2CYDA

Crystal structure of lithium bound rotor ring of the v-atpase from enterococcus hirae
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
156
structure length
156
Chain Sequence
MMDYLITQNGGMVFAVLAMATATIFSGIGSAKGVGMTGEAAAALTTSQPEKFGQALILQLLPGTQGLYGFVIAFLIFINLGSDMSVVQGLNFLGASLPIAFTGLFSGIAQGKVAAAGIQILAKKPEHATKGIIFAAMVETYAILGFVISFLLVLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Lithium bound rotor ring of the V-ATPase from Enterococcus hirae
rcsb
source organism Enterococcus hirae
molecule tags Hydrolase
molecule keywords V-type sodium ATP synthase subunit K
total genus 74
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2005-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00137 ATP-synt_C ATP synthase subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) lithium bound rotor ring of v- atpase 2cydA00
3AOUA 2CYDA 4BEMJ 2DB4A 5TJ5E 2BL2A
chains in the Genus database with same CATH superfamily
2I15A 2XS1A 1QVXA 2UUIA 4IRUA 3M4BA 4JRZA 1C17M 2QE9A 2ZPAA 3AQBA 3Q6NA 4H54A 4NCQA 4BEMJ 1EI7A 3U0CA 3ZQYA 1TWCA 2VCBA 3S9OA 1LI5A 3K6BA 3UMKA 2HS5A 2ZXOA 1ZW2A 4U5FE 1RMVA 3C8GA 1VLTA 3T6BA 1QLEC 4Q5SF 1NFNA 4Z9JA 5DVWA 1D0XA 1T01A 2CW0F 3NKEA 1C03A 5JSLA 1NFOA 2LSEA 2VASA 4IJJA 3AGTA 2J46A 1K04A 3ABMC 3DM5A 4JVSA 4XQ1A 3EH1A 2EPKX 3GORA 4CIPA 4YT4A 1GQAA 3JZ0A 3QMKA 3K1IC 3LUTB 1TKNA 3QZCA 3OA1A 3SEOA 1A41A 1WATA 2RSEB 4I44A 2CNWA 3EFOB 1YA7O 2FGYA 4ZLDA 4CIHA 2PNOA 1O5HA 4EBKA 3O39A 4BJ6A 4DVZA 5T3WA 1I4ZA 3FOOA 3NRHA 4JEBA 2XXAB 2R7SA 2OJED 1OKKD 2XM0A 2YQYA 2PBEA 2IOQA 2OEXA 4R32A 1Z23A 4BJ5A 3LEVA 5JP7A 1AEPA 3EQLF 3AGUA 2HMZA 3F46A 1CGME 2XLOA 3CSKA 3LS1A 1FFHA 3ZVRA 4JCZA 3UGPA 2MWQA 4JE9A 4K0DA 2FFHA 3TD7A 4CBEA 2HKVA 4CDYA 1L7CA 5EGYA 4MTGA 4U5DE 1YDIA 4IGGA 1H6GA 1M2OA 2Q4FA 2YL7A 3I5QA 4QI0A 1ZHZA 3GM2A 1HE1A 1WGWA 2XM4A 3EZHA 4JIOA 3W8IA 5L3VA 1V54C 3FVYA 1H9TA 2OJQA 4FX5A 5F28E 3N2ZB 3RQEA 3U2MA 4PFOA 1RKCA 2YHSA 3LLKA 3C63A 4U9EA 5A6BA 1ZVZA 4YK5A 1EKYA 3EGDB 5TJ5E 2CDQA 1LI7A 3EGXB 3NMIA 3Q6MA 1G4US 4LDRA 1UG7A 5COFA 4YL3A 1SR2A 5E33A 3GEIA 4JCHA 5EK0A 5T3TA 3U3FA 5DS4A 3K66A 2R7RA 