2CYDA

Crystal structure of lithium bound rotor ring of the v-atpase from enterococcus hirae
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
156
structure length
156
Chain Sequence
MMDYLITQNGGMVFAVLAMATATIFSGIGSAKGVGMTGEAAAALTTSQPEKFGQALILQLLPGTQGLYGFVIAFLIFINLGSDMSVVQGLNFLGASLPIAFTGLFSGIAQGKVAAAGIQILAKKPEHATKGIIFAAMVETYAILGFVISFLLVLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords V-type sodium ATP synthase subunit K
publication title Crystal structure of Lithium bound rotor ring of the V-ATPase from Enterococcus hirae
rcsb
source organism Enterococcus hirae
total genus 74
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2005-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00137 ATP-synt_C ATP synthase subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) lithium bound rotor ring of v- atpase 2cydA00
2BL2A 2DB4A 5TJ5E 3AOUA 4BEMJ 2CYDA
chains in the Genus database with same CATH superfamily
3I5PA 3QZCA 2Y3GA 3O6XA 1Z3IX 1JOGA 2L81A 4JJFA 5KYWB 2W9YA 4XPXA 3U9MA 2IBFA 5JLIA 1WOLA 2WL8A 1MMAA 2C03A 3AG2C 3O10A 1D1AA 4JZAA 4MTFA 3VF0A 4E0IA 3GEEA 4IWBA 3B9QA 5BQGA 2J0XA 4CDAA 4MTGA 1O3UA 2J45A 3MLGA 3LAYA 2JX0A 2O9XA 2HKVA 2OU6A 5F28E 4E0HA 4YT4A 3JYYA 3UR3C 2ETSA 3HKKA 3SP1A 5JUAA 2YHSA 5TJ5E 3GEHA 3ZQYA 1T5OA 4E17A 4RBNA 5D92A 4PFPA 2OJQA 2ZPAA 2IOQA 1W2WA 3VRCA 5L0GA 1YA9A 4MNDA 4O7GA 1QZXA 2EILC 1ZHTA 1E2XA 3B0VC 4U5CE 3TJ6A 3C8ZA 4IB4A 4PFOA 1I4ZA 1YA7O 5COMA 3LEOA 1AUEA 2GAQA 4C3DA 1HE9A 4G78A 1WN0A 4Q5SF 1LS1A 3O39A 1OW6A 2A1DD 3LS1A 4LDKA 1SR2A 1ZHZA 4E18A 2YL3A 3S29A 4DVYP 1MNEA 4EBBA 2NSFA 4C7OB 2VCCA 4E7SA 2L6HA 2MHRA 3DJNB 1RMVA 1UFBA 1EA8A 4G0HA 1VB5A 2FAPB 2X0CA 3K66A 1ZZPA 2WVQA 4L6RA 3R7CA 2YZSA 2OOCA 4I1OB 5L0FA 4DJ9A 1MNDA 2R7SA 5BQIA 4JIOA 2PX0A 4BJ5A 1HMDA 3GANA 4I1MA 2DGJA 4IARA 4HE8D 4NTBA 1TWHA 3WHNA 2EIKC 4YT8A 4G7ZF 1HW2A 2R7UA 3NKEA 2BC5A 1RXQA 1VK5A 4W8KA 4PJMA 3RVZA 2XXAB 2J9VA 3OWTA 2G3KA 1MQVA 2R7QA 5B1AC 3K7DA 4N4WA 3C18A 2HJ3A 4LDRA 3RH3A 4A2NB 3LS0A 4J32B 4MW3A 3EPVA 1TWCA 1BBHA 5T3TA 3QVZA 5T3WA 3G4ZA 1VLTA 4QI0A 3ZQVA 1VOMA 5A6AA 2EINC 1V4AA 3Q7GA 4JW1A 3LEVA 3JZ0A 4CIPA 2XS1A 2A0BA 5CIVA 2I8BA 3DM9B 3HTKC 1WWPA 2XLVA 2XM0A 4C3BA 2XLMA 1LE2A 4PJNA 1OKKD 3DZAA 5L0IA 1H7IA 5D91A 2LK4A 1SYQA 3W2WA 1YVIA 4DVZA 4KBLA 5E3AA 4C7OA 4UDVA 2J9BA 3DJUB 3OEOA 2XXAA 3QMKA 4AL0A 2E87A 3ABMC 3IQ5A 2EIJC 1O87A 1ZVZA 1LI5A 4PK4A 