1OW8A

Paxillin ld2 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Recognition of Paxillin LD Motifs by the Focal Adhesion Targeting Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 60
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow8A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow8A02
3AEEC 3L8IA 2H89C 1YQ3C 3AECC 3JYYA 1V4AA 3AE5C 3O10A 2JPUA 3U0CA 2LK4A 3L8JA 3AJMA 3AE1C 3B71A 1OW6A 1ZZPA 1O3UA 2PBEA 1WOLA 3RQEA 3RQFA 3AEAC 1K04A 3GM3A 3AE8C 3AEFC 2L6FA 1UFBA 2YWAA 3C8GA 4EBKA 3BRJA 1JOGA 1ZOYC 3JZ0A 3AE9C 3ABVC 2FBWC 3AEGC 1OW8A 1KNYA 3U3FA 4XEVA 3S9OA 3SFDC 3GM1A 1K05A 3TULA 3K7DA 3RQGA 2JX0A 2L6GA 4EBJA 3MFNA 4NQFA 3AEBC 4YTPC 3C8GB 3AE7C 3SFEC 4XEFA 1K40A 1WTYA 3AE2C 1WWPA 2KK1A 1QVXA 2HSBA 2G3AA 2WQYC 2L6HA 3AE3C 2Q00A 4XEKA 3AEDC 1PV3A 1ZP0C 3AE6C 1KTMA 2H88C 5F28E 3AE4C 4R32A 1YQ4C 1OW7A 4YXDC 3C18A 3C8GD 3GM2A
chains in the Genus database with same CATH superfamily
4WY4D 3HUSB 3HTKB 1PD0A 3L8IA 2L5GB 1NFOA 3CCMP 4CJGA 2R7VA 4JBZA 3Q5SA 3RH3A 2OARA 3NMDA 1VYKA 2QG4A 5KTBA 5DLJA 3TGUD 5GTHH 3JYYA 1L0NE 5DQTA 3GF3A 5E3CA 1MMDA 2KNCB 2NZ2A 3TOLA 2LCHA 1AQ5A 1KQGB 5APXA 2P67A 4K7BA 1GK6A 3W8HA 3L75E 2KS1A 3M4CA 1LTBC 1BCCE 3ZQYA 3EG9A 1UIIA 3MUDC 2TMVP 2Y39A 2EPLX 1MFZA 4IAOA 5T3TA 2J46A 3SNHA 3CX5E 1MUUA 1NAYA 3JSVC 1LIHA 4XPWA 1K04A 1VL2A 1VOMA 2Q9BA 1PL5A 4Q5SF 3K66A 3PH0A 1FDIA 4NCQA 3L0IA 4LDQA 2IZ0A 2CCYA 1M1JA 3L75J 2KSFA 4HE8D 5CJ0A 3CMEP 1BZ4A 1YTZI 2NSGA 4DRHB 1OKKD 1ZR4A 2YVKA 5CCGD 1RJ9B 1LE2A 2Z5IA 4PD4E 5H2FE 1BE3J 1EKYA 2A0UA 3W2VA 3TULA 3VF0A 2AXTE 4O79A 5L0FA 2KP8A 1SQPE 3AG3C 1PZQA 2A45H 4U9DA 4GDOA 1IC2A 3GLMA 2FFHA 1T9KA 4AQRD 4PR9A 1OR2A 1TFOB 1NOHA 2HJ3A 2AVKA 5AVTB 1ZU5A 3Q5RA 4TLFA 1LPEA 4DBRA 2BEZF 3A3YB 3AGUA 3NMKA 4DXWA 2E75B 4BJ5C 1G2CA 3B5NC 3O6QA 1JOCA 1EDIA 4W7ZA 1D1BA 2ZJSE 3QZCA 1T2KC 1Y8AA 3V5XA 2R44A 2GM4A 1SMYF 1GU4A 2LXBA 2N9BA 3AQBA 1HUCA 1PP9E 2O9XA 1YTZT 2QA4P 2PNOA 5JRAA 2XV5A 5JUAA 5KYUB 1M1JB 2Q4FA 2WTYA 1BE3D 4U5EE 1D0YA 5A6KA 4Z9IA 4PV1C 3SWYA 1TWGA 3SYNA 4JTAB 3M0AA 3RK3C 1JPNA 3HTKC 1RJ9A 3BCCE 1CI6B 1OKKA 2BCCJ 3RQFA 1LTAC 5AVXB 1A7VA 1OXBA 4ULVA 4XLNF 4IAQA 1L7CA 4OINF 1OQCA 3R4YA 4JPZB 3L74E 4EOTA 2KW3C 2Z5HA 2I1JA 4MTGA 2I1KA 1Z63A 3TNUA 4G7ZF 3L70J 1H9TA 3W68A 1EZVI 3ATPA 2YWAA 4D6TG 3ITKA 1X79B 1GL2D 3DD7A 3M4BA 3WG7C 4IGGA 3QMKA 4XTKA 3FAJA 3G4SP 3U3FA 5BU8B 4EIJA 4UB6H 2OQQA 5B5EE 4AK9A 2GWWA 1NTZE 5EGYA 1T3JA 1CZQA 2BC5A 2KOGA 2JR8A 1ZU4A 4PD4D 2OYIC 2AWCA 1RF0C 4BWNA 1JRAA 3V5YA 3L75G 3P8MC 2HPCA 1SQXJ 1ST6A 2WT7A 4MNDA 1ORYA 4XPXA 3VYWA 2OYIA 2XLEA 4C7OB 1YJGA 2ZT9D 1TWAA 1QVXA 3I4UA 2RN0A 1FZAA 2YKPA 1YA9A 2LKMA 5KYUA 1SQVJ 3L71J 4XEKA 1OVRA 4K3AA 4JJGA 1JEKA 1SQBJ 1ZP0C 2H88C 1YVIA 1A41A 1GK4A 1T6AA 1Q0DA 4YXDC 1R4TA 2NG1A 3GWNA 2WVRA 4LLHA 2K9YA 3C8GD 2ZD9A 1C03A 4JTDB 1M2VB 3FX0A 2O01J 4FESA 1AUEA 1MKMA 2UUHA 3KPHA 5CBOA 5F5FA 3F47A 1LS1A 1NYHA 3VMXA 3Q5PA 4YPCA 1T6UA 2E74B 2EILC 3M79A 1VQPP 2VC9A 3U0CA 4P6IC 1RF1A 1JNMA 1BR2A 1LTIC 1HW2A 2CPSA 4NTFA 2XLHA 4Z9JA 1LGHB 3G71P 3HUSA 4LLCA 3V2QA 3LIDA 4AX2A 3L72J 1Y4CA 1D7MA 3H1HJ 1H7IA 3QTHA 2R7WA 1FZCA 1AQTA 1WN0A 1S05A 1JCDA 2QM7A 3NYJA 1Y47A 3GF7A 1YA7O 3QVYA 4U5HA 3BRJA 2R9RB 4W8PA 2EIJC 1E2XA 4U5DE 3D6ZA 3L72E 1RMVA 1AEPA 1ZW2A 2HMQA 4C7OA 1A0BA 2Q5UA 2ZXPA 1M8OB 1U6HA 3CX5H 4UB8H 4FX5A 4XEVA 3S9OA 4U5GA 3ITFA 4U3FG 4WABA 3UR3C 2YMYA 3IAOA 3HNJA 1JO5A 2L6GA 1PIXA 1VF5B 2YRFA 1GQAA 3DMDA 2WPQA 1EQ7A 5BU5A 2IXMA 5A6BD 2QNLA 2K88A 2AEJA 2WPRA 3DJNB 2XSEA 4W80A 2P7VA 3JSEO 1NKZB 2IBFA 2D2CD 3LLKA 1KILB 4K1OA 3B8EB 3C63A 1VQKP 2FAPB 3C9IA 3E7KA 1EI7A 1BDJB 3TGUG 2L6HA 2XKMA 1OXKA 3AE3C 3VM6A 5AVUB 1SQXE 3U9JA 1S2EA 3LS1A 4XE5B 1BBHA 3N2ZB 3U2MA 1NGMB 1W2EA 3CCEP 4H44C 4HEAJ 1H9GA 2XNXA 1ZMEC 3C18A 3PHLA 4DJGA 1O87A 2XXAB 2K37A 5DJTB 3MUDA 2AP3A 1L0LD 2YHSA 1LWUA 2W27A 1E5WA 2KYVA 1R5ID 5KLVE 2Q6QA 2EPMX 3HNLA 1SFCD 3H1IE 2OJQA 1HE9A 4OIQF 2KC3A 4JRZA 4R4MA 2A68F 3L8JA 2W4MA 1AA0A 3SWKA 4Y99B 1NH4A 4MVZA 1OW6A 3HKKA 2GUVA 1KMIZ 2H7OA 2X51A 5AW6B 3FAPB 3L70D 1VQMP 3SXKA 2XLVA 1Z7Qc 3MLGA 4ZNCA 4IOIH 3KYJA 3K1HA 2HZ8A 4AYCA 2R7UA 2ZXOA 2IBZI 2IXOA 3X2QC 3AGTA 1QVGO 2JEEA 3FVYA 2YIUC 1EA8A 3TOMA 5K5GB 5L0JA 1JUNA 2WZLA 4E0HA 3AEGC 2J5UA 1OW8A 4MW8A 4JCHA 1IJDB 1NJIQ 4OIPF 1GW4A 2D4UA 3VAYA 2YKZA 3RVYA 4A2NB 3CC4P 2E43A 3SFDC 3A9CA 3BATA 5AW4B 2LD6A 3RQGA 3TJ6A 1NTMK 2J59M 3TNUB 1TKNA 2PAJA 1LP1A 1S7ZA 1HMOA 1Q82Q 2DYRC 2Y0DA 3A0BE 3CI9A 1OX3A 3M9BA 4BJ5A 1X8YA 4IWBA 3H1IJ 1VQ8P 1BGYD 4XEFA 5L8RJ 4MVMA 1H8AA 1NTZG 5AW3B 1TQGA 2KGOA 1PP9J 3RL0B 2K9JA 5TJ5E 2E76C 3L71D 1J1DC 4MN4C 2KK1A 1LWUB 3V5BA 2IDBA 1Q0MA 3WUUA 1KV4A 4DJ9A 3CXHI 1URQC 3T6BA 3IF4A 1CSBA 1ZHTA 3FOOA 1QL2A 1YLMA 2I15A 1CGME 5AW7B 5BQHA 2ZAEB 4XLPF 1SQXK 1YQ4C 4R4LA 4DVYP 4OIOF 2HUJA 1JTHB 2WT7B 3LLIA 4BJ1A 4BRYA 3CMAP 3X1OA 2E5YA 4J7YA 1EXIA 3LESA 3GM2A 2OTKE 4BEJA 4ASWA 3GMAA 5KJ7D 4DBQA 1O5HA 3IHUA 5E33A 1ZN5A 2YL0A 2NPSD 1FZGA 4H4KC 1SQVG 2N1TA 2D5RB 5B1AC 3M0DA 2E76D 3SZRA 4OGQC 4C3DA 3S1KA 3AE5C 1M57D 3VN0A 4H44B 1SQPJ 1BDDA 1SP4A 3N24A 3RKOF 5DS4A 2IX7C 3AG4C 1RE3C 1A02J 5AVWB 3M91A 3NRHA 3KZIH 1JMWA 2MHRA 2SPZA 3CCUP 3IQCA 3IN6A 2D2CB 3UGPA 2E74D 1U89A 4HB1A 3H1KD 3DE8A 2NPUA 1X0TA 1LS4A 3CCJP 4Y99C 1DIPA 1NTKG 4IRUA 1LNQA 1FFTC 1NG1A 1NLXA 3JZ0A 3H1KJ 2A0BA 3S27A 1USDA 5AVYB 1IW7F 4DOZA 2Y3GA 5H2FH 1IFDA 1OR3A 2J45A 3V4QA 2ZPAA 1GM5A 4MVUA 3LS0A 1HE1A 2WSSH 1IFPA 3VRCA 1G2CB 4HKZH 3BVHA 3O6QB 2OCCC 3CPWO 4C7NA 3H1ID 4E7SA 1G1IA 2JX0A 1FZCB 4G0HA 1L2PA 1PPJG 3C7JA 3E9VA 