4JKVA 1ZHTA 1MNEA 1TR2A 2NUTA 4DBRA 2M4EA 5L0CA 2PF4E 2W9YA 4JC7A 3IQ6A 3U3BA 2VC9A 1M57C 3R7CA 2Z15A 4NC3A 3OEOA 4G7ZF 3SXYA 3RQGA 3L8IA 1QKRA 5B1BC 1DOWA 2AWCA 3PMRA 2XLVA 2YLIA 1TQGA 4YJWA 3TJ6A 5JS5A 2HV7A 4XWJA 1HW2A 3DD7A 3M4CA 2VH3A 4I1MA 3X1OA 1O3UA 4XEFA 3EH2A 4UDVA 5KYYB 3S90A 3LS0A 3Q7LA 2CNWD 1Y6DA 2DGJA 2NUPA 2J9VA 3B71A 1QQ3A 2XLDA 4NY3A 1WASA 4U5GA 3RKOF 3ZWIA 3IPMO 4CS9A 4OIQF 2J9WA 2ICWG 2DYSC 3ITFA 4L6RA 3CAXA 4MTFA 3H65A 3SXKA 2EILC 1EA8A 4PJJA 1NU9C 2R7WA 4KNWA 2WZLA 2Y3GA 3AG2C 3T6JA 5D92A 1MMGA 4MVSA 3U8VA 4AL1A 2H7BA 4YT8A 2UUHA 4ONSA 1KTMA 4JZAA 2L81A 1H9GA 3CQZA 3CZ6A 1ZU5A 2XLMA 5CI8A 3AG4C 4D4XA 2F22A 1FMWA 3G4XA 4O6NA 3V5YA 4E17A 4EBBA 3DM9B 3N24A 4ZLCA 4MVMA 1R5ID 1FNTc 1CGOA 1MMAA 1TWGA 2KSFA 2E87A 3HNIA 4PJMA 5L3QA 1ZHXA 3OWTA 3AG3C 3FMSA 4U9DA 2L9JA 1YAUO 4NQFA 1B68A 1A7DA 3NMJA 3QVYA 4IAQA 1NU7D 2GDCA 1RCPA 2OCCC 3Q7GA 1ZZPA 4C3DA 3MBGA 2KQ9A 5KYUA 1NZEA 2G3VA 3HNLA 3K1IA 1OXBA 1CPQA 2B0JA 2LFFA 256BA 2J0XA 2GA0A 2TMVP 4A2NB 1ORSC 5E3AA 2HZ8A 3U8PA 2LD6A 2R02A 3EHMA 3PHF2 3JSEO 4MS2A 3K33A 3RQFA 2R05A 3ASNC 1Z7Qc 4XLPF 4PJNA 5AC4A 1SF8A 5JLIA 3DJNB 3POVA 4DVYP 2DYRC 2MHRA 3EGDA 3RW0A 4C3EA 3VF0A 4CS8A 2PFDA 4EWCA 1YYXA 4ER9A 1PD0A 2D4UA 3FXHA 2IXMA 3JRMO 5B3IA 3VM6A 4K7BA 3UGOA 2YL0A 4B6IA 5FZTA 4BJ1A 3J06A 1LKXA 4EBJA 2G62A 2HSBA 5A69A 3QW0A 3ZQVA 3C62A 1XWJA 4C3BA 5FCLA 3PDMP 2EPLX 1JRAA 5JVEA 1I4YA 4OD4A 4MW3A 5DLJA 1E2XA 3F47A 1JOGA 3US6A 4EHPA 2BC5A 3QW1A 4D4NA 4BJ6C 1RKEB 2EIKC 3IHUA 4JJFA 4E0HA 4DJ9A 5L0JA 4EKWA 5F5FA 2Q7RA 1ZW3A 2XL6A 5DS5A 4EIYA 3S0XA 1T6UA 4KNVA 5CI9A 3W4YA 3QVZA 3LLIA 4G78A 5DQZA 1E86A 2XLHA 3K1HA 4O7GA 3U5SA 1M6TA 1W2WA 1A0BA 1QPUA 1YJGA 4MW8A 1YZCA 1ZHYA 1WOLA 3RVZA 3H2UA 3ECSA 3T4RA 1TFOB 3C18A 1TWAA 3GM3A 1M2VA 2RD9A 3RH3A 3NG1A 2WL8A 2ZXPA 3KYJA 1ZHWA 1HMDA 5L0DA 3H2VA 2H8AA 2A68F 3FAPB 1OCOC 2YRFA 3DJUB 3LNRA 2WVNA 2R7TA 2KGOA 3AG1C 1JPNA 4PK4A 3MFNA 1MMDA 2LCHA 3L1MA 5KYWA 1APCA 2VCAA 5KYXB 1ST6A 4XLNF 1F1MA 2L6FA 5DQTA 1KU2A 4JEAA 3ZTMA 1WWPA 1K05A 2AVKA 3EZIA 3MX3A 4LDKA 4LLEA 1RJ9A 2JPUA 2O9XA 1VYKA 2ZXRA 1OQCA 3W8HA 3V5XA 3M79A 1MNDA 3DI5A 