1OW8A

Paxillin ld2 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Focal adhesion kinase 1
publication title Molecular Recognition of Paxillin LD Motifs by the Focal Adhesion Targeting Domain
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow8A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow8A02
3AE3C 3AEDC 1KTMA 3JYYA 3RQGA 2L6GA 1WOLA 2YWAA 4NQFA 3AECC 2G3AA 4YTPC 3AEBC 1ZZPA 2JX0A 4YXDC 1ZOYC 3C18A 3SFEC 1OW7A 3AEEC 3L8IA 2LK4A 2FBWC 3B71A 1JOGA 2L6HA 3MFNA 3AE4C 3C8GD 3AE8C 3S9OA 2Q00A 3O10A 1K05A 3AJMA 3ABVC 3L8JA 3AE5C 1YQ4C 3C8GA 4XEVA 1WWPA 3C8GB 3AE2C 3BRJA 1K04A 1PV3A 3AE6C 3AE9C 2JPUA 2PBEA 3RQFA 3AEGC 2H89C 1WTYA 4XEKA 1V4AA 3TULA 2WQYC 3AEFC 2KK1A 3GM2A 3RQEA 3GM3A 3U3FA 3JZ0A 4R32A 2HSBA 4EBKA 1OW6A 1KNYA 1OW8A 1UFBA 1QVXA 2L6FA 2H88C 1ZP0C 3GM1A 4XEFA 3K7DA 1K40A 3AEAC 3SFDC 1YQ3C 3AE7C 1O3UA 3U0CA 3AE1C 5F28E 4EBJA
chains in the Genus database with same CATH superfamily
1JMWA 3DXJF 2P6VA 4RJTA 4OIRF 3CCVP 3KYQA 2LSEA 3PDMP 1FDOA 1AQTA 3SSUA 1JR8A 1YARO 2HPCB 1DIPA 3B29A 4KI2A 1ORSC 1W2BO 1AVOA 1IFIA 3FHDA 4LDRA 2VB6A 4JCZA 3JSEO 2WVNA 3G71P 2JX0A 4JTAB 1WASA 4K3AA 3AEEC 1VTMP 3KZIE 3B5NC 2XKMA 1NKNA 4N3YB 2N1TC 2KB7P 3WU2E 2KNCA 3AE8C 4BXLA 3L73G 1L4AC 1J2JB 1S9KE 2JO1A 2KJGA 5AW8B 2HMQA 1NTMK 1YHQP 2XDJA 3MD0A 1LJ2A 3HLZA 3B8EB 3EGXA 2P7JA 3TF5A 3V5YA 3W2VA 1PGJA 4MTOA 3BRTB 1SQQK 3M1CB 4CJGA 5B66H 1W2WA 2KLUA 2JD3A 2ETSA 2V3CC 4HFFB 4JZAA 2IFNA 4IJJA 1LTTC 1NU1E 2E5TA 4Z9IA 3ZC4A 4WWIA 3WUVA 3JCUQ 1FZCC 1DD3A 4JC7A 1VYKA 2J0XA 2WSEJ 4W80A 3MYFA 1KILE 1CZQA 2FYZA 1TFKB 2DB4A 1BZ4A 4CIHA 1FJPA 2P10A 3MTUE 2N9YB 3U3FA 4YL0A 2NPSB 1L7CA 3SWKA 2HSBA 1KQSO 1ZRTE 2PX3A 3L71D 4PJJA 3LLIA 2AWYA 5KYUA 2Q6QA 1NU1J 1HE1A 2RSEB 1QL2A 2O3JA 2AEJA 3U9JA 4GDOA 3CCQP 4PD4I 4XLPF 3M15A 4HH2A 3U1CA 4IRUA 2EIJC 5IY5C 4XTKA 1NTZK 4K35A 4Y28J 4JEAA 3H1KJ 1BCCE 4QI0A 4PJ0H 4U3FJ 1SQBD 1KYOH 1JRAA 2AU5A 2XLOA 2WZGA 3JCUH 4DCKA 3M0DC 1QSPA 2B0HA 1EDIA 1G8XA 3UGPA 2KI7B 3V5BA 4DZOA 3W2WA 1FS0E 3GANA 2W90A 1P84H 3H1HE 4CDAA 1JAFA 2YZSA 1IFPA 1LWUB 2YMKA 2GFHA 5JT4A 2G3AA 2R7RA 3RVYA 3FWLA 2LFFA 2XL8A 1BCCJ 1A7EA 4O6YA 3LEVA 4CDVA 1T01A 2ZT9D 3H1JJ 2L91A 3LIEA 1NZEA 3X1OA 1U89A 3CX5H 3P32A 3P8CD 5AW6B 3KHUA 1OQCA 1APCA 3H1HJ 3G6EP 4K1OA 1SQVG 2D2CB 3E9VA 1HH0A 4BPMA 1ZHWA 3ZWIA 2V26A 4GIFA 4WJ0A 1Y8AA 3W8IA 1JEKA 1T5OA 3IPMO 5TISE 5A6BA 4GKGA 2BCCG 4JKVA 3RK3E 4OINF 3QMKA 3UMKA 4IGGA 3CC7P 1LT1A 1ZXGA 2W6BA 1LTJC 4M3LA 4X0RA 5T1DB 2Y0DA 5CJ0A 1OCOC 1Z7Qc 1OXZA 1KD1Q 2YO2A 1HF9A 1CSBA 1G2CA 1JUNA 2XLWA 2NPSD 4D6TJ 3AE9C 2OYHB 1GZLA 4H44C 1RF1C 2YLDA 2M64A 1FTSA 1Z3IX 1M2VA 5L0FA 3M91A 2E74C 1GL2A 1HBWA 1Z6AA 4CX9A 2FYUD 4GODA 5T3TA 1A7DA 1RCPA 2W6AA 3H1ID 4I7ZC 2E75C 4BRYA 1LE2A 3L72G 3Q2YA 3UR3C 4O6NA 3CWBG 4N78E 3L37A 1LT9A 5DVWA 1G1JA 5COFA 1JB0J 3X2QC 2L9JA 2WVRA 4H0LC 4DJ9A 3FXHA 3AE7C 4WY4A 4NC3A 2J9WA 1H8AA 3M9QA 4YT2A 1LPEA 2VH3A 3GWNA 4MTFA 3T9OA 2A1DD 5B1AC 3SXMA 1J1EC 1OR2A 3T4RA 2EIKC 4BJ5A 5CCHC 4UB8H 4JQ0D 5CCGD 3A11A 1VOMA 3IHUA 1TFOB 1EZVE 2YIUC 3CZ6A 4DOZA 2A69F 4C3DA 2HFED 3C8VA 1K73Q 2YWAA 3AECC 3VMAA 3LNRA 3I5CA 1SQXE 5JSLA 2KXPB 3EQ2A 2R7QA 3C9IA 1ZZPA 1OCZC 1AVOB 4MVZA 1SLQA 4XPWA 4EHPA 2CCYA 2VRSA 2ZYAA 2O1JA 2YLGA 5CMZA 1M1KQ 4ZKUA 3S0XA 1PL5A 2OYIA 3GHGA 4DJGA 3K5BA 4WB4A 2UUIA 2YL3A 2WSCH 1RKCA 4CS9C 4E0HA 5KJ7A 3V6IA 1SQQD 1SQXJ 1U7JA 1NYHA 3PMRA 1NWQA 1VQOP 2YVKA 2P7VA 3ABLC 2KNCB 5KLVD 1X8YA 3ZTZA 2IYLD 2ASRA 2R7TA 2HV6A 3WG7C 1S4XA 2PFXA 3R2PA 1EA8A 4YWQA 5JRAA 2AVKA 1JO5A 1KYOD 2XL4A 3EGXB 1HVVA 3V2RA 2J46A 3TSIA 1WWPA 3Q7GA 1OXBA 4FESA 5DS4A 2OGUA 3L75E 1A02J 3AG3C 3AE6C 2BEZF 2Q9BA 1AQ5A 1GM5A 1NU1K 1P84D 2JPUA 1BGYD 2NUTB 4JVSA 2QJKB 5L0DA 2JP3A 3B0UX 3R4YA 4YL1A 3KZIH 2A68F 3LEOA 3AEGC 3OA7A 1MV8A 3TYYA 3L71G 1WTYA 3ZG1A 4BG0A 1ZU5A 2M0BA 3AEFC 3WU2H 4PJLA 3U9MA 2ZVOB 2M5AA 3NMIA 2M8RA 1RHZB 4IFDK 3CX5D 4MS2A 3ATPA 2OU6A 4N6JA 1PGOA 1GK4A 3K1IA 5DJTB 1TU3F 2WSFJ 3HNLA 3VAYA 2B87B 3DMDA 2ITAA 2A6EF 2HODA 5KYUB 1Z63A 2DYRC 1ZVZA 1SQBG 4JEBA 3EPVA 2HFIA 1VLSA 2LIGA 3TK0A 2WL8A 4W8PA 5L0CA 3TGUE 2OYOA 2PGDA 1VQNP 4IAOA 1D0YA 3EJNA 5KYNA 1OMIA 2YXQB 2IYOA 3U59A 5AVTB 2ZXOA 2IBFA 4ULWA 2R5BA 2NG1A 4IB4A 4H4KC 2YL7A 3RW0A 4BWNA 2G3KA 3M0AA 3E1IA 2FFHA 3BCCE 3NRHA 3CXHI 3EFOA 4MVSA 4ZKPA 5KAIE 3TGUJ 1HJ0A 3B4SA 2MJZA 4KHXA 1EKYA 3I5QA 2I15A 3Q3DA 1RXQA 2O01J 2C0XA 2E5YA 2PX0A 3OJAB 2LK4A 3BCCJ 3NFQA 3K1IC 3CLQA 1JOGA 2L6HA 3Q7LA 3HNIA 5AW3B 2Y0CA 4NPEA 4N4WA 3AQCA 2K88A 1PP9D 2E87A 1L2PA 1LTSC 2J5UA 4PACA 4LDQA 1R5ID 1M56D 3V2QA 2KK7A 1H0TA 4FAPB 3KQGA 4BJ6C 4OIQF 2WITA 3Q6NA 1K04A 2W9YA 3F46A 1GS9A 3JSVC 1G2CB 1ST6A 1H9GA 4G7ZF 1GK6A 5AVSB 2FYUG 3H1IG 4E7ZA 3QVZA 4I3MA 5JS5A 5DS5A 3GM2A 4Q7CA 1M2VB 3AG4C 2J59M 1WATA 4QMAA 1GL2B 1QGKB 4J30B 2W27A 5TISH 3TOMA 1IZMA 1PPJD 3HNKA 4BRYB 1KU2A 3EHMA 2OG2A 2E76D 1AVYA 1B68A 1LT9B 4I6MC 2IZ0A 2FKWB 3CPWO 1OZHA 3H1LJ 1T9KA 4WY4B 3WMM0 2P2UA 3PP5A 2EPMX 5AGFA 3BASA 4JYCA 1XZQA 4EUKB 3LS0A 5CI9A 3EFGA 3MBGA 3V2PA 4IWBA 1NAFA 3CCEP 1Y4CA 2WPRA 3GODA 3GMAA 1HY5A 4OD5A 4BJ1A 3U3BA 1F1MA 2FXOA 1RF0C 1N7LA 5T3WA 1MMNA 2KSJA 1SQQG 1S9KD 2OJED 2ZXRA 2WZLA 1WN0A 2P1AA 2VCCA 1X0TA 4WGZA 2H8PD 1EZVI 5KLVG 2OYIB 1BE3E 5A6BD 3DI5A 3GHGB 3DAGA 2R7SA 5AW0B 5E2QA 1CPRA 2IXNA 4IL6X 2ZD9A 3K66A 1UIXA 3K1HA 2XSEA 1SQBK 3UMIA 1T3JA 4JRZA 1LIHA 2KYVA 2HV7A 1SVFA 3DE8A 3TQOA 3TOLA 1M7LA 1NU1D 2A45I 1RE3A 1V54C 2VCAA 3L4FA 2HKVA 2NPSC 1BGYG 3RK3B 1NTKJ 2JEEA 3CAXA 3A9CA 3D6ZA 2YO3A 1KC8Q 1ZW3A 2HJMA 1D1AA 1ZLLA 2QUPA 3H1KD 