF3A 1TKNA 2IXMA 3CWBE 4PK4A 2FY8A 2J59M 3FDQA 5BU8B 3PMRA 3RK2D 1RKCA 1J8MF 4YWQA 3IQ6A 5JUAA 2J45A 2PFDA 4KNVA 1PFIA 3HNLA 1ZRTD 3H1KJ 4C3BA 2B88A 5AW7B 3P8CD 2ZXWC 5E3CA 4XA4A 2NUTB 4C7RA 4AL0A 2OOCA 2IPPA 3RL0D 3Q5PA 4EBBA 2J7PA 3W2WA 4PV1D 3KPHA 3RK2B 1Z63A 4GDOA 2QJPC 1ZW2A 1GQAA 1N73A 1X9VA 5K0IA 2A0UA 4U5HA 2ZYAA 2MJZA 3V2PA 1SLQA 1AVOB 1H0TA 2PP6A 3O6QB 4Z9HA 5COFA 2KQ9A 3A0BE 1LTAC 3L75J 1H9GA 2C0WA 3BCCD 1HBWA 3RL0B 1OCRC 2ZXPA 4PV1B 3S0XA 3C8ZA 3RQFA 2VH3A 4FESA 3GHGB 5AW0B 1YA7O 2L6HA 3EPVA 2R7OA 4JZAA 5D92A 3CCSP 1FAPB 3KDPB 1ORJA 4XEVA 1C17M 3V7OA 1BR4A 4QDLA 1WWPA 4QI2A 2FXPA 2IZ0A 1MMAA 2KSJA 3FXHA 2NSFA 2EINC 2NUPB 2N9YB 1IK9A 2CPSA 1M8OB 1W5CE 2N1TD 3H1JD 2C9NY 3SFDC 2E42A 1ZLLA 3CX5H 3N0TA 3KPEA 3I4UA 4HE8D 1AQTA 5F28E 1M56D 3RIPA 4CDAA 3V6IA 5GTIE 3K1IC 3NFQA 3G4XA 4H0LD 4XLNF 1WASA 1SFCC 3CWBG 1D1AA 2HUJA 1PZQA 1VF5C 1D0YA 3RBZA 3EGDA 3L71J 1SQXJ 3WU2H 1DH3A 3SNHA 3MIWA 4YL0A 4D6TE 2JJLA 2IBFA 1AFOA 3LAYA 5TJHA 2XLVA 4ZMDA 1PGOA 4WY4A 3U2LA 3DM5A 2E5YA 1T9KA 2OEVA 1SQQJ 3U9JA 4Y28J 2YIUC 1J8YF 4H0LB 4PJMA 3AE7C 5L3QA 5KLVE 1NTZE 4JQ0D 1J1DC 4OGQC 2OEXA 5T3WA 5E3AA 4M63A 3LIEA 2QNLA 3OEOA 3ZDLA 2WVRA 3EFFK 2ZT9C 3EQ2A 3PHF2 4OH8B 1D7MA 3H25A 2YXQB 5CCHD 1O3UA 1FC2C 3M4BA 4IAOA 4EI2A 4J32B 2HYNA 3KXDA 3P7KA 3DE8A 1IZNB 1TWHA 2E87A 1GTWA 3NKEA 4MVMA 2QJKC 2P58A 5CCGD 1T01A 3JT1A 2L5GB 2HS5A 5K5GB 1L2PA 2Y3DA 2QA4P 1L0LK 3TQOA 4BJ1A 2R7UA 3B5NC 3WG7C 5DQZA 3U5SA 2Y0CA 2EPOA 2XLHA 3X2QC 1PGQA 1MFZA 1HMDA 4EWCA 1E2XA 2D2CC 2IXNA 1BCCE 4CS8C 1Y47A 3CX5I 4OIPF 3A0HH 1NFNA 5A69A 2YL0A 4MW8A 3DI5A 1JTHA 2HV7A 3FAJA 1H9TA 3T97A 1IZMA 2ZVOB 3W8IA 4I7ZB 2NPSC 4AK9A 3II6A 1IFDA 3AE2C 4GOEA 1NGMB 1LE4A 1R5SA 1YTZT 4Z9IA 3A7OA 2J9UA 3CX5D 4C3DA 1YI2P 4CDVA 1M1JA 2QVAA 3G50A 2OGUA 5AW1B 1KFMA 3GW6A 3NMJA 3L8JA 1RCPA 2ZD9A 1RY3A 2K9JA 3L37A 4XTKA 2EILC 2Z15A 4YT8A 3W8HA 2KLVA 1L0LJ 3DMDA 3OJAB 1A7EA 1NTMJ 2B87B 4PFPA 2WPRA 5KLVG 1VQ5P 2EIKC 2EIMC 4IGGA 4DBRA 3ZQVA 1L0NG 1D0ZA 1OKKA 2Q3EA 4U5FE 1NAYA 2QIWA 1Y4CA 4JKVA 3V2NA 4G7ZF 1FTSA 2QTVA 1KB9E 5DVWA 1CPQA 1ZU4A 1E86A 4R4MA 1NKNA 2P61A 1FDOA 1YHQP 2P0NA 2F22A 4EBJA 3CMAP 2E74D 2GUVA 5AVVB 3K33A 4E7SA 1A02J 3ECSA 4O6MA 3MP7B 5CIVA 4NPEA 3A0BH 4MQ9F 2PAJA 2YQYA 2IBZE 1LVKA 2AEMA 3V5BA 3H1KE 1N73B 4DVZA 2V3CC 3KYJA 4KHXA 4MVUA 4DXWA 2W6BA 3RKOF 5AVYB 1WRGA 3ZIBA 4D4XA 3Q3DA 2Z5IA 2WZGA 4YN0B 2PRRA 3H1HG 1SMYF 1GS9A 1MNDA 2E74B 5BQIA 2JR8A 2KNCB 1HY5A 3F47A 3GEEA 4BJTA 1SQPG 3L73D 3GEIA 3L70G 3EWKA 2YVKA 3VM6A 4NC3A 3LUTB 2BASA 1GMJA 2JO1A 5AGFA 3L75E 1GU5A 2O01J 1NTKG 5GTIH 2KZJA 2HPCA 3M1CB 1Q0DA 2H7VC 2GDCA 3RVYA 3MBGA 1RF1C 1CW5A 1S9KD 3EG9A 4PD4E 1VYIA 2KK7A 1M7LA 3CWBD 1GGQA 3AEBC 3KQGA 2O01N 1I4YA 2L81A 3HTKA 1X22A 2R7QA 3PHLA 4WBAA 4KBLA 2I8BA 4W8PA 4RJTA 4ULVA 2YEVA 2WVQA 4Y99B 2BCCG 3HNIA 3BVHA 2LKMA 3O39A 5BVZA 3CI9A 4IB4A 1QL1A 3DJNB 1MKMA 1AJYA 5COGA 5B66E 4YXWH 4BPMA 1BE3G 1JPNA 1V55C 1OCCC 1K9MQ 4HJGH 5L8RJ 5F5FA 1CSBA 3L71E 1SQXE 2Q1KA 2Q00A 1KV4A 2FYUJ 2IBZG 3CCQP 4L74A 5B1BC 3H1KG 3TK1A 1HGVA 3ATPA 4CJOA 2IZ1A 4IFMA 5AW8B 1WN0A 4EHPA 3UGPA 2E75D 1Q82Q 1TFOB 1VL2A 2ITAA 3HLZA 4JTDB 2KC3A 2NUTA 1SQQE 2QLAA 5KKZC 4GQHA 3A2AA 2DGJA 2G3AA 2RH0A 2Y3BA 5KYYA 3D71A 2HG5D 1S5LX 2YLGA 1YYXA 2YL7A 4JPZB 4JEAA 2DI3A 1NZEA 1EI7A 1V54C 2JX0A 1G5ZA 5L0GA 4MVOA 1NOHA 2E75B 4RKUJ 5KLVK 2OJQA 1GW3A 2IYOA 4KC9A 1QVFO 2B0HA 4O79A 1VOMA 2YXRB 1QPUA 3TF5A 3AE6C 2Q9AA 3MZWB 1L0NK 3LW5J 2HFED 5BU5A 4W7ZA 5HSWA 1M57C 1YJ9P 2XSEA 4JCHA 3M9HA 4GYTA 1LTSC 1RJ9B 3HNKA 2HMZA 2IFMA 4LDRA 1Q81Q 1N1CA 1OMIA 3CC2P 4D6TD 2NUPA 1M1JB 1YLMA 1PD0A 4KNWA 5AVQB 3RBXA 4ULWA 2ZAEB 1N7LA 3DAGA 1FU1A 3OW2O 4D4NA 3I55P 5JP7A 2HR3A 3QW1A 2CPBA 2E76D 1KILC 5EK0A 3SYNA 3M0DC 1G2CA 1NTZD 3LESA 1ST6A 2O9XA 5KLVJ 1KB9H 1Z6AA 1EQ7A 1YYCA 1D0XA 4U5CE 2K88A 1URQD 4DRIB 3SFEC 3TD7A 4H44D 2QUPA 5A6BD 3D6ZA 1L0NJ 2N1TA 1SQPK 4U9EA 1Z7Qc 4MVSA 2BC5A 1IK7A 3JSVC 3GMAA 1IFJA 1FZCC 1QLEC 2R03A 3MYFA 1L0LE 4C7NB 1SQQG 2E76B 1TQGA 1NTME 1RF0C 3GLMA 2WSEJ 1T2KD 4JBZA 5BQHA 2NRGA 1OXZA 3L35A 2FYNB 1FNTc 3ZC4A 4W8KA 1A41A 4CS9A 1YA9A 2GUSA 2R02A 1H6GA 1CPRA 4CDYA 2XS8A 4RDAA 5L0CA 2R5BA 3E1RA 1Y6DA 1URQB 3SSUA 3GEHA 1G1IA 4H44B 5AW2B 2ASRA 1Q7YQ 1BCCD 5TISE 1N7SC 1LGHB 2XS1A 1APCA 3FHDA 1HGZA 3AE4C 1X0TA 4OIQF 3WUVA 1VK5A 2KI7B 2C04A 2KLUA 5F5HA 3ZSUA 3H1HJ 4A4AA 3CMEP 5KJ7C 4WB4A 1R5ID 1FOSF 3EFOA 3T6GB 1USEA 1YTZI 4MTGA 3Q5SA 5L0IA 2NZ2A 3MYIA 1JPJA 1SQPJ 3TK0A 1G4US 3HE4B 1FAVA 2AXCA 3L70J 2HJMA 1TR2A 3NYJA 1LTBC 1I4ZA 5CCHA 3B0PA 4PD4H 3ABKC 1WT6A 4NQFA 1N86A 1EDKA 4C7OB 1NTKJ 4DBQA 4YL3A 1LS1A 5CCGA 3LS0A 4JW1A 3I5CA 1ZZPA 2OYIC 1KB9I 2J0XA 2I8DA 4JF7A 2PP4A 3HUSB 4N6CA 1WATA 1LWUC 2XZRA 2YO2A 1VQ8P 4HB1A 2M3BA 2H88C 2A69F 1K8AQ 1T3JA 2AVKA 3P8MC 3HTKB 2XLOA 1A0BA 1E5WA 2TMVP 3KYQA 1ORSC 1Z56A 