3PHF2 3NYLA 1P84D 2HG5D 2R32A 2K3RA 1FMVA 4LERA 4CS8C 5APUA 3MIWA 2J9UA 3AE2C 1SFCA 2P1JA 2E87A 3I56P 4MTFA 3ZSUA 2WSFJ 2GA0A 5APVA 3RGUA 2QM8A 4NPDA 2GA1A 2ZVNB 3U3BA 2W45A 2R5DA 1ZHZA 1OVVA 1L0NG 1NU1J 3AEDC 3L71E 1KILD 3N7NA 4OD4A 2DI3A 3VMYA 2UWJE 4JYCA 3KDPB 3QWOC 1APCA 1L0LJ 1JB0J 5CI8A 3W67A 1LWUC 2R03A 1E84A 1GTWA 3T6JA 3VMZA 2IXNA 1ORSC 5APQA 3JCUH 4GODA 3VP9A 3FMSA 3EFOB 3ZWIA 1VQ5P 4D4NA 2BCCG 3RVZA 2YKQA 2WVQA 3CEXA 1IFJA 3TYYA 5IY5C 3ZC4A 2H8AA 2FFDA 2CYDA 5APYA 2YEVA 1FJKA 3AJMA 1LI7A 1ZW0A 1ZR2A 2W83C 3HE5B 4JEBA 1AVOB 3TF5A 3H32B 2QJYB 1SZIA 1L4AD 3AEAC 1I4ZA 5D91A 1JY2P 3VYIA 1RCPA 3AE8C 5DS6A 2MWQA 2L6FA 3UIAA 2OU6A 3H2UA 3L70E 3E70C 1EZVG 4I7ZC 5AW9B 3SWFA 1T6IA 2M5AA 3FXHA 3RBXA 3AE9C 1HGVA 3ZQVA 5B66H 3L74G 4IB4A 2M8RA 4KBLA 3MP7B 1MV8A 3F5HA 1QPUA 1J1EB 2LIGA 4G7OF 1CPQA 3TGUJ 3LUTB 2FYZA 2W8ZA 1XTCC 1S9KE 3GEHA 1BGYJ 3PDMP 2KIKA 3U5SA 2L9JA 3C8VA 4GT1A 1JY2N 2H8PD 4PACA 3S90A 3L72G 1N7SB 3Q6NA 1L0LE 4NQFA 3WUTA 1X9VA 3AEBC 3RK2D 1EDLA 1HF9A 4YTPC 3L73G 3AE7C 1MNEA 3SFEC 4IL6E 2BE5F 3LEOA 2R7RA 1M1KQ 4P9FA 2V7QH 3GEIA 1NU1K 3AG1C 3ASOC 1M2VA 4G7HF 1FBMA 1VQ4P 1QLEC 1FZCC 1LT1A 4ONSA 4H0LC 5AC5A 2HR3A 3T6GB 2FFDB 3TJ5A 1PV3A 2W6JH 5DVWA 1AVYA 3CD6P 3EZHA 2XLOA 1V55C 2XS8A 3L36A 5KYXB 1OVUA 3HE5A 2QSIA 4DCKA 1AVOA 5JSLA 3KHUA 4LDKA 1T8ZA 2PRRA 4O7GA 3FGAD 3U59A 3K1IA 1B68A 3NKEA 2ICWG 2Y0EA 3ABLC 4XFJA 2Q3TA 5T3WA 2PF4E 4IL6H 3OW2O 5CCHC 1RKCA 4X0RA 2QEXP 1RQUA 1Y9BA 2P58A 3B71A 2PFXA 2OEXA 4ZKPA 1S5LX 4E17A 2HKVA 2PBEA 2PX3A 2WSEH 1AV1A 2ZVOB 4OGQD 1Q0GA 5E3AA 4CS7A 3DI5A 1QKRA 1I4YA 1QVFO 4JCZA 4BEMJ 4WWIA 3V6IA 1OCCC 1TR2A 2N1TB 3MGNA 3A5TA 2QUPA 1LKXA 4CDVA 1R5LA 3EQ2A 1Z5ZA 4WGYA 3J06A 3SP1A 2PGDA 2FXMA 4DZOA 1FJPA 4DRJB 2KZIA 1ZOYC 3ABVC 3FHDA 2HYNA 1QX8A 1RF0A 3NTNA 1C17M 1YYJA 5DQZA 2DGJA 1QEXA 4LC1A 1NWQA 2ZYGA 4JW1A 2PP6A 4JE9A 2WPSA 2O3JA 1NTMD 3K7DA 3RFYA 4CX9A 1NKNA 1HVVA 3M0DC 3LAYA 2NSFA 4D6TE 2A06D 3L1MA 1IK7A 4NPFX 3JYHA 3LJBA 1Y6DA 1X22A 3H1JE 3G6EP 4E18A 4E7ZA 3S84A 2B9BA 3LIEA 3CWBG 4LGDE 3DWWA 3VTPC 3TQOA 1SQQE 3CCLP 4DRIB 2G8YA 1CW5A 5CJ4A 3AOUA 5TISE 3HUSC 3ZG1A 2VH3A 4U5BE 3DKAA 2KB7P 1NTMG 2C04A 5BQGA 4QI0A 3D6YA 1VB5A 1SQQD 1V54C 2YO2A 4R32A 3C62A 1W2WA 1MFTA 3H1JD 3N4XA 3IPMO 1Q0FA 1WMKA 2R7QA 2E75D 2F22A 3EFFK 2J9VA 1S1CX 1T2KD 1QZXA 4PV1D 1L0ND 4IFFA 3GG2A 3CSKA 2Q3IA 3ECSA 4GQHA 2RSEB 1NU9C 2YO3A 1TU3F 1CGNA 3ZDLA 5GTIE 3MD0A 2N9YB 5E79H 4XQ1A 5C39A 2V26A 5KJ7A 3K6BA 3RF3A 1YYXA 4M63A 1USEA 1WOLA 5BQIA 2EPOA 4C3BA 3M9HA 4U3FJ 1SQXD 5KYYB 3EH2A 4ZLDA 3GM3A 5L0GA 4U3FE 4QDLA 2H7BA 2WZ7A 1U7JA 2CPBA 1JCCA 4Q4ZF 1LP1B 5AW5B 1LT9C 1BR1A 2WPVB 5JS5A 3USSA 3GHGB 3C8GA 1NVOA 2IZ1A 4O6MA 2DW3A 4I1LA 3KYQA 4U5CE 3V2NA 2IBZG 4EBBA 2FBWC 1T6QA 3WHNA 2K9JB 2P6VA 1Q0KA 4UB6E 2VCCA 1S5LH 3BRVB 1SYQA 3B0PA 4J32B 2A06E 5A6AA 3US6A 3B0VC 1T01A 3IQTA 3CLQA 5CHXA 2Y9YA 3C8ZA 2IM8A 1DD4A 1GL2C 2CNWA 2AU5A 1LTTC 4XWJA 1L0LG 4YK5A 4WY4C 3K5BA 2I8BA 2XL8A 5K0IA 4OH8B 1SLQA 1G8XA 1FNTc 1VPCA 2Q1KA 3G4ZA 3KMIA 4PJNA 2IBZD 4DOJA 3SEOA 5F5HA 3HD7D 1RE3A 3B29A 4WB4A 2XLWA 2A69F 1N7SA 4MTOA 1BDCA 2P0NA 3I5CA 2NPSA 4ER9A 1M1JC 4B6IA 4C3EA 3MYFA 5HSWA 1IZNB 2C0XA 3UGOA 2YXQB 1HH0A 3Q7LA 5TISH 4EDFA 4PV1B 1EDJA 1Q81Q 2W6BA 1N73B 3E1RA 3S28A 2Z4EA 3ZTZA 2V4HA 2VB6A 5EK0A 3VOPA 2O01N 2B87B 3D70A 2G62A 5KLVD 2JPUA 2KK7A 3TK1A 2PX0A 5CCGC 2L81A 1Q7YQ 3CXHD 4YL3A 1PFIA 3UNGC 1VF5C 1KB9D 4G78A 5KLVK 2OYHA 3EWKA 3EGDB 1KQSO 3P8CD 2A6HF 4N4WA 5AC4A 1YZAA 2BEQD 3Q2YA 3EZIA 4JTCB 2VCBA 4W7YA 1L4AB 4CIPA 3JCUE 1PD1A 2EINC 4AL0A 4PFPA 3AEFC 1EC5A 4C7NB 3HNKA 2M0BA 4HYTB 4RBNA 4N6CA 3CX5D 4JJFA 3U1AA 2J9WA 3L73D 1HMDA 2BL2A 1AFOA 1M56C 5FCLA 1LTSC 3H1HE 2J7PA 2WSCH 1KB9E 1VK5A 1R5SA 1KD1Q 3WAQA 1DD3A 2HV6A 4ZMDA 1KFMA 3EHNA 1VYIA 2FYUG 1W2BO 3GEEA 1RF1C 3RIPA 4EI2A 2JWDA 2D2CC 3WODF 5CBNA 3TDKA 1BSNA 2NPSB 3L35A 3PTZA 5GTIH 3SXZA 2WWWA 2OYOA 4WBAA 2KSEA 4I3MA 2O1KA 5EHHA 3H1LJ 3F89A 2LP4A 2IPPA 1N73A 1S4XA 1WT6A 4D4XA 2W6AA 2E75C 1S72P 3T4RA 1YBKA 2B87A 1ZRTD 1BGYG 5EFWB 1FZFA 1UIXA 2QIWA 1IK9A 2A45I 4BG0A 3L4FA 3A0HH 1SQVE 4YT2A 3ASNC 3DJUB 2IBZE 1YITP 1NBBA 3H1LG 5AVQB 3FWLA 4H13C 2HSQA 1TWCA 3LNRA 1BGYE 2YL1A 1P84I 3G50A 3H2VA 2R3SA 2H89C 5GPGB 1YQ3C 4ASVA 3G9RA 1DOVA 1L4AA 3M1CB 2VRSA 2JO1A 5KKZC 3WU2H 1V4AA 3KXDA 1NAFA 2WB7A 3W4YA 3Q1MA 1H6GA 3RBZA 3DM5A 2RH0A 1RKEA 1EZVE 2CK3H 3L70G 4L6RA 2FYNB 1V74B 5D92A 3AQCA 1JTHA 2FYNC 1N73C 1YI2P 1O3UA 3QW1A 3EQLF 5AW0B 2Y9ZA 1SQVD 4MVQA 3II6A 1KILE 5AVVB 2G3VA 3QW0A 3RK2C 2KYHA 1C02A 3BCCJ 1SR2A 2LXCB 1J8MF 4RO0A 1ZXGA 1RE4A 1FR0A 4Q7CA 5L0HA 2VCAA 1ORJA 1PGJA 1JMBA 3M9QA 5JVEA 1OZHA 3FXEA 2KNHA 5GTHE 1NO4A 2LR2A 2N1TD 2B0JA 2HODA 4PJ0E 3E1IA 2BCCE 4JVSA 5KYYA 3JT1A 5AGFA 3TSIA 4IJJA 2IYOA 1PGPA 3GORA 4EBJA 3RK3E 1CGOA 4CS9A 3L71G 3C8GB 3CAXA 5CCGA 3Q7GA 2AEFA 5APWA 3DAFA 5KYXA 3A0BH 5KLIB 2YLDA 3KKBA 3GW6A 4EWCA 2KQ9A 4RD9A 3VMAA 5B3SC 1PPJD 3OA7A 3KYIA 1YIJP 1OXZA 2JP3A 1SQQJ 4PK4A 2OQMA 2JD3A 4YJWA 2NUPB 2QE7H 5AVZB 2XRHA 1KZUB 1MMAA 2WVNA 2C03A 1BR4A 4BXLA 5CIVA 5F28E 3AE4C 1MZ9A 3VP8A 1JPJA 1FDOA 1YJWP 2B0HA 2EPKX 1N7SC 1RQVA 4Z9HA 1D0ZA 3CXHE 1KYOE 1OWAA 4RJTA 4CDYA 1ZHXA 2H7VC 1LTJC 2WMMA 1HJBA 3AEEC 1BE3E 2KUBA 2J0WA 3H1JJ 2P2UA 2QJKB 2UUIA 1YJNP 3GODA 3G3ZA 4J30B 4EHPA 3O10A 2Y0CA 4D6TJ 3BRTB 4NTAA 1NTMJ 1FFHA 2VASA 3T97A 1FZEA 3CCVP 1J8YF 1NTKJ 1ZZPA 1XZPA 5COFA 1K8AQ 3H65A 3RQEA 3H1KG 3IQ6A 2XS1A 3A7OA 2FYUJ 1G5ZA 5L3VA 2M64A 3EFGA 1M90Q 3LEVA 1KB9H 1GDTA 1NTKE 2Y3DA 5COGA 4WJ0A 2XLMA 4IL6X 5TJHA 1LT9A 1F1MA 1PP9G 