1J8MF 2A06E 4U3FD 4CJOA 1FE6A 1ZRTD 1VQ4P 3EZHA 5L3VA 1D1CA 1EDLA 3H6PA 2IBZE 1LKXA 3DZAA 5KYYA 4L73A 2QM8A 2CYDA 2HSQA 1IJDB 2C03A 3MX3A 3MGNA 1ORYA 2M5AB 4CS8A 1OFCX 4MW8A 1YAUO 4WY4D 2DI3A 3QVYA 3T6JA 5A6KA 3OW2O 1U0BB 3RL0B 3N2ZB 3K33A 1LWUC 2HODB 3H1JD 1MMGA 1YLMA 3E1RA 2H7HA 3MLGA 5BUOA 3RK2B 4DOJA 2WSFH 4A2NB 3H1HD 1DOWA 5CCGC 1PD0A 3RYLA 3ZSUA 1YJWP 4U5BE 2J9VA 5DQTA 3SNHA 3JC22 1SQPE 4L75A 4XFJA 1O87A 1Q86Q 1JMBA 3CMEP 2D2CC 2YRFA 3F89A 5B1BC 1Q0DA 1YTZI 5APSA 1VF5D 3SXZA 3IQ5A 1QVFO 3EFOB 5HV9A 3VOPA 5CBNA 1Q81Q 1FR0A 3U8PA 1CI6A 3QTHA 5KJ7D 2XLMA 4OIOF 2RH0A 1G1IA 4D6TD 2B0JA 4PR9A 1Y6DA 1D7MA 1SQPJ 1IFMA 2OJQA 3FMSA 4YT8A 2IFMA 3G3ZA 4UB6H 4LERA 4CS8C 3P8MC 2W6JH 1PP9G 2N9BA 3RK3D 2OYHC 2YKPA 2O01H 2C9LY 1FMWA 2B89A 1FFHA 3FGAD 3MYIA 2J9BA 4DBRA 2KSEA 3NMKA 2O01N 4DBQA 1EXJA 2IOQA 4U5CE 2JR8A 2HS5A 5KAIH 3DWWA 3EG9A 1SFCA 2CPBA 2AXTE 1H0TB 3BRJA 2BC5A 1QZXA 3NKDA 5DJUB 1ZHXA 3C1LA 1RY3A 4GT1A 3EGDA 4P9TA 1Z23A 4F4BA 2XV5A 2ZT9B 3ABMC 3RL0D 1FU1A 1PPJG 1NAYA 2X51A 1N73A 3RQEA 4MNDA 4N78D 1R5SA 4CBEA 4R32A 1XWJA 1JTHA 4E18A 3HTKA 3RK2D 2FXPA 5AVVB 3PLNA 5KLVK 1IO4A 2L6FA 2YKZA 3ABKC 2NUTA 2FFDB 3SZRA 4LLHA 2E43A 4Y99B 2J8WA 2KOGA 2OQQA 4TT3H 2IXPA 3OA1A 1UIIA 3VYIA 2KC3A 4U5FE 1O3UA 1PZQA 3UIAA 3Q5RA 1RMVA 3AG2C 1SQXD 1GGQA 3RIPA 2XNXA 1N8RQ 2B87A 4JURI 3S27A 3PHF2 3HD7A 4Z1MH 2R3SA 3PHLA 5DS6A 4JJFA 3DJUB 4H13B 2A0BA 2IPPA 4ULVA 1VYIA 3F5HA 2OOCA 3CXHE 2AEFA 3B0VC 3HUSA 3E7KA 2L5GB 4Q5SF 1WRGA 4KBLA 2R25A 3CQZA 4U5DE 3BATA 3DJNB 3ZTMA 1QX8A 2PP4A 2V7QJ 3RL0g 2Q7RA 4IFFA 4PD4H 5CJ4A 4IAQA 1QEXA 4R4LA 1YYJA 1JOCA 1SQVE 1I5NA 2YHSA 2OEXA 2P58A 1NTKK 5D91A 3EH2A 3CCMP 1NU1G 5COMA 2QJKC 4Z9JA 4KNWA 2HZ8A 3AG1C 5KAFE 4PV1B 1GW3A 4A7PA 1M56C 4L6RA 2I1JA 4G7OF 2KYHA 1E5WA 3QWOC 4EDFA 3C8GA 2XS1A 1E79H 3I55P 3H1KG 3L70E 1VQMP 2ICWG 3KH2A 4U3FG 1SYQA 2K9JA 2OTJP 2B9BA 3CX5I 5AVRB 3GEIA 1T2KD 3QW1A 3DM9B 2IXMA 5CBOA 1LI5A 1G5ZA 4U9DA 2Z5HA 1BDDA 3LESA 2Q7CA 1BDJB 4O9BA 3VMXA 1VQKP 1BSHA 5M1BA 3GORA 2R05A 1M57D 2H43A 2H7BA 2KW3C 4XLNF 1ORJA 5CI8A 1DD4A 5KYYB 3L70J 4NTAA 5GTHE 2Z4EA 3H1JG 4C46A 1OW6A 2F22A 1LTBC 4YT5A 2ZYGA 5D92A 1N86A 3FXDA 2MYSA 3TGUD 3B0PA 1YITP 2YXRB 3H1HG 2IBZI 4C3EA 3H65A 3E70C 3AEAC 2C04A 1YQ3C 1E2XA 1CW5A 1KILA 3BCCD 4H13D 1NG1A 3U1AA 4G0HA 3S1KA 3N0TA 3VRCA 2XLDA 1BR4A 2DYSC 1CGME 4NTFA 1YBKA 2JJLA 1RJ9A 3IF4A 3JYYA 4MVMA 4AL0A 2KNHA 4J7TA 1LS4A 3IAOA 1AEPA 1S2EA 1URQB 2A6HF 2WT7B 1KQLA 1OWAA 2FYNB 1WOLA 4D6TG 3Q1MA 1YDIA 1FJKA 2YMYA 4YTPC 5AC5A 2PAJA 3M9HA 2XL6A 1T6QA 3U2LA 1PFIA 1NBBA 2XLHA 5A69A 2R7XA 4PV1D 2WVOA 1CI6B 4DRHB 2Z15A 1Q0MA 1SR2A 5AW2B 1QVGO 2FBWC 5GTIE 5APXA 3MFNA 3AE4C 4DT0A 4GEHA 3SXKA 3RF3A 4CSAA 3S9OA 4RO0A 1K8AQ 3ABVC 3AE5C 1H9TA 1YIJP 1KQGB 1NO4A 1G4US 2Y69C 2GWWA 4XEVA 2HMZA 1GL2C 1S1CX 1E83A 3DAFA 3EG9B 3P7KA 4XWJA 1SFCB 1LM3B 1I4YA 3ECSA 1L0LE 5DLJA 3H1LD 2PBEA 3Q6MA 1LP1A 3EGDB 3U2MA 1LT9C 1GW4A 4WBAA 2NZ2A 1Z56A 2OKUA 1AJYA 2LR2A 3GM3A 4WY4C 3VYWA 1FZAA 4OIPF 1N73B 3FOOA 2M4EA 1HMOA 1JTHB 4IL6E 4PD4D 2ZXWC 4OH8B 3HTKB 1VQ5P 3GM1A 4BJ5C 1KMIZ 1L0LJ 1GMJA 2R7OA 4CIPA 2R02A 1ZHZA 4LDKA 4U7JA 2MKVA 2AXTH 1SQXG 1Q0KA 1URQD 2J58A 3MUDA 5B5EE 3EQLF 3TD7A 3DE9A 1JY3P 4ANJA 4D4NA 3F47A 1VPCA 2QG4A 2WZFA 3VF0A 2LXCB 3L75J 2OYIC 1WGWA 3I5PA 5TJ5E 3GLMA 3GHGC 2WSEH 1L0NE 2AWCA 3JT1A 3HD7B 5KJ7C 3DKAA 5L0GA 2N1TD 3P8CE 1TWHA 3O39A 3CL3D 3UGOA 2QSIA 3D6YA 1NTKD 3NMDA 1H89A 4JTDB 1S72P 4CDYA 1KN7A 2KZIA 3HUSB 4Z9HA 3RK3C 1RQUA 1UG7A 2P0NA 2J9UA 4MVRA 1RQVA 1L0NJ 4BEMJ 3KPEA 1AV1A 3A2AA 1YZAA 2E76B 2R7UA 2KGOA 4L76A 1SFCD 2NUPA 2V7QH 3KYIA 2CDQA 2JKVA 1OKKD 5APWA 1L3PA 4EYYQ 1I4ZA 1RKEA 2WPVB 1CGOA 4LACB 1VB5A 2H7VC 4HB1A 2IZ1A 4BJTA 3WHNA 3LAYA 3CXHH 3AGUA 2IXOA 3C8GB 5A6AA 4K7BA 5B3SC 4I2LC 1TKNA 1MFZA 2Y3DA 1C02A 2Q9CA 1QLED 2K9JB 3V5XA 3RL0C 4DRJB 2FYUE 3TK1A 2SPZA 1K9MQ 1GDTA 3UMHA 1PGPA 4JF7A 1KZUB 5EK0A 3RK2C 3TGUG 4XPYA 2WZ7A 4AK9A 4EIYA 1J1DB 3T97A 1OXKA 5AVZB 3ITKA 1O5HA 1NJIQ 5A6JA 2D5RB 4XEFA 2LFDA 2FYUJ 1A7VA 3C7JA 3BCCG 2ZXEB 2ZXPA 4TLFA 4UDVA 1FFTC 1SMYF 1K40A 1SQPD 2A0UA 4U9EA 4D4XA 1FZFA 2LP4A 1FZBA 1QKRA 2WPSA 3HD7D 3VTPC 3U0CA 1VK5A 1IW7F 1V55C 1KILB 2XM4A 1KB9I 5E3AA 2EIMC 4MVOA 2RKLA 5L0HA 2LQGA 1YTZT 3M79A 2FFDA 4NCQA 2HYNA 1RJ9B 2Y3GA 5GTHH 3AOUA 3KXDA 3HE4A 1Q0GA 5AW4B 1HWTC 1NTME 1LTIC 2LCHA 4JJGA 2Q4FA 3ZVRA 2QA4P 1AA0A 2NSFA 3VN0A 3TJ5A 1MUUA 3C18A 3A0BE 2OTKE 5L3QA 2W8ZA 2POHA 3OWTA 4OD4A 5COGA 3BEHA 1VDFA 1EDJA 2R5DA 1CPQA 3L0IA 3N7NA 3C8GD 4PJ0E 1NTMJ 1RE4A 2ZFCA 1XZPA 2ZT9C 2J7PA 1X9VA 2YNYA 4C7RA 4LLEA 4YK5A 1SQXK 4JW1A 3L1MA 4I44A 4EI2A 3IFMA 2QM7A 1BGYE 2OEVA 3EWKA 1T2KC 3H1LG 2NRGA 3L74E 4JTCB 3WODF 1IK9A 3FDQA 4R4MA 1A02F 1VF5B 5KTBA 2QE7H 2FFDC 2QVAA 5E79E 3C62A 3HE5A 1KV4A 1HMDA 1S5LX 2J0WA 2QJYB 4Y99C 3CX5E 3SXYA 5GTIH 1NTZE 1V4AA 1LP1B 2JWDA 2KK1A 2VCBA 5BQGA 3RGUA 3L74J 1N7SA 3JZ0A 1EQ7A 4EBKA 1BE3J 4MTGA 2WPQA 1OVRA 1IZNB 4KC9A 3EH1A 3S84A 2H88C 1KILD 1ZP0C 1MNDA 1DH3A 3T6GB 1S05A 4MQ9F 1J8YF 4O6MA 4H13C 2A45H 1XTGB 1OVVA 3VMZA 1NTZJ 3NKEA 1M1JA 3C63A 5JLIA 1Q0FA 4P9FA 2R44A 2CGEA 2GA0A 1HGVA 2I8BA 1EDKA 1YA7O 3PJSK 4WVZA 2K3RA 4A4AA 3CCRP 1OIPA 3CXHD 4KT0J 3POVA 4AE4A 3RFYA 4GYTA 3PTZA 5K5GB 2O1KA 1FBMA 2WB7A 3ASOC 1NTKG 1Q7YQ 1TQGA 1BCCD 2C0WA 2OQMA 3VMYA 3GEHA 1YI2P 4IL6H 2XS8A 2NSGA 4PV1C 2OARA 3W8HA 2P1JA 1S3JA 3S90A 3OEOA 2K9YA 3LLKA 5AW5B 1KORA 2Y0EA 3M06A 1JY3N 3SFEC 1RE3C 3JRMO 1OR3A 2WSSH 4J7YA 4G7HF 1PP9E 1URQA 2WT7A 1DX7A 1VQLP 1FDMA 3JSZA 3L70D 3LW5J 2G3VA 4HE8D 2WMMA 2XU6A 3USSA 4UB8E 5APTA 