1OR3A 1LI7A 2IBZI 1S05A 2H7OA 5B66H 1DD3A 1OIPA 4F4BA 2LXCB 5AVWB 1KB9D 2LD6A 2BCCJ 4BJ5A 2QM7A 3F89A 1JCCA 3VYIA 3AQBA 1IFMA 5E2QA 4R4LA 3ASNC 1QSPA 2B87A 5A6JA 2HODB 1KORA 1T3UA 4HH2A 1U7JA 3E1IA 4JTCB 1BE3J 1FZAA 2IBZD 4U3FE 4BXLA 1NJIQ 1VPCA 3H1KD 5KAIE 1JB0J 1A02F 1KQSO 1MMNA 1OQCA 2YO3A 2EPLX 2UUHA 1U0BB 3U1CA 1PIXA 2W6AA 4WWIA 1BSNA 2PX0A 4ER9A 2AWYA 2FFHA 4E7ZA 2ZXRA 3EH1A 1T6IA 3W4YA 1AEPA 1M2OA 3FX0A 1FFHA 1LTTC 3NMKA 1DD4A 3L74J 3EFGA 3JRTA 4LDKA 2IXPA 1LS4A 4DOJA 2Q4FA 3FOPA 5KYYB 2G62A 4PD4I 2FYUE 4E18A 1KNYA 1NSGB 2QJPB 3AEAC 3D70A 4LLEA 2JP3A 2CW0F 2L6GA 5JT4A 2KS1B 1SQVG 1ZU5A 4MVQA 3CCRP 5D91A 4G7HF 2Q9BA 3L75D 3V4QA 2K3RA 1FZFA 1FMWA 3HD7C 1VQ6P 3VMZA 1VQNP 4L73A 3CD6P 1SQXK 1KYOI 1P84E 2KNCA 1RQVA 1EDJA 4PD4D 3G9RA 3RK2C 4CX9A 2P7JA 4PJLA 2WITA 3FMSA 3AE3C 4OD4A 1S5LE 2A06E 4LGDE 1ZW3A 5KAFE 3L8IA 2IFNA 1SFCD 4EIJA 1SQQK 4YJWA 2XRHA 3VAYA 5C39A 1VF5D 3UMIA 2YKQA 1TFKB 3U0CA 3V2RA 4I1OB 1RE4C 3C62A 3RL0C 3JTLO 1JMBA 3IF4A 3C7JA 3VOPA 1QVXA 4PV1C 1A7DA 1EDLA 2ZXEB 1JOGA 1YVIA 2K1AA 3V5ZA 4ZKUA 3GHGC 2Y0EA 1RE3C 2IYLD 1T5OA 1DEEG 1KILE 5APYA 4YPCA 3QZCA 1SFCB 1G2CB 3VMAA 1SP4A 3L71D 1S1CX 1SQXD 3M9BA 4OGQD 1J1EB 4U3FG 2R7XA 3HRNA 4IAQA 3P32A 4RBNA 5BUOA 1FFTC 5T1DB 2AXTE 1JY2O 1SQBG 2ZT9D 1JMWA 2H43A 4CIHA 1PP9G 1JY2P 1SVFA 2FAPB 1Y9BA 4BJ6A 2N1TB 5DS4A 1SQQD 1QGKB 1JAFA 5KYNA 1MV8A 2YIUB 1BDDA 1L3PA 4AUWA 256BA 4U9DA 1RMVA 2I1KA 2Q9CA 5TISH 5DJUB 1J1DB 4OGQB 3CCVP 1IJDB 3PLNA 2FYUG 4E17A 4W7YA 4WVZA 2L9JA 3DAFA 2GA0A 2Y3GA 1L0NE 1LTGC 3B5ND 4H13C 2Y0DA 2ZT9B 4N6JA 2GAQA 3EJNA 3KL4A 4JEBA 4XEFA 1RXQA 4NTAA 3M9QA 3Q7GA 2D2CD 4TT3H 3KHUA 2V26A 1FMVA 1NU1G 1EQ1A 3T6JA 3JSZA 3B0UX 3TGUG 3NMDA 1YJWP 1R4TA 2GM4A 1OXBA 3BRVB 3GWNA 3C8GD 1Q2NA 2NPSD 2J9WA 3EFOB 1Z3IX 1ZHTA 2OU6A 1B68A 2A06G 5CBNA 3B5NB 3B0VC 3PCVA 3AGTA 3NMIA 4LACB 1ZR2A 1NTMK 1S7ZA 4ZKPA 1UG7A 2D2CB 1CGNA 3SXYA 4GEHA 1GL2C 5AW3B 1MMDA 3EQLF 5HV9A 1HTLC 1WGWA 2LXBA 3H1HE 3TSIA 3CEXA 1QX8A 3LS1A 3S29A 2WTYA 3LLIA 4G0HA 3C8GB 2VRSA 4CSAC 4EDFA 1JNMA 2O01H 1L4AC 2NPSB 5CHXA 3H2VA 1SQPE 5APUA 4EUKB 3L70E 2DB4A 4WABA 3ABMC 1RJ9A 1E79H 3RK3C 2W45A 1DX7A 2XXAB 3MUDC 2FFDA 3H65A 4BEMJ 4WGZA 1O87A 2YRFA 3CSKA 4JE9A 4L75A 1J2JB 2KK1A 1EXIA 3ABLC 4IWBA 1LT9A 1NTKE 3V5XA 1AVYA 1ZW0A 2XL8A 2OYHC 2RD9A 2FYZA 1L0LD 1SQVK 4JRZA 3KH2A 1NTMD 3M0AA 4LC1A 3Q1MA 1EA8A 2WSFH 5CI8A 3KMIA 3GANA 5KAIH 1DIPA 3USSA 1RHZB 4N3YB 1O5HA 5AVSB 3K66A 1F1MA 2NSGA 3E7KA 4AE4B 3VP8A 3CZ6A 3JZ0A 5CJ4A 1VQLP 4GODA 1LKXA 1Q90D 4FWVA 2BCCE 3DWWA 3EZHA 3CLQA 2JWAA 5GPGB 4C7NA 3WUTA 3BEHA 1WMKA 4GKGA 2O1KA 1BR1A 1LTJB 2XLMA 4XLPF 2R7TA 2MYSA 1XZPA 1BE3E 2C9LY 2J5UA 3AG4C 5A6AA 4YL1A 2IDBA 3AE8C 2LSEA 1URQA 3UR3C 2R7VA 5A6BA 1P84H 1GZLA 3B9QA 1SQVJ 2M5AA 2H8PD 3CCLP 1EC5A 4A7PA 1ZHXA 1FZBA 1BGYG 5EHHA 1VQ7P 2KSFA 3L74E 1BDJB 4N06A 4GT1A 1S5LH 4B6IA 1NLXA 5KAFH 3LNRA 1YZAA 5JRAA 3L4FA 4IARA 4J7YA 3FXEA 2WSCJ 3SXKA 5CI9A 2IYPA 1SQBK 3L72J 2OKUA 2W83C 1OVVA 2UWJE 1N73C 3HE4A 2XU6A 3AE9C 1ZHZA 2CNWD 3U59A 3LW5H 3ITKA 2HLOA 4AL1A 1JMMA 1DOWA 4WGYA 3QW0A 1JY2N 4NPFX 1YITP 1JR8A 4ZLDA 4C7OA 1CZQA 3IN6A 3TJ5A 2FYUK 4MVRA 5BQGA 2Q3IA 2YL3A 1RF1B 3WHNA 1N2DC 1CI6B 3F46A 3ASOC 2AP3A 1JOCA 3HUSA 4GIFA 3NYMA 3K6BA 2AXTH 2Z4EA 4L6RA 1HF9A 1GK4A 2V7QJ 5JLIA 2HZ8A 3LEVA 4I2LC 3NRHA 3VMXA 2LR2A 3TDKA 1SZIA 1RQUA 2KYHA 2ZXXA 3OAKA 1EZVG 2LIGA 4HFKB 3GG2A 5T3TA 4U3FJ 2OTKE 2M0BA 1AUEA 2R05A 1KYOE 5DQTA 1SQBJ 1PP9J 4IFDK 2WQYC 1BZ4A 2ZJSE 4NPDA 2HODA 3QVZA 2FXMA 2RMZA 3G3ZA 3ITFA 1P84I 2AU5A 2FYUD 1MUUA 3DM9B 3CCMP 3G6EP 1YYJA 4BRYB 2LK4A 2WSEH 3EGXB 2L6FA 5L0DA 1N8RQ 1FBMA 1IW7F 2YLIA 4PFOA 1NAFA 4WY4C 3SWFA 5AVXB 4EKWA 5KKZB 1S3JA 1XWJA 3L74G 2Y9ZA 1P84D 1XZQA 5JS5A 1NU1J 2MHRA 2P1AA 3SWKA 1SYQA 1ZP0C 3TGUJ 4G78A 2WZLA 1HE9A 3PJSK 3ZQYA 1IFPA 3QVYA 3AEEC 4JURI 1WTYA 3ZVRA 5KLIC 3I5PA 2KS1A 3DXJF 3BATA 4RESB 3LNMB 3KKBA 1YQ3C 3V2QA 1Q86Q 4JTAB 2J46A 2M64A 2J8WA 2P2UA 3L36A 3IR9A 3AEDC 5A6KA 4W80A 1IFNA 1OW8A 1S2EA 1KILD 3L34A 1M1KQ 3MFNA 4N78E 4LLHA 3G4SP 3BRJA 3TNUB 2FBWC 2LFFA 2J9VA 1OCZC 1NWQA 3RK3E 1ZV8A 2HSQA 2FFDB 1FOSE 4KI2A 3DJUB 3N7NA 1LT9B 2O3JA 2IX7C 3BCCG 4K35A 3L0IA 3O55A 4X0RA 3RVZA 3JCUE 1QLED 5AVTB 3B29A 2N9BA 3CCJP 3SXZA 2Q3TA 2QE7H 3A11A 4P9TA 4EBKA 3ABVC 1YAUO 1L7CA 1SFCA 5KLVD 3C63A 3CC7P 5APVA 3CPWO 3H1IJ 3AOUA 1Z5ZA 1K05A 1IO4A 5COMA 1L0ND 3M91A 1M1JC 1ORYA 3AE1C 4WJ0A 1WOLA 2WVOA 2Q9IA 2PFXA 5DS6A 1KU2A 4PACA 2R44A 1BSHA 2BEZF 4HYTB 3AEFC 1N7SD 2XLDA 3K1HA 3TOMA 3H1JG 3GORA 1AV1A 1FZCB 2XLEA 3M79A 1VQMP 1NU7D 3K7DA 3JC22 2CDQA 2OARA 1QZXA 3U8VA 2R9RB 3H1LJ 2KZIA 2LQGA 4DCKA 1NTKK 5KJ7D 3EHNA 3LLKA 1GW4A 4K0DA 3U8PA 2E43A 3HE5B 3JYHA 4DOZA 2Q5UA 3FOOA 1G8XA 2QY9A 3RYLA 5E79E 4HEAJ 1VYKA 3NYLA 4I44A 1KFNA 1UIXA 2IXOA 2QG4A 1N7SB 2M5AB 3CXHI 2E76C 2MKVA 1FJKA 3H1HD 