1MMDA 3CSKA 3SYNA 3CEXA 3NG1A 3RQGA 3RKOF 3U9JA 1PD0A 4DBQA 5E3CA 3SXZA 1NFNA 4EHPA 4BG0A 5B1BC 1MMGA 2M64A 4U5BE 1NSGB 2YLGA 5L0JA 5CI8A 1QVXA 1D0YA 2QE9A 4YK5A 2PFDA 3AJMA 3U3FA 3ZTMA 5A6BA 4KI2A 4U9EA 3GODA 3IHUA 3JSEO 3SEOA 4MVUA 3RF3A 3TULA 5DS6A 4XLPF 1FNTc 3NKDA 3O55A 3PMRA 2YRFA 3EGDA 4AK9A 3HNLA 5A6JA 3GM1A 2QLAA 3X1OA 3C8GA 4ZLCA 2NG1A 1M57C 1U0BB 4IJJA 1IZMA 5JT4A 4CJGA 3JYHA 3EZIA 3N2ZB 2ZXOA 1YZAA 1OCRC 2HFIA 2R7VA 3C62A 4NC3A 3NYLA 1Q0FA 4OD4A 1M2VB 3U2LA 4OIPF 3DM5A 1L3PA 1JR8A 4XEVA 2PBEA 1J8YF 3M4CA 4CDVA 4PJLA 3MX3A 3WG7C 2V26A 2Y69C 1C03A 2NUPB 3KKBA 2WZFA 3DXJF 4U9DA 3AGTA 2CNWD 2L7AA 4BPMA 4MTOA 2W45A 5DLJA 2A6HF 1J8MF 3MBGA 4DBRA 2XL8A 2Q9AA 2AWCA 1FAPB 1C02A 2VCAA 1TR2A 3E9VA 3EGXA 3LLKA 4MVOA 3UMKA 3V5ZA 1TKNA 3K6BA 4KNWA 1GGQA 4RDAA 1OQCA 2L9JA 4O6NA 4BJTA 2R7OA 3IQTA 1A41A 3NYJA 1OXKA 1JPNA 3A11A 4K0DA 5DS4A 2BL2A 2D4UA 3JRMO 1ZYRF 1RJ9B 1BR1A 4JE9A 4NTFA 1DOVA 3DKAA 4XPYA 2KNHA 3FAPB 1M2OA 2XSEA 3CQZA 2J8WA 4LLEA 2FGYA 2XLHA 1WGWA 3US6A 3GM3A 4IAOA 1KU2A 5L0CA 3EFOA 4FAPB 1ORSC 3ABKC 3S28A 1VMAA 2GA0A 5B3IA 4PACA 5EHHA 1N1CA 1OCCC 1Z5ZA 2KW3C 2W4BA 2JPUA 1MMNA 4YL3A 1M2VA 4P6IC 3RW0A 2KC3A 1OR2A 3TK0A 2IXNA 3DAGA 3WODF 2H7BA 3KMIA 4HEAJ 4EIYA 3A9CA 2EPKX 4EBKA 5KYYB 2XLOA 1T6IA 4XPWA 256BA 1Q0KA 3GORA 2Y3BA 5HV9A 2OKUA 2DB4A 1XZQA 2YLDA 3AQBA 3S27A 3J06A 2R9RB 3N24A 2R02A 2YL1A 1OKKA 3V7OA 2EPMX 4AL1A 5KYXA 1M56C 1GM5A 2WB7A 1YZCA 1QKRA 1ZU5A 2G3VA 4MQ9F 3Q6MA 2LQGA 4O6YA 5KYWA 3L0IA 1WASA 2J7PD 1HW1A 4JCZA 1K04A 3EZHA 3IEEA 3I4UA 4YN0B 2TMVP 3T6JA 2WZLA 1OW7A 2OCCC 1A7EA 4CS9C 4GQHA 3RFYA 1NLXA 1F1MA 3HJCA 1T01A 3QW1A 4ONSA 4NQFA 3SXKA 3PCVA 3W4YA 1AVOB 2CDQA 4DXWA 1H6GA 4H4KC 4LLCA 4Z9JA 4QDLA 3ZSUA 1VLSA 3Q7LA 3JSZA 4H54A 3C7JA 1TWGA 4N6CA 4CDYA 4JEAA 1QSPA 4WGYA 3EG9B 3B0PA 3HNJA 2HJMA 2C04A 4NCQA 4F4BA 4OD5A 3DWWA 1NU9C 2R03A 3HNKA 4MVSA 4BEMJ 3EH1A 3K33A 2B0HA 2HS5A 2Q4FA 3FOOA 4MVRA 1RKEB 3FXHA 3AOUA 2L6GA 3UMHA 3M15A 4IGGA 3LLIA 4IRUA 4CS7A 1ZW2A 1T9KA 1OXBA 2WVNA 1Y6DA 4EBJA 2AWYA 3SXYA 1E84A 2Q9BA 3AGUA 1V74B 2DI3A 2X51A 3H2VA 3TOLA 4LERA 3C63A 3U3BA 2OEVA 3ZTZA 1XWJA 5EGYA 4DRHB 4YL1A 3ASOC 2QY9A 1NFOA 1D1BA 4HFKB 2WVOA 3FAJA 4FX5A 2EPNA 4JC7A 4KNVA 4ULVA 1JAFA 2YVKA 2A68F 2LCHA 3JT1A 2CNWA 3LESA 5COGA 1OCOC 2MYSA 4LDQA 3AG3C 4XEFA 1CGOA 5CI9A 5AGFA 4A4AA 3DE8A 4OINF 3X2QC 1Y4CA 3K1IA 4NTAA 5JSLA 1BR2A 1NU7D 4CS9A 5E33A 2A6EF 3F47A 