2NUPB 1SZIA 3JRTA 2XNDH 4ASVA 5BU5A 2XLVA 3HJCA 5H2FE 2CPSA 5APVA 3M4BA 1MFTA 1RKEB 1PP9J 3B5NA 1VQ9P 1EI7A 2M3EA 3AQBA 2N1TA 3TDKA 4PJNA 1IC2A 5AVWB 3A0HE 3US6A 2ZPAA 1L4AA 2KS1B 3IQCA 2JWAA 3L73E 2LKMA 4XPXA 3G4SP 2TMVP 5AC4A 4KJMA 2FY8A 1YJGA 3TULA 1PPJE 5TJHA 4AX2A 4WABA 1KFNA 1QPUA 2L81A 3QW0A 4MW3A 5KLIB 3NMJA 1SQPG 4L74A 2GA1A 3T97B 1OKKA 1UFBA 2X0CA 5F5HA 1ZYRF 3L73J 2P61A 1URQC 2HJ3A 1FZCA 3V4QA 3K6BA 3K7DA 2LD6A 2FYNC 1JY3O 2PRRA 1D1BA 3EZIA 2Q3TA 4EBBA 4Q4ZF 4RDAA 3SFDC 2WSCJ 3GWLA 3H2UA 2QNLA 5CHXA 4PFOA 2L7AA 1VMAA 3CMAP 1GTWA 3RQGA 1SF8A 4ER9A 4EWCA 3HKKA 3NYMA 1M6TA 3IN6A 2HUJA 2GM4A 3VP8A 2WWWA 1W2EA 2RN0A 3FWNA 1H7IA 2RD9A 4MVUA 2D4UA 3HE4B 4FX5A 3RBZA 1SP4A 3LNMB 2KZJA 1ZW0A 1EZVD 3M0DA 4OGQB 3TNUB 1LTGC 1FC2C 3V4WA 2CW0F 1SFCC 3NXSA 3ITFA 3O6QA 2BASA 2V4HA 1LI7A 1YA9A 1NGMB 1X79B 2Q00A 1OX3A 3G4XA 3O10A 2XXAA 2I1KA 2BL2A 3LUTB 1JM0A 1NU9C 4I1MA 1M8OB 1L0LD 3H1KE 1NH4A 4U3FE 1MNEA 1N73C 4N6HA 2Y9YA 1QLEC 3KYJA 4JE9A 3W4YA 3AE2C 1KYOI 3HTKC 2FGYA 4M63A 5JP7A 5EGYA 3A0BH 1OCCC 1YZCA 3PCVA 3O55A 3HE5B 3RQFA 2QRXA 2W4BA 2H89C 3CCSP 4ASWA 1ZU4A 5BQHA 4AQRD 1P84I 4XEKA 1FOSF 2WVQA 2AXCA 2BCCE 3L75D 1C17M 2KLVA 1LTJA 3CCJP 1V74B 3H1JE 2CK3H 3O6XA 1N7SB 1SQVJ 4BEJA 2OTLP 3L36A 5APQA 1QVXA 5KKZB 4N6CA 1RF1A 3O8ZA 3HD7C 1JMMA 2BCCJ 3H25A 2YLIA 2UUHA 5KYWA 5JVEA 1IFJA 4QDLA 1M1JB 1FAVA 5E79H 5L0JA 1L0ND 3FAPB 1TR2A 5KYXA 5EHHA 2NPUA 1HJBA 3HUSC 1BCCG 3AE3C 1Z5ZA 3FXEA 3H2VA 4ZNCA 4P6IC 4OGQD 1KB9E 3L72E 4YN0B 1T3UA 1PIXA 3II6A 4AE4B 1XTCC 4HJGH 2E76C 2KUBA 2QJPB 4WGYA 4D6TE 3CWBE 4YT4A 3EHNA 4LLCA 1IK7A 1HTLC 4KNVA 1NFOA 1NU7D 3SWFA 2LXBA 1IFNA 1H6GA 5FZTA 2XLEA 3KPHA 5JUAA 5CCHA 2PF4E 4E17A 2PFDA 2J7PD 1OW7A 3L70G 4RKUJ 2R9RB 3L72J 1M90Q 3NDBB 2Y9ZA 4GOFA 3MZWB 1X22A 1SQPK 3CWBJ 3A5TA 5DQZA 3KMIA 1M2OA 2H7OA 2H8AA 1FZEA 3SWYA 2ZYDA 2E42A 1ZR2A 4DVYP 4JYBA 1WMKA 3BRVB 4JPZB 1K05A 1Q2NA 4IFMA 1A41A 3IEEA 1DEBA 4LGDE 2KSFA 1LNQA 1ZV8A 2CNWA 1J1DC 5APUA 3RH3A 3LW5H 3T6BA 4CS9A 2R7WA 3B5NB 2IYPA 2G8YA 2ZJSE 3ZQVA 2N1TB 3OAKA 4YL3A 4C7OA 5AVUB 1N7SD 1L4AB 1ZW2A 3S4RA 1ZHTA 5BU8B 3H32A 2QTVA 1FZGA 5E33A 2WQYC 3PH0A 5AVQB 4RBNA 2R7VA 3HRNA 1KILC 1U6HA 2W4MA 5AVXB 1OCRC 4C7NA 5H2FH 4YPCA 4DXWA 3R7CA 2EINC 3HNJA 4JIOA 5APYA 1VQPP 3ASNC 2QLAA 1FZCB 1EXIA 2D2CD 1NSGB 2YKQA 4ZMDA 3L71E 3A0HH 4O7GA 3RKOF 5B3IA 1LS1A 3FAJA 4U5GA 2IX7C 5F28E 2Q3EA 1TWAA 1NTMD 1YYCA 1BR2A 1NLXA 2BE5F 5L0IA 1JY2P 2GAQA 1QL1A 2K1AA 1S5LE 2EILC 3TJ6A 3D70A 5L8RJ 3JTLO 3S28A 1GQAA 1QQ3A 1EC5A 1EZVG 1SQBE 2Q1KA 3V2NA 3L71J 1VQ8P 3WAQA 2Q9IA 4CSAC 2W45A 3G4ZA 1SS1A 2DW3A 4YXWH 3PRJA 1LVKA 2EPOA 1YJNP 1JPJA 2Y3BA 1W5CE 3G9RA 2GUSA 3A7OA 3L8IA 5CIVA 2A45G 3CD6P 3EFFK 4W7YA 1VF5C 1AFOA 3ZDMA 4QI2A 1SQBJ 2M3BA 2BEQD 3O6QB 1MMDA 1C03A 4U5HA 3B5ND 1L0LG 1R5LA 2QJYC 5E3CA 1G4WR 3L74D 3AJMA 3FVYA 1PD1A 1BE3D 2XXAB 1L4AD 5K0IA 3FX0A 4NTBA 2MHRA 3A3YB 2R03A 4OVNF 4EOTA 3C8ZA 2W83C 4GOEA 2HLOA 3LS1A 2P67A 4FWVA 2Y3HA 2AEMA 1NTZD 4H54A 4DVZA 1RH5B 1SQVK 1ZN5A 3L75G 3KL4A 2VASA 1U57A 3Q5SA 3KKBA 2IDBA 4PK4A 3IQTA 1LTAC 2JDIH 4UB6E 1R4TA 2PNOA 1AUEA 3L35A 2EPKX 1MZ9A 2KQ9A 4EIJA 4I1LA 2YL0A 4B6IA 4BJ6A 2A06D 3MUDC 4HKZH 4MN4C 4CPGA 1LTJB 5C39A 1JCCA 3U8VA 3U5SA 2KS1A 2IBZD 1MMAA 4ZLCA 2KP8A 1LGHB 1LE4A 1ZHYA 1L0NG 3D71A 3CC4P 3VP9A 3CI9A 4RD9A 4H44B 2EPNA 1RF1B 2GUVA 1JPNA 1ZMEC 3H1IE 3FOPA 1JCDA 3GW6A 2ZXXA 4W8KA 5KYWB 2E74B 1YVIA 3CEXA 1DOVA 5KAFH 2EPLX 3AEDC 5KYXB 1KTMA 4U5EE 3CC2P 1BDCA 4I7ZB 2E75B 1E84A 4XA4A 2HPCA 2XRHA 3GEEA 5AW1B 3MHVA 1FNTc 3H1IJ 3W68A 4YJWA 2K37A 4ONSA 2HG5D 1JNMA 4H0LB 1NOHA 3AEBC 2Q5UA 5B66E 4DRIB 3S29A 4EKWA 1BSNA 1PGQA 3NYLA 4HFKB 3LIDA 4MVQA 1ZOYC 4OWFA 3AGTA 3DM5A 1YYXA 1J1EB 1KQFB 1HW2A 2AP3A 1USEA 4ZLDA 1VQ7P 1OVUA 3ZDLA 1NFNA 4HYTB 4IOIH 3B71A 1YJ9P 3DD7A 2YIUB 2ZAEB 2Y39A 3V5ZA 1PCXA 4N06A 3SYNA 2QIWA 3I56P 4K0DA 3IR9A 5AVYB 4C3BA 3MP7B 1KB9H 1RF0A 2DGJA 2R3CA 2G62A 3L8JA 1YQ4C 1T6AA 3MIWA 4AYCA 3L73D 3TNUA 1R8EA 2Q9AA 1SQQE 3H1LE 3VM6A 4NPDA 2QEXP 3RVZA 5KLVE 2XM0A 1BBHA 3SEOA 5KLIC 3SP1A 2R32A 4PJMA 3NG1A 5BQIA 1Y9BA 2IM8A 1KYOE 2OCCC 4C7OB 2KIKA 3JCUE 3L34A 4PD4E 1WT6A 3H32B 3LJBA 1FMVA 1SQQJ 2NPSA 4H44D 4XE5B 3JYHA 5KLVJ 1P84E 5AW9B 5BVZA 1T8ZA 2E74D 4W7ZA 2Z5IA 3GF3A 1CGNA 1HE9A 1KNYA 4J32B 2PP6A 4C7NB 3CSKA 2E75D 4JBZA 1M57C 1T6IA 1L0LK 3QH9A 1NTMG 2YEVA 2YQYA 3UNGC 3N4XA 2MWQA 4NY3A 1BGYJ 2QY9A 3M9BA 3ZQYA 4OGQC 4H0LD 3WUUA 1VQ6P 4IARA 2Q3IA 4LC1A 1T6UA 2VC9A 4CS7A 256BA 3GF7A 1MKMA 1NTKE 1S7ZA 2L6GA 3M4CA 4E7SA 1Y47A 1LWUA 1GD2E 4PFPA 4G78A 5CCHD 1MQVA 4NQFA 5GPGB 4I1OB 3QZCA 1RE4C 3RBXA 1DEEG 5HSWA 5AW7B 2ZVNB 2YKOA 1D0ZA 3V7OA 5CCGA 1GU5A 4YXDC 1TWGA 1KFMA 1ZR4A 1FOSE 4RESB 3J06A 2FXMA 1JY2N 3L74G 1N2DC 1Q90D 4AL1A 5EFWB 4E0IA 3N24A 1GL2D 1BE3G 1Q82Q 4AUWA 1L0NK 3Q5PA 2CNWD 4B86A 3NYJA 1IFDA 2XZRA 1VLTA 1S5LH 1NHLA 2C9NY 1FAPB 1NTZG 1SQVD 1VL2A 2UWJE 3CCLP 1NKZB 1E86A 1USDA 4GQHA 1N7SC 2HR3A 3B9QA 2BCCD 2OYHA 5B5EH 1HUCA 5KKZC 1D0XA 1PV3A 5F5FA 5FCLA 3CCUP 2A06G 2I8DA 3GG2A 3NTNA 2GDCA 1H88A 2J45A 1M1JC 2B88A 1NVOA 2IBZG 4HEAJ 4O79A 4NPFX 3BVHA 1A0BA 1E85A 2WTYA 3WUTA 1FDIA 4JCHA 3W67A 4XQ1A 1N1CA 1U7MA 2O9XA 1BR1A 1OW8A 1EQ1A 1HW1A 2YL1A 2FAPB 3I4UA 2QJPC 1TWCA 3ZIBA 1GU4A 3IQ6A 2FYUK 1JY2O 1HGZA 2QE9A 1KB9D 3L72D 3G50A 2RMZA 3CWBD 3AE1C 4EBJA 3KDPB
chains in the Genus database with same CATH topology