1MNEA 1BGYJ 1QVGO 4CBEA 1M6TA 3VP9A 4NCQA 1DEBA 2OTJP 3S4RA 1PGJA 3WUUA 2FGYA 1W2EA 2HJ3A 1K04A 4BG0A 1SQPD 2P7VA 3U2MA 3L70D 3UMHA 5AW9B 3B5NA 1RKEB 2QSIA 1SQVE 1T8ZA 2J9BA 2W4BA 4J30B 3FWNA 1EKYA 4DJGA 4CS8A 1ZMEC 1GD2E 1NTKD 1EZVI 3QH9A 2QEXP 3A3YB 1M2VB 3O10A 4TLFA 4YT2A 2YWAA 2WWWA 3C8GA 1KQGB 4M3LA 3L72E 2VASA 3R4YA 2NPSA 2Y9YA 2OYIB 1YJGA 2W4MA 1I5NA 3AECC 1MFTA 2Q7RA 1LWUB 2KP8A 1KYOH 1BR2A 2R7WA 2XXAA 3G4ZA 2NPUA 2HV6A 4E0IA 3GWLA 2NG1A 5H2FE 4OD5A 4ASWA 1TU3F 2KXPB 2BCCD 2YLDA 4IFFA 2ZPAA 4NTBA 1NU9C 2KW3C 1YZCA 2I15A 4IL6X 3JRMO 1R5LA 4AX2A 1JY3O 1PPJE 2YMKA 3JSEO 1JY3P 3E9VA 2QJYC 1GU4A 1BE3D 1C03A 1VB5A 3HTKC 3AG3C 1NHLA 2CYDA 4AE4A 4BEJA 1VMAA 2RN0A 1E85A 1OW7A 2WT7B 1VLTA 2A6HF 5L0FA 1U57A 1YDIA 2W6JH 3N24A 4AQRD 2LFDA 1QKRA 1SQBE 2H89C 1H8AA 1PP9E 2Q6QA 1FJPA 1FDMA 3L74D 3ZG1A 4XWJA 3HD7D 3OA1A 1LP1A 3U3BA 3FXDA 1LTJA 3M15A 4P6IC 2OG2A 4ANJA 3D6YA 3FAPB 2W90A 5M1BA 1PCXA 2MWQA 3K5BA 4FAPB
chains in the Genus database with same CATH topology
5F28E 2WSCJ 2D2CB 2HSBA 3AE3C 3RQEA 1YQ3C 3L8IA 4H0LD 4H0LC 4XFJA 3C18A 1K04A 3L8JA 1OMIA 1ZZPA 3AEBC 1VF5D 3FGAD 1VF5C 3AE9C 1UFBA 3C8GB 1PL5A 3U0CA 2QSIA 3AEDC 3SFDC 4YXDC 2H88C 3U3FA 1OW8A 1QVXA 1PV3A 4PV1C 1JOGA 2E76D 3IN6A 1ZMEC 3RQGA 3TULA 3MFNA 2FYNC 3BRJA 1KMIZ 3O10A 4R32A 2FBWC 2KK1A 1R8EA 1DD3A 2WPVB 1KILE 2YIUC 3B71A 4Y28J 3GF7A 1EXIA 4H0LB 2YWAA 3C8GA 1KQGB 3RK3E 1EXJA 4U7JA 1MKMA 3AE7C 3R4YA 1AJYA 1S1CX 2QIWA 4OGQD 1HF9A 3AECC 4OGQC 3GM2A 2V7QJ 3SFEC 1ZRTE 4H44D 4R4LA 3GF3A 3D6ZA 3Q1MA 2OQQA 4H44C 1FDIA 1IK7A 1RQUA 5L8RJ 1KORA 3Q5PA 4R4MA 1DIPA 2ZT9D 2Q00A 3JYYA 3GMAA 2ZT9C 4PV1D 1FDOA 1KTMA 4EBJA 1Y9BA 2E76B 4EBKA 2E74D 3ABVC 2WSEJ 3GLMA 1V4AA 2E74C 1TU3F 3H25A 1O3UA 4GDOA 2QJPC 1JB0J 2BEQD 3JZ0A 3O6QA 2E75D 3Q2YA 2WQYC 4IL6X 1VL2A 2E75C 4Z1MH 1PIXA 3GM3A 4KT0J 1K05A 5KKZC 3S9OA 1Q90D 2QJKC 1KQFB 3AE1C 1WOLA 3IAOA 3C8VA 4OGQB 2YMKA 2P10A 1VF5B 2G3AA 3GM1A 3D71A 1DD4A 4I7ZC 1K40A 4H44B 2QJYC 3T97B 1S5LX 2BEZF 4H13D 3AEFC 2LK4A 3AEGC 4H13C 2ZT9B 2L6FA 3Q3DA 1WMKA 3RL0g 4PV1B 4XEFA 3K7DA 3AE4C 3RQFA 3Q5RA 1OW7A 2E74B 1KNYA 2D2CD 4TT3H 3D70A 3AEAC 2D2CC 2JP3A 2L6GA 1U57A 2J5UA 2JX0A 2L6HA 2PBEA 4NQFA 2IDBA 2E75B 3AE8C 4XEVA 1YQ4C 2H89C 4RKUJ 3EWKA 2JPUA 3Q5SA 4XEKA 3C8GD 3AE5C 3AJMA 1WWPA 1ZP0C 2NZ2A 1OW6A 2FXPA 3AE6C 1GMJA 2JO1A 4I7ZB 1UIXA 4YTPC 1NYHA 3AE2C 3LW5J 1NGMB 4H13B 1RQVA 2WSFJ 3AEEC 3D6YA 2O01J 1WTYA 3G9RA 1HJ0A 5KLIC 2E76C 5M1BA 2MKVA 1ZOYC 2G8YA 2K9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F28 E;  2HSB A;  3AE3 C;  3RQE A;  1YQ3 C;  3L8I A;  3C18 A;  1K04 A;  3L8J A;  1ZZP A;  3AEB C;  3AE9 C;  1UFB A;  3C8G B;  3U0C A;  3AED C;  4YXD C;  2H88 C;  3U3F A;  1OW8 A;  1QVX A;  1PV3 A;  1JOG A;  3RQG A;  3TUL A;  3MFN A;  3BRJ A;  3O10 A;  4R32 A;  2FBW C;  2KK1 A;  3B71 A;  2YWA A;  3C8G A;  3AE7 C;  3AEC C;  3GM2 A;  3SFE C;  2Q00 A;  3JYY A;  1KTM A;  4EBJ A;  4EBK A;  3ABV C;  1V4A A;  1O3U A;  3JZ0 A;  2WQY C;  3GM3 A;  1K05 A;  3S9O A;  3AE1 C;  1WOL A;  2G3A A;  3GM1 A;  1K40 A;  3AEF C;  2LK4 A;  3AEG C;  2L6F A;  4XEF A;  3K7D A;  3AE4 C;  3RQF A;  1OW7 A;  1KNY A;  3AEA C;  2L6G A;  2JX0 A;  2L6H A;  2PBE A;  3AE8 C;  4XEV A;  1YQ4 C;  2H89 C;  2JPU A;  4XEK A;  3C8G D;  3AE5 C;  3AJM A;  1WWP A;  1ZP0 C;  1OW6 A;  3AE6 C;  4YTP C;  3AE2 C;  3AEE C;  1WTY A;  1ZOY C;  3SFD C;  4NQF A; 
#chains in the Genus database with same CATH topology
 4XQ1 A;  2A68 F;  3DE9 A;  1FZE A;  2H7B A;  4P9F A;  4XFJ A;  1W2W A;  3C18 A;  2R25 A;  1JEK A;  1JCD A;  4CPG A;  2Z5H A;  2L7A A;  2YKP A;  1UFB A;  2XND H;  3R7C A;  3HD7 B;  1NU1 E;  3RGU A;  5FCL A;  4MND A;  3TGU E;  3AGU A;  1QL2 A;  5KYX B;  1HE1 A;  1Q0G A;  1PV3 A;  2AWC A;  2XDJ A;  3L72 G;  3TUL A;  1JM0 A;  4I6M C;  1KMI Z;  5AVU B;  4UB6 E;  5CBO A;  2WPV B;  5TJ5 E;  3L1M A;  1LM3 B;  1G1J A;  5IY5 C;  2Y39 A;  3JCU H;  3PDM P;  1HJB A;  1KYO D;  1H89 A;  1FDI A;  5KYW B;  2XL4 A;  1RF1 A;  1CI6 A;  3CCE P;  3DZA A;  3BCC J;  3LID A;  3EZI A;  4IJJ A;  3PTZ A;  2KGO A;  1MMG A;  5APS A;  1PPJ G;  4PJ0 E;  2BL2 A;  1OVU A;  2H7H A;  3L73 G;  2CNW A;  3GM3 A;  1AA0 A;  4KJM A;  2JEE A;  3TYY A;  2PNO A;  2CK3 H;  4YK5 A;  2ZVN B;  3W68 A;  1VF5 B;  4JCZ A;  4ASV A;  3HJC A;  4EYY Q;  3CC4 P;  3IFM A;  4H13 D;  3POV A;  2H8A A;  3H32 B;  5B3S C;  1HVV A;  4JYC A;  1FR0 A;  4H54 A;  5FZT A;  3H1J J;  2POH A;  2W9Y A;  2XKM A;  5E79 H;  1X79 B;  1YQ4 C;  1KN7 A;  3US6 A;  1YJN P;  4OIN F;  3H1I E;  1HW1 A;  1J1E C;  5AVR B;  3M06 A;  4BRY A;  1VQO P;  2PF4 E;  2VB6 A;  3BRT B;  3AJM A;  3EGX A;  3CCU P;  3LJB A;  3IQC A;  4EIY A;  4LLC A;  3IEE A;  4H13 B;  3W67 A;  2BE5 F;  4OIO F;  1V74 B;  2N1T C;  1D1C A;  1M56 C;  3O8Z A;  1GL2 D;  5DS5 A;  4N4W A;  3H1L E;  