3NRHA 2PX3A 5BQHA 4M63A 1R4TA 5E2QA 3VM6A 2I15A 2AP3A 5HSWA 3GEIA 3G4XA 2XL4A 3ZVRA 4U5GA 1ZU4A 2P1AA 5KYUB 5JP7A 2CW0F 1D0ZA 2XM4A 3ECSA 3UNGC 3K1HA 3CZ6A 4JRZA 3G50A 1UG7A 4MVMA 4ULWA 1H9TA 3S0XA 2VH3A 3NYMA 3CAXA 1LVKA 1G4WR 4JJGA 4CX9A 2R7TA 3B71A 3BRJA 4JTDB 3T4RA 4P9FA 1M6TA 4NY3A 3ITFA 2OEXA 2KGOA 1O5HA 4N6HA 1ZHXA 1EI7A 1LKXA 5AC4A 3S90A 4XTKA 5IY5C 3PDMP 2G62A 4AX2A 4D4NA 4MVZA 2ZXWC 3QVYA 4PJJA 2IYLD 1CPRA 5DQZA 1T6QA 3DD7A 3NMJA 2M4EA 1YAUO 5AC5A 3PHF2 4U5FE 4BJ6C 2J9WA 4IAQA 2F22A 2J46A 1S7ZA 4I3MA 4R32A 3M1CB 1K05A 4D4XA 2KK1A 2Q9CA 5EK0A 2QNLA 5FZTA 2W4MA 1D0XA 1TFOB 4CIHA 3E70C 4I44A 2R7RA 2EPLX 2FFHA 1ST6A 1I4YA 2ZD9A 3SNHA 3EHMA 1V55C 4Q7CA 4AE4B 3T6GB 1GQAA 3W2VA 4HFFB 2GDCA 1CPQA 3RYLA 1FMVA 4DRJB 4JEBA 5JS5A 3DI5A 3HLZA 3ZDLA 4KC9A 4LACB 4B6IA 1VTMP 1OW8A 4Z9IA 2H7OA 4MVQA 3POVA 2KQ9A 3U8VA 1APCA 2CGEA 3JRTA 4JKVA 1JPJA 1SMYF 2H8AA 4ZLDA 1QQ3A 1Q0MA 1YLMA 1G4US 2ZXRA 4YT5A 3T6BA 2LD6A 1JMWA 1LS4A 1LI7A 2HSQA 3EHNA 3L1MA 4O79A 3S84A 2B0JA 2HZ8A 1E85A 2EPOA 3C8GD 2OJED 2PP4A 1A0BA 2J9UA 2Q3TA 2NUPA 1E86A 2J0WA 1PV3A 2BE5F 4WJ0A 1BR4A 1XZPA 1GS9A 1QPUA 1Z63A 2WZGA 2Z15A 1EQ1A 2UUIA 3AQCA 5A69A 1FTSA 2A69F 1CGME 3ATPA 1V54C 4C3EA 3FHDA 1LE4A 3M4BA 3ZC4A 3W8HA 5JRAA 2YKZA 2LSEA 2H7VC 3LNRA 3ZIBA 2YEVA 2P7VA 2XLWA 2HUJA 2Q7RA 4G7HF 1HMOA 2R05A 4BJ6A 4J7TA 4DOZA 1JRAA 2YWAA 1DOWA 2YLIA 2AU5A 2KSFA 1RJ9A 1TWAA 1Q0DA 3K1IC 1S05A 2ZXPA 4ANJA 4MW8A 3WAQA 2RSEB 4AE4A 4CS8A 3KYJA 3RQEA 2VASA 3ASNC 2CCYA 1FR0A 2NPUA 4J30B 4K1OA 3L34A 3SXMA 1OR3A 2HMZA 3ABLC 1IW7F 1NBBA 3Q6NA 1C17M 3FOPA 3MFNA 4OIRF 1TQGA 1TFKB 2A0UA 2DYSC 2Q00A 4JTCB 4EWCA 4MS2A 4CSAC 2PF4E 2RD9A 4O6MA 2OQMA 1OCZC 2Y3HA 1D1CA 1U6HA 1FFTC 5BUOA 2QTVA 3F46A 1LIHA 3MYFA 4EKWA 1YDIA 3DMDA 1E83A 3OA1A 2HV6A 3M79A 3RQFA 5KYYA 2YL0A 4X0RA 2OG2A 4BJ1A 5KYNA 4OIQF 3GM2A 3B0UX 2IXPA 2V3CC 4FESA 4U5HA 1A7DA 3W8IA 5L0DA 3R2PA 2CYDA 4FWVA 2LFDA 1I5NA 5DQTA 2NUTB 3MYIA 5L3QA 1LM3B 1LPEA 4XLNF 2AVKA 5B3SC 5L0HA 1U89A 2Y39A 5F5FA 1VYIA 2MWQA 5FCLA 1PCXA 3U8PA 2VB6A 3TD7A 1FFHA 4DRIB 3TQOA 3AG1C 3EJNA 5F5HA 3TJ5A 4Q4ZF 1T6UA 3EGDB 3EH2A 4J7YA 3TOMA 1RKCA 3C8GB 2R25A 3DAFA 1R5ID 2HSBA 1VYKA 4YT2A 3LNMB 4CBEA 1YYJA 4CJOA 1K40A 3UGPA 4GYTA 1HY5A 2XLEA 3H65A 4U5EE 1ORJA 3JCUQ 3HNIA 2KYHA 3IPMO 3KL4A 3SZRA 2YL7A 1NG1A 2Y3DA 3FMSA 4BEJA 2HMQA 2VC9A 1YARO 2IM8A 1WATA 4G7OF 2IXMA 3ZWIA 5JVEA 5A6KA 2P0NA 1PD1A 1Z7Qc 5K0IA 3EG9A 