2KZJA 3PMRA 1RY3A 5B3IA 3H32A 4KT0J 3V2RA 1P84E 2IXPA 2OGUA 1GL2A 1CPRA 2XU6A 1KORA 2CGEA 1BCCJ 2EIMC 3MTUE 3GM1A 4YT5A 1J1DB 5HV9A 3ZIBA 2M4EA 1SQPD 2O01H 4O6YA 2OOCA 3FOPA 1K73Q 3PJSK 4EKWA 2YL3A 3U2LA 1G4US 1JY3N 3KQGA 1JM0A 3MHVA 4EUKB 3PCVA 2MYSA 1L0NJ 1VQLP 2M5AB 4CPGA 4N78D 1H0TA 2J0XA 1R8EA 1KYOD 1GZLA 4FWVA 3I55P 4HFKB 1DOWA 1KILC 1FTSA 3H1HD 1H89A 4JC7A 3NG1A 3HTKA 3FXDA 5M1BA 5CCHA 3GANA 256BA 1T5OA 3OJAB 3TD7A 1N8RQ 4HFFB 2CNWD 1HJ0A 1SQPG 1RHZB 2WZFA 3QVZA 4JF7A 3PRJA 1TWHA 1VDFA 3A11A 2IFNA 3A2AA 3IEEA 4YT4A 3S0XA 2YNYA 2R5BA 3T97B 1D0XA 4N06A 3CWBJ 1W5CE 2XL6A 2KS1B 2HMZA 2QJPB 1FOSE 2JJLA 2R02A 1SS1A 4LLEA 2YZSA 1E79H 1VQNP 1LE4A 3JTLO 1OIPA 3POVA 4TT3H 1OCZC 4K0DA 3H1HG 3B0UX 1S5LE 3RK3D 4KNWA 1J1EC 4MVSA 5KAFH 1MQVA 4JQ0D 3S4RA 1S3JA 3H1LD 2QY9A 1OCOC 2HV7A 1KFNA 2ETSA 3EH1A 1D1CA 1FU1A 3GHGA 3PLNA 4XPYA 3AE1C 1KQFB 2Y3HA 4BPMA 4MS2A 4IARA 2A6EF 4O6NA 4DT0A 2MJZA 1OMIA 4GOEA 1FAVA 1BCCG 1BE3G 3CL3D 1GL2B 4ANJA 2WSEJ 2V7QJ 2QJKC 3KH2A 3RYLA 2NUTA 4WY4B 2AXCA 3JC22 1IFNA 2Q9AA 3EGXB 3O6XA 3HD7A 2XDJA 2B89A 3P7KA 2ZYAA 4H0LB 4AUWA 3QH9A 2AEMA 1Z3IX 3LNMB 4YT8A 1HGZA 2QVAA 3HRNA 3L73J 2PFDA 4KNVA 4PJMA 1IZMA 3IQ5A 4D6TD 3ABMC 2OKUA 1VQ9P 4LDRA 3EPVA 3FDQA 3ABKC 5BVZA 1N7LA 1HY5A 2KLUA 3U8PA 1SQPK 2ZT9C 4BJ6A 2PP4A 5E79E 1QLED 3RK3B 1LM3B 5A6BA 4K35A 1FS0E 5AW1B 5L3QA 1E83A 1SQBG 1K40A 4KC9A 3RL0C 1HTLC 2FGYA 1JY3O 1URQA 2HODB 4GIFA 2C0WA 2YKOA 3RK2B 1SQVK 2HLOA 2B88A 3U8VA 3EHMA 3K1IC 4NY3A 1NHLA 1ZLLA 2WITA 5APSA 4M3LA 1N7SD 2G3AA 2R25A 2ZXEB 2YLIA 2M3EA 1IO4A 4GOFA 4L76A 2LQGA 1SQXG 2LFFA 1SVFA 1JAFA 4GKGA 1SQQK 2Q9IA 1Z23A 4MVOA 2G3KA 4Y28J 1SQBD 4C7RA 1YZCA 3CCSP 4I6MC 1GS9A 3T9OA 3H1LE 1OFCX 2QJYC 2P61A 3RL0D 2Q3EA 4RKUJ 2IFMA 3DXJF 1M56D 1LTJA 3KZIE 1LI5A 4J7TA 2V3CC 1IFIA 2BCCD 5CMZA 1GW3A 5KLIC 1YAUO 2LK4A 4W8KA 2YXRB 2YL7A 4L73A 3UMHA 3CCRP 1QSPA 2ZFCA 2RMZA 1JY3P 4CS8A 5FZTA 2NRGA 2P10A 3O8ZA 4HJGH 2KI7B 2HFIA 2JDIH 2QLAA 4CIHA 3NMJA 1JMMA 1PGQA 1FAPB 3H1KE 2DYSC 1YHQP 5KJ7C 3UMKA 5AW2B 1ZHYA 5B1BC 1KC8Q 2AWYA 4N3YB 2R7OA 5KAIE 2GUSA 4EBKA 1U7MA 4KHXA 1RE4C 4OVNF 3P8CE 4PFOA 4RESB 5KYNA 3B5NB 4ULWA 3B5ND 2FYUE 3ZVRA 3EG9B 2R3CA 3L75D 4AE4A 3KL4A 1OCRC 2CDQA 5JT4A 3TK0A 1NSGB 1KB9I 3OWTA 1S9KD 3OEOA 1J2JB 1NTME 4H13D 3GWLA 1ZW3A 3A0HE 4I1OB 1L3PA 3M06A 2FFDC 2H7HA 1SQBE 4CJOA 2ZYDA 4WGZA 1WTYA 5APTA 3HLZA 2KJGA 1WWPA 1XTGB 2WSFH 5AVSB 2HFED 3CX5I 4YL0A 1TFKB 1LJ2A 2LFDA 1WGWA 4H44D 1NU1D 4HH2A 2W4BA 5CI9A 4GEHA 1Z56A 2OTLP 3FWNA 4XA4A 1M2OA 4OWFA 2FXOA 4KJMA 1RF1B 4L75A 1RKEB 2WL8A 3H6PA 1SF8A 2E76B 2OEVA 3H1IG 1EXJA 4MW3A 3GHGC 4MQ9F 1NTZJ 1EZVD 4JYBA 3OAKA 3AECC 2XL4A 1FDMA 4JIOA 5A69A 1NU1G 4EIYA 1T3UA 1ZVZA 2KLVA 2N1TC 1VLSA 3R7CA 4E0IA 2J58A 5JP7A 1FMWA 1E85A 4OIRF 2J8WA 3SSUA 2R05A 1RXQA 1G1JA 2XM4A 1FC2C 2IYLD 2E42A 2XZRA 4PD4I 4JKVA 1Z6AA 5KLVG 1HW1A 1NTKD 3N0TA 1Q2NA 4NPEA 3I5QA 5KYWA 5B66E 3W2WA 4YWQA 4IFDK 4U3FD 4I7ZB 4U7JA 1UFBA 1PGOA 1BCCD 4L74A 1JOGA 4BJ6C 2P7JA 4MVRA 1E86A 1RH5B 1KN7A 2O1JA 1CI6A 3S29A 2OYHB 4A7PA 5KLVJ 3EGDA 3RL0g 4H0LD 3WUVA 1KILA 1QL1A 2A45G 2GDCA 3IFMA 2NUTB 4YN0B 3JCUQ 2Q7RA 1U0BB 2ITAA 1NFNA 5AVRB 2HS5A 4B86A 3L37A 2X0CA 3EJNA 2L91A 3EGXA 1EQ1A 1PCXA 2FYUD 4PJLA 3DM9B 3CQZA 2LSEA 2XXAA 4ZKUA 4NTBA 2A06G 5CCHD 2L7AA 2EPNA 3MX3A 4C46A 4QI2A 4UB8E 3CWBD 3L74D 5L0DA 1FOSF 1A7DA 2E5TA 2YIUB 3DAGA 2BASA 2J7PD 3HNIA 3CCQP 1A02F 2KNCA 2GAQA 5DS5A 5JLIA 2GFHA 1VMAA 3DZAA 2HPCB 4EYYQ 1L0NK 1OW7A 1U57A 3HD7C 3JRMO 3NDBB 4FAPB 2OYIB 1KTMA 4GYTA 2WZGA 3LW5H 1A7EA 2FXPA 1MMNA 1G4WR 2ZT9B 3CXHH 1VF5D 1VLTA 2XM0A 4Z1MH 3DE9A 2ZXWC 3K33A 2OG2A 4CSAC 4YL1A 1KQLA 1XWJA 2YLGA 3U9MA 1HWTC 1BSHA 1LT9B 2I8DA 4A4AA 2JKVA 2HJMA 4N6HA 2NPSC 3ZTMA 3G4XA 1GU5A 4QMAA 4PD4H 2YQYA 1ZRTE 3UMIA 1JY2O 1YARO 2M3BA 2R7SA 1AJYA 4LACB 4I1MA 1KU2A 2DB4A 2Q9CA 1LTJB 3KPEA 3OA1A 4I2LC 4WVZA 3JRTA 2Z15A 3M15A 3AG2C 5DJUB 2FKWB 3Q3DA 2E74C 3P32A 1MMGA 1YYCA 2K1AA 5KAFE 2H43A 1EDKA 2J9BA 1WATA 1GD2E 1P84H 1QGKB 5BUOA 1SQQG 4OGQB 3V7OA 1Q90D 2POHA 1K05A 1VQ6P 2QRXA 1LTGC 2RKLA 2ZXXA 2C9NY 3H25A 4H54A 2Q7CA 3NKDA 4AL1A 3PP5A 2JWAA 3BASA 2MKVA 1ZYRF 1UG7A 2KSJA 1HBWA 4BRYB 2XLDA 5E2QA 3B5NA 4F4BA 2W90A 4YXWH 2Y3BA 4AE4B 4KI2A 1XZQA 1VQOP 1DX7A 1NU7D 2WQYC 3WMM0 5B5EH 2R7TA 3F46A 3I5PA 2EIKC 3HJCA 1PPJE 4JZAA 2Q00A 4U9EA 1DH3A 2XNDH 3AE6C 3NXSA 3R2PA 3WU2E 3NMIA 2FYUK 1WASA 4CSAA 3B4SA 3O55A 1M7LA 3O39A 1ZV8A 1FE6A 3V4WA 1LVKA 4IFMA 1NTKK 2A1DD 3TGUE 1DEBA 4WY4A 4PJJA 1KYOI 1NTZD 1N1CA 2NUPA 1M6TA 1L4AC 3V2PA 3HE4B 1DEEG 3BCCG 3HD7B 1K9MQ 5L0CA 4JURI 2AXTH 2Y69C 3LW5J 1MNDA 1SQBK 3L34A 3L74J 2P1AA 4I44A 2KXPB 1N86A 3L73E 3Q6MA 3JSZA 1GMJA 2QJPC 4RDAA 1KYOH 1ZHWA 5KAIH 4CBEA 3CC7P 3NFQA 1FZBA 3BCCD 3IR9A 3MBGA 2IOQA 1NZEA 1SFCC 4N78E 1SFCB 5L0IA 4P9TA 1URQB 5A6JA 1URQD 2FY8A 1KNYA 2WVOA 3B9QA 1I5NA 1H88A 1VTMP 4CDAA 3MZWB 4NC3A 4PJ0H 1QQ3A 3SXMA 4DVZA 3BEHA 1GGQA 3V5ZA 5KYWB 2RD9A 2QE9A 1VQ7P 2ASRA 2C9LY 3NYMA 3MFNA 1N2DC 1PP9D 5COMA 4UDVA 2R7XA 2OTJP 1Q86Q 2ZXRA 3D71A 5T1DB 2WSCJ 3L72D 4CS9C 3MYIA 1NTZK 3W8IA 1YDIA 4N6JA 2CW0F 3CZ6A 2IYPA 5AW8B 2W9YA 3RW0A 4H13B 3EFOA 3ZDMA 1L0LK 1M57C 1D1AA 2HSBA 1YJ9P 1JR8A 4ZLCA 1IFMA 3CWBE 4JEAA 3SXYA 1WRGA 3H1JG 4OD5A 1NU1E 5KKZB 3C1LA 3HE4A 2QTVA 2OJED 2YMKA 2OYHC 4O9BA 1H0TB 4BJTA 4U5FE 3U1CA 3CC2P
chains in the Genus database with same CATH topology