1G4W R;  4H0L C;  2KYV A;  1VQ4 P;  4G7O F;  1Y8A A;  2A6E F;  2D5R B;  3RW0 A;  1HW2 A;  4CS9 C;  1NVO A;  2DYS C;  2QJK B;  4IOI H;  1HMO A;  1L4A D;  3SZR A;  5CMZ A;  2R5D A;  4N78 D;  5B5E E;  3S28 A;  4MTO A;  3U3F A;  2M3E A;  2WSC H;  4O9B A;  1PD1 A;  3MGN A;  3RK3 D;  3A5T A;  3JCU Q;  2YMY A;  2V4H A;  4JIO A;  2L91 A;  4QMA A;  2JKV A;  1BGY E;  1R8E A;  3B71 A;  1GL2 B;  3SP1 A;  5B3I A;  4U7J A;  3OWT A;  1VTM P;  1JY3 N;  3MTU E;  1VQK P;  4C46 A;  2EPM X;  2VCA A;  2XLW A;  5H2F H;  1L4A B;  4K3A A;  4UDV A;  1KTM A;  5EFW B;  3TNU A;  4YT4 A;  1OWA A;  1X8Y A;  4XPY A;  2SPZ A;  3RK3 B;  3ZTZ A;  1SR2 A;  2XV5 A;  3CXH E;  5CCH C;  3WOD F;  1ZN5 A;  2BEQ D;  5KTB A;  1OVR A;  4MVZ A;  1BBH A;  2V7Q H;  2Q7C A;  2C03 A;  3UNG C;  3C8V A;  5APW A;  2OYH B;  5CCG C;  2P10 A;  1Z23 A;  5GTH E;  2R3S A;  2EPN A;  3B8E B;  1KQL A;  3HNJ A;  4I7Z C;  1KIL A;  1EDI A;  3M0D A;  1CGM E;  2A45 G;  2RKL A;  2XM0 A;  2PX3 A;  3H1I G;  1ZHW A;  4BWN A;  2RSE B;  1MQV A;  2YKZ A;  3ZWI A;  2W27 A;  1EZV E;  2AEJ A;  4D6T G;  3MHV A;  3GOD A;  1FE6 A;  4LER A;  4PJN A;  4XE5 B;  3DD7 A;  1D1B A;  5AC4 A;  2GA1 A;  1FZC A;  1OW6 A;  4Q4Z F;  1OX3 A;  1LE2 A;  4BJ5 C;  4IL6 E;  1OR2 A;  2ZXO A;  3SWY A;  5L0J A;  1RF0 A;  2KUB A;  3H1L G;  3I5Q A;  2E5T A;  1NTZ G;  1LP1 B;  2J7P D;  1ZHY A;  2HSB A;  3HE5 A;  4Q5S F;  3H2U A;  1SQV D;  1TWG A;  2YL1 A;  2KB7 P;  1S4X A;  5B1A C;  3RFY A;  3CAX A;  1N7S A;  4I1M A;  2QRX A;  4FX5 A;  3NG1 A;  3CL3 D;  1W2B O;  1E83 A;  1YAR O;  4U5D E;  4DJ9 A;  5AC5 A;  5L0H A;  3CQZ A;  4UB6 H;  1M90 Q;  1LTJ C;  3RQG A;  2IOQ A;  2A1D D;  1C02 A;  4Z9J A;  2QE9 A;  3L72 D;  3X1O A;  2LP4 A;  4XPX A;  5KJ7 A;  3EH2 A;  2B9B A;  3GF7 A;  3QWO C;  1RKE A;  3U9M A;  3BAS A;  3V5Y A;  3C9I A;  3GM2 A;  2IM8 A;  3Q7L A;  1ZRT E;  4U5G A;  2VC9 A;  1BCC G;  2OQQ A;  2A0B A;  1H0T B;  2KJG A;  4PJ0 H;  3P8C E;  3JYY A;  1M2V A;  1MZ9 A;  2KOG A;  1OFC X;  2WB7 A;  4JJG A;  3IQT A;  2E74 C;  4N6H A;  3C1L A;  3TOL A;  1PPJ D;  2ICW G;  1ZYR F;  2OYI A;  2J0W A;  1ZXG A;  3EHM A;  2R3C A;  1LWU A;  3NXS A;  5KYU A;  4EOT A;  3MD0 A;  3S9O A;  5CJ0 A;  3S90 A;  2X51 A;  5DJT B;  3L73 J;  3G71 P;  3GM1 A;  1NU1 K;  4RO0 A;  2FXO A;  4U3F D;  2OYO A;  3PRJ A;  3AEG C;  3H6P A;  2WZ7 A;  1SQB D;  1NG1 A;  3NTN A;  2A45 H;  1PP9 D;  2OCC C;  5EGY A;  3BCC E;  2J58 A;  3WMM 0;  2PBE A;  2GFH A;  4WY4 D;  2OTL P;  2VCB A;  1Q0F A;  5AVZ B;  4CIP A;  4OVN F;  2M8R A;  2OQM A;  4UB8 E;  3U1A A;  2O1J A;  3CWB J;  2YNY A;  1NFO A;  2HKV A;  2UUI A;  3VN0 A;  3MLG A;  4AYC A;  1FZG A;  2WT7 A;  5L3V A;  2WSF J;  1HJ0 A;  3EGD B;  3V4W A;  1VLS A;  4Y99 C;  3I56 P;  4JC7 A;  2EIJ C;  4BJ6 C;  1TWC A;  3KYI A;  4WY4 B;  3H1J E;  1NU1 D;  3AG1 C;  5B5E H;  3TGU D;  1UII A;  3HKK A;  1YIJ P;  1GK6 A;  1Q0M A;  4LDQ A;  3SEO A;  5JSL A;  3QTH A;  1LTI C;  2PGD A;  4QI0 A;  3T4R A;  1AQ5 A;  5APQ A;  3FWL A;  3KZI E;  2ZYD A;  5AW4 B;  2ETS A;  2JDI H;  2A06 D;  5KLI B;  3T9O A;  2AEF A;  1M57 D;  4DRJ B;  3NKD A;  2HFI A;  4ZLC A;  1DOV A;  1LI5 A;  1SF8 A;  1XTG B;  2ZYG A;  3AG2 C;  2XNX A;  1T6Q A;  3HD7 A;  2WPS A;  1JUN A;  4C3E A;  4H4K C;  1NKZ B;  1KD1 Q;  1LPE A;  4GOF A;  5KYX A;  3GF3 A;  2WZF A;  3S84 A;  3N4X A;  2FKW B;  3CXH H;  5DLJ A;  2GWW A;  3E70 C;  4JVS A;  3LEO A;  2EPK X;  1JRA A;  1V4A A;  1AVO A;  2A45 I;  4PR9 A;  4ONS A;  4XPW A;  3O6Q A;  4DT0 A;  5GTH H;  3Q2Y A;  2E75 C;  1NTZ K;  3L75 G;  1H88 A;  4KT0 J;  2DYR C;  1RE4 A;  2YKO A;  1KQF B;  1T6U A;  2CCY A;  5KYW A;  1VDF A;  2G3V A;  1KC8 Q;  4CS7 A;  1HWT C;  3PH0 A;  4CJG A;  1K40 A;  1JTH B;  2YHS A;  3T97 B;  2G3K A;  3GHG A;  4J7T A;  1RE3 A;  3RL0 g;  5AW5 B;  1KIL B;  4MW3 A;  3K1I A;  1GDT A;  2XL6 A;  2WSS H;  3UIA A;  3S27 A;  3IHU A;  3VRC A;  3H1I D;  4HKZ H;  1HUC A;  2VCC A;  2FFD C;  3VYW A;  4IL6 H;  2WPQ A;  2JPU A;  3AE5 C;  1LT9 C;  2QM8 A;  1OKK D;  2ZFC A;  1YBK A;  2Y3H A;  1OZH A;  5APX A;  3H32 A;  4YTP C;  4D6T J;  1NYH A;  2C0X A;  2K9J B;  3F5H A;  2JD3 A;  3H1L D;  2G8Y A;  2K37 A;  1NO4 A;  3O6X A;  5E33 A;  3AQC A;  4IRU A;  3M4C A;  2I1J A;  1IC2 A;  1U89 A;  3WAQ A;  1NTZ J;  3L71 G;  1SQX G;  1QQ3 A;  3CX5 E;  3VF0 A;  3QMK A;  2WMM A;  3UGO A;  3NDB B;  3RH3 A;  3FGA D;  1VQP P;  2R7R A;  4I3M A;  4OWF A;  3DKA A;  4YXD C;  1BDC A;  1U6H A;  3Q6M A;  1OCO C;  1BGY D;  1U7M A;  1OXK A;  1GM5 A;  3ZDM A;  3WU2 E;  1S72 P;  2HMQ A;  2WVN A;  4K1O A;  2X0C A;  4MN4 C;  2R7S A;  2FYN C;  1FS0 E;  4R32 A;  4L76 A;  2KSE A;  2R32 A;  1EXJ A;  1K73 Q;  1T6A A;  1CGO A;  2YZS A;  3UMK A;  5JVE A;  3S1K A;  1URQ C;  4H44 C;  1XTC C;  3W2V A;  3VTP C;  3CXH D;  4PJJ A;  4HFF B;  3VMY