3AE3C 3AEDC 1KTMA 1OMIA 4I7ZB 4KT0J 2E75B 3GF7A 3JYYA 3RQGA 1MKMA 4XFJA 4OGQD 2L6GA 3D70A 3GLMA 5L8RJ 1PIXA 4Z1MH 2D2CC 3IAOA 2E76C 1FDOA 2YIUC 3IN6A 1WOLA 3C8VA 2YWAA 1VF5D 1IK7A 4H13B 3AECC 2YMKA 1DIPA 3Q1MA 4NQFA 2G3AA 4YTPC 4PV1C 4H0LB 2QSIA 3AEBC 3GMAA 3D6YA 1ZZPA 1HJ0A 2JX0A 2K9YA 2ZT9D 1KORA 1ZOYC 4OGQB 4PV1D 4YXDC 3C18A 3Q3DA 3SFEC 1PL5A 2V7QJ 2O01J 3RL0g 1RQUA 1OW7A 3AEEC 3G9RA 4RKUJ 1KQFB 3L8IA 2LK4A 1Q90D 1RQVA 4R4LA 1VF5C 2FBWC 3O6QA 2D2CB 3B71A 2E76B 1JOGA 2L6HA 3MFNA 3AE4C 3C8GD 4IL6X 2BEQD 3AE8C 1NGMB 1UIXA 1NYHA 3S9OA 2QJKC 3Q5PA 2Q00A 2QJYC 3LW5J 2JO1A 2QIWA 3O10A 1WMKA 2ZT9C 4PV1B 1K05A 3AJMA 3FGAD 3ABVC 3L8JA 3AE5C 1VL2A 1YQ4C 2J5UA 1KQGB 2WPVB 1EXJA 3RK3E 3C8GA 1R8EA 4XEVA 3EWKA 1WWPA 1S1CX 3C8GB 5KLIC 3D6ZA 4R4MA 3AE2C 3BRJA 2G8YA 1VF5B 1HF9A 1K04A 5KKZC 1PV3A 3AE6C 2BEZF 3AE9C 2JPUA 1Y9BA 1S5LX 1U57A 2JP3A 2PBEA 3R4YA 3Q5SA 4H44C 2IDBA 2ZT9B 3RQFA 1DD3A 3AEGC 2H89C 1WTYA 5M1BA 1V4AA 2NZ2A 2WQYC 2WSEJ 4XEKA 3TULA 3AEFC 1KILE 2KK1A 3GM2A 2E74C 3RQEA 1DD4A 4H44D 2P10A 1AJYA 3GM3A 1FDIA 3U3FA 3JZ0A 4R32A 2HSBA 4EBKA 1ZRTE 4I7ZC 1OW6A 2E75C 2E74D 2FXPA 3GF3A 1KNYA 1OW8A 3T97B 1TU3F 2WSFJ 1QVXA 1UFBA 2L6FA 2H88C 1ZP0C 3GM1A 4XEFA 1KMIZ 3Q2YA 2QJPC 1GMJA 3D71A 2E75D 3K7DA 4GDOA 2FYNC 4H13C 4U7JA 1K40A 2MKVA 4H44B 2OQQA 2D2CD 1JB0J 3AEAC 4TT3H 2E76D 1EXIA 1ZMEC 4H0LC 3H25A 3SFDC 2WSCJ 1YQ3C 3AE7C 4H13D 4Y28J 2E74B 1O3UA 4EBJA 3AE1C 3U0CA 4OGQC 3Q5RA 5F28E 4H0LD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE3 C;  3AED C;  1KTM A;  3JYY A;  3RQG A;  2L6G A;  1WOL A;  2YWA A;  4NQF A;  3AEC C;  2G3A A;  4YTP C;  3AEB C;  1ZZP A;  2JX0 A;  4YXD C;  1ZOY C;  3C18 A;  3SFE C;  1OW7 A;  3AEE C;  3L8I A;  2LK4 A;  2FBW C;  3B71 A;  1JOG A;  2L6H A;  3MFN A;  3AE4 C;  3C8G D;  3AE8 C;  3S9O A;  2Q00 A;  3O10 A;  1K05 A;  3AJM A;  3ABV C;  3L8J A;  3AE5 C;  1YQ4 C;  3C8G A;  4XEV A;  1WWP A;  3C8G B;  3AE2 C;  3BRJ A;  1K04 A;  1PV3 A;  3AE6 C;  3AE9 C;  2JPU A;  2PBE A;  3RQF A;  3AEG C;  2H89 C;  1WTY A;  4XEK A;  1V4A A;  3TUL A;  2WQY C;  3AEF C;  2KK1 A;  3GM2 A;  3RQE A;  3GM3 A;  3U3F A;  3JZ0 A;  4R32 A;  2HSB A;  4EBK A;  1OW6 A;  1KNY A;  1OW8 A;  1UFB A;  1QVX A;  2L6F A;  2H88 C;  1ZP0 C;  3GM1 A;  4XEF A;  3K7D A;  1K40 A;  3AEA C;  3SFD C;  1YQ3 C;  3AE7 C;  1O3U A;  3U0C A;  3AE1 C;  5F28 E;  4EBJ A; 
#chains in the Genus database with same CATH topology
 1JMW A;  3DXJ F;  2P6V A;  4RJT A;  4OIR F;  3CCV P;  3KYQ A;  2LSE A;  3PDM P;  1FDO A;  1AQT A;  3SSU A;  1JR8 A;  1YAR O;  2HPC B;  1DIP A;  3B29 A;  4KI2 A;  1ORS C;  1W2B O;  1AVO A;  1IFI A;  3FHD A;  4LDR A;  2VB6 A;  4JCZ A;  3JSE O;  2WVN A;  3G71 P;  2JX0 A;  4JTA B;  1WAS A;  4K3A A;  3AEE C;  1VTM P;  3KZI E;  3B5N C;  2XKM A;  1NKN A;  4N3Y B;  2N1T C;  2KB7 P;  3WU2 E;  2KNC A;  3AE8 C;  4BXL A;  3L73 G;  1L4A C;  1J2J B;  1S9K E;  2JO1 A;  2KJG A;  5AW8 B;  2HMQ A;  1NTM K;  1YHQ P;  2XDJ A;  3MD0 A;  1LJ2 A;  3HLZ A;  3B8E B;  3EGX A;  2P7J A;  3TF5 A;  3V5Y A;  3W2V A;  1PGJ A;  4MTO A;  3BRT B;  1SQQ K;  3M1C B;  4CJG A;  5B66 H;  1W2W A;  2KLU A;  2JD3 A;  2ETS A;  2V3C C;  4HFF B;  4JZA A;  2IFN A;  4IJJ A;  1LTT C;  1NU1 E;  2E5T A;  4Z9I A;  3ZC4 A;  4WWI A;  3WUV A;  3JCU Q;  1FZC C;  1DD3 A;  4JC7 A;  1VYK A;  2J0X A;  2WSE J;  4W80 A;  3MYF A;  1KIL E;  1CZQ A;  2FYZ A;  1TFK B;  2DB4 A;  1BZ4 A;  4CIH A;  1FJP A;  2P10 A;  3MTU E;  2N9Y B;  3U3F A;  4YL0 A;  2NPS B;  1L7C A;  3SWK A;  2HSB A;  1KQS O;  1ZRT E;  2PX3 A;  3L71 D;  4PJJ A;  3LLI A;  2AWY A;  5KYU A;  2Q6Q A;  1NU1 J;  1HE1 A;  2RSE B;  1QL2 A;  2O3J A;  2AEJ A;  3U9J A;  4GDO A;  3CCQ P;  4PD4 I;  4XLP F;  3M15 A;  4HH2 A;  3U1C A;  4IRU A;  2EIJ C;  5IY5 C;  4XTK A;  1NTZ K;  4K35 A;  4Y28 J;  4JEA A;  3H1K J;  1BCC E;  4QI0 A;  4PJ0 H;  4U3F J;  1SQB D;  1KYO H;  1JRA A;  2AU5 A;  2XLO A;  2WZG A;  3JCU H;  4DCK A;  3M0D C;  1QSP A;  2B0H A;  1EDI A;  1G8X A;  3UGP A;  2KI7 B;  3V5B A;  4DZO A;  3W2W A;  1FS0 E;  3GAN A;  2W90 A;  1P84 H;  3H1H E;  4CDA A;  1JAF A;  2YZS A;  1IFP A;  1LWU B;  2YMK A;  2GFH A;  5JT4 A;  2G3A A;  2R7R A;  3RVY A;  3FWL A;  2LFF A;  2XL8 A;  1BCC J;  1A7E A;  4O6Y A;  3LEV A;  4CDV A;  1T01 A;  2ZT9 D;  3H1J J;  2L91 A;  3LIE A;  1NZE A;  3X1O A;  1U89 A;  3CX5 H;  3P32 A;  3P8C D;  5AW6 B;  3KHU A;  1OQC A;  1APC A;  3H1H J;  3G6E P;  4K1O A;  1SQV G;  2D2C B;  3E9V A;  1HH0 A;  4BPM A;  1ZHW A;  3ZWI A;  2V26 A;  4GIF A;  4WJ0 A;  1Y8A A;  3W8I A;  1JEK A;  1T5O A;  3IPM O;  5TIS E;  5A6B A;  4GKG A;  2BCC G;  4JKV A;  3RK3 E;  4OIN F;  3QMK A;  3UMK A;  4IGG A;  3CC7 P;  1LT1 A;  1ZXG A;  2W6B A;  1LTJ C;  4M3L A;  4X0R A;  5T1D B;  2Y0D A;  5CJ0 A;  1OCO C;  1Z7Q c;  1OXZ A;  1KD1 Q;  2YO2 A;  1HF9 A;  1CSB A;  1G2C A;  1JUN A;  2XLW A;  2NPS D;  4D6T J;  3AE9 C;  2OYH B;  1GZL A;  4H44 C;  1RF1 C;  2YLD A;  2M64 A;  1FTS A;  1Z3I X;  1M2V A;  5L0F A;  3M91 A;  2E74 C;  1GL2 A;  1HBW A;  1Z6A A;  4CX9 A;  2FYU D;  4GOD A;  5T3T A;  1A7D A;  1RCP A;  2W6A A;  3H1I D;  4I7Z C;  2E75 C;  4BRY A;  1LE2 A;  3L72 G;  3Q2Y A;  3UR3 C;  4O6N A;  3CWB G;  4N78 E;  3L37 A;  1LT9 A;  5DVW A;  1G1J A;  5COF A;  1JB0 J;  3X2Q C;  2L9J A;  2WVR A;  4H0L C;  4DJ9 A;  3FXH A;  3AE7 C;  4WY4 A;  4NC3 A;  2J9W A;  1H8A A;  3M9Q A;  4YT2 A;  1LPE A;  2VH3 A;  3GWN A;  4MTF A;  3T9O A;  2A1D D;  5B1A C;  3SXM A;  1J1E C;  1OR2 A;  3T4R A;  2EIK C;  4BJ5 A;  5CCH C;  4UB8 H;  4JQ0 D;  5CCG D;  3A11 A;  1VOM A;  3IHU A;  1TFO B;  1EZV E;  2YIU C;  3CZ6 A;  4DOZ A;  2A69 F;  4C3D A;  2HFE D;  3C8V A;  1K73 Q;  2YWA A;  3AEC C;  3VMA A;  3LNR A;  3I5C A;  1SQX E;  5JSL