3RVYA 3U5SA 2LP4A 2P6VA 4CSAA 4OIOF 4JCHA 4WABA 2XL6A 2XS8A 3DE9A 1Z6AA 3I5QA 3EGXB 3GWLA 3L8IA 4U5DE 4XEKA 2HV7A 4Z9HA 3NDBB 1RKEA 2UUHA 3VYWA 1CGNA 2XRHA 3RIPA 1Q0GA 3NMKA 1YJGA 2GWWA 2P61A 3IQ6A 3NMIA 5T1DB 3EQLF 2ICWG 2LIGA 1SZIA 3L8JA 5DVWA 2NUTA 4QI2A 3N0TA 3U0CA 1NZEA 3UGOA 2L6FA 4YWQA 1SF8A 3KH2A 1G8XA 1A7VA 2LFFA 1BDJB 3V5YA 4JTAB 4ER9A 4E7ZA 1ZHYA 2ASRA 3LJBA 1FMWA 4EUKB 4GEHA 2R7XA 3U2MA 3H2UA 3KYIA 1HE1A 2PNOA 1BZ4A 4P9TA 2IXOA 4RD9A 1EKYA 1KTMA 3JTLO 4PR9A 3VAYA 3EFOB 1QLEC 3QTHA 4CS8C 1KNYA 4XQ1A 3B29A 2KJGA 3S9OA 3V5XA 2QUPA 4N06A 3ZG1A 5DS5A 4XWJA 4YL0A 1WTYA 5COFA 1G5ZA 4JVSA 1YYXA 5L3VA 1ZW3A 3T9OA 4YJWA 1ZHWA 3BEHA 3IQCA 3KPHA 2J7PA 1L7CA 3GWNA 3UMIA 3FDQA 3LUTB 2D5RB 2JD3A 2VCBA 2R7WA 2NSGA 2XLDA 3FVYA 1B68A 2YQYA 2EIMC 4JURI 4W8PA 1AEPA 2DYRC 3QW0A 1Z23A 5KYUA 2GFHA 5KYXB 1RCPA 5GPGB 4BJ5C 5A6BD 1H9GA 1ORYA 3AG4C 4WGZA 4K7BA
chains in the Genus database with same CATH topology
2BL2A 2DB4A 5TJ5E 3AOUA 4BEMJ 2CYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BL2 A;  2DB4 A;  5TJ5 E;  3AOU A;  4BEM J;  2CYD A; 
#chains in the Genus database with same CATH topology
 3I5P A;  3QZC A;  2Y3G A;  3O6X A;  1Z3I X;  1JOG A;  2L81 A;  4JJF A;  5KYW B;  2W9Y A;  4XPX A;  3U9M A;  2IBF A;  5JLI A;  1WOL A;  2WL8 A;  1MMA A;  2C03 A;  3AG2 C;  3O10 A;  1D1A A;  4JZA A;  4MTF A;  3VF0 A;  4E0I A;  3GEE A;  4IWB A;  3B9Q A;  5BQG A;  2J0X A;  4CDA A;  4MTG A;  1O3U A;  2J45 A;  3MLG A;  3LAY A;  2JX0 A;  2O9X A;  2HKV A;  2OU6 A;  5F28 E;  4E0H A;  4YT4 A;  3JYY A;  3UR3 C;  2ETS A;  3HKK A;  3SP1 A;  5JUA A;  2YHS A;  5TJ5 E;  3GEH A;  3ZQY A;  1T5O A;  4E17 A;  4RBN A;  5D92 A;  4PFP A;  2OJQ A;  2ZPA A;  2IOQ A;  1W2W A;  3VRC A;  5L0G A;  1YA9 A;  4MND A;  4O7G A;  1QZX A;  2EIL C;  1ZHT A;  1E2X A;  3B0V C;  4U5C E;  3TJ6 A;  3C8Z A;  4IB4 A;  4PFO A;  1I4Z A;  1YA7 O;  5COM A;  3LEO A;  1AUE A;  2GAQ A;  4C3D A;  1HE9 A;  4G78 A;  1WN0 A;  4Q5S F;  1LS1 A;  3O39 A;  1OW6 A;  2A1D D;  3LS1 A;  4LDK A;  1SR2 A;  1ZHZ A;  4E18 A;  2YL3 A;  3S29 A;  4DVY P;  1MNE A;  4EBB A;  2NSF A;  4C7O B;  2VCC A;  4E7S A;  2L6H A;  2MHR A;  3DJN B;  1RMV A;  1UFB A;  1EA8 A;  4G0H A;  1VB5 A;  2FAP B;  2X0C A;  3K66 A;  1ZZP A;  2WVQ A;  4L6R A;  3R7C A;  2YZS A;  2OOC A;  4I1O B;  5L0F A;  4DJ9 A;  1MND A;  2R7S A;  5BQI A;  4JIO A;  2PX0 A;  4BJ5 A;  1HMD A;  3GAN A;  