4HEAJ 1C02A 1Z3IX 2HJMA 3BRJA 2PP4A 3S27A 4AX2A 3DAGA 2HSQA 3WODF 2XRHA 2P0NA 3LESA 3EPVA 1IW7F 4O79A 2R7VA 3HKKA 3ZDLA 3EGXA 4G7OF 2W4BA 1PV3A 1DOVA 3UNGC 2R9RB 1LE2A 4GEHA 1BR4A 1LIHA 1S05A 2DB4A 2EINC 3TOMA 4MTOA 2KC3A 2FAPB 3RF3A 3HTKC 1A7EA 1LVKA 2P61A 4E0IA 1RXQA 3DE8A 2PX0A 2ASRA 2R03A 3DAFA 2LIGA 3HLZA 3JCUQ 2Y3DA 5JRAA 3RFYA 1BR1A 3EHNA 2J45A 3UR3C 2BE5F 2LP4A 4DRJB 1OXKA 2Y3BA 3W2WA 5B3SC 5KYUB 4G0HA 3FHDA 3MYFA 3NKDA 3B29A 4RBNA 3DXJF 1G8XA 4U5HA 5B1AC 4E18A 2Y69C 2QLAA 2A0BA 2YKZA 3O6XA 4JTDB 4LDQA 5F5HA 1BDJB 2A69F 2KW3C 3LJBA 1MQVA 4XTKA 5A6AA 4KI2A 1NG1A 2NSGA 2A6EF 4FWVA 4BG0A 2EPNA 1BZ4A 2EPOA 1OW7A 1LE4A 1NLXA 2QTVA 5E2QA 3X2QC 5BQIA 4OIOF 3NMKA 1Q0FA 3AJMA 3EFOA 4PR9A 3ABKC 3MLGA 4KC9A 4OIPF 2HUJA 2KK1A 1ORYA 3L8JA 3KMIA 3IQ5A 3AOUA 2EIJC 4BPMA 1H7IA 2A6HF 1Z63A 1Q0DA 2L6GA 4MVOA 1T6IA 1M2VB 1HW1A 1FTSA 3RIPA 4AL0A 4Z9IA 3HNJA 1EQ1A 3SXZA 4I3MA 1FMVA 2IXPA 3U9MA 5KYNA 1FAPB 1Y4CA 2A1DD 2KYHA 3ASOC 3GANA 5IY5C 4BEJA 1M56C 3U2LA 4YL1A 1U89A 1YLMA 4N06A 1ZU4A 4AK9A 1CGNA 2IXNA 2OQMA 3JT1A 4U5CE 5L0GA 5L0HA 5BQHA 4N6HA 4RD9A 2HFIA 3JSZA 2XLEA 1OCRC 2Q3TA 4PJLA 2G3KA 3IQCA 4X0RA 3B9QA 2P7VA 1D1BA 1WN0A 2YLDA 2Y39A 3DWWA 2W45A 4YT2A 3SZRA 2J0WA 4GYTA 3E70C 1L3PA 1HMOA 4JTCB 2BL2A 3TULA 3B0PA 3GEHA 4N4WA 4I1OB 1VTMP 2Q9BA 3AQCA 1YVIA 4Z9HA 2JD3A 2P1AA 2VB6A 4FESA 2YVKA 2P6VA 5AC5A 4JJGA 4E7ZA 2CGEA 1BR2A 1D0YA 4P9FA 4E7SA 1LM3B 3O55A 4CSAC 4YL0A 2C03A 2X0CA 5A6JA 3SNHA 1CPRA 1TFKB 3TJ5A 2EPMX 5E3CA 1SMYF 4HE8D 5HV9A 3V5ZA 2Q9AA 3EJNA 2CYDA 4U5BE 3RVYA 5KYYA 3VAYA 1HY5A 3FDQA 5JUAA 1BBHA 1HE9A 3LAYA 3O10A 3M15A 3JTLO 4W8PA 2VCCA 2LQGA 3I5PA 4IWBA 4YN0B 1XZQA 2OG2A 1V4AA 1IZMA 2L6HA 4CS8C 1QSPA 3K7DA 3LEOA 4CDVA 1SZIA 4MNDA 1LS1A 1AVOB 2AU5A 3DZAA 2J7PA 4KBLA 1KNYA 5A6KA 1YZAA 3ATPA 2J9BA 4NTBA 2OKUA 1VOMA 1Z5ZA 2Y3HA 4XPXA 3V7OA 2A0UA 2M64A 1G4WR 3S29A 1N1CA 3WHNA 3NYLA 4N6CA 5HSWA 1OCZC 1ORJA 1K40A 3G4ZA 4CSAA 4JW1A 4WABA 2NSFA 3B0VC 2V26A 2WZGA 4CJGA 4YWQA 1ZYRF 2OEVA 4WGZA 3UMIA 3MYIA 3E9VA 1A7VA 2XS8A 1Z6AA 2AP3A 3WAQA 2QY9A 2WVQA 4LERA 4MVZA 1VYIA 3FAJA 1RJ9B 1VB5A 2YLGA 2ZXWC 3L34A 4U5EE 4ULWA 