A;  2KXP B;  3EQ2 A;  2R7Q A;  3C9I A;  1ZZP A;  1OCZ C;  1AVO B;  4MVZ A;  1SLQ A;  4XPW A;  4EHP A;  2CCY A;  2VRS A;  2ZYA A;  2O1J A;  2YLG A;  5CMZ A;  1M1K Q;  4ZKU A;  3S0X A;  1PL5 A;  2OYI A;  3GHG A;  4DJG A;  3K5B A;  4WB4 A;  2UUI A;  2YL3 A;  2WSC H;  1RKC A;  4CS9 C;  4E0H A;  5KJ7 A;  3V6I A;  1SQQ D;  1SQX J;  1U7J A;  1NYH A;  3PMR A;  1NWQ A;  1VQO P;  2YVK A;  2P7V A;  3ABL C;  2KNC B;  5KLV D;  1X8Y A;  3ZTZ A;  2IYL D;  2ASR A;  2R7T A;  2HV6 A;  3WG7 C;  1S4X A;  2PFX A;  3R2P A;  1EA8 A;  4YWQ A;  5JRA A;  2AVK A;  1JO5 A;  1KYO D;  2XL4 A;  3EGX B;  1HVV A;  3V2R A;  2J46 A;  3TSI A;  1WWP A;  3Q7G A;  1OXB A;  4FES A;  5DS4 A;  2OGU A;  3L75 E;  1A02 J;  3AG3 C;  3AE6 C;  2BEZ F;  2Q9B A;  1AQ5 A;  1GM5 A;  1NU1 K;  1P84 D;  2JPU A;  1BGY D;  2NUT B;  4JVS A;  2QJK B;  5L0D A;  2JP3 A;  3B0U X;  3R4Y A;  4YL1 A;  3KZI H;  2A68 F;  3LEO A;  3AEG C;  3OA7 A;  1MV8 A;  3TYY A;  3L71 G;  1WTY A;  3ZG1 A;  4BG0 A;  1ZU5 A;  2M0B A;  3AEF C;  3WU2 H;  4PJL A;  3U9M A;  2ZVO B;  2M5A A;  3NMI A;  2M8R A;  1RHZ B;  4IFD K;  3CX5 D;  4MS2 A;  3ATP A;  2OU6 A;  4N6J A;  1PGO A;  1GK4 A;  3K1I A;  5DJT B;  1TU3 F;  2WSF J;  3HNL A;  3VAY A;  2B87 B;  3DMD A;  2ITA A;  2A6E F;  2HOD A;  5KYU B;  1Z63 A;  2DYR C;  1ZVZ A;  1SQB G;  4JEB A;  3EPV A;  2HFI A;  1VLS A;  2LIG A;  3TK0 A;  2WL8 A;  4W8P A;  5L0C A;  3TGU E;  2OYO A;  2PGD A;  1VQN P;  4IAO A;  1D0Y A;  3EJN A;  5KYN A;  1OMI A;  2YXQ B;  2IYO A;  3U59 A;  5AVT B;  2ZXO A;  2IBF A;  4ULW A;  2R5B A;  2NG1 A;  4IB4 A;  4H4K C;  2YL7 A;  3RW0 A;  4BWN A;  2G3K A;  3M0A A;  3E1I A;  2FFH A;  3BCC E;  3NRH A;  3CXH I;  3EFO A;  4MVS A;  4ZKP A;  5KAI E;  3TGU J;  1HJ0 A;  3B4S A;  2MJZ A;  4KHX A;  1EKY A;  3I5Q A;  2I15 A;  3Q3D A;  1RXQ A;  2O01 J;  2C0X A;  2E5Y A;  2PX0 A;  3OJA B;  2LK4 A;  3BCC J;  3NFQ A;  3K1I C;  3CLQ A;  1JOG A;  2L6H A;  3Q7L A;  3HNI A;  5AW3 B;  2Y0C A;  4NPE A;  4N4W A;  3AQC A;  2K88 A;  1PP9 D;  2E87 A;  1L2P A;  1LTS C;  2J5U A;  4PAC A;  4LDQ A;  1R5I D;  1M56 D;  3V2Q A;  2KK7 A;  1H0T A;  4FAP B;  3KQG A;  4BJ6 C;  4OIQ F;  2WIT A;  3Q6N A;  1K04 A;  2W9Y A;  3F46 A;  1GS9 A;  3JSV C;  1G2C B;  1ST6 A;  1H9G A;  4G7Z F;  1GK6 A;  5AVS B;  2FYU G;  3H1I G;  4E7Z A;  3QVZ A;  4I3M A;  5JS5 A;  5DS5 A;  3GM2 A;  4Q7C A;  1M2V B;  3AG4 C;  2J59 M;  1WAT A;  4QMA A;  1GL2 B;  1QGK B;  4J30 B;  2W27 A;  5TIS H;  3TOM A;  1IZM A;  1PPJ D;  3HNK A;  4BRY B;  1KU2 A;  3EHM A;  2OG2 A;  2E76 D;  1AVY A;  1B68 A;  1LT9 B;  4I6M C;  2IZ0 A;  2FKW B;  3CPW O;  1OZH A;  3H1L J;  1T9K A;  4WY4 B;  3WMM 0;  2P2U A;  3PP5 A;  2EPM X;  5AGF A;  3BAS A;  4JYC A;  1XZQ A;  4EUK B;  3LS0 A;  5CI9 A;  3EFG A;  3MBG A;  3V2P A;  4IWB A;  1NAF A;  3CCE P;  1Y4C A;  2WPR A;  3GOD A;  3GMA A;  1HY5 A;  4OD5 A;  4BJ1 A;  3U3B A;  1F1M A;  2FXO A;  1RF0 C;  1N7L A;  5T3W A;  1MMN A;  2KSJ A;  1SQQ G;  1S9K D;  2OJE D;  2ZXR A;  2WZL A;  1WN0 A;  2P1A A;  2VCC A;  1X0T A;  4WGZ A;  2H8P D;  1EZV I;  5KLV G;  2OYI B;  1BE3 E;  5A6B D;  3DI5 A;  3GHG B;  3DAG A;  2R7S A;  5AW0 B;  5E2Q A;  1CPR A;  2IXN A;  4IL6 X;  2ZD9 A;  3K66 A;  1UIX A;  3K1H A;  2XSE A;  1SQB K;  3UMI A;  1T3J A;  4JRZ A;  1LIH A;  2KYV A;  2HV7 A;  1SVF A;  3DE8 A;  3TQO A;  3TOL A;  1M7L A;  1NU1 D;  2A45 I;  1RE3 A;  1V54 C;  2VCA A;  3L4F A;  2HKV A;  2NPS C;  1BGY G;  3RK3 B;  1NTK J;  2JEE A;  3CAX A;  3A9C A;  3D6Z A;  2YO3 A;  1KC8 Q;  1ZW3 A;  2HJM A;  1D1A A;  1ZLL A;  2QUP A;  3H1K D;  1J8M F;  2A06 E;  4U3F D;  4CJO A;  1FE6 A;  1ZRT D;  1VQ4 P;  3EZH A;  5L3V A;  1D1C A;  1EDL A;  3H6P A;  2IBZ E;  1LKX A;  3DZA A;  5KYY A;  4L73 A;  2QM8 A;  2CYD A;  2HSQ A;  1IJD B;  2C03 A;  3MX3 A;  3MGN A;  1ORY A;  2M5A B;  4CS8 A;  1OFC X;  4MW8 A;  1YAU O;  4WY4 D;  2DI3 A;  3QVY A;  3T6J A;  5A6K A;  3OW2 O;  1U0B B;  3RL0 B;  3N2Z B;  3K33 A;  1LWU C;  2HOD B;  3H1J D;  1MMG A;  1YLM A;  3E1R A;  2H7H A;  3MLG A;  5BUO A;  3RK2 B;  4DOJ A;  2WSF H;  4A2N B;  3H1H D;  1DOW A;  5CCG C;  1PD0 A;  3RYL A;  3ZSU A;  1YJW P;  4U5B E;  2J9V A;  5DQT A;  3SNH A;  3JC2 2;  1SQP E;  4L75 A;  4XFJ A;  1O87 A;  1Q86 Q;  1JMB A;  3CME P;  2D2C C;  2YRF A;  3F89 A;  5B1B C;  1Q0D A;  1YTZ I;  5APS A;  1VF5 D;  3SXZ A;  3IQ5 A;  1QVF O;  3EFO B;  5HV9 A;  3VOP A;  5CBN A;  1Q81 Q;  1FR0 A;  3U8P A;  1CI6 A;  3QTH A;  5KJ7 D;  2XLM A;  4OIO F;  2RH0 A;  1G1I A;  4D6T D;  2B0J A;  4PR9 A;  1Y6D A;  1D7M A;  1SQP J;  1IFM A;  2OJQ A;  3FMS A;  4YT8 A;  2IFM A;  3G3Z A;  4UB6 H;  4LER A;  4CS8 C;  3P8M C;  2W6J H;  1PP9 G;  2N9B A;  3RK3 D;  2OYH C;  2YKP A;  2O01 H;  2C9L Y;  1FMW A;  2B89 A;  1FFH A;  3FGA D;  3MYI A;  2J9B A;  4DBR A;  2KSE A;  3NMK A;  2O01 N;  4DBQ A;  1EXJ A;  2IOQ A;  4U5C E;  2JR8 A;  2HS5 A;  5KAI H;  3DWW A;  3EG9 A;  1SFC A;  2CPB A;  2AXT E;  1H0T B;  3BRJ A;  2BC5 A;  1QZX A;  3NKD A;  5DJU B;  1ZHX A;  3C1L A;  1RY3 A;  4GT1 A;  3EGD A;  4P9T A;  1Z23 A;  4F4B A;  2XV5 A;  2ZT9 B;  3ABM C;  3RL0 D;  1FU1 A;  1PPJ G;  1NAY A;  2X51 A;  1N73 A;  3RQE A;  4MND A;  4N78 D;  1R5S A;  4CBE A;  4R32 A;  1XWJ A;  1JTH A;  4E18 A;  3HTK A;  3RK2 D;  2FXP A;  5AVV B;  3PLN A;  5KLV K;  1IO4 A;  2L6F A;  2YKZ A;  3ABK C;  2NUT A;  2FFD B;  3SZR A;  4LLH A;  2E43 A;  4Y99 B;  2J8W A;  2KOG A;  2OQQ A;  4TT3 H;  2IXP A;  3OA1 A;  1UII A;  3VYI A;  2KC3 A;  4U5F E;  1O3U A;  1PZQ A;  3UIA A;  3Q5R A;  1RMV A;  3AG2 C;  1SQX