A;  4MS2 A;  1LJ2 A;  2DW3 A;  1A7V A;  1LIH A;  1NH4 A;  1LNQ A;  1VQ9 P;  1ZVZ A;  4NTF A;  2D4U A;  4DZO A;  1BCC J;  1T2K C;  1GL2 A;  4MTF A;  3N2Z B;  2CGE A;  3B4S A;  1E84 A;  5AW6 B;  2OJE D;  1USD A;  4U5B E;  4Z1M H;  4CSA A;  3PP5 A;  3OA7 A;  2W8Z A;  3MX3 A;  4E0H A;  1L4A A;  1TWA A;  4U5E E;  4B86 A;  3SXM A;  3IAO A;  3FVY A;  2P1J A;  1ZR4 A;  3Q6N A;  5KYU B;  4I1L A;  4RD9 A;  4O6N A;  4OIR F;  3MUD A;  1RH5 B;  4JYB A;  1EZV D;  1SS1 A;  1LT1 A;  1IFI A;  4DVY P;  3Q5R A;  2WL8 A;  1PGP A;  2HPC B;  4UB8 H;  3R2P A;  2OYH A;  2JWD A;  4JJF A;  4O7G A;  2B0J A;  3EG9 B;  3A9C A;  4O6Y A;  2M4E A;  4XEK A;  3HUS C;  3A0H E;  4ZNC A;  2KNH A;  2QJY B;  3L73 E;  4A2N B;  2LCH A;  3J06 A;  3TJ6 A;  2Y69 C;  4K7B A;  5APT A;  1ZOY C;  2K9Y A;  1H7I A;  2KIK A;  4YT5 A;  1JO5 A;  2B89 A;  3RQE A;  4Q7C A;  4NY3 A;  4DRH B;  3T6B A;  1NBB A;  1KZU B;  2P6V A;  1L0L G;  3KZI H;  1S9K E;  2P67 A;  2XM4 A;  1Q0K A;  3IQ5 A;  1NTM G;  3IPM O;  3ZTM A;  1HH0 A;  1QEX A;  1PL5 A;  3RF3 A;  1TKN A;  2IXM A;  3CWB E;  4PK4 A;  2FY8 A;  2J59 M;  3FDQ A;  5BU8 B;  3PMR A;  3RK2 D;  1RKC A;  1J8M F;  4YWQ A;  3IQ6 A;  5JUA A;  2J45 A;  2PFD A;  4KNV A;  1PFI A;  3HNL A;  1ZRT D;  3H1K J;  4C3B A;  2B88 A;  5AW7 B;  3P8C D;  2ZXW C;  5E3C A;  4XA4 A;  2NUT B;  4C7R A;  4AL0 A;  2OOC A;  2IPP A;  3RL0 D;  3Q5P A;  4EBB A;  2J7P A;  3W2W A;  4PV1 D;  3KPH A;  3RK2 B;  1Z63 A;  4GDO A;  2QJP C;  1ZW2 A;  1GQA A;  1N73 A;  1X9V A;  5K0I A;  2A0U A;  4U5H A;  2ZYA A;  2MJZ A;  3V2P A;  1SLQ A;  1AVO B;  1H0T A;  2PP6 A;  3O6Q B;  4Z9H A;  5COF A;  2KQ9 A;  3A0B E;  1LTA C;  3L75 J;  1H9G A;  2C0W A;  3BCC D;  1HBW A;  3RL0 B;  1OCR C;  2ZXP A;  4PV1 B;  3S0X A;  3C8Z A;  3RQF A;  2VH3 A;  4FES A;  3GHG B;  5AW0 B;  1YA7 O;  2L6H A;  3EPV A;  2R7O A;  4JZA A;  5D92 A;  3CCS P;  1FAP B;  3KDP B;  1ORJ A;  4XEV A;  1C17 M;  3V7O A;  1BR4 A;  4QDL A;  1WWP A;  4QI2 A;  2FXP A;  2IZ0 A;  1MMA A;  2KSJ A;  3FXH A;  2NSF A;  2EIN C;  2NUP B;  2N9Y B;  1IK9 A;  2CPS A;  1M8O B;  1W5C E;  2N1T D;  3H1J D;  2C9N Y;  3SFD C;  2E42 A;  1ZLL A;  3CX5 H;  3N0T A;  3KPE A;  3I4U A;  4HE8 D;  1AQT A;  5F28 E;  1M56 D;  3RIP A;  4CDA A;  3V6I A;  5GTI E;  3K1I C;  3NFQ A;  3G4X A;  4H0L D;  4XLN F;  1WAS A;  1SFC C;  3CWB G;  1D1A A;  2HUJ A;  1PZQ A;  1VF5 C;  1D0Y A;  3RBZ A;  3EGD A;  3L71 J;  1SQX J;  3WU2 H;  1DH3 A;  3SNH A;  3MIW A;  4YL0 A;  4D6T E;  2JJL A;  2IBF A;  1AFO A;  3LAY A;  5TJH A;  2XLV A;  4ZMD A;  1PGO A;  4WY4 A;  3U2L A;  3DM5 A;  2E5Y A;  1T9K A;  2OEV A;  1SQQ J;  3U9J A;  4Y28 J;  2YIU C;  1J8Y F;  4H0L B;  4PJM A;  3AE7 C;  5L3Q A;  5KLV E;  1NTZ E;  4JQ0 D;  1J1D C;  4OGQ C;  2OEX A;  5T3W A;  5E3A A;  4M63 A;  3LIE A;  2QNL A;  3OEO A;  3ZDL A;  2WVR A;  3EFF K;  2ZT9 C;  3EQ2 A;  3PHF 2;  4OH8 B;  1D7M A;  3H25 A;  2YXQ B;  5CCH D;  1O3U A;  1FC2 C;  3M4B A;  4IAO A;  4EI2 A;  4J32 B;  2HYN A;  3KXD A;  3P7K A;  3DE8 A;  1IZN B;  1TWH A;  2E87 A;  1GTW A;  3NKE A;  4MVM A;  2QJK C;  2P58 A;  5CCG D;  1T01 A;  3JT1 A;  2L5G B;  2HS5 A;  5K5G B;  1L2P A;  2Y3D A;  2QA4 P;  1L0L K;  3TQO A;  4BJ1 A;  2R7U A;  3B5N C;  3WG7 C;  5DQZ A;  3U5S A;  2Y0C A;  2EPO A;  2XLH A;  3X2Q C;  1PGQ A;  1MFZ A;  1HMD A;  4EWC A;  1E2X A;  2D2C C;  2IXN A;  1BCC E;  4CS8 C;  1Y47 A;  3CX5 I;  4OIP F;  3A0H H;  1NFN A;  5A69 A;  2YL0 A;  4MW8 A;  3DI5 A;  1JTH A;  2HV7 A;  3FAJ A;  1H9T A;  3T97 A;  1IZM A;  2ZVO B;  3W8I A;  4I7Z B;  2NPS C;  4AK9 A;  3II6 A;  1IFD A;  3AE2 C;  4GOE A;  1NGM B;  1LE4 A;  1R5S A;  1YTZ T;  4Z9I A;  3A7O A;  2J9U A;  3CX5 D;  4C3D A;  1YI2 P;  4CDV A;  1M1J A;  2QVA A;  3G50 A;  2OGU A;  5AW1 B;  1KFM A;  3GW6 A;  3NMJ A;  3L8J A;  1RCP A;  2ZD9 A;  1RY3 A;  2K9J A;  3L37 A;  4XTK A;  2EIL C;  2Z15 A;  4YT8 A;  3W8H A;  2KLV A;  1L0L J;  3DMD A;  3OJA B;  1A7E A;  1NTM J;  2B87 B;  4PFP A;  2WPR A;  5KLV G;  1VQ5 P;  2EIK C;  2EIM C;  4IGG A;  4DBR A;  3ZQV A;  1L0N G;  1D0Z A;  1OKK A;  2Q3E A;  4U5F E;  1NAY A;  2QIW A;  1Y4C A;  4JKV A;  3V2N A;  4G7Z F;  1FTS A;  2QTV A;  1KB9 E;  5DVW A;  1CPQ A;  1ZU4 A;  1E86 A;  4R4M A;  1NKN A;  2P61 A;  1FDO A;  1YHQ P;  2P0N A;  2F22 A;  4EBJ A;  3CMA P;  2E74 D;  2GUV A;  5AVV B;  3K33 A;  4E7S A;  1A02 J;  3ECS A;  4O6M A;  3MP7 B;  5CIV A;  4NPE A;  3A0B H;  4MQ9 F;  2PAJ A;  2YQY A;  2IBZ E;  1LVK A;  2AEM A;  3V5B A;  3H1K E;  1N73 B;  4DVZ A;  2V3C C;  3KYJ A;  4KHX A;  4MVU A;  4DXW A;  2W6B A;  3RKO F;  5AVY B;  1WRG A;  3ZIB A;  4D4X A;  3Q3D A;  2Z5I A;  2WZG A;  4YN0 B;  2PRR A;  3H1H G;  1SMY F;  1GS9 A;  1MND A;  2E74 B;  5BQI A;  2JR8 A;  2KNC B;  1HY5 A;  3F47 A;  3GEE A;  4BJT A;  1SQP G;  3L73 D;  3GEI A;  3L70 G;  3EWK A;  2YVK A;  3VM6 A;  4NC3 A;  3LUT B;  2BAS A;  1GMJ A;  2JO1 A;  5AGF A;  3L75 E;  1GU5 A;  2O01 J;  1NTK G;  5GTI H;  2KZJ A;  2HPC A;  3M1C B;  1Q0D A;  2H7V C;  2GDC A;  3RVY A;  3MBG A;  1RF1 C;  1CW5 A;  1S9K D;  3EG9 A;  4PD4 E;  1VYI A;  2KK7 A;  1M7L A;  3CWB D;  1GGQ A;  3AEB C;  3KQG A;  2O01 N;  1I4Y A;  2L81 A;  3HTK A;  1X22 A;  2R7Q A;  3PHL A;  4WBA A;  4KBL A;  2I8B A;  4W8P A;  4RJT A;  4ULV A;  2YEV A;  2WVQ A;  4Y99 B;  2BCC G;  3HNI A;  3BVH A;  2LKM A;  3O39 A;  5BVZ A;  3CI9 A;  4IB4 A;  1QL1 A;  3DJN B;  1MKM A;  1AJY A;  5COG A;  5B66 E;  4YXW H;  4BPM A;  1BE3 G;  1JPN A;  1V55 C;  1OCC C;  1K9M Q;  4HJG H;  5L8R J;  5F5F A;  1CSB A;  3L71 E;  1SQX E;  2Q1K A;  2Q00 A;  1KV4 A;  2FYU J;  2IBZ G;  3CCQ P;  4L74 A;  5B1B C;  3H1K G;  3TK1 A;  1HGV A;  3ATP A;  4CJO A;  2IZ1 A;  4IFM A;  5AW8 B;  1WN0 A;  4EHP A;  3UGP A;  2E75 D;  1Q82 Q;  1TFO B;  1VL2 A;  2ITA A;  3HLZ A;  4JTD B;  2KC3 A;  2NUT A;  1SQQ E;  2QLA A;  5KKZ C;  4GQH A;  3A2A A;  2DGJ A;  2G3A A;  2RH0 A;  2Y3B A;  5KYY A;  3D71 A;  2HG5 D;  1S5L X;  2YLG A;  1YYX A;  2YL7 A;  4JPZ B;  4JEA A;  2DI3 A;  1NZE A;  1EI7 A;  1V54 C;  2JX0 A;  1G5Z A;  5L0G A;  4MVO A;  1NOH A;  2E75 B;  4RKU J;  5KLV K;  2OJQ A;  1GW3 A;  2IYO A;  4KC9 A;  1QVF O;  2B0H A;  4O79 A;  1VOM A;  2YXR B;  1QPU A;  3TF5 A;  3AE6 C;  2Q9A A;  3MZW B;  1L0N K;  3LW5 J;  2HFE D;  5BU5 A;  4W7Z A;  5HSW A;  1M57 C;  1YJ9 P;  2XSE A;  4JCH A;  3M9H A;  4GYT A;  1LTS C;  1RJ9 B;  3HNK A;  2HMZ A;  2IFM A;  4LDR A;  1Q81 Q;  1N1C A;  1OMI A;  3CC2 P;  4D6T D;  2NUP A;  1M1J B;  1YLM A;  1PD0 A;  4KNW A;  5AVQ B;  3RBX A;  4ULW A;  2ZAE B;  1N7L A;  3DAG A;  1FU1 A;  3OW2 O;  4D4N A;  3I55 P;  5JP7 A;  2HR3 A;  3QW1 A;  2CPB A;  2E76 D;  1KIL C;  5EK0 A;  3SYN A;  3M0D C;  1G2C A;  1NTZ D;  3LES A;  1ST6 A;  2O9X A;  5KLV J;  1KB9 H;  1Z6A A;  1EQ7 A;  1YYC A;  1D0X A;  4U5C E;  2K88 A;  1URQ D;  4DRI B;  3SFE C;  3TD7 A;  4H44 D;  2QUP A;  5A6B D;  3D6Z A;  1L0N J;  2N1T A;  1SQP K;  4U9E A;  1Z7Q c;  4MVS A;  2BC5 A;  1IK7 A;  3JSV C;  3GMA A;  1IFJ A;  1FZC C;  1QLE C;  2R03 A;  3MYF A;  1L0L E;  4C7N B;  1SQQ G;  2E76 B;  1TQG A;  1NTM E;  1RF0 C;  3GLM A;  2WSE J;  1T2K D;  4JBZ A;  5BQH A;  2NRG A;  1OXZ A;  3L35 A;  2FYN B;  1FNT c;  3ZC4 A;  4W8K A;  1A41 A;  4CS9 A;  1YA9 A;  2GUS A;  2R02 A;  1H6G A;  1CPR A;  4CDY A;  2XS8 A;  4RDA A;  5L0C A;  2R5B A;  3E1R A;  1Y6D A;  1URQ B;  3SSU A;  3GEH A;  1G1I A;  4H44 B;  5AW2 B;  2ASR A;  1Q7Y Q;  1BCC D;  5TIS E;  1N7S C;  1LGH B;  2XS1 A;  1APC A;  3FHD A;  1HGZ A;  3AE4 C;  1X0T A;  4OIQ F;  3WUV A;  1VK5 A;  2KI7 B;  2C04 A;  2KLU A;  5F5H A;  3ZSU A;  3H1H J;  4A4A A;  3CME P;  5KJ7 C;  4WB4 A;  1R5I D;  1FOS F;  3EFO A;  3T6G B;  1USE A;  1YTZ I;  4MTG A;  3Q5S A;  5L0I A;  2NZ2 A;  3MYI A;  1JPJ A;  1SQP J;  3TK0 A;  1G4U S;  3HE4 B;  1FAV A;  2AXC A;  3L70 J;  2HJM A;  1TR2 A;  3NYJ A;  1LTB C;  1I4Z A;  5CCH A;  3B0P A;  4PD4 H;  3ABK C;  1WT6 A;  4NQF A;  1N86 A;  1EDK A;  4C7O B;  1NTK J;  4DBQ A;  4YL3 A;  1LS1 A;  5CCG A;  3LS0 A;  4JW1 A;  3I5C A;  1ZZP A;  2OYI C;  1KB9 I;  2J0X A;  2I8D A;  4JF7 A;  2PP4 A;  3HUS B;  4N6C A;  1WAT A;  1LWU C;  2XZR A;  2YO2 A;  1VQ8 P;  4HB1 A;  2M3B A;  2H88 C;  2A69 F;  1K8A Q;  1T3J A;  2AVK A;  3P8M C;  3HTK B;  2XLO A;  1A0B A;  1E5W A;  2TMV P;  3KYQ A;  1ORS C;  1Z56 A;  1OR3 A;  1LI7 A;  2IBZ I;  1S05 A;  2H7O A;  5B66 H;  1DD3 A;  1OIP A;  4F4B A;  2LXC B;  5AVW B;  1KB9 D;  2LD6 A;  2BCC J;  4BJ5 A;  2QM7 A;  3F89 A;  1JCC A;  3VYI A;  3AQB A;  1IFM A;  5E2Q A;  4R4L A;  3ASN C;  1QSP A;  2B87 A;  5A6J A;  2HOD B;  1KOR A;  1T3U A;  4HH2 A;  1U7J A;  3E1I A;  4JTC B;  1BE3 J;  1FZA A;  2IBZ D;  4U3F E;  4BXL A;  1NJI Q;  1VPC A;  3H1K D;  5KAI E;  1JB0 J;  1A02 F;  1KQS O;  1MMN A;  1OQC A;  2YO3 A;  2EPL X;  2UUH A;  1U0B B;  3U1C A;  1PIX A;  2W6A A;  4WWI A;  1BSN A;  2PX0 A;  4ER9 A;  2AWY A;  2FFH A;  4E7Z A;  2ZXR A;  3EH1 A;  1T6I A;  3W4Y A;  1AEP A;  1M2O A;  3FX0 A;  1FFH A;  1LTT C;  3NMK A;  1DD4 A;  3L74 J;  3EFG A;  3JRT A;  4LDK A;  2IXP A;  1LS4 A;  4DOJ A;  2Q4F A;  3FOP A;  5KYY B;  2G62 A;  4PD4 I;  2FYU E;  4E18 A;  1KNY A;  1NSG B;  2QJP B;  3AEA C;  3D70 A;  4LLE A;  2JP3 A;  2CW0 F;  2L6G A;  5JT4 A;  2KS1 B;  1SQV G;  1ZU5 A;  4MVQ A;  3CCR P;  5D91 A;  4G7H F;  2Q9B A;  3L75 D;  3V4Q A;  2K3R A;  1FZF A;  1FMW A;  3HD7 C;  1VQ6 P;  3VMZ A;  1VQN P;  4L73 A;  3CD6 P;  1SQX K;  1KYO I;  1P84 E;  2KNC A;  1RQV A;  1EDJ A;  4PD4 D;  3G9R A;  3RK2 C;  4CX9 A;  2P7J A;  4PJL A;  2WIT A;  3FMS A;  3AE3 C;  4OD4 A;  1S5L E;  2A06 E;  4LGD E;  1ZW3 A;  5KAF E;  3L8I A;  2IFN A;  1SFC D;  4EIJ A;  1SQQ K;  4YJW