2FXPA 3GMAA 2O01J 4TT3H 1S1CX 2ZT9B 3AEEC 1VF5D 3FGAD 2H89C 4PV1D 1MKMA 1YQ3C 2QJYC 3G9RA 3Q5SA 4Z1MH 3AECC 4XFJA 4RKUJ 2JO1A 5KKZC 2E76D 1NYHA 3Q5PA 3JYYA 4OGQC 2E74B 3D70A 1V4AA 3AE5C 3O10A 2JPUA 3GF3A 3U0CA 5KLIC 1TU3F 4R4MA 3Q1MA 2LK4A 4H44B 2NZ2A 1RQUA 3L8JA 1Y9BA 3L8IA 1KQGB 3AJMA 3AE1C 3B71A 1KQFB 1VF5C 1OW6A 4PV1C 1ZZPA 2FYNC 1S5LX 3LW5J 1O3UA 2PBEA 1KMIZ 1WOLA 3RQEA 1OMIA 3EWKA 3RQFA 3AEAC 4OGQD 2P10A 2WSEJ 2BEQD 2D2CB 2V7QJ 3IN6A 2QJKC 3Q2YA 1KILE 1ZRTE 2E74D 1K04A 1VL2A 3GM3A 3R4YA 1PL5A 1GMJA 2QJPC 1AJYA 3AE8C 1FDIA 3AEFC 2L6FA 1DIPA 4I7ZB 2WPVB 3C8GD 4I7ZC 4IL6X 4U7JA 1UFBA 2YWAA 3C8GA 4EBKA 3GF7A 3BRJA 2YIUC 1ZOYC 4H0LB 3Q3DA 3AE9C 1JOGA 3JZ0A 3ABVC 2E74C 3D6ZA 1DD3A 2FBWC 3AEGC 2J5UA 1OW8A 1KNYA 4KT0J 3U3FA 3RL0g 4H0LD 2OQQA 1KORA 4XEVA 4OGQB 3S9OA 1Q90D 3SFDC 3GM1A 1K05A 3IAOA 3TULA 3C8VA 3K7DA 3GM2A 3RQGA 1DD4A 2JX0A 2ZT9C 2L6GA 1PIXA 4EBJA 2D2CC 1VF5B 3H25A 3MFNA 4H13D 3RK3E 4GDOA 4NQFA 3AEBC 3GLMA 1HF9A 4YTPC 3C8GB 3AE7C 2MKVA 3SFEC 3D71A 1IK7A 2WSCJ 4XEFA 1R8EA 1K40A 5L8RJ 1WTYA 3AE2C 1WWPA 2E76C 3Q5RA 2ZT9D 2WSFJ 2G8YA 2KK1A 2D2CD 4H13B 1QVXA 2IDBA 2BEZF 5M1BA 4H44D 2E75B 2HSBA 2G3AA 2WQYC 2JP3A 3O6QA 2E75C 2L6HA 1HJ0A 4H0LC 3AE3C 2Q00A 3D6YA 1UIXA 4XEKA 2QIWA 3AEDC 1PV3A 1ZP0C 3AE6C 2H88C 2YMKA 5F28E 3AE4C 3T97B 1YQ4C 4R32A 4R4LA 1NGMB 1FDOA 2E76B 1JB0J 1OW7A 1U57A 1RQVA 4H44C 2QSIA 4Y28J 4YXDC 1EXJA 1ZMEC 1WMKA 4H13C 3C18A 1EXIA 2K9YA 2E75D 1KTMA 4PV1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEE C;  3L8I A;  2H89 C;  1YQ3 C;  3AEC C;  3JYY A;  1V4A A;  3AE5 C;  3O10 A;  2JPU A;  3U0C A;  2LK4 A;  3L8J A;  3AJM A;  3AE1 C;  3B71 A;  1OW6 A;  1ZZP A;  1O3U A;  2PBE A;  1WOL A;  3RQE A;  3RQF A;  3AEA C;  1K04 A;  3GM3 A;  3AE8 C;  3AEF C;  2L6F A;  1UFB A;  2YWA A;  3C8G A;  4EBK A;  3BRJ A;  1JOG A;  1ZOY C;  3JZ0 A;  3AE9 C;  3ABV C;  2FBW C;  3AEG C;  1OW8 A;  1KNY A;  3U3F A;  4XEV A;  3S9O A;  3SFD C;  3GM1 A;  1K05 A;  3TUL A;  3K7D A;  3RQG A;  2JX0 A;  2L6G A;  4EBJ A;  3MFN A;  4NQF A;  3AEB C;  4YTP C;  3C8G B;  3AE7 C;  3SFE C;  4XEF A;  1K40 A;  1WTY A;  3AE2 C;  1WWP A;  2KK1 A;  1QVX A;  2HSB A;  2G3A A;  2WQY C;  2L6H A;  3AE3 C;  2Q00 A;  4XEK A;  3AED C;  1PV3 A;  1ZP0 C;  3AE6 C;  1KTM A;  2H88 C;  5F28 E;  3AE4 C;  4R32 A;  1YQ4 C;  1OW7 A;  4YXD C;  3C18 A;  3C8G D;  3GM2 A; 
#chains in the Genus database with same CATH topology
 4WY4 D;  3HUS B;  3HTK B;  1PD0 A;  3L8I A;  2L5G B;  1NFO A;  3CCM P;  4CJG A;  2R7V A;  4JBZ A;  3Q5S A;  3RH3 A;  2OAR A;  3NMD A;  1VYK A;  2QG4 A;  5KTB A;  5DLJ A;  3TGU D;  5GTH H;  3JYY A;  1L0N E;  5DQT A;  3GF3 A;  5E3C A;  1MMD A;  2KNC B;  2NZ2 A;  3TOL A;  2LCH A;  1AQ5 A;  1KQG B;  5APX A;  2P67 A;  4K7B A;  1GK6 A;  3W8H A;  3L75 E;  2KS1 A;  3M4C A;  1LTB C;  1BCC E;  3ZQY A;  3EG9 A;  1UII A;  3MUD C;  2TMV P;  2Y39 A;  2EPL X;  1MFZ A;  4IAO A;  5T3T A;  2J46 A;  3SNH A;  3CX5 E;  1MUU A;  1NAY A;  3JSV C;  1LIH A;  4XPW A;  1K04 A;  1VL2 A;  1VOM A;  2Q9B A;  1PL5 A;  4Q5S F;  3K66 A;  3PH0 A;  1FDI A;  4NCQ A;  3L0I A;  4LDQ A;  2IZ0 A;  2CCY A;  1M1J A;  3L75 J;  2KSF A;  4HE8 D;  5CJ0 A;  3CME P;  1BZ4 A;  1YTZ I;  2NSG A;  4DRH B;  1OKK D;  1ZR4 A;  2YVK A;  5CCG D;  1RJ9 B;  1LE2 A;  2Z5I A;  4PD4 E;  5H2F E;  1BE3 J;  1EKY A;  2A0U A;  3W2V A;  3TUL A;  3VF0 A;  2AXT E;  4O79 A;  5L0F A;  2KP8 A;  1SQP E;  3AG3 C;  1PZQ A;  2A45 H;  4U9D A;  4GDO A;  1IC2 A;  3GLM A;  2FFH A;  1T9K A;  4AQR D;  4PR9 A;  1OR2 A;  1TFO B;  1NOH A;  2HJ3 A;  2AVK A;  5AVT B;  1ZU5 A;  3Q5R A;  4TLF A;  1LPE A;  4DBR A;  2BEZ F;  3A3Y B;  3AGU A;  3NMK A;  4DXW A;  2E75 B;  4BJ5 C;  1G2C A;  3B5N C;  3O6Q A;  1JOC A;  1EDI A;  4W7Z A;  1D1B A;  2ZJS E;  3QZC A;  1T2K C;  1Y8A A;  3V5X A;  2R44 A;  2GM4 A;  1SMY F;  1GU4 A;  2LXB A;  2N9B A;  3AQB A;  1HUC A;  1PP9 E;  2O9X A;  1YTZ T;  2QA4 P;  2PNO A;  5JRA A;  2XV5 A;  5JUA A;  5KYU B;  1M1J B;  2Q4F A;  2WTY A;  1BE3 D;  4U5E E;  1D0Y A;  5A6K A;  4Z9I A;  4PV1 C;  3SWY A;  1TWG A;  3SYN A;  4JTA B;  3M0A A;  3RK3 C;  1JPN A;  3HTK C;  1RJ9 A;  3BCC E;  1CI6 B;  1OKK A;  2BCC J;  3RQF A;  1LTA C;  5AVX B;  1A7V A;  1OXB A;  4ULV A;  4XLN F;  4IAQ A;  1L7C A;  4OIN F;  1OQC A;  3R4Y A;  4JPZ B;  3L74 E;  4EOT A;  2KW3 C;  2Z5H A;  2I1J A;  4MTG A;  2I1K A;  1Z63 A;  3TNU A;  4G7Z F;  3L70 J;  1H9T A;  3W68 A;  1EZV I;  3ATP A;  2YWA A;  4D6T G;  3ITK A;  1X79 B;  1GL2 D;  3DD7 A;  3M4B A;  3WG7 C;  4IGG A;  3QMK A;  4XTK A;  3FAJ A;  3G4S P;  3U3F A;  5BU8 B;  4EIJ A;  4UB6 H;  2OQQ A;  5B5E E;  4AK9 A;  2GWW A;  1NTZ E;  5EGY A;  1T3J A;  1CZQ A;  2BC5 A;  2KOG A;  2JR8 A;  1ZU4 A;  4PD4 D;  2OYI C;  2AWC A;  1RF0 C;  4BWN A;  1JRA A;  3V5Y A;  3L75 G;  3P8M C;  2HPC A;  1SQX J;  1ST6 A;  2WT7 A;  4MND A;  1ORY A;  4XPX A;  3VYW A;  2OYI A;  2XLE A;  4C7O B;  1YJG A;  2ZT9 D;  1TWA A;  1QVX A;  3I4U A;  2RN0 A;  1FZA A;  2YKP A;  1YA9 A;  2LKM A;  5KYU A;  1SQV J;  3L71 J;  4XEK A;  1OVR A;  4K3A A;  4JJG A;  1JEK A;  1SQB J;  1ZP0 C;  2H88 C;  1YVI A;  1A41 A;  1GK4 A;  1T6A A;  1Q0D A;  4YXD C;  1R4T A;  2NG1 A;  3GWN A;  2WVR A;  4LLH A;  2K9Y A;  3C8G D;  2ZD9 A;  1C03 A;  4JTD B;  1M2V B;  3FX0 A;  2O01 J;  4FES A;  1AUE A;  1MKM A;  2UUH A;  3KPH A;  5CBO A;  5F5F A;  3F47 A;  1LS1 A;  1NYH A;  3VMX A;  3Q5P A;  4YPC A;  1T6U A;  2E74 B;  2EIL C;  3M79 A;  1VQP P;  2VC9 A;  3U0C A;  4P6I C;  1RF1 A;  1JNM A;  1BR2 A;  1LTI C;  1HW2 A;  2CPS A;  4NTF A;  2XLH A;  4Z9J A;  1LGH B;  3G71 P;  3HUS A;  4LLC A;  3V2Q A;  3LID A;  4AX2 A;  3L72 J;  1Y4C A;  1D7M A;  3H1H J;  1H7I A;  3QTH A;  2R7W A;  1FZC A;  1AQT