D;  1GGQ A;  3RIP A;  2XNX A;  1N8R Q;  2B87 A;  4JUR I;  3S27 A;  3PHF 2;  3HD7 A;  4Z1M H;  2R3S A;  3PHL A;  5DS6 A;  4JJF A;  3DJU B;  4H13 B;  2A0B A;  2IPP A;  4ULV A;  1VYI A;  3F5H A;  2OOC A;  3CXH E;  2AEF A;  3B0V C;  3HUS A;  3E7K A;  2L5G B;  4Q5S F;  1WRG A;  4KBL A;  2R25 A;  3CQZ A;  4U5D E;  3BAT A;  3DJN B;  3ZTM A;  1QX8 A;  2PP4 A;  2V7Q J;  3RL0 g;  2Q7R A;  4IFF A;  4PD4 H;  5CJ4 A;  4IAQ A;  1QEX A;  4R4L A;  1YYJ A;  1JOC A;  1SQV E;  1I5N A;  2YHS A;  2OEX A;  2P58 A;  1NTK K;  5D91 A;  3EH2 A;  3CCM P;  1NU1 G;  5COM A;  2QJK C;  4Z9J A;  4KNW A;  2HZ8 A;  3AG1 C;  5KAF E;  4PV1 B;  1GW3 A;  4A7P A;  1M56 C;  4L6R A;  2I1J A;  4G7O F;  2KYH A;  1E5W A;  3QWO C;  4EDF A;  3C8G A;  2XS1 A;  1E79 H;  3I55 P;  3H1K G;  3L70 E;  1VQM P;  2ICW G;  3KH2 A;  4U3F G;  1SYQ A;  2K9J A;  2OTJ P;  2B9B A;  3CX5 I;  5AVR B;  3GEI A;  1T2K D;  3QW1 A;  3DM9 B;  2IXM A;  5CBO A;  1LI5 A;  1G5Z A;  4U9D A;  2Z5H A;  1BDD A;  3LES A;  2Q7C A;  1BDJ B;  4O9B A;  3VMX A;  1VQK P;  1BSH A;  5M1B A;  3GOR A;  2R05 A;  1M57 D;  2H43 A;  2H7B A;  2KW3 C;  4XLN F;  1ORJ A;  5CI8 A;  1DD4 A;  5KYY B;  3L70 J;  4NTA A;  5GTH E;  2Z4E A;  3H1J G;  4C46 A;  1OW6 A;  2F22 A;  1LTB C;  4YT5 A;  2ZYG A;  5D92 A;  1N86 A;  3FXD A;  2MYS A;  3TGU D;  3B0P A;  1YIT P;  2YXR B;  3H1H G;  2IBZ I;  4C3E A;  3H65 A;  3E70 C;  3AEA C;  2C04 A;  1YQ3 C;  1E2X A;  1CW5 A;  1KIL A;  3BCC D;  4H13 D;  1NG1 A;  3U1A A;  4G0H A;  3S1K A;  3N0T A;  3VRC A;  2XLD A;  1BR4 A;  2DYS C;  1CGM E;  4NTF A;  1YBK A;  2JJL A;  1RJ9 A;  3IF4 A;  3JYY A;  4MVM A;  4AL0 A;  2KNH A;  4J7T A;  1LS4 A;  3IAO A;  1AEP A;  1S2E A;  1URQ B;  2A6H F;  2WT7 B;  1KQL A;  1OWA A;  2FYN B;  1WOL A;  4D6T G;  3Q1M A;  1YDI A;  1FJK A;  2YMY A;  4YTP C;  5AC5 A;  2PAJ A;  3M9H A;  2XL6 A;  1T6Q A;  3U2L A;  1PFI A;  1NBB A;  2XLH A;  5A69 A;  2R7X A;  4PV1 D;  2WVO A;  1CI6 B;  4DRH B;  2Z15 A;  1Q0M A;  1SR2 A;  5AW2 B;  1QVG O;  2FBW C;  5GTI E;  5APX A;  3MFN A;  3AE4 C;  4DT0 A;  4GEH A;  3SXK A;  3RF3 A;  4CSA A;  3S9O A;  4RO0 A;  1K8A Q;  3ABV C;  3AE5 C;  1H9T A;  1YIJ P;  1KQG B;  1NO4 A;  1G4U S;  2Y69 C;  2GWW A;  4XEV A;  2HMZ A;  1GL2 C;  1S1C X;  1E83 A;  3DAF A;  3EG9 B;  3P7K A;  4XWJ A;  1SFC B;  1LM3 B;  1I4Y A;  3ECS A;  1L0L E;  5DLJ A;  3H1L D;  2PBE A;  3Q6M A;  1LP1 A;  3EGD B;  3U2M A;  1LT9 C;  1GW4 A;  4WBA A;  2NZ2 A;  1Z56 A;  2OKU A;  1AJY A;  2LR2 A;  3GM3 A;  4WY4 C;  3VYW A;  1FZA A;  4OIP F;  1N73 B;  3FOO A;  2M4E A;  1HMO A;  1JTH B;  4IL6 E;  4PD4 D;  2ZXW C;  4OH8 B;  3HTK B;  1VQ5 P;  3GM1 A;  4BJ5 C;  1KMI Z;  1L0L J;  1GMJ A;  2R7O A;  4CIP A;  2R02 A;  1ZHZ A;  4LDK A;  4U7J A;  2MKV A;  2AXT H;  1SQX G;  1Q0K A;  1URQ D;  2J58 A;  3MUD A;  5B5E E;  3EQL F;  3TD7 A;  3DE9 A;  1JY3 P;  4ANJ A;  4D4N A;  3F47 A;  1VPC A;  2QG4 A;  2WZF A;  3VF0 A;  2LXC B;  3L75 J;  2OYI C;  1WGW A;  3I5P A;  5TJ5 E;  3GLM A;  3GHG C;  2WSE H;  1L0N E;  2AWC A;  3JT1 A;  3HD7 B;  5KJ7 C;  3DKA A;  5L0G A;  2N1T D;  3P8C E;  1TWH A;  3O39 A;  3CL3 D;  3UGO A;  2QSI A;  3D6Y A;  1NTK D;  3NMD A;  1H89 A;  4JTD B;  1S72 P;  4CDY A;  1KN7 A;  2KZI A;  3HUS B;  4Z9H A;  3RK3 C;  1RQU A;  1UG7 A;  2P0N A;  2J9U A;  4MVR A;  1RQV A;  1L0N J;  4BEM J;  3KPE A;  1AV1 A;  3A2A A;  1YZA A;  2E76 B;  2R7U A;  2KGO A;  4L76 A;  1SFC D;  2NUP A;  2V7Q H;  3KYI A;  2CDQ A;  2JKV A;  1OKK D;  5APW A;  1L3P A;  4EYY Q;  1I4Z A;  1RKE A;  2WPV B;  1CGO A;  4LAC B;  1VB5 A;  2H7V C;  4HB1 A;  2IZ1 A;  4BJT A;  3WHN A;  3LAY A;  3CXH H;  3AGU A;  2IXO A;  3C8G B;  5A6A A;  4K7B A;  5B3S C;  4I2L C;  1TKN A;  1MFZ A;  2Y3D A;  1C02 A;  2Q9C A;  1QLE D;  2K9J B;  3V5X A;  3RL0 C;  4DRJ B;  2FYU E;  3TK1 A;  2SPZ A;  1K9M Q;  1GDT A;  3UMH A;  1PGP A;  4JF7 A;  1KZU B;  5EK0 A;  3RK2 C;  3TGU G;  4XPY A;  2WZ7 A;  4AK9 A;  4EIY A;  1J1D B;  3T97 A;  1OXK A;  5AVZ B;  3ITK A;  1O5H A;  1NJI Q;  5A6J A;  2D5R B;  4XEF A;  2LFD A;  2FYU J;  1A7V A;  3C7J A;  3BCC G;  2ZXE B;  2ZXP A;  4TLF A;  4UDV A;  1FFT C;  1SMY F;  1K40 A;  1SQP D;  2A0U A;  4U9E A;  4D4X A;  1FZF A;  2LP4 A;  1FZB A;  1QKR A;  2WPS A;  3HD7 D;  3VTP C;  3U0C A;  1VK5 A;  1IW7 F;  1V55 C;  1KIL B;  2XM4 A;  1KB9 I;  5E3A A;  2EIM C;  4MVO A;  2RKL A;  5L0H A;  2LQG A;  1YTZ T;  3M79 A;  2FFD A;  4NCQ A;  2HYN A;  1RJ9 B;  2Y3G A;  5GTH H;  3AOU A;  3KXD A;  3HE4 A;  1Q0G A;  5AW4 B;  1HWT C;  1NTM E;  1LTI C;  2LCH A;  4JJG A;  2Q4F A;  3ZVR A;  2QA4 P;  1AA0 A;  2NSF A;  3VN0 A;  3TJ5 A;  1MUU A;  3C18 A;  3A0B E;  2OTK E;  5L3Q A;  2W8Z A;  2POH A;  3OWT A;  4OD4 A;  5COG A;  3BEH A;  1VDF A;  1EDJ A;  2R5D A;  1CPQ A;  3L0I A;  3N7N A;  3C8G D;  4PJ0 E;  1NTM J;  1RE4 A;  2ZFC A;  1XZP A;  2ZT9 C;  2J7P A;  1X9V A;  2YNY A;  4C7R A;  4LLE A;  4YK5 A;  1SQX K;  4JW1 A;  3L1M A;  4I44 A;  4EI2 A;  3IFM A;  2QM7 A;  1BGY E;  2OEV A;  3EWK A;  1T2K C;  3H1L G;  2NRG A;  3L74 E;  4JTC B;  3WOD F;  1IK9 A;  3FDQ A;  4R4M A;  1A02 F;  1VF5 B;  5KTB A;  2QE7 H;  2FFD C;  2QVA A;  5E79 E;  3C62 A;  3HE5 A;  1KV4 A;  1HMD A;  1S5L X;  2J0W A;  2QJY B;  4Y99 C;  3CX5 E;  3SXY A;  5GTI H;  1NTZ E;  1V4A A;  1LP1 B;  2JWD A;  2KK1 A;  2VCB A;  5BQG A;  3RGU A;  3L74 J;  1N7S A;  3JZ0 A;  1EQ7 A;  4EBK A;  1BE3 J;  4MTG A;  2WPQ A;  1OVR A;  1IZN B;  4KC9 A;  3EH1 A;  3S84 A;  2H88 C;  1KIL D;  1ZP0 C;  1MND A;  1DH3 A;  3T6G B;  1S05 A;  4MQ9 F;  1J8Y F;  4O6M