4I1M A;  2DGJ A;  4IAR A;  4HE8 D;  4NTB A;  1TWH A;  3WHN A;  2EIK C;  4YT8 A;  4G7Z F;  1HW2 A;  2R7U A;  3NKE A;  2BC5 A;  1RXQ A;  1VK5 A;  4W8K A;  4PJM A;  3RVZ A;  2XXA B;  2J9V A;  3OWT A;  2G3K A;  1MQV A;  2R7Q A;  5B1A C;  3K7D A;  4N4W A;  3C18 A;  2HJ3 A;  4LDR A;  3RH3 A;  4A2N B;  3LS0 A;  4J32 B;  4MW3 A;  3EPV A;  1TWC A;  1BBH A;  5T3T A;  3QVZ A;  5T3W A;  3G4Z A;  1VLT A;  4QI0 A;  3ZQV A;  1VOM A;  5A6A A;  2EIN C;  1V4A A;  3Q7G A;  4JW1 A;  3LEV A;  3JZ0 A;  4CIP A;  2XS1 A;  2A0B A;  5CIV A;  2I8B A;  3DM9 B;  3HTK C;  1WWP A;  2XLV A;  2XM0 A;  4C3B A;  2XLM A;  1LE2 A;  4PJN A;  1OKK D;  3DZA A;  5L0I A;  1H7I A;  5D91 A;  2LK4 A;  1SYQ A;  3W2W A;  1YVI A;  4DVZ A;  4KBL A;  5E3A A;  4C7O A;  4UDV A;  2J9B A;  3DJU B;  3OEO A;  2XXA A;  3QMK A;  4AL0 A;  2E87 A;  3ABM C;  3IQ5 A;  2EIJ C;  1O87 A;  1ZVZ A;  1LI5 A;  4PK4 A;  1MMD A;  3CSK A;  3SYN A;  3CEX A;  3NG1 A;  3RQG A;  3RKO F;  3U9J A;  1PD0 A;  4DBQ A;  5E3C A;  3SXZ A;  1NFN A;  4EHP A;  4BG0 A;  5B1B C;  1MMG A;  2M64 A;  4U5B E;  1NSG B;  2YLG A;  5L0J A;  5CI8 A;  1QVX A;  1D0Y A;  2QE9 A;  4YK5 A;  2PFD A;  3AJM A;  3U3F A;  3ZTM A;  5A6B A;  4KI2 A;  4U9E A;  3GOD A;  3IHU A;  3JSE O;  3SEO A;  4MVU A;  3RF3 A;  3TUL A;  5DS6 A;  4XLP F;  1FNT c;  3NKD A;  3O55 A;  3PMR A;  2YRF A;  3EGD A;  4AK9 A;  3HNL A;  5A6J A;  3GM1 A;  2QLA A;  3X1O A;  3C8G A;  4ZLC A;  2NG1 A;  1M57 C;  1U0B B;  4IJJ A;  1IZM A;  5JT4 A;  4CJG A;  3JYH A;  3EZI A;  3N2Z B;  2ZXO A;  1YZA A;  1OCR C;  2HFI A;  2R7V A;  3C62 A;  4NC3 A;  3NYL A;  1Q0F A;  4OD4 A;  1M2V B;  3U2L A;  4OIP F;  3DM5 A;  1L3P A;  1JR8 A;  4XEV A;  2PBE A;  1J8Y F;  3M4C A;  4CDV A;  4PJL A;  3MX3 A;  3WG7 C;  2V26 A;  2Y69 C;  1C03 A;  2NUP B;  3KKB A;  2WZF A;  3DXJ F;  4U9D A;  3AGT A;  2CNW D;  2L7A A;  4BPM A;  4MTO A;  2W45 A;  5DLJ A;  2A6H F;  1J8M F;  3MBG A;  4DBR A;  2XL8 A;  2Q9A A;  2AWC A;  1FAP B;  1C02 A;  2VCA A;  1TR2 A;  3E9V A;  3EGX A;  3LLK A;  4MVO A;  3UMK A;  3V5Z A;  1TKN A;  3K6B A;  4KNW A;  1GGQ A;  4RDA A;  1OQC A;  2L9J A;  4O6N A;  4BJT A;  2R7O A;  3IQT A;  1A41 A;  3NYJ A;  1OXK A;  1JPN A;  3A11 A;  4K0D A;  5DS4 A;  2BL2 A;  2D4U A;  3JRM O;  1ZYR F;  1RJ9 B;  1BR1 A;  4JE9 A;  4NTF A;  1DOV A;  3DKA A;  4XPY A;  2KNH A;  3FAP B;  1M2O A;  2XSE A;  3CQZ A;  2J8W A;  4LLE A;  2FGY A;  2XLH A;  