2NUPB 2C04A 4LLCA 3RYLA 3NDBB 1PD1A 2YL1A 4EUKB 2GAQA 2IBFA 5BQGA 2L7AA 3ZIBA 2NG1A 3JRTA 3PCVA 1FR0A 4MVQA 5GPGB 1D0ZA 2XL4A 4M63A 5A6BD 3ZC4A 1JR8A 4HFFB 5COMA 2QUPA 1G5ZA 1Q0GA 1NSGB 1O87A 2W4MA 2WVOA 4JURI 4IARA 4MVRA 2ETSA 2XSEA 4OINF 1TWHA 2D5RB 4XPWA 2NUTB 3UMHA 3ZG1A 2GFHA 2IM8A 3JYHA 4QDLA 1XZPA 5KYWB 3HJCA 1D1AA 3GWLA 5COGA 3S84A 4Q4ZF 2LFDA 1R4TA 4Q7CA 3BEHA 5L0IA 2HJ3A 3N0TA 1OW6A 3WG7C 4F4BA 1LPEA 4DRHB 2KJGA 2ZD9A 3IEEA 3VRCA 1GM5A 4NTAA 2XLWA 3SP1A 4DBQA 2H7VC 5K0IA 1OR3A 3ABLC 2YEVA 1RKEA 4XEVA 3EG9A 4PACA 4CX9A 1VLSA 1UFBA 4C7OB 2YWAA 4OIRF 2H7OA 4BJTA 1E85A 3GWNA 1AUEA 5EHHA 3U9JA 3DE9A 4NTFA 4LACB 1NBBA 4BJ5C 2R7OA 2J7PD 1LS4A 1VK5A 3GEEA 3A9CA 2IXOA 3GODA 3HNKA 4IB4A 4JTAB 3B0UX 2YZSA 2B0HA 2Q00A 4MVUA 1U0BB 3LNMB 5JT4A 2KNHA 5CIVA 3T6GB 1WTYA 3DMDA 1JPJA 4J30B 2Q9CA 1FFTC 1SYQA 3IQTA 1PCXA 3R2PA 2V3CC 1Q0MA 2WB7A 2XXAA 2R7XA 1T5OA 1JMWA 2X51A 2I8BA 2R7QA 5L0FA 2R25A 3QTHA 3TQOA 1GS9A 3KH2A 1QZXA 3C8GD 4ULVA 3VYWA 3SXMA 3ZTZA 1J8MF 1Q0KA 3EG9B 1OCCC 4C7OA 4K1OA 1D1CA 4G7HF 3C8GB 2J9UA 4W8KA 3FOPA 3SYNA 1S7ZA 2OU6A 2XL8A 3TK0A 4OD5A 3A11A 4CJOA 5T1DB 3KPHA 2JX0A 4ANJA 4DRIB 1YYJA 1MMNA 1YARO 3W2VA 5AGFA 4O6YA 3S28A 4P6IC 4YT5A 3C8ZA 4RDAA 3T9OA 1OR2A 1JAFA 2IYLD 3KYIA 3L0IA 3NYJA 4AE4A 4J32B 4CS7A 1I5NA 1T6QA 2GWWA 2WZFA 3ZSUA 1V74B 3CEXA 4WGYA 2HMQA 4MQ9F 3NYMA 2AWYA 4DOZA 5KYXA 4H4KC 2EIMC 2NPUA 2HV6A 3KL4A 1E84A 2R7UA 3M1CB 5D91A 1U6HA 1VMAA 2QNLA 3DKAA 1YA9A 2LK4A 3JYYA 3I4UA 4XEKA 4FAPB 2MYSA 4J7YA 1T9KA 4HFKB 1GGQA 3GM1A 3KKBA 4QI2A 1E83A 2J8WA 4WJ0A 1J8YF 2PX3A 5DS6A 4XPYA 5BUOA 4DXWA 4GQHA 4O6MA 2CCYA 4PFPA 1V55C 4CDAA 2YL3A 4J7TA 4AE4B 2OOCA 3TOLA 2DI3A 4CS9C 1OKKA 4A4AA 3G50A 1OW8A 4IAOA 3C7JA 4P9TA
chains in the Genus database with same CATH topology
3AOUA 2CYDA 4BEMJ 2DB4A 5TJ5E 2BL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AOU A;  2CYD A;  4BEM J;  2DB4 A;  5TJ5 E;  2BL2 A; 
#chains in the Genus database with same CATH topology