A;  1WN0 A;  1S05 A;  1JCD A;  2QM7 A;  3NYJ A;  1Y47 A;  3GF7 A;  1YA7 O;  3QVY A;  4U5H A;  3BRJ A;  2R9R B;  4W8P A;  2EIJ C;  1E2X A;  4U5D E;  3D6Z A;  3L72 E;  1RMV A;  1AEP A;  1ZW2 A;  2HMQ A;  4C7O A;  1A0B A;  2Q5U A;  2ZXP A;  1M8O B;  1U6H A;  3CX5 H;  4UB8 H;  4FX5 A;  4XEV A;  3S9O A;  4U5G A;  3ITF A;  4U3F G;  4WAB A;  3UR3 C;  2YMY A;  3IAO A;  3HNJ A;  1JO5 A;  2L6G A;  1PIX A;  1VF5 B;  2YRF A;  1GQA A;  3DMD A;  2WPQ A;  1EQ7 A;  5BU5 A;  2IXM A;  5A6B D;  2QNL A;  2K88 A;  2AEJ A;  2WPR A;  3DJN B;  2XSE A;  4W80 A;  2P7V A;  3JSE O;  1NKZ B;  2IBF A;  2D2C D;  3LLK A;  1KIL B;  4K1O A;  3B8E B;  3C63 A;  1VQK P;  2FAP B;  3C9I A;  3E7K A;  1EI7 A;  1BDJ B;  3TGU G;  2L6H A;  2XKM A;  1OXK A;  3AE3 C;  3VM6 A;  5AVU B;  1SQX E;  3U9J A;  1S2E A;  3LS1 A;  4XE5 B;  1BBH A;  3N2Z B;  3U2M A;  1NGM B;  1W2E A;  3CCE P;  4H44 C;  4HEA J;  1H9G A;  2XNX A;  1ZME C;  3C18 A;  3PHL A;  4DJG A;  1O87 A;  2XXA B;  2K37 A;  5DJT B;  3MUD A;  2AP3 A;  1L0L D;  2YHS A;  1LWU A;  2W27 A;  1E5W A;  2KYV A;  1R5I D;  5KLV E;  2Q6Q A;  2EPM X;  3HNL A;  1SFC D;  3H1I E;  2OJQ A;  1HE9 A;  4OIQ F;  2KC3 A;  4JRZ A;  4R4M A;  2A68 F;  3L8J A;  2W4M A;  1AA0 A;  3SWK A;  4Y99 B;  1NH4 A;  4MVZ A;  1OW6 A;  3HKK A;  2GUV A;  1KMI Z;  2H7O A;  2X51 A;  5AW6 B;  3FAP B;  3L70 D;  1VQM P;  3SXK A;  2XLV A;  1Z7Q c;  3MLG A;  4ZNC A;  4IOI H;  3KYJ A;  3K1H A;  2HZ8 A;  4AYC A;  2R7U A;  2ZXO A;  2IBZ I;  2IXO A;  3X2Q C;  3AGT A;  1QVG O;  2JEE A;  3FVY A;  2YIU C;  1EA8 A;  3TOM A;  5K5G B;  5L0J A;  1JUN A;  2WZL A;  4E0H A;  3AEG C;  2J5U A;  1OW8 A;  4MW8 A;  4JCH A;  1IJD B;  1NJI Q;  4OIP F;  1GW4 A;  2D4U A;  3VAY A;  2YKZ A;  3RVY A;  4A2N B;  3CC4 P;  2E43 A;  3SFD C;  3A9C A;  3BAT A;  5AW4 B;  2LD6 A;  3RQG A;  3TJ6 A;  1NTM K;  2J59 M;  3TNU B;  1TKN A;  2PAJ A;  1LP1 A;  1S7Z A;  1HMO A;  1Q82 Q;  2DYR C;  2Y0D A;  3A0B E;  3CI9 A;  1OX3 A;  3M9B A;  4BJ5 A;  1X8Y A;  4IWB A;  3H1I J;  1VQ8 P;  1BGY D;  4XEF A;  5L8R J;  4MVM A;  1H8A A;  1NTZ G;  5AW3 B;  1TQG A;  2KGO A;  1PP9 J;  3RL0 B;  2K9J A;  5TJ5 E;  2E76 C;  3L71 D;  1J1D C;  4MN4 C;  2KK1 A;  1LWU B;  3V5B A;  2IDB A;  1Q0M A;  3WUU A;  1KV4 A;  4DJ9 A;  3CXH I;  1URQ C;  3T6B A;  3IF4 A;  1CSB A;  1ZHT A;  3FOO A;  1QL2 A;  1YLM A;  2I15 A;  1CGM E;  5AW7 B;  5BQH A;  2ZAE B;  4XLP F;  1SQX K;  1YQ4 C;  4R4L A;  4DVY P;  4OIO F;  2HUJ A;  1JTH B;  2WT7 B;  3LLI A;  4BJ1 A;  4BRY A;  3CMA P;  3X1O A;  2E5Y A;  4J7Y A;  1EXI A;  3LES A;  3GM2 A;  2OTK E;  4BEJ A;  4ASW A;  3GMA A;  5KJ7 D;  4DBQ A;  1O5H A;  3IHU A;  5E33 A;  1ZN5 A;  2YL0 A;  2NPS D;  1FZG A;  4H4K C;  1SQV G;  2N1T A;  2D5R B;  5B1A C;  3M0D A;  2E76 D;  3SZR A;  4OGQ C;  4C3D A;  3S1K A;  3AE5 C;  1M57 D;  3VN0 A;  4H44 B;  1SQP J;  1BDD A;  1SP4 A;  3N24 A;  3RKO F;  5DS4 A;  2IX7 C;  3AG4 C;  1RE3 C;  1A02 J;  5AVW B;  3M91 A;  3NRH A;  3KZI H;  1JMW A;  2MHR A;  2SPZ A;  3CCU P;  3IQC A;  3IN6 A;  2D2C B;  3UGP A;  2E74 D;  1U89 A;  4HB1 A;  3H1K D;  3DE8 A;  2NPU A;  1X0T A;  1LS4 A;  3CCJ P;  4Y99 C;  1DIP A;  1NTK G;  4IRU A;  1LNQ A;  1FFT C;  1NG1 A;  1NLX A;  3JZ0 A;  3H1K J;  2A0B A;  3S27 A;  1USD A;  5AVY B;  1IW7 F;  4DOZ A;  2Y3G A;  5H2F H;  1IFD A;  1OR3 A;  2J45 A;  3V4Q A;  2ZPA A;  1GM5 A;  4MVU A;  3LS0 A;  1HE1 A;  2WSS H;  1IFP A;  3VRC A;  1G2C B;  4HKZ H;  3BVH A;  3O6Q B;  2OCC C;  3CPW O;  4C7N A;  3H1I D;  4E7S A;  1G1I A;  2JX0 A;  1FZC B;  4G0H A;  1L2P A;  1PPJ G;  3C7J A;  3E9V A;  3PHF 2;  3NYL A;  1P84 D;  2HG5 D;  2R32 A;  2K3R A;  1FMV A;  4LER A;  4CS8 C;  5APU A;  3MIW A;  2J9U A;  3AE2 C;  1SFC A;  2P1J A;  2E87 A;  3I56 P;  4MTF A;  3ZSU A;  2WSF J;  2GA0 A;  5APV A;  3RGU A;  2QM8 A;  4NPD A;  2GA1 A;  2ZVN B;  3U3B A;  2W45 A;  2R5D A;  1ZHZ A;  1OVV A;  1L0N G;  1NU1 J;  3AED C;  3L71 E;  1KIL D;  3N7N A;  4OD4 A;  2DI3 A;  3VMY A;  2UWJ E;  4JYC A;  3KDP B;  3QWO C;  1APC A;  1L0L J;  1JB0 J;  5CI8 A;  3W67 A;  1LWU C;  2R03 A;  1E84 A;  1GTW A;  3T6J A;  3VMZ A;  2IXN A;  1ORS C;  5APQ A;  3JCU H;  4GOD A;  3VP9 A;  3FMS A;  3EFO B;  3ZWI A;  1VQ5 P;  4D4N A;  2BCC G;  3RVZ A;  2YKQ A;  2WVQ A;  3CEX A;  1IFJ A;  3TYY A;  5IY5 C;  3ZC4 A;  2H8A A;  2FFD A;  2CYD A;  5APY A;  2YEV A;  1FJK A;  3AJM A;  1LI7 A;  1ZW0 A;  1ZR2 A;  2W83 C;  3HE5 B;  4JEB A;  1AVO B;  3TF5 A;  3H32 B;  2QJY B;  1SZI A;  1L4A D;  3AEA C;  1I4Z A;  5D91 A;  1JY2 P;  3VYI A;  1RCP A;  3AE8 C;  5DS6 A;  2MWQ A;  2L6F A;  3UIA A;  2OU6 A;  3H2U A;  3L70 E;  3E70 C;  1EZV G;  4I7Z C;  5AW9 B;  3SWF A;  1T6I A;  2M5A A;  3FXH A;  3RBX A;  3AE9 C;  1HGV A;  3ZQV A;  5B66 H;  3L74 G;  4IB4 A;  2M8R A;  4KBL A;  3MP7 B;  1MV8 A;  3F5H A;  1QPU A;  1J1E B;  2LIG A;  4G7O F;  1CPQ A;  3TGU J;  3LUT B;  2FYZ A;  2W8Z A;  1XTC C;  1S9K E;  3GEH A;  1BGY J;  3PDM P;  2KIK A;  3U5S A;  2L9J A;  3C8V A;  4GT1 A;  1JY2 N;  2H8P D;  4PAC A;  3S90 A;  3L72 G;  1N7S B;  3Q6N A;  1L0L E;  4NQF A;  3WUT A;  1X9V A;  3AEB C;  3RK2 D;  1EDL A;  1HF9 A;  4YTP C;  3L73 G;  3AE7 C;  1MNE A;  3SFE C;  4IL6 E;  2BE5 F;  3LEO A;  2R7R A;  1M1K Q;  4P9F A;  2V7Q H;  3GEI A;  1NU1 K;  3AG1 C;  3ASO C;  1M2V A;  4G7H F;  1FBM A;  1VQ4 P;  1QLE C;  1FZC C;  1LT1 A;  4ONS A;  4H0L C;  5AC5 A;  2HR3 A;  3T6G B;  2FFD B;  3TJ5 A;  1PV3 A;  2W6J H;  5DVW A;  1AVY A;  3CD6 P;  3EZH A;  2XLO A;  1V55 C;  2XS8 A;  3L36 A;  5KYX B;  1OVU A;  3HE5 A;  2QSI