1WGW A;  3US6 A;  3GM3 A;  4IAO A;  1KU2 A;  5L0C A;  3EFO A;  4FAP B;  1ORS C;  3ABK C;  3S28 A;  1VMA A;  2GA0 A;  5B3I A;  4PAC A;  5EHH A;  1N1C A;  1OCC C;  1Z5Z A;  2KW3 C;  2W4B A;  2JPU A;  1MMN A;  4YL3 A;  1M2V A;  4P6I C;  3RW0 A;  2KC3 A;  1OR2 A;  3TK0 A;  2IXN A;  3DAG A;  3WOD F;  2H7B A;  3KMI A;  4HEA J;  4EIY A;  3A9C A;  2EPK X;  4EBK A;  5KYY B;  2XLO A;  1T6I A;  4XPW A;  256B A;  1Q0K A;  3GOR A;  2Y3B A;  5HV9 A;  2OKU A;  2DB4 A;  1XZQ A;  2YLD A;  3AQB A;  3S27 A;  3J06 A;  2R9R B;  3N24 A;  2R02 A;  2YL1 A;  1OKK A;  3V7O A;  2EPM X;  4AL1 A;  5KYX A;  1M56 C;  1GM5 A;  2WB7 A;  1YZC A;  1QKR A;  1ZU5 A;  2G3V A;  4MQ9 F;  3Q6M A;  2LQG A;  4O6Y A;  5KYW A;  3L0I A;  1WAS A;  2J7P D;  1HW1 A;  4JCZ A;  1K04 A;  3EZH A;  3IEE A;  3I4U A;  4YN0 B;  2TMV P;  3T6J A;  2WZL A;  1OW7 A;  2OCC C;  1A7E A;  4CS9 C;  4GQH A;  3RFY A;  1NLX A;  1F1M A;  3HJC A;  1T01 A;  3QW1 A;  4ONS A;  4NQF A;  3SXK A;  3PCV A;  3W4Y A;  1AVO B;  2CDQ A;  4DXW A;  1H6G A;  4H4K C;  4LLC A;  4Z9J A;  4QDL A;  3ZSU A;  1VLS A;  3Q7L A;  3JSZ A;  4H54 A;  3C7J A;  1TWG A;  4N6C A;  4CDY A;  4JEA A;  1QSP A;  4WGY A;  3EG9 B;  3B0P A;  3HNJ A;  2HJM A;  2C04 A;  4NCQ A;  4F4B A;  4OD5 A;  3DWW A;  1NU9 C;  2R03 A;  3HNK A;  4MVS A;  4BEM J;  3EH1 A;  3K33 A;  2B0H A;  2HS5 A;  2Q4F A;  3FOO A;  4MVR A;  1RKE B;  3FXH A;  3AOU A;  2L6G A;  3UMH A;  3M15 A;  4IGG A;  3LLI A;  4IRU A;  4CS7 A;  1ZW2 A;  1T9K A;  1OXB A;  2WVN A;  1Y6D A;  4EBJ A;  2AWY A;  3SXY A;  1E84 A;  2Q9B A;  3AGU A;  1V74 B;  2DI3 A;  2X51 A;  3H2V A;  3TOL A;  4LER A;  3C63 A;  3U3B A;  2OEV A;  3ZTZ A;  1XWJ A;  5EGY A;  4DRH B;  4YL1 A;  3ASO C;  2QY9 A;  1NFO A;  1D1B A;  4HFK B;  2WVO A;  3FAJ A;  4FX5 A;  2EPN A;  4JC7 A;  4KNV A;  4ULV A;  1JAF A;  2YVK A;  2A68 F;  2LCH A;  3JT1 A;  2CNW A;  3LES A;  5COG A;  1OCO C;  2MYS A;  4LDQ A;  3AG3 C;  4XEF A;  1CGO A;  5CI9 A;  5AGF A;  4A4A A;  3DE8 A;  4OIN F;  3X2Q C;  1Y4C A;  3K1I A;  4NTA A;  5JSL A;  1BR2 A;  1NU7 D;  4CS9 A;  5E33 A;  2A6E F;  3F47 A;  3NRH A;  2PX3 A;  5BQH A;  4M63 A;  1R4T A;  5E2Q A;  3VM6 A;  2I15 A;  2AP3 A;  5HSW A;  3GEI A;  3G4X A;  2XL4 A;  3ZVR A;  4U5G A;  1ZU4 A;  2P1A A;  5KYU B;  5JP7 A;  2CW0 F;  1D0Z A;  2XM4 A;  3ECS A;  3UNG C;  3K1H A;  3CZ6 A;  4JRZ A;  3G50 A;  1UG7 A;  4MVM A;  4ULW A;  1H9T A;  3S0X A;  