A;  2XRH A;  3VAY A;  5C39 A;  1VF5 D;  3UMI A;  2YKQ A;  1TFK B;  3U0C A;  3V2R A;  4I1O B;  1RE4 C;  3C62 A;  3RL0 C;  3JTL O;  1JMB A;  3IF4 A;  3C7J A;  3VOP A;  1QVX A;  4PV1 C;  1A7D A;  1EDL A;  2ZXE B;  1JOG A;  1YVI A;  2K1A A;  3V5Z A;  4ZKU A;  3GHG C;  2Y0E A;  1RE3 C;  2IYL D;  1T5O A;  1DEE G;  1KIL E;  5APY A;  4YPC A;  3QZC A;  1SFC B;  1G2C B;  3VMA A;  1SP4 A;  3L71 D;  1S1C X;  1SQX D;  3M9B A;  4OGQ D;  1J1E B;  4U3F G;  2R7X A;  3HRN A;  4IAQ A;  3P32 A;  4RBN A;  5BUO A;  1FFT C;  5T1D B;  2AXT E;  1JY2 O;  1SQB G;  2ZT9 D;  1JMW A;  2H43 A;  4CIH A;  1PP9 G;  1JY2 P;  1SVF A;  2FAP B;  1Y9B A;  4BJ6 A;  2N1T B;  5DS4 A;  1SQQ D;  1QGK B;  1JAF A;  5KYN A;  1MV8 A;  2YIU B;  1BDD A;  1L3P A;  4AUW A;  256B A;  4U9D A;  1RMV A;  2I1K A;  2Q9C A;  5TIS H;  5DJU B;  1J1D B;  4OGQ B;  3CCV P;  1IJD B;  3PLN A;  2FYU G;  4E17 A;  4W7Y A;  4WVZ A;  2L9J A;  3DAF A;  2GA0 A;  2Y3G A;  1L0N E;  1LTG C;  3B5N D;  4H13 C;  2Y0D A;  2ZT9 B;  4N6J A;  2GAQ A;  3EJN A;  3KL4 A;  4JEB A;  4XEF A;  1RXQ A;  4NTA A;  3M9Q A;  3Q7G A;  2D2C D;  4TT3 H;  3KHU A;  2V26 A;  1FMV A;  1NU1 G;  1EQ1 A;  3T6J A;  3JSZ A;  3B0U X;  3TGU G;  3NMD A;  1YJW P;  1R4T A;  2GM4 A;  1OXB A;  3BRV B;  3GWN A;  3C8G D;  1Q2N A;  2NPS D;  2J9W A;  3EFO B;  1Z3I X;  1ZHT A;  2OU6 A;  1B68 A;  2A06 G;  5CBN A;  3B5N B;  3B0V C;  3PCV A;  3AGT A;  3NMI A;  4LAC B;  1ZR2 A;  1NTM K;  1S7Z A;  4ZKP A;  1UG7 A;  2D2C B;  1CGN A;  3SXY A;  4GEH A;  1GL2 C;  5AW3 B;  1MMD A;  3EQL F;  5HV9 A;  1HTL C;  1WGW A;  2LXB A;  3H1H E;  3TSI A;  3CEX A;  1QX8 A;  3LS1 A;  3S29 A;  2WTY A;  3LLI A;  4G0H A;  3C8G B;  2VRS A;  4CSA C;  4EDF A;  1JNM A;  2O01 H;  1L4A C;  2NPS B;  5CHX A;  3H2V A;  1SQP E;  5APU A;  4EUK B;  3L70 E;  2DB4 A;  4WAB A;  3ABM C;  1RJ9 A;  1E79 H;  3RK3 C;  2W45 A;  1DX7 A;  2XXA B;  3MUD C;  2FFD A;  3H65 A;  4BEM J;  4WGZ A;  1O87 A;  2YRF A;  3CSK A;  4JE9 A;  4L75 A;  1J2J B;  2KK1 A;  1EXI A;  3ABL C;  4IWB A;  1LT9 A;  1NTK E;  3V5X A;  1AVY A;  1ZW0 A;  2XL8 A;  2OYH C;  2RD9 A;  2FYZ A;  1L0L D;  1SQV K;  4JRZ A;  3KH2 A;  1NTM D;  3M0A A;  4LC1 A;  3Q1M A;  1EA8 A;  2WSF H;  5CI8 A;  3KMI A;  3GAN A;  5KAI H;  1DIP A;  3USS A;  1RHZ B;  4N3Y B;  1O5H A;  5AVS B;  3K66 A;  1F1M A;  2NSG A;  3E7K A;  4AE4 B;  3VP8 A;  3CZ6 A;  3JZ0 A;  5CJ4 A;  1VQL P;  4GOD A;  1LKX A;  1Q90 D;  4FWV A;  2BCC E;  3DWW A;  3EZH A;  3CLQ A;  2JWA A;  5GPG B;  4C7N A;  3WUT A;  3BEH A;  1WMK A;  4GKG A;  2O1K A;  1BR1 A;  1LTJ B;  2XLM A;  4XLP F;  2R7T A;  2MYS A;  1XZP A;  1BE3 E;  2C9L Y;  2J5U A;  3AG4 C;  5A6A A;  4YL1 A;  2IDB A;  3AE8 C;  2LSE A;  1URQ A;  3UR3 C;  2R7V A;  5A6B A;  1P84 H;  1GZL A;  3B9Q A;  1SQV J;  2M5A A;  2H8P D;  3CCL P;  1EC5 A;  4A7P A;  1ZHX A;  1FZB A;  1BGY G;  5EHH A;  1VQ7 P;  2KSF A;  3L74 E;  1BDJ B;  4N06 A;  4GT1 A;  1S5L H;  4B6I A;  1NLX A;  5KAF H;  3LNR A;  1YZA A;  5JRA A;  3L4F A;  4IAR A;  4J7Y A;  3FXE A;  2WSC J;  3SXK A;  5CI9 A;  2IYP A;  1SQB K;  3L72 J;  2OKU A;  2W83 C;  1OVV A;  2UWJ E;  1N73 C;  3HE4 A;  2XU6 A;  3AE9 C;  1ZHZ A;  2CNW D;  3U59 A;  3LW5 H;  3ITK A;  2HLO A;  4AL1 A;  1JMM A;  1DOW A;  4WGY A;  3QW0 A;  1JY2 N;  4NPF X;  1YIT P;  1JR8 A;  4ZLD A;  4C7O A;  1CZQ A;  3IN6 A;  3TJ5 A;  2FYU K;  4MVR A;  5BQG A;  2Q3I A;  2YL3 A;  1RF1 B;  3WHN A;  1N2D C;  1CI6 B;  3F46 A;  3ASO C;  2AP3 A;  1JOC A;  3HUS A;  4GIF A;  3NYM A;  3K6B A;  2AXT H;  2Z4E A;  4L6R A;  1HF9 A;  1GK4 A;  2V7Q J;  5JLI A;  2HZ8 A;  3LEV A;  4I2L C;  3NRH A;  3VMX A;  2LR2 A;  3TDK A;  1SZI A;  1RQU A;  2KYH A;  2ZXX A;  3OAK A;  1EZV G;  2LIG A;  4HFK B;  3GG2 A;  5T3T A;  4U3F J;  2OTK E;  2M0B A;  1AUE A;  2R05 A;  1KYO E;  5DQT A;  1SQB J;  1PP9 J;  4IFD K;  2WQY C;  1BZ4 A;  2ZJS E;  4NPD A;  2HOD A;  3QVZ A;  2FXM A;  2RMZ A;  3G3Z A;  3ITF A;  1P84 I;  2AU5 A;  2FYU D;  1MUU A;  3DM9 B;  3CCM P;  3G6E P;  1YYJ A;  4BRY B;  2LK4 A;  2WSE H;  3EGX B;  2L6F A;  5L0D A;  1N8R Q;  1FBM A;  1IW7 F;  2YLI A;  4PFO A;  1NAF A;  4WY4 C;  3SWF A;  5AVX B;  4EKW A;  5KKZ B;  1S3J A;  1XWJ A;  3L74 G;  2Y9Z A;  1P84 D;  1XZQ A;  5JS5 A;  1NU1 J;  2MHR A;  2P1A A;  3SWK A;  1SYQ A;  1ZP0 C;  3TGU J;  4G78 A;  2WZL A;  1HE9 A;  3PJS K;  3ZQY A;  1IFP A;  3QVY A;  3AEE C;  4JUR I;  1WTY A;  3ZVR A;  5KLI C;  3I5P A;  2KS1 A;  3DXJ F;  3BAT A;  4RES B;  3LNM B;  3KKB A;  1YQ3 C;  3V2Q A;  1Q86 Q;  4JTA B;  2J46 A;  2M64 A;  2J8W A;  2P2U A;  3L36 A;  3IR9 A;  3AED C;  5A6K A;  4W80 A;  1IFN A;  1OW8 A;  1S2E A;  1KIL D;  3L34 A;  1M1K Q;  3MFN A;  4N78 E;  4LLH A;  3G4S P;  3BRJ A;  3TNU B;  2FBW C;  2LFF A;  2J9V A;  1OCZ C;  1NWQ A;  3RK3 E;  1ZV8 A;  2HSQ A;  2FFD B;  1FOS E;  