 2I15 A;  2XS1 A;  1QVX A;  2UUI A;  4IRU A;  3M4B A;  4JRZ A;  1C17 M;  2QE9 A;  2ZPA A;  3AQB A;  3Q6N A;  4H54 A;  4NCQ A;  4BEM J;  1EI7 A;  3U0C A;  3ZQY A;  1TWC A;  2VCB A;  3S9O A;  1LI5 A;  3K6B A;  3UMK A;  2HS5 A;  2ZXO A;  1ZW2 A;  4U5F E;  1RMV A;  3C8G A;  1VLT A;  3T6B A;  1QLE C;  4Q5S F;  1NFN A;  4Z9J A;  5DVW A;  1D0X A;  1T01 A;  2CW0 F;  3NKE A;  1C03 A;  5JSL A;  1NFO A;  2LSE A;  2VAS A;  4IJJ A;  3AGT A;  2J46 A;  1K04 A;  3ABM C;  3DM5 A;  4JVS A;  4XQ1 A;  3EH1 A;  2EPK X;  3GOR A;  4CIP A;  4YT4 A;  1GQA A;  3JZ0 A;  3QMK A;  3K1I C;  3LUT B;  1TKN A;  3QZC A;  3OA1 A;  3SEO A;  1A41 A;  1WAT A;  2RSE B;  4I44 A;  2CNW A;  3EFO B;  1YA7 O;  2FGY A;  4ZLD A;  4CIH A;  2PNO A;  1O5H A;  4EBK A;  3O39 A;  4BJ6 A;  4DVZ A;  5T3W A;  1I4Z A;  3FOO A;  3NRH A;  4JEB A;  2XXA B;  2R7S A;  2OJE D;  1OKK D;  2XM0 A;  2YQY A;  2PBE A;  2IOQ A;  2OEX A;  4R32 A;  1Z23 A;  4BJ5 A;  3LEV A;  5JP7 A;  1AEP A;  3EQL F;  3AGU A;  2HMZ A;  3F46 A;  1CGM E;  2XLO A;  3CSK A;  3LS1 A;  1FFH A;  3ZVR A;  4JCZ A;  3UGP A;  2MWQ A;  4JE9 A;  4K0D A;  2FFH A;  3TD7 A;  4CBE A;  2HKV A;  4CDY A;  1L7C A;  5EGY A;  4MTG A;  4U5D E;  1YDI A;  4IGG A;  1H6G A;  1M2O A;  2Q4F A;  2YL7 A;  3I5Q A;  4QI0 A;  1ZHZ A;  3GM2 A;  1HE1 A;  1WGW A;  2XM4 A;  3EZH A;  4JIO A;  3W8I A;  5L3V A;  1V54 C;  3FVY A;  1H9T A;  2OJQ A;  4FX5 A;  5F28 E;  3N2Z B;  3RQE A;  3U2M A;  4PFO A;  1RKC A;  2YHS A;  3LLK A;  3C63 A;  4U9E A;  5A6B A;  1ZVZ A;  4YK5 A;  1EKY A;  3EGD B;  5TJ5 E;  2CDQ A;  1LI7 A;  3EGX B;  3NMI A;  3Q6M A;  1G4U S;  4LDR A;  1UG7 A;  5COF A;  4YL3 A;  1SR2 A;  5E33 A;  3GEI A;  4JCH A;  5EK0 A;  5T3T A;  3U3F A;  5DS4 A;  3K66 A;  2R7R A;  4JKV A;  1ZHT A;  1MNE A;  1TR2 A;  2NUT A;  4DBR A;  2M4E A;  5L0C A;  2PF4 E;  2W9Y A;  4JC7 A;  3IQ6 A;  3U3B A;  2VC9 A;  1M57 C;  3R7C A;  2Z15 A;  4NC3 A;  3OEO A;  4G7Z F;  3SXY A;  3RQG A;  3L8I A;  1QKR A;  5B1B C;  1DOW A;  2AWC A;  3PMR A;  2XLV A;  2YLI A;  1TQG A;  4YJW A;  3TJ6 A;  5JS5 A;  2HV7 A;  4XWJ A;  1HW2 A;  3DD7 A;  3M4C A;  2VH3 A;  4I1M A;  3X1O A;  1O3U A;  4XEF A;  3EH2 A;  4UDV A;  5KYY B;  3S90 A;  3LS0 A;  3Q7L A;  2CNW D;  1Y6D A;  2DGJ A;  2NUP A;  2J9V A;  3B71 A;  1QQ3 A;