2VH3 A;  3NYM A;  3CAX A;  1LVK A;  1G4W R;  4JJG A;  4CX9 A;  2R7T A;  3B71 A;  3BRJ A;  4JTD B;  3T4R A;  4P9F A;  1M6T A;  4NY3 A;  3ITF A;  2OEX A;  2KGO A;  1O5H A;  4N6H A;  1ZHX A;  1EI7 A;  1LKX A;  5AC4 A;  3S90 A;  4XTK A;  5IY5 C;  3PDM P;  2G62 A;  4AX2 A;  4D4N A;  4MVZ A;  2ZXW C;  3QVY A;  4PJJ A;  2IYL D;  1CPR A;  5DQZ A;  1T6Q A;  3DD7 A;  3NMJ A;  2M4E A;  1YAU O;  5AC5 A;  3PHF 2;  4U5F E;  4BJ6 C;  2J9W A;  4IAQ A;  2F22 A;  2J46 A;  1S7Z A;  4I3M A;  4R32 A;  3M1C B;  1K05 A;  4D4X A;  2KK1 A;  2Q9C A;  5EK0 A;  2QNL A;  5FZT A;  2W4M A;  1D0X A;  1TFO B;  4CIH A;  3E70 C;  4I44 A;  2R7R A;  2EPL X;  2FFH A;  1ST6 A;  1I4Y A;  2ZD9 A;  3SNH A;  3EHM A;  1V55 C;  4Q7C A;  4AE4 B;  3T6G B;  1GQA A;  3W2V A;  4HFF B;  2GDC A;  1CPQ A;  3RYL A;  1FMV A;  4DRJ B;  4JEB A;  5JS5 A;  3DI5 A;  3HLZ A;  3ZDL A;  4KC9 A;  4LAC B;  4B6I A;  1VTM P;  1OW8 A;  4Z9I A;  2H7O A;  4MVQ A;  3POV A;  2KQ9 A;  3U8V A;  1APC A;  2CGE A;  3JRT A;  4JKV A;  1JPJ A;  1SMY F;  2H8A A;  4ZLD A;  1QQ3 A;  1Q0M A;  1YLM A;  1G4U S;  2ZXR A;  4YT5 A;  3T6B A;  2LD6 A;  1JMW A;  1LS4 A;  1LI7 A;  2HSQ A;  3EHN A;  3L1M A;  4O79 A;  3S84 A;  2B0J A;  2HZ8 A;  1E85 A;  2EPO A;  3C8G D;  2OJE D;  2PP4 A;  1A0B A;  2J9U A;  2Q3T A;  2NUP A;  1E86 A;  2J0W A;  1PV3 A;  2BE5 F;  4WJ0 A;  1BR4 A;  1XZP A;  1GS9 A;  1QPU A;  1Z63 A;  2WZG A;  2Z15 A;  1EQ1 A;  2UUI A;  3AQC A;  5A69 A;  1FTS A;  2A69 F;  1CGM E;  3ATP A;  1V54 C;  4C3E A;  3FHD A;  1LE4 A;  3M4B A;  3ZC4 A;  3W8H A;  5JRA A;  2YKZ A;  2LSE A;  2H7V C;  3LNR A;  3ZIB A;  2YEV A;  2P7V A;  2XLW A;  2HUJ A;  2Q7R A;  4G7H F;  1HMO A;  2R05 A;  4BJ6 A;  4J7T A;  4DOZ A;  1JRA A;  2YWA A;  1DOW A;  2YLI A;  2AU5 A;  2KSF A;  1RJ9 A;  1TWA A;  1Q0D A;  3K1I C;  1S05 A;  2ZXP A;  4ANJ A;  4MW8 A;  3WAQ A;  2RSE B;  4AE4 A;  4CS8 A;  3KYJ A;  3RQE A;  2VAS A;  3ASN C;  2CCY A;  1FR0 A;  2NPU A;  4J30 B;  4K1O A;  3L34 A;  3SXM A;  1OR3 A;  2HMZ A;  3ABL C;  1IW7 F;  1NBB A;  3Q6N A;  1C17 M;  3FOP A;  3MFN A;  4OIR F;  1TQG A;  1TFK B;  2A0U A;  2DYS C;  2Q00 A;  4JTC B;  4EWC A;  4MS2 A;  4CSA C;  2PF4 E;  2RD9 A;  4O6M A;  2OQM A;  1OCZ C;  2Y3H A;  1D1C A;  1U6H A;  1FFT C;  5BUO A;  2QTV A;  3F46 A;  1LIH A;  3MYF A;  4EKW A;  1YDI A;  3DMD A;  1E83 A;  3OA1 A;  2HV6 A;  3M79 A;  3RQF A;  5KYY A;  2YL0 A;  4X0R A;  2OG2 