4KI2 A;  3DJU B;  3N7N A;  1LT9 B;  2O3J A;  2IX7 C;  3BCC G;  4K35 A;  3L0I A;  3O55 A;  4X0R A;  3RVZ A;  3JCU E;  1QLE D;  5AVT B;  3B29 A;  2N9B A;  3CCJ P;  3SXZ A;  2Q3T A;  2QE7 H;  3A11 A;  4P9T A;  4EBK A;  3ABV C;  1YAU O;  1L7C A;  1SFC A;  5KLV D;  3C63 A;  3CC7 P;  5APV A;  3CPW O;  3H1I J;  3AOU A;  1Z5Z A;  1K05 A;  1IO4 A;  5COM A;  1L0N D;  3M91 A;  1M1J C;  1ORY A;  3AE1 C;  4WJ0 A;  1WOL A;  2WVO A;  2Q9I A;  2PFX A;  5DS6 A;  1KU2 A;  4PAC A;  2R44 A;  1BSH A;  2BEZ F;  4HYT B;  3AEF C;  1N7S D;  2XLD A;  3K1H A;  3TOM A;  3H1J G;  3GOR A;  1AV1 A;  1FZC B;  2XLE A;  3M79 A;  1VQM P;  1NU7 D;  3K7D A;  3JC2 2;  2CDQ A;  2OAR A;  1QZX A;  3U8V A;  2R9R B;  3H1L J;  2KZI A;  2LQG A;  4DCK A;  1NTK K;  5KJ7 D;  3EHN A;  3LLK A;  1GW4 A;  4K0D A;  3U8P A;  2E43 A;  3HE5 B;  3JYH A;  4DOZ A;  2Q5U A;  3FOO A;  1G8X A;  2QY9 A;  3RYL A;  5E79 E;  4HEA J;  1VYK A;  3NYL A;  4I44 A;  1KFN A;  1UIX A;  2IXO A;  2QG4 A;  1N7S B;  2M5A B;  3CXH I;  2E76 C;  2MKV A;  1FJK A;  3H1H D;  1MNE A;  1BGY J;  1QVG O;  4CBE A;  1M6T A;  3VP9 A;  4NCQ A;  1DEB A;  2OTJ P;  3S4R A;  1PGJ A;  3WUU A;  2FGY A;  1W2E A;  2HJ3 A;  1K04 A;  4BG0 A;  1SQP D;  2P7V A;  3U2M A;  3L70 D;  3UMH A;  5AW9 B;  3B5N A;  1RKE B;  2QSI A;  1SQV E;  1T8Z A;  2J9B A;  2W4B A;  4J30 B;  3FWN A;  1EKY A;  4DJG A;  4CS8 A;  1ZME C;  1GD2 E;  1NTK D;  1EZV I;  3QH9 A;  2QEX P;  3A3Y B;  1M2V B;  3O10 A;  4TLF A;  4YT2 A;  2YWA A;  2WWW A;  3C8G A;  1KQG B;  4M3L A;  3L72 E;  2VAS A;  3R4Y A;  2NPS A;  2Y9Y A;  2OYI B;  1YJG A;  2W4M A;  1I5N A;  3AEC C;  1MFT A;  2Q7R A;  1LWU B;  2KP8 A;  1KYO H;  1BR2 A;  2R7W A;  2XXA A;  3G4Z A;  2NPU A;  2HV6 A;  4E0I A;  3GWL A;  2NG1 A;  5H2F E;  4OD5 A;  4ASW A;  1TU3 F;  2KXP B;  2BCC D;  2YLD A;  4IFF A;  2ZPA A;  4NTB A;  1NU9 C;  2KW3 C;  1YZC A;  2I15 A;  4IL6 X;  3JRM O;  1R5L A;  4AX2 A;  1JY3 O;  1PPJ E;  2YMK A;  3JSE O;  1JY3 P;  3E9V A;  2QJY C;  1GU4 A;  1BE3 D;  1C03 A;  1VB5 A;  3HTK C;  3AG3 C;  1NHL A;  2CYD A;  4AE4 A;  4BEJ A;  1VMA A;  2RN0 A;  1E85 A;  1OW7 A;  2WT7 B;  1VLT A;  2A6H F;  5L0F A;  1U57 A;  1YDI A;  2W6J H;  3N24 A;  4AQR D;  2LFD A;  1QKR A;  1SQB E;  2H89 C;  1H8A A;  1PP9 E;  2Q6Q A;  1FJP A;  1FDM A;  3L74 D;  3ZG1 A;  4XWJ A;  3HD7 D;  3OA1 A;  1LP1 A;  3U3B A;  3FXD A;  1LTJ A;  3M15 A;  4P6I C;  2OG2 A;  4ANJ A;  3D6Y A;  3FAP B;  2W90 A;  5M1B A;  1PCX A;  2MWQ A;  3K5B A;  4FAP B; 
#chains in the Genus database with same CATH homology
 5F28 E;  2WSC J;  2D2C B;  2HSB A;  3AE3 C;  3RQE A;  1YQ3 C;  3L8I A;  4H0L D;  4H0L C;  4XFJ A;  3C18 A;  1K04 A;  3L8J A;  1OMI A;  1ZZP A;  3AEB C;  1VF5 D;  3FGA D;  1VF5 C;  3AE9 C;  1UFB A;  3C8G B;  1PL5 A;  3U0C A;  2QSI A;  3AED C;  3SFD C;  4YXD C;  2H88 C;  3U3F A;  1OW8 A;  1QVX A;  1PV3 A;  4PV1 C;  1JOG A;  2E76 D;  3IN6 A;  1ZME C;  3RQG A;  3TUL A;  3MFN A;  2FYN C;  3BRJ A;  1KMI Z;  3O10 A;  4R32 A;  2FBW C;  2KK1 A;  1R8E A;  1DD3 A;  2WPV B;  1KIL E;  2YIU C;  3B71 A;  4Y28 J;  3GF7 A;  1EXI A;  4H0L B;  2YWA A;  3C8G A;  1KQG B;  3RK3 E;  1EXJ A;  4U7J A;  1MKM A;  3AE7 C;  3R4Y A;  1AJY A;  1S1C X;  2QIW A;  4OGQ D;  1HF9 A;  3AEC C;  4OGQ C;  3GM2 A;  2V7Q J;  3SFE C;  1ZRT E;  4H44 D;  4R4L A;  3GF3 A;  3D6Z A;  3Q1M A;  2OQQ A;  4H44 C;  1FDI A;  1IK7 A;  1RQU A;  5L8R J;  1KOR A;  3Q5P A;  4R4M A;  1DIP A;  2ZT9 D;  2Q00 A;  3JYY A;  3GMA A;  2ZT9 C;  4PV1 D;  1FDO A;  1KTM A;  4EBJ A;  1Y9B A;  2E76 B;  4EBK A;  2E74 D;  3ABV C;  2WSE J;  3GLM A;  1V4A A;  2E74 C;  1TU3 F;  3H25 A;  1O3U A;  4GDO A;  2QJP C;  1JB0 J;  2BEQ D;  3JZ0 A;  3O6Q A;  2E75 D;  3Q2Y A;  2WQY C;  4IL6 X;  1VL2 A;  2E75 C;  4Z1M H;  1PIX A;  3GM3 A;  4KT0 J;  1K05 A;  5KKZ C;  3S9O A;  1Q90 D;  2QJK C;  1KQF B;  3AE1 C;  1WOL A;  3IAO A;  3C8V A;  4OGQ B;  2YMK A;  2P10 A;  1VF5 B;  2G3A A;  3GM1 A;  3D71 A;  1DD4 A;  4I7Z C;  1K40 A;  4H44 B;  2QJY C;  3T97 B;  1S5L X;  2BEZ F;  4H13 D;  3AEF C;  2LK4 A;  3AEG C;  4H13 C;  2ZT9 B;  2L6F A;  3Q3D A;  1WMK A;  3RL0 g;  4PV1 B;  4XEF A;  3K7D A;  3AE4 C;  3RQF A;  3Q5R A;  1OW7 A;  2E74 B;  1KNY A;  2D2C D;  4TT3 H;  3D70 A;  3AEA C;  2D2C C;  2JP3 A;  2L6G A;  1U57 A;  2J5U A;  2JX0 A;  2L6H A;  2PBE A;  4NQF A;  2IDB A;  2E75 B;  3AE8 C;  4XEV A;  1YQ4 C;  2H89 C;  4RKU J;  3EWK A;  2JPU A;  3Q5S A;  4XEK A;  3C8G D;  3AE5 C;  3AJM A;  1WWP A;  1ZP0 C;  2NZ2 A;  1OW6 A;  2FXP A;  3AE6 C;  1GMJ A;  2JO1 A;  4I7Z B;  1UIX A;  4YTP C;  1NYH A;  3AE2 C;  3LW5 J;  1NGM B;  4H13 B;  1RQV A;  2WSF J;  3AEE C;  3D6Y A;  2O01 J;  1WTY A;  3G9R A;  1HJ0 A;  5KLI C;  2E76 C;  5M1B A;  2MKV A;  1ZOY C;  2G8Y A;  2K9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...