A;  4DCK A;  1AVO A;  5JSL A;  3KHU A;  4LDK A;  1T8Z A;  2PRR A;  4O7G A;  3FGA D;  3U59 A;  3K1I A;  1B68 A;  3NKE A;  2ICW G;  2Y0E A;  3ABL C;  4XFJ A;  2Q3T A;  5T3W A;  2PF4 E;  4IL6 H;  3OW2 O;  5CCH C;  1RKC A;  4X0R A;  2QEX P;  1RQU A;  1Y9B A;  2P58 A;  3B71 A;  2PFX A;  2OEX A;  4ZKP A;  1S5L X;  4E17 A;  2HKV A;  2PBE A;  2PX3 A;  2WSE H;  1AV1 A;  2ZVO B;  4OGQ D;  1Q0G A;  5E3A A;  4CS7 A;  3DI5 A;  1QKR A;  1I4Y A;  1QVF O;  4JCZ A;  4BEM J;  4WWI A;  3V6I A;  1OCC C;  1TR2 A;  2N1T B;  3MGN A;  3A5T A;  2QUP A;  1LKX A;  4CDV A;  1R5L A;  3EQ2 A;  1Z5Z A;  4WGY A;  3J06 A;  3SP1 A;  2PGD A;  2FXM A;  4DZO A;  1FJP A;  4DRJ B;  2KZI A;  1ZOY C;  3ABV C;  3FHD A;  2HYN A;  1QX8 A;  1RF0 A;  3NTN A;  1C17 M;  1YYJ A;  5DQZ A;  2DGJ A;  1QEX A;  4LC1 A;  1NWQ A;  2ZYG A;  4JW1 A;  2PP6 A;  4JE9 A;  2WPS A;  2O3J A;  1NTM D;  3K7D A;  3RFY A;  4CX9 A;  1NKN A;  1HVV A;  3M0D C;  3LAY A;  2NSF A;  4D6T E;  2A06 D;  3L1M A;  1IK7 A;  4NPF X;  3JYH A;  3LJB A;  1Y6D A;  1X22 A;  3H1J E;  3G6E P;  4E18 A;  4E7Z A;  3S84 A;  2B9B A;  3LIE A;  3CWB G;  4LGD E;  3DWW A;  3VTP C;  3TQO A;  1SQQ E;  3CCL P;  4DRI B;  2G8Y A;  1CW5 A;  5CJ4 A;  3AOU A;  5TIS E;  3HUS C;  3ZG1 A;  2VH3 A;  4U5B E;  3DKA A;  2KB7 P;  1NTM G;  2C04 A;  5BQG A;  4QI0 A;  3D6Y A;  1VB5 A;  1SQQ D;  1V54 C;  2YO2 A;  4R32 A;  3C62 A;  1W2W A;  1MFT A;  3H1J D;  3N4X A;  3IPM O;  1Q0F A;  1WMK A;  2R7Q A;  2E75 D;  2F22 A;  3EFF K;  2J9V A;  1S1C X;  1T2K D;  1QZX A;  4PV1 D;  1L0N D;  4IFF A;  3GG2 A;  3CSK A;  2Q3I A;  3ECS A;  4GQH A;  2RSE B;  1NU9 C;  2YO3 A;  1TU3 F;  1CGN A;  3ZDL A;  5GTI E;  3MD0 A;  2N9Y B;  5E79 H;  4XQ1 A;  5C39 A;  2V26 A;  5KJ7 A;  3K6B A;  3RF3 A;  1YYX A;  4M63 A;  1USE A;  1WOL A;  5BQI A;  2EPO A;  4C3B A;  3M9H A;  4U3F J;  1SQX D;  5KYY B;  3EH2 A;  4ZLD A;  3GM3 A;  5L0G A;  4U3F E;  4QDL A;  2H7B A;  2WZ7 A;  1U7J A;  2CPB A;  1JCC A;  4Q4Z F;  1LP1 B;  5AW5 B;  1LT9 C;  1BR1 A;  2WPV B;  5JS5 A;  3USS A;  3GHG B;  3C8G A;  1NVO A;  2IZ1 A;  4O6M A;  2DW3 A;  4I1L A;  3KYQ A;  4U5C E;  3V2N A;  2IBZ G;  4EBB A;  2FBW C;  1T6Q A;  3WHN A;  2K9J B;  2P6V A;  1Q0K A;  4UB6 E;  2VCC A;  1S5L H;  3BRV B;  1SYQ A;  3B0P A;  4J32 B;  2A06 E;  5A6A A;  3US6 A;  3B0V C;  1T01 A;  3IQT A;  3CLQ A;  5CHX A;  2Y9Y A;  3C8Z A;  2IM8 A;  1DD4 A;  1GL2 C;  2CNW A;  2AU5 A;  1LTT C;  4XWJ A;  1L0L G;  4YK5 A;  4WY4 C;  3K5B A;  2I8B A;  2XL8 A;  5K0I A;  4OH8 B;  1SLQ A;  1G8X A;  1FNT c;  1VPC A;  2Q1K A;  3G4Z A;  3KMI A;  4PJN A;  2IBZ D;  4DOJ A;  3SEO A;  5F5H A;  3HD7 D;  1RE3 A;  3B29 A;  4WB4 A;  2XLW A;  2A69 F;  1N7S A;  4MTO A;  1BDC A;  2P0N A;  3I5C A;  2NPS A;  4ER9 A;  1M1J C;  4B6I A;  4C3E A;  3MYF A;  5HSW A;  1IZN B;  2C0X A;  3UGO A;  2YXQ B;  1HH0 A;  3Q7L A;  5TIS H;  4EDF A;  4PV1 B;  1EDJ A;  1Q81 Q;  2W6B A;  1N73 B;  3E1R A;  3S28 A;  2Z4E A;  3ZTZ A;  2V4H A;  2VB6 A;  5EK0 A;  3VOP A;  2O01 N;  2B87 B;  3D70 A;  2G62 A;  5KLV D;  2JPU A;  2KK7 A;  3TK1 A;  2PX0 A;  5CCG C;  2L81 A;  1Q7Y Q;  3CXH D;  4YL3 A;  1PFI A;  3UNG C;  1VF5 C;  1KB9 D;  4G78 A;  5KLV K;  2OYH A;  3EWK A;  3EGD B;  1KQS O;  3P8C D;  2A6H F;  4N4W A;  5AC4 A;  1YZA A;  2BEQ D;  3Q2Y A;  3EZI A;  4JTC B;  2VCB A;  4W7Y A;  1L4A B;  4CIP A;  3JCU E;  1PD1 A;  2EIN C;  4AL0 A;  4PFP A;  3AEF C;  1EC5 A;  4C7N B;  3HNK A;  2M0B A;  4HYT B;  4RBN A;  4N6C A;  3CX5 D;  4JJF A;  3U1A A;  2J9W A;  3L73 D;  1HMD A;  2BL2 A;  1AFO A;  1M56 C;  5FCL A;  1LTS C;  3H1H E;  2J7P A;  2WSC H;  1KB9 E;  1VK5 A;  1R5S A;  1KD1 Q;  3WAQ A;  1DD3 A;  2HV6 A;  4ZMD A;  1KFM A;  3EHN A;  1VYI A;  2FYU G;  1W2B O;  3GEE A;  1RF1 C;  3RIP A;  4EI2 A;  2JWD A;  2D2C C;  3WOD F;  5CBN A;  3TDK A;  1BSN A;  2NPS B;  3L35 A;  3PTZ A;  5GTI H;  3SXZ A;  2WWW A;  2OYO A;  4WBA A;  2KSE A;  4I3M A;  2O1K A;  5EHH A;  3H1L J;  3F89 A;  2LP4 A;  2IPP A;  1N73 A;  1S4X A;  1WT6 A;  4D4X A;  2W6A A;  2E75 C;  1S72 P;  3T4R A;  1YBK A;  2B87 A;  1ZRT D;  1BGY G;  5EFW B;  1FZF A;  1UIX A;  2QIW A;  1IK9 A;  2A45 I;  4BG0 A;  3L4F A;  3A0H H;  1SQV E;  4YT2 A;  3ASN C;  3DJU B;  2IBZ E;  1YIT P;  1NBB A;  3H1L G;  5AVQ B;  3FWL A;  4H13 C;  2HSQ A;  1TWC A;  3LNR A;  1BGY E;  2YL1 A;  1P84 I;  3G50 A;  3H2V A;  2R3S A;  2H89 C;  5GPG B;  1YQ3 C;  4ASV A;  3G9R A;  1DOV A;  1L4A A;  3M1C B;  2VRS A;  2JO1 A;  5KKZ C;  3WU2 H;  1V4A A;  3KXD A;  1NAF A;  2WB7 A;  3W4Y A;  3Q1M A;  1H6G A;  3RBZ A;  3DM5 A;  2RH0 A;  1RKE A;  1EZV E;  2CK3 H;  3L70 G;  4L6R A;  2FYN B;  1V74 B;  5D92 A;  3AQC A;  1JTH A;  2FYN C;  1N73 C;  1YI2 P;  1O3U A;  3QW1 A;  3EQL F;  5AW0 B;  2Y9Z A;  1SQV D;  4MVQ A;  3II6 A;  1KIL E;  5AVV B;  2G3V A;  3QW0 A;  3RK2 C;  2KYH A;  1C02 A;  3BCC J;  1SR2 A;  2LXC B;  1J8M F;  4RO0 A;  1ZXG A;  1RE4 A;  1FR0 A;  4Q7C A;  5L0H A;  2VCA A;  1ORJ A;  1PGJ A;  1JMB A;  3M9Q A;  5JVE A;  1OZH A;  3FXE A;  2KNH A;  5GTH E;  1NO4 A;  2LR2 A;  2N1T D;  2B0J A;  2HOD A;  4PJ0 E;  3E1I A;  2BCC E;  4JVS A;  5KYY A;  3JT1 A;  5AGF A;  3TSI A;  4IJJ A;  2IYO A;  1PGP A;  3GOR A;  4EBJ A;  3RK3 E;  1CGO A;  4CS9 A;  3L71 G;  3C8G B;  3CAX A;  5CCG A;  3Q7G A;  2AEF A;  5APW A;  3DAF A;  5KYX A;  3A0B H;  5KLI B;  2YLD A;  3KKB A;  3GW6 A;  4EWC A;  2KQ9 A;  4RD9 A;  3VMA A;  5B3S C;  1PPJ D;  3OA7 A;  3KYI A;  1YIJ P;  1OXZ A;  2JP3 A;  1SQQ J;  4PK4 A;  2OQM A;  2JD3 A;  4YJW A;  2NUP B;  2QE7 H;  5AVZ B;  2XRH A;  1KZU B;  1MMA A;  2WVN A;  2C03 A;  1BR4 A;  4BXL A;  5CIV A;  5F28 E;  3AE4 C;  1MZ9 A;  3VP8 A;  1JPJ A;  1FDO A;  1YJW P;  2B0H A;  2EPK X;  1N7S C;  1RQV A;  4Z9H A;  1D0Z A;  3CXH E;  1KYO E;  1OWA A;  4RJT A;  4CDY A;  1ZHX A;  2H7V C;  1LTJ C;  2WMM A;  1HJB A;  3AEE C;  1BE3 E;  2KUB A;  2J0W A;  3H1J J;  2P2U A;  2QJK B;  2UUI A;  1YJN P;  3GOD A;  3G3Z A;  4J30 B;  4EHP A;  3O10 A;  2Y0C A;  4D6T J;  3BRT B;  4NTA A;  1NTM J;  1FFH A;  2VAS A;  3T97 A;  1FZE A;  3CCV P;  1J8Y F;  1NTK J;  1ZZP A;  1XZP A;  5COF A;  1K8A Q;  3H65 A;  3RQE A;  3H1K G;  3IQ6 A;  2XS1 A;  3A7O A;  2FYU J;  1G5Z A;  5L3V A;  2M64 A;  3EFG A;  1M90 Q;  3LEV A;  1KB9 H;  1GDT A;  1NTK E;  2Y3D A;  5COG A;  4WJ0 A;  2XLM A;  4IL6 X;  5TJH A;  1LT9 A;  1F1M A;  1PP9 G;  2KZJ A;  3PMR A;  1RY3 A;  5B3I A;  3H32 A;  4KT0 J;  3V2R A;  1P84 E;  2IXP A;  2OGU A;  1GL2 A;  1CPR A;  2XU6 A;  1KOR A;  2CGE A;  1BCC J;  2EIM C;  3MTU E;  3GM1 A;  4YT5 A;  1J1D B;  5HV9 A;  3ZIB A;  2M4E A;  1SQP D;  2O01 H;  4O6Y A;  2OOC A;  3FOP A;  1K73 Q;  3PJS K;  4EKW A;  2YL3 A;  3U2L A;  1G4U S;  1JY3 N;  3KQG A;  1JM0 A;  3MHV A;  4EUK B;  3PCV A;  2MYS A;  1L0N J;  1VQL P;  2M5A B;  4CPG A;  4N78 D;  1H0T A;  2J0X A;  1R8E A;  1KYO D;  1GZL A;  4FWV A;  3I55 P;  4HFK B;  1DOW A;  1KIL C;  1FTS A;  3H1H D;  1H89 A;  4JC7 A;  3NG1 A;  3HTK A;  3FXD A;  5M1B A;  5CCH A;  3GAN A;  256B A;  1T5O A;  3OJA B;  3TD7 A;  1N8R Q;  4HFF B;  2CNW D;  1HJ0 A;  1SQP G;  1RHZ B;  2WZF A;  3QVZ A;  4JF7 A;  3PRJ A;  1TWH A;  1VDF A;  3A11 A;  2IFN A;  3A2A A;  3IEE A;  4YT4 A;  3S0X A;  2YNY A;  2R5B A;  3T97 B;  1D0X A;  4N06 A;  3CWB J;  1W5C E;  2XL6 A;  2KS1 B;  2HMZ A;  2QJP B;  1FOS E;  2JJL A;  2R02 A;  1SS1 A;  4LLE A;  2YZS A;  1E79 H;  1VQN P;  1LE4 A;  3JTL O;  1OIP A;  3POV A;  4TT3 H;  1OCZ C;  4K0D A;  3H1H G;  3B0U X;  1S5L E;  3RK3 D;  4KNW A;  1J1E C;  4MVS A;  5KAF H;  1MQV A;  4JQ0 D;  3S4R A;  1S3J A;  3H1L D;  2QY9 A;  1OCO C;  2HV7 A;  1KFN A;  2ETS A;  3EH1 A;  1D1C A;  1FU1 A;  3GHG A;  3PLN A;  4XPY A;  3AE1 C;  1KQF B;  2Y3H A;  4BPM A;  4MS2 A;  4IAR A;  2A6E F;  4O6N A;  4DT0 A;  2MJZ A;  1OMI A;  4GOE A;  1FAV A;  1BCC G;  1BE3 G;  3CL3 D;  1GL2 B;  4ANJ A;  2WSE J;  2V7Q J;  2QJK C;  3KH2 A;  3RYL A;  2NUT A;  4WY4 B;  2AXC A;  3JC2 2;  1IFN A;  2Q9A A;  3EGX B;  3O6X A;  3HD7 A;  2XDJ A;  2B89 A;  3P7K A;  2ZYA A;  4H0L B;  4AUW A;  3QH9 A;  2AEM A;  1Z3I X;  3LNM B;  4YT8 A;  1HGZ A;  2QVA A;  3HRN A;  3L73 J;  2PFD A;  4KNV A;  4PJM A;  1IZM A;  3IQ5 A;  4D6T D;  3ABM C;  2OKU A;  1VQ9 P;  4LDR A;  3EPV A;  3FDQ A;  3ABK C;  5BVZ A;  1N7L A;  1HY5 A;  2KLU A;  3U8P A;  1SQP K;  2ZT9 C;  4BJ6 A;  2PP4 A;  5E79 E;  1QLE D;  3RK3 B;  1LM3 B;  5A6B A;  4K35 A;  1FS0 E;  5AW1 B;  5L3Q A;  1E83 A;  1SQB G;  1K40 A;  4KC9 A;  3RL0 C;  1HTL C;  2FGY A;  1JY3 O;  1URQ A;  2HOD B;  4GIF A;  2C0W A;  2YKO A;  3RK2 B;  1SQV K;  2HLO A;  2B88 A;  3U8V A;  3EHM A;  3K1I C;  4NY3 A;  1NHL A;  1ZLL A;  2WIT A;  5APS A;  4M3L A;  1N7S D;  2G3A A;  2R25 A;  2ZXE B;  2YLI A;  2M3E A;  1IO4 A;  4GOF A;  4L76 A;  2LQG A;  1SQX G;  2LFF A;  1SVF A;  1JAF A;  4GKG A;  1SQQ K;  2Q9I A;  1Z23 A;  4MVO A;  2G3K A;  4Y28 J;  1SQB D;  4C7R A;  1YZC A;  3CCS P;  4I6M C;  1GS9 A;  3T9O A;  3H1L E;  1OFC X;  2QJY C;  2P61 A;  3RL0 D;  2Q3E A;  4RKU J;  2IFM A;  3DXJ F;  1M56 D;  1LTJ A;  3KZI E;  1LI5 A;  4J7T A;  2V3C C;  1IFI A;  2BCC D;  5CMZ A;  1GW3 A;  5KLI C;  1YAU O;  2LK4 A;  4W8K A;  2YXR B;  2YL7 A;  4L73 A;  3UMH A;  3CCR P;  1QSP A;  2ZFC A;  2RMZ A;  1JY3 P;  4CS8 A;  5FZT A;  2NRG A;  2P10 A;  3O8Z A;  4HJG H;  2KI7 B;  2HFI A;  2JDI H;  2QLA A;  4CIH A;  3NMJ A;  1JMM A;  1PGQ A;  1FAP B;  3H1K E;  2DYS C;  1YHQ P;  5KJ7 C;  3UMK A;  5AW2 B;  1ZHY A;  5B1B C;  1KC8 Q;  2AWY A;  4N3Y B;  2R7O A;  5KAI E;  2GUS A;  4EBK A;  1U7M A;  4KHX A;  1RE4 C;  4OVN F;  3P8C E;  4PFO A;  4RES B;  5KYN A;  3B5N B;  4ULW A;  3B5N D;  2FYU E;  3ZVR A;  3EG9 B;  2R3C A;  3L75 D;  4AE4 A;  3KL4 A;  1OCR C;  2CDQ A;  5JT4 A;  3TK0 A;  1NSG B;  1KB9 I;  3OWT A;  1S9K D;  3OEO A;  1J2J B;  1NTM E;  4H13 D;  3GWL A;  1ZW3 A;  3A0H E;  4I1O B;  1L3P A;  3M06 A;  2FFD C;  2H7H A;  1SQB E;  4CJO A;  2ZYD A;  4WGZ A;  1WTY A;  5APT A;  3HLZ A;  2KJG A;  1WWP A;  1XTG B;  2WSF H;  5AVS B;  2HFE D;  3CX5 I;  4YL0 A;  1TFK B;  1LJ2 A;  2LFD A;  1WGW A;  4H44 D;  1NU1 D;  4HH2 A;  2W4B A;  5CI9 A;  4GEH A;  1Z56 A;  2OTL P;  3FWN A;  4XA4 A;  1M2O A;  4OWF A;  2FXO A;  4KJM A;  1RF1 B;  4L75 A;  1RKE B;  2WL8 A;  3H6P A;  1SF8 A;  2E76 B;  2OEV A;  3H1I G;  1EXJ A;  4MW3 A;  3GHG C;  4MQ9 F;  1NTZ J;  1EZV D;  4JYB A;  3OAK A;  3AEC C;  2XL4 A;  1FDM A;  4JIO A;  5A69 A;  1NU1 G;  4EIY A;  1T3U A;  1ZVZ A;  2KLV A;  2N1T C;  1VLS A;  3R7C A;  4E0I A;  2J58 A;  5JP7 A;  1FMW A;  1E85 A;  4OIR F;  2J8W A;  3SSU A;  2R05 A;  1RXQ A;  1G1J A;  2XM4 A;  1FC2 C;  2IYL D;  2E42 A;  2XZR A;  4PD4 I;  4JKV A;  1Z6A A;  5KLV G;  1HW1 A;  1NTK D;  3N0T A;  1Q2N A;  4NPE A;  3I5Q A;  5KYW A;  5B66 E;  3W2W A;  4YWQ A;  4IFD K;  4U3F D;  4I7Z B;  4U7J A;  1UFB A;  1PGO A;  1BCC D;  4L74 A;  1JOG A;  4BJ6 C;  2P7J A;  4MVR A;  1E86 A;  1RH5 B;  1KN7 A;  2O1J A;  1CI6 A;  3S29 A;  2OYH B;  4A7P A;  5KLV J;  3EGD A;  3RL0 g;  4H0L D;  3WUV A;  1KIL A;  1QL1 A;  2A45 G;  2GDC A;  3IFM A;  2NUT B;  4YN0 B;  3JCU Q;  2Q7R A;  1U0B B;  2ITA