A;  4BJ1 A;  5KYN A;  4OIQ F;  3GM2 A;  3B0U X;  2IXP A;  2V3C C;  4FES A;  4U5H A;  1A7D A;  3W8I A;  5L0D A;  3R2P A;  2CYD A;  4FWV A;  2LFD A;  1I5N A;  5DQT A;  2NUT B;  3MYI A;  5L3Q A;  1LM3 B;  1LPE A;  4XLN F;  2AVK A;  5B3S C;  5L0H A;  1U89 A;  2Y39 A;  5F5F A;  1VYI A;  2MWQ A;  5FCL A;  1PCX A;  3U8P A;  2VB6 A;  3TD7 A;  1FFH A;  4DRI B;  3TQO A;  3AG1 C;  3EJN A;  5F5H A;  3TJ5 A;  4Q4Z F;  1T6U A;  3EGD B;  3EH2 A;  4J7Y A;  3TOM A;  1RKC A;  3C8G B;  2R25 A;  3DAF A;  1R5I D;  2HSB A;  1VYK A;  4YT2 A;  3LNM B;  4CBE A;  1YYJ A;  4CJO A;  1K40 A;  3UGP A;  4GYT A;  1HY5 A;  2XLE A;  3H65 A;  4U5E E;  1ORJ A;  3JCU Q;  3HNI A;  2KYH A;  3IPM O;  3KL4 A;  3SZR A;  2YL7 A;  1NG1 A;  2Y3D A;  3FMS A;  4BEJ A;  2HMQ A;  2VC9 A;  1YAR O;  2IM8 A;  1WAT A;  4G7O F;  2IXM A;  3ZWI A;  5JVE A;  5A6K A;  2P0N A;  1PD1 A;  1Z7Q c;  5K0I A;  3EG9 A;  3RVY A;  3U5S A;  2LP4 A;  2P6V A;  4CSA A;  4OIO F;  4JCH A;  4WAB A;  2XL6 A;  2XS8 A;  3DE9 A;  1Z6A A;  3I5Q A;  3EGX B;  3GWL A;  3L8I A;  4U5D E;  4XEK A;  2HV7 A;  4Z9H A;  3NDB B;  1RKE A;  2UUH A;  3VYW A;  1CGN A;  2XRH A;  3RIP A;  1Q0G A;  3NMK A;  1YJG A;  2GWW A;  2P61 A;  3IQ6 A;  3NMI A;  5T1D B;  3EQL F;  2ICW G;  2LIG A;  1SZI A;  3L8J A;  5DVW A;  2NUT A;  4QI2 A;  3N0T A;  3U0C A;  1NZE A;  3UGO A;  2L6F A;  4YWQ A;  1SF8 A;  3KH2 A;  1G8X A;  1A7V A;  2LFF A;  1BDJ B;  3V5Y A;  4JTA B;  4ER9 A;  4E7Z A;  1ZHY A;  2ASR A;  3LJB A;  1FMW A;  4EUK B;  4GEH A;  2R7X A;  3U2M A;  3H2U A;  3KYI A;  1HE1 A;  2PNO A;  1BZ4 A;  4P9T A;  2IXO A;  4RD9 A;  1EKY A;  1KTM A;  3JTL O;  4PR9 A;  3VAY A;  3EFO B;  1QLE C;  3QTH A;  4CS8 C;  1KNY A;  4XQ1 A;  3B29 A;  2KJG A;  3S9O A;  3V5X A;  2QUP A;  4N06 A;  3ZG1 A;  5DS5 A;  4XWJ A;  4YL0 A;  1WTY A;  5COF A;  1G5Z A;  4JVS A;  1YYX A;  5L3V A;  1ZW3 A;  3T9O A;  4YJW A;  1ZHW A;  3BEH A;  3IQC A;  3KPH A;  2J7P A;  1L7C A;  3GWN A;  3UMI A;  3FDQ A;  3LUT B;  2D5R B;  2JD3 A;  2VCB A;  2R7W A;  2NSG A;  2XLD A;  3FVY A;  1B68 A;  2YQY A;  2EIM C;  4JUR I;  4W8P A;  1AEP A;  2DYR C;  3QW0 A;  1Z23 A;  5KYU A;  2GFH A;  5KYX B;  1RCP A;  5GPG B;  4BJ5 C;  5A6B D;  1H9G A;  1ORY A;  3AG4 C;  4WGZ A;  4K7B A; 
#chains in the Genus database with same CATH homology
 2BL2 A;  2DB4 A;  5TJ5 E;  3AOU A;  4BEM J;  2CYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...