A;  4H13 C;  2A45 H;  1XTG B;  1OVV A;  3VMZ A;  1NTZ J;  3NKE A;  1M1J A;  3C63 A;  5JLI A;  1Q0F A;  4P9F A;  2R44 A;  2CGE A;  2GA0 A;  1HGV A;  2I8B A;  1EDK A;  1YA7 O;  3PJS K;  4WVZ A;  2K3R A;  4A4A A;  3CCR P;  1OIP A;  3CXH D;  4KT0 J;  3POV A;  4AE4 A;  3RFY A;  4GYT A;  3PTZ A;  5K5G B;  2O1K A;  1FBM A;  2WB7 A;  3ASO C;  1NTK G;  1Q7Y Q;  1TQG A;  1BCC D;  2C0W A;  2OQM A;  3VMY A;  3GEH A;  1YI2 P;  4IL6 H;  2XS8 A;  2NSG A;  4PV1 C;  2OAR A;  3W8H A;  2P1J A;  1S3J A;  3S90 A;  3OEO A;  2K9Y A;  3LLK A;  5AW5 B;  1KOR A;  2Y0E A;  3M06 A;  1JY3 N;  3SFE C;  1RE3 C;  3JRM O;  1OR3 A;  2WSS H;  4J7Y A;  4G7H F;  1PP9 E;  1URQ A;  2WT7 A;  1DX7 A;  1VQL P;  1FDM A;  3JSZ A;  3L70 D;  3LW5 J;  2G3V A;  4HE8 D;  2WMM A;  2XU6 A;  3USS A;  4UB8 E;  5APT A;  2NUP B;  1SZI A;  3JRT A;  2XND H;  4ASV A;  5BU5 A;  2XLV A;  3HJC A;  5H2F E;  2CPS A;  5APV A;  3M4B A;  1MFT A;  1RKE B;  1PP9 J;  3B5N A;  1VQ9 P;  1EI7 A;  2M3E A;  3AQB A;  2N1T A;  3TDK A;  4PJN A;  1IC2 A;  5AVW B;  3A0H E;  3US6 A;  2ZPA A;  1L4A A;  2KS1 B;  3IQC A;  2JWA A;  3L73 E;  2LKM A;  4XPX A;  3G4S P;  2TMV P;  5AC4 A;  4KJM A;  2FY8 A;  1YJG A;  3TUL A;  1PPJ E;  5TJH A;  4AX2 A;  4WAB A;  1KFN A;  1QPU A;  2L81 A;  3QW0 A;  4MW3 A;  5KLI B;  3NMJ A;  1SQP G;  4L74 A;  2GA1 A;  3T97 B;  1OKK A;  1UFB A;  2X0C A;  5F5H A;  1ZYR F;  3L73 J;  2P61 A;  1URQ C;  2HJ3 A;  1FZC A;  3V4Q A;  3K6B A;  3K7D A;  2LD6 A;  2FYN C;  1JY3 O;  2PRR A;  1D1B A;  3EZI A;  2Q3T A;  4EBB A;  4Q4Z F;  4RDA A;  3SFD C;  2WSC J;  3GWL A;  3H2U A;  2QNL A;  5CHX A;  4PFO A;  2L7A A;  1VMA A;  3CMA P;  1GTW A;  3RQG A;  1SF8 A;  4ER9 A;  4EWC A;  3HKK A;  3NYM A;  1M6T A;  3IN6 A;  2HUJ A;  2GM4 A;  3VP8 A;  2WWW A;  1W2E A;  2RN0 A;  3FWN A;  1H7I A;  2RD9 A;  4MVU A;  2D4U A;  3HE4 B;  4FX5 A;  3RBZ A;  1SP4 A;  3LNM B;  2KZJ A;  1ZW0 A;  1EZV D;  3M0D A;  4OGQ B;  3TNU B;  1LTG C;  1FC2 C;  3V4W A;  2CW0 F;  1SFC C;  3NXS A;  3ITF A;  3O6Q A;  2BAS A;  2V4H A;  1LI7 A;  1YA9 A;  1NGM B;  1X79 B;  2Q00 A;  1OX3 A;  3G4X A;  3O10 A;  2XXA A;  2I1K A;  2BL2 A;  3LUT B;  1JM0 A;  1NU9 C;  4I1M A;  1M8O B;  1L0L D;  3H1K E;  1NH4 A;  4U3F E;  1MNE A;  1N73 C;  4N6H A;  2Y9Y A;  1QLE C;  3KYJ A;  4JE9 A;  3W4Y A;  3AE2 C;  1KYO I;  3HTK C;  2FGY A;  4M63 A;  5JP7 A;  5EGY A;  3A0B H;  1OCC C;  1YZC A;  3PCV A;  3O55 A;  3HE5 B;  3RQF A;  2QRX A;  2W4B A;  2H89 C;  3CCS P;  4ASW A;  1ZU4 A;  5BQH A;  4AQR D;  1P84 I;  4XEK A;  1FOS F;  2WVQ A;  2AXC A;  2BCC E;  3L75 D;  1C17 M;  2KLV A;  1LTJ A;  3CCJ P;  1V74 B;  3H1J E;  2CK3 H;  3O6X A;  1N7S B;  1SQV J;  4BEJ A;  2OTL P;  3L36 A;  5APQ A;  1QVX A;  5KKZ B;  4N6C A;  1RF1 A;  3O8Z A;  3HD7 C;  1JMM A;  2BCC J;  3H25 A;  2YLI A;  2UUH A;  5KYW A;  5JVE A;  1IFJ A;  4QDL A;  1M1J B;  1FAV A;  5E79 H;  5L0J A;  1L0N D;  3FAP B;  1TR2 A;  5KYX A;  5EHH A;  2NPU A;  1HJB A;  3HUS C;  1BCC G;  3AE3 C;  1Z5Z A;  3FXE A;  3H2V A;  4ZNC A;  4P6I C;  4OGQ D;  1KB9 E;  3L72 E;  4YN0 B;  1T3U A;  1PIX A;  3II6 A;  4AE4 B;  1XTC C;  4HJG H;  2E76 C;  2KUB A;  2QJP B;  4WGY A;  4D6T E;  3CWB E;  4YT4 A;  3EHN A;  4LLC A;  1IK7 A;  1HTL C;  4KNV A;  1NFO A;  1NU7 D;  3SWF A;  2LXB A;  1IFN A;  1H6G A;  5FZT A;  2XLE A;  3KPH A;  5JUA A;  5CCH A;  2PF4 E;  4E17 A;  2PFD A;  2J7P D;  1OW7 A;  3L70 G;  4RKU J;  2R9R B;  3L72 J;  1M90 Q;  3NDB B;  2Y9Z A;  4GOF A;  3MZW B;  1X22 A;  1SQP K;  3CWB J;  3A5T A;  5DQZ A;  3KMI A;  1M2O A;  2H7O A;  2H8A A;  1FZE A;  3SWY A;  2ZYD A;  2E42 A;  1ZR2 A;  4DVY P;  4JYB A;  1WMK A;  3BRV B;  4JPZ B;  1K05 A;  1Q2N A;  4IFM A;  1A41 A;  3IEE A;  1DEB A;  4LGD E;  2KSF A;  1LNQ A;  1ZV8 A;  2CNW A;  1J1D C;  5APU A;  3RH3 A;  3LW5 H;  3T6B A;  4CS9 A;  2R7W A;  3B5N B;  2IYP A;  2G8Y A;  2ZJS E;  3ZQV A;  2N1T B;  3OAK A;  4YL3 A;  4C7O A;  5AVU B;  1N7S D;  1L4A B;  1ZW2 A;  3S4R A;  1ZHT A;  5BU8 B;  3H32 A;  2QTV A;  1FZG A;  5E33 A;  2WQY C;  3PH0 A;  5AVQ B;  4RBN A;  2R7V A;  3HRN A;  1KIL C;  1U6H A;  2W4M A;  5AVX B;  1OCR C;  4C7N A;  5H2F H;  4YPC A;  4DXW A;  3R7C A;  2EIN C;  3HNJ A;  4JIO A;  5APY A;  1VQP P;  3ASN C;  2QLA A;  1FZC B;  1EXI A;  2D2C D;  1NSG B;  2YKQ A;  4ZMD A;  3L71 E;  3A0H H;  4O7G A;  3RKO F;  5B3I A;  1LS1 A;  3FAJ A;  4U5G A;  2IX7 C;  5F28 E;  2Q3E A;  1TWA A;  1NTM D;  1YYC A;  1BR2 A;  1NLX A;  2BE5 F;  5L0I A;  1JY2 P;  2GAQ A;  1QL1 A;  2K1A A;  1S5L E;  2EIL C;  3TJ6 A;  3D70 A;  5L8R J;  3JTL O;  3S28 A;  1GQA A;  1QQ3 A;  1EC5 A;  1EZV G;  1SQB E;  2Q1K A;  3V2N A;  3L71 J;  1VQ8 P;  3WAQ A;  2Q9I A;  4CSA C;  2W45 A;  3G4Z A;  1SS1 A;  2DW3 A;  4YXW H;  3PRJ A;  1LVK A;  2EPO A;  1YJN P;  1JPJ A;  2Y3B A;  1W5C E;  3G9R A;  2GUS A;  3A7O A;  3L8I A;  5CIV A;  2A45 G;  3CD6 P;  3EFF K;  4W7Y A;  1VF5 C;  1AFO A;  3ZDM A;  4QI2 A;  1SQB J;  2M3B A;  2BEQ D;  3O6Q B;  1MMD A;  1C03 A;  4U5H A;  3B5N D;  1L0L G;  1R5L A;  2QJY C;  5E3C A;  1G4W R;  3L74 D;  3AJM A;  3FVY A;  1PD1 A;  1BE3 D;  2XXA B;  1L4A D;  5K0I A;  3FX0 A;  4NTB A;  2MHR A;  3A3Y B;  2R03 A;  4OVN F;  4EOT A;  3C8Z A;  2W83 C;  4GOE A;  2HLO A;  3LS1 A;  2P67 A;  4FWV A;  2Y3H A;  2AEM A;  1NTZ D;  4H54 A;  4DVZ A;  1RH5 B;  1SQV K;  1ZN5 A;  3L75 G;  3KL4 A;  2VAS A;  1U57 A;  3Q5S A;  3KKB A;  2IDB A;  4PK4 A;  3IQT A;  1LTA C;  2JDI H;  4UB6 E;  1R4T A;  2PNO A;  1AUE A;  3L35 A;  2EPK X;  1MZ9 A;  2KQ9 A;  4EIJ A;  4I1L A;  2YL0 A;  4B6I A;  4BJ6 A;  2A06 D;  3MUD C;  4HKZ H;  4MN4 C;  4CPG A;  1LTJ B;  5C39 A;  1JCC A;  3U8V A;  3U5S A;  2KS1 A;  2IBZ D;  1MMA A;  4ZLC A;  2KP8 A;  1LGH B;  1LE4 A;  1ZHY A;  1L0N G;  3D71 A;  3CC4 P;  3VP9 A;  3CI9 A;  4RD9 A;  4H44 B;  2EPN A;  1RF1 B;  2GUV A;  1JPN A;  1ZME C;  3H1I E;  3FOP A;  1JCD A;  3GW6 A;  2ZXX A;  4W8K A;  5KYW B;  2E74 B;  1YVI A;  3CEX A;  1DOV A;  5KAF H;  2EPL X;  3AED C;  5KYX B;  1KTM A;  4U5E E;  3CC2 P;  1BDC A;  4I7Z B;  2E75 B;  1E84 A;  4XA4 A;  2HPC A;  2XRH A;  3GEE A;  5AW1 B;  3MHV A;  1FNT c;  3H1I J;  3W68 A;  4YJW A;  2K37 A;  4ONS A;  2HG5 D;  1JNM A;  4H0L B;  1NOH A;  3AEB C;  2Q5U A;  5B66 E;  4DRI B;  3S29 A;  4EKW A;  1BSN A;  1PGQ A;  3NYL A;  4HFK B;  3LID A;  4MVQ A;  1ZOY C;  4OWF A;  3AGT A;  3DM5 A;  1YYX A;  1J1E B;  1KQF B;  1HW2 A;  2AP3 A;  1USE A;  4ZLD A;  1VQ7 P;  1OVU A;  3ZDL A;  1NFN A;  4HYT B;  4IOI H;  3B71 A;  1YJ9 P;  3DD7 A;  2YIU B;  2ZAE B;  2Y39 A;  3V5Z A;  1PCX A;  4N06 A;  3SYN A;  2QIW A;  3I56 P;  4K0D A;  3IR9 A;  5AVY B;  4C3B A;  3MP7 B;  1KB9 H;  1RF0 A;  2DGJ A;  2R3C A;  2G62 A;  3L8J A;  1YQ4 C;  1T6A A;  3MIW A;  4AYC A;  3L73 D;  3TNU A;  1R8E A;  2Q9A A;  1SQQ E;  3H1L E;  3VM6 A;  4NPD A;  2QEX P;  3RVZ A;  5KLV E;  2XM0 A;  1BBH A;  3SEO A;  5KLI C;  3SP1 A;  2R32 A;  4PJM A;  3NG1 A;  5BQI A;  1Y9B A;  2IM8 A;  1KYO E;  2OCC C;  4C7O B;  2KIK A;  3JCU E;  3L34 A;  4PD4 E;  1WT6 A;  3H32 B;  3LJB A;  1FMV A;  1SQQ J;  2NPS A;  4H44 D;  4XE5 B;  3JYH A;  5KLV J;  1P84 E;  5AW9 B;  5BVZ A;  1T8Z A;  2E74 D;  4W7Z A;  2Z5I A;  3GF3 A;  1CGN A;  1HE9 A;  1KNY A;  4J32 B;  2PP6 A;  4C7N B;  3CSK A;  2E75 D;  4JBZ A;  1M57 C;  1T6I A;  1L0L K;  3QH9 A;  1NTM G;  2YEV A;  2YQY A;  3UNG C;  3N4X A;  2MWQ A;  4NY3 A;  1BGY J;  2QY9 A;  3M9B A;  3ZQY A;  4OGQ C;  4H0L D;  3WUU A;  1VQ6 P;  4IAR A;  2Q3I A;  4LC1 A;  1T6U A;  2VC9 A;  4CS7 A;  256B A;  3GF7 A;  1MKM A;  1NTK E;  1S7Z A;  2L6G A;  3M4C A;  4E7S A;  1Y47 A;  1LWU A;  1GD2 E;  4PFP A;  4G78 A;  5CCH D;  1MQV A;  4NQF A;  5GPG B;  4I1O B;  3QZC A;  1RE4 C;  3RBX A;  1DEE G;  5HSW A;  5AW7 B;  2ZVN B;  2YKO A;  1D0Z A;  3V7O A;  5CCG A;  1GU5 A;  4YXD C;  1TWG A;  1KFM A;  1ZR4 A;  1FOS E;  4RES B;  3J06 A;  2FXM A;  1JY2 N;  3L74 G;  1N2D C;  1Q90 D;  4AL1 A;  5EFW B;  4E0I A;  3N24 A;  1GL2 D;  1BE3 G;  1Q82 Q;  4AUW A;  1L0N K;  3Q5P A;  2CNW D;  4B86 A;  3NYJ A;  1IFD A;  2XZR A;  1VLT A;  1S5L H;  1NHL A;  2C9N Y;  1FAP B;  1NTZ G;  1SQV D;  1VL2 A;  2UWJ E;  3CCL P;  1NKZ B;  1E86 A;  1USD A;  4GQH A;  1N7S C;  2HR3 A;  3B9Q A;  2BCC D;  2OYH A;  5B5E H;  1HUC A;  5KKZ C;  1D0X A;  1PV3 A;  5F5F A;  5FCL A;  3CCU P;  2A06 G;  2I8D A;  3GG2 A;  3NTN A;  2GDC A;  1H88 A;  2J45 A;  1M1J C;  2B88 A;  1NVO A;  2IBZ G;  4HEA J;  4O79 A;  4NPF X;  3BVH A;  1A0B A;  1E85 A;  2WTY A;  3WUT A;  1FDI A;  4JCH A;  3W67 A;  4XQ1 A;  1N1C A;  1U7M A;  2O9X A;  1BR1 A;  1OW8 A;  1EQ1 A;  1HW1 A;  2YL1 A;  2FAP B;  3I4U A;  2QJP C;  1TWC A;  3ZIB A;  1GU4 A;  3IQ6 A;  2FYU K;  1JY2 O;  1HGZ A;  2QE9 A;  1KB9 D;  3L72 D;  3G50 A;  2RMZ A;  3CWB D;  3AE1 C;  4EBJ A;  3KDP B; 
#chains in the Genus database with same CATH homology
 3AE3 C;  3AED C;  1KTM A;  1OMI A;  4I7Z B;  4KT0 J;  2E75 B;  3GF7 A;  3JYY A;  3RQG A;  1MKM A;  4XFJ A;  4OGQ D;  2L6G A;  3D70 A;  3GLM A;  5L8R J;  1PIX A;  4Z1M H;  2D2C C;  3IAO A;  2E76 C;  1FDO A;  2YIU C;  3IN6 A;  1WOL A;  3C8V A;  2YWA A;  1VF5 D;  1IK7 A;  4H13 B;  3AEC C;  2YMK A;  1DIP A;  3Q1M A;  4NQF A;  2G3A A;  4YTP C;  4PV1 C;  4H0L B;  2QSI A;  3AEB C;  3GMA A;  3D6Y A;  1ZZP A;  1HJ0 A;  2JX0 A;  2K9Y A;  2ZT9 D;  1KOR A;  1ZOY C;  4OGQ B;  4PV1 D;  4YXD C;  3C18 A;  3Q3D A;  3SFE C;  1PL5 A;  2V7Q J;  2O01 J;  3RL0 g;  1RQU A;  1OW7 A;  3AEE C;  3G9R A;  4RKU J;  1KQF B;  3L8I A;  2LK4 A;  1Q90 D;  1RQV A;  4R4L A;  1VF5 C;  2FBW C;  3O6Q A;  2D2C B;  3B71 A;  2E76 B;  1JOG A;  2L6H A;  3MFN A;  3AE4 C;  3C8G D;  4IL6 X;  2BEQ D;  3AE8 C;  1NGM B;  1UIX A;  1NYH A;  3S9O A;  2QJK C;  3Q5P A;  2Q00 A;  2QJY C;  3LW5 J;  2JO1 A;  2QIW A;  3O10 A;  1WMK A;  2ZT9 C;  4PV1 B;  1K05 A;  3AJM A;  3FGA D;  3ABV C;  3L8J A;  3AE5 C;  1VL2 A;  1YQ4 C;  2J5U A;  1KQG B;  2WPV B;  1EXJ A;  3RK3 E;  3C8G A;  1R8E A;  4XEV A;  3EWK A;  1WWP A;  1S1C X;  3C8G B;  5KLI C;  3D6Z A;  4R4M A;  3AE2 C;  3BRJ A;  2G8Y A;  1VF5 B;  1HF9 A;  1K04 A;  5KKZ C;  1PV3 A;  3AE6 C;  2BEZ F;  3AE9 C;  2JPU A;  1Y9B A;  1S5L X;  1U57 A;  2JP3 A;  2PBE A;  3R4Y A;  3Q5S A;  4H44 C;  2IDB A;  2ZT9 B;  3RQF A;  1DD3 A;  3AEG C;  2H89 C;  1WTY A;  5M1B A;  1V4A A;  2NZ2 A;  2WQY C;  2WSE J;  4XEK A;  3TUL A;  3AEF C;  1KIL E;  2KK1 A;  3GM2 A;  2E74 C;  3RQE A;  1DD4 A;  4H44 D;  2P10 A;  1AJY A;  3GM3 A;  1FDI A;  3U3F A;  3JZ0 A;  4R32 A;  2HSB A;  4EBK A;  1ZRT E;  4I7Z C;  1OW6 A;  2E75 C;  2E74 D;  2FXP A;  3GF3 A;  1KNY A;  1OW8 A;  3T97 B;  1TU3 F;  2WSF J;  1QVX A;  1UFB A;  2L6F A;  2H88 C;  1ZP0 C;  3GM1 A;  4XEF A;  1KMI Z;  3Q2Y A;  2QJP C;  1GMJ A;  3D71 A;  2E75 D;  3K7D A;  4GDO A;  2FYN C;  4H13 C;  4U7J A;  1K40 A;  2MKV A;  4H44 B;  2OQQ A;  2D2C D;  1JB0 J;  3AEA C;  4TT3 H;  2E76 D;  1EXI A;  1ZME C;  4H0L C;  3H25 A;  3SFD C;  2WSC J;  1YQ3 C;  3AE7 C;  4H13 D;  4Y28 J;  2E74 B;  1O3U A;  4EBJ A;  3AE1 C;  3U0C A;  4OGQ C;  3Q5R A;  5F28 E;  4H0L D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...