A;  1NFN A;  5AVR B;  2HS5 A;  4B86 A;  3L37 A;  2X0C A;  3EJN A;  2L91 A;  3EGX A;  1EQ1 A;  1PCX A;  2FYU D;  4PJL A;  3DM9 B;  3CQZ A;  2LSE A;  2XXA A;  4ZKU A;  4NTB A;  2A06 G;  5CCH D;  2L7A A;  2EPN A;  3MX3 A;  4C46 A;  4QI2 A;  4UB8 E;  3CWB D;  3L74 D;  5L0D A;  1FOS F;  1A7D A;  2E5T A;  2YIU B;  3DAG A;  2BAS A;  2J7P D;  3HNI A;  3CCQ P;  1A02 F;  2KNC A;  2GAQ A;  5DS5 A;  5JLI A;  2GFH A;  1VMA A;  3DZA A;  2HPC B;  4EYY Q;  1L0N K;  1OW7 A;  1U57 A;  3HD7 C;  3JRM O;  3NDB B;  4FAP B;  2OYI B;  1KTM A;  4GYT A;  2WZG A;  3LW5 H;  1A7E A;  2FXP A;  1MMN A;  1G4W R;  2ZT9 B;  3CXH H;  1VF5 D;  1VLT A;  2XM0 A;  4Z1M H;  3DE9 A;  2ZXW C;  3K33 A;  2OG2 A;  4CSA C;  4YL1 A;  1KQL A;  1XWJ A;  2YLG A;  3U9M A;  1HWT C;  1BSH A;  1LT9 B;  2I8D A;  4A4A A;  2JKV A;  2HJM A;  4N6H A;  2NPS C;  3ZTM A;  3G4X A;  1GU5 A;  4QMA A;  4PD4 H;  2YQY A;  1ZRT E;  3UMI A;  1JY2 O;  1YAR O;  2M3B A;  2R7S A;  1AJY A;  4LAC B;  4I1M A;  1KU2 A;  2DB4 A;  2Q9C A;  1LTJ B;  3KPE A;  3OA1 A;  4I2L C;  4WVZ A;  3JRT A;  2Z15 A;  3M15 A;  3AG2 C;  5DJU B;  2FKW B;  3Q3D A;  2E74 C;  3P32 A;  1MMG A;  1YYC A;  2K1A A;  5KAF E;  2H43 A;  1EDK A;  2J9B A;  1WAT A;  1GD2 E;  1P84 H;  1QGK B;  5BUO A;  1SQQ G;  4OGQ B;  3V7O A;  1Q90 D;  2POH A;  1K05 A;  1VQ6 P;  2QRX A;  1LTG C;  2RKL A;  2ZXX A;  2C9N Y;  3H25 A;  4H54 A;  2Q7C A;  3NKD A;  4AL1 A;  3PP5 A;  2JWA A;  3BAS A;  2MKV A;  1ZYR F;  1UG7 A;  2KSJ A;  1HBW A;  4BRY B;  2XLD A;  5E2Q A;  3B5N A;  4F4B A;  2W90 A;  4YXW H;  2Y3B A;  4AE4 B;  4KI2 A;  1XZQ A;  1VQO P;  1DX7 A;  1NU7 D;  2WQY C;  3WMM 0;  5B5E H;  2R7T A;  3F46 A;  3I5P A;  2EIK C;  3HJC A;  1PPJ E;  4JZA A;  2Q00 A;  4U9E A;  1DH3 A;  2XND H;  3AE6 C;  3NXS A;  3R2P A;  3WU2 E;  3NMI A;  2FYU K;  1WAS A;  4CSA A;  3B4S A;  3O55 A;  1M7L A;  3O39 A;  1ZV8 A;  1FE6 A;  3V4W A;  1LVK A;  4IFM A;  1NTK K;  2A1D D;  3TGU E;  1DEB A;  4WY4 A;  4PJJ A;  1KYO I;  1NTZ D;  1N1C A;  2NUP A;  1M6T A;  1L4A C;  3V2P A;  3HE4 B;  1DEE G;  3BCC G;  3HD7 B;  1K9M Q;  5L0C A;  4JUR I;  2AXT H;  2Y69 C;  3LW5 J;  1MND A;  1SQB K;  3L34 A;  3L74 J;  2P1A A;  4I44 A;  2KXP B;  1N86 A;  3L73 E;  3Q6M A;  3JSZ A;  1GMJ A;  2QJP C;  4RDA A;  1KYO H;  1ZHW A;  5KAI H;  4CBE A;  3CC7 P;  3NFQ A;  1FZB A;  3BCC D;  3IR9 A;  3MBG A;  2IOQ A;  1NZE A;  1SFC C;  4N78 E;  1SFC B;  5L0I A;  4P9T A;  1URQ B;  5A6J A;  1URQ D;  2FY8 A;  1KNY A;  2WVO A;  3B9Q A;  1I5N A;  1H88 A;  1VTM P;  4CDA A;  3MZW B;  4NC3 A;  4PJ0 H;  1QQ3 A;  3SXM A;  4DVZ A;  3BEH A;  1GGQ A;  3V5Z A;  5KYW B;  2RD9 A;  2QE9 A;  1VQ7 P;  2ASR A;  2C9L Y;  3NYM A;  3MFN A;  1N2D C;  1PP9 D;  5COM A;  4UDV A;  2R7X A;  2OTJ P;  1Q86 Q;  2ZXR A;  3D71 A;  5T1D B;  2WSC J;  3L72 D;  4CS9 C;  3MYI A;  1NTZ K;  3W8I A;  1YDI A;  4N6J A;  2CW0 F;  3CZ6 A;  2IYP A;  5AW8 B;  2W9Y A;  3RW0 A;  4H13 B;  3EFO A;  3ZDM A;  1L0L K;  1M57 C;  1D1A A;  2HSB A;  1YJ9 P;  1JR8 A;  4ZLC A;  1IFM A;  3CWB E;  4JEA A;  3SXY A;  1WRG A;  3H1J G;  4OD5 A;  1NU1 E;  5KKZ B;  3C1L A;  3HE4 A;  2QTV A;  2OJE D;  2YMK A;  2OYH C;  4O9B A;  1H0T B;  4BJT A;  4U5F E;  3U1C A;  3CC2 P; 
#chains in the Genus database with same CATH homology
 2FXP A;  3GMA A;  2O01 J;  4TT3 H;  1S1C X;  2ZT9 B;  3AEE C;  1VF5 D;  3FGA D;  2H89 C;  4PV1 D;  1MKM A;  1YQ3 C;  2QJY C;  3G9R A;  3Q5S A;  4Z1M H;  3AEC C;  4XFJ A;  4RKU J;  2JO1 A;  5KKZ C;  2E76 D;  1NYH A;  3Q5P A;  3JYY A;  4OGQ C;  2E74 B;  3D70 A;  1V4A A;  3AE5 C;  3O10 A;  2JPU A;  3GF3 A;  3U0C A;  5KLI C;  1TU3 F;  4R4M A;  3Q1M A;  2LK4 A;  4H44 B;  2NZ2 A;  1RQU A;  3L8J A;  1Y9B A;  3L8I A;  1KQG B;  3AJM A;  3AE1 C;  3B71 A;  1KQF B;  1VF5 C;  1OW6 A;  4PV1 C;  1ZZP A;  2FYN C;  1S5L X;  3LW5 J;  1O3U A;  2PBE A;  1KMI Z;  1WOL A;  3RQE A;  1OMI A;  3EWK A;  3RQF A;  3AEA C;  4OGQ D;  2P10 A;  2WSE J;  2BEQ D;  2D2C B;  2V7Q J;  3IN6 A;  2QJK C;  3Q2Y A;  1KIL E;  1ZRT E;  2E74 D;  1K04 A;  1VL2 A;  3GM3 A;  3R4Y A;  1PL5 A;  1GMJ A;  2QJP C;  1AJY A;  3AE8 C;  1FDI A;  3AEF C;  2L6F A;  1DIP A;  4I7Z B;  2WPV B;  3C8G D;  4I7Z C;  4IL6 X;  4U7J A;  1UFB A;  2YWA A;  3C8G A;  4EBK A;  3GF7 A;  3BRJ A;  2YIU C;  1ZOY C;  4H0L B;  3Q3D A;  3AE9 C;  1JOG A;  3JZ0 A;  3ABV C;  2E74 C;  3D6Z A;  1DD3 A;  2FBW C;  3AEG C;  2J5U A;  1OW8 A;  1KNY A;  4KT0 J;  3U3F A;  3RL0 g;  4H0L D;  2OQQ A;  1KOR A;  4XEV A;  4OGQ B;  3S9O A;  1Q90 D;  3SFD C;  3GM1 A;  1K05 A;  3IAO A;  3TUL A;  3C8V A;  3K7D A;  3GM2 A;  3RQG A;  1DD4 A;  2JX0 A;  2ZT9 C;  2L6G A;  1PIX A;  4EBJ A;  2D2C C;  1VF5 B;  3H25 A;  3MFN A;  4H13 D;  3RK3 E;  4GDO A;  4NQF A;  3AEB C;  3GLM A;  1HF9 A;  4YTP C;  3C8G B;  3AE7 C;  2MKV A;  3SFE C;  3D71 A;  1IK7 A;  2WSC J;  4XEF A;  1R8E A;  1K40 A;  5L8R J;  1WTY A;  3AE2 C;  1WWP A;  2E76 C;  3Q5R A;  2ZT9 D;  2WSF J;  2G8Y A;  2KK1 A;  2D2C D;  4H13 B;  1QVX A;  2IDB A;  2BEZ F;  5M1B A;  4H44 D;  2E75 B;  2HSB A;  2G3A A;  2WQY C;  2JP3 A;  3O6Q A;  2E75 C;  2L6H A;  1HJ0 A;  4H0L C;  3AE3 C;  2Q00 A;  3D6Y A;  1UIX A;  4XEK A;  2QIW A;  3AED C;  1PV3 A;  1ZP0 C;  3AE6 C;  2H88 C;  2YMK A;  5F28 E;  3AE4 C;  3T97 B;  1YQ4 C;  4R32 A;  4R4L A;  1NGM B;  1FDO A;  2E76 B;  1JB0 J;  1OW7 A;  1U57 A;  1RQV A;  4H44 C;  2QSI A;  4Y28 J;  4YXD C;  1EXJ A;  1ZME C;  1WMK A;  4H13 C;  3C18 A;  1EXI A;  2K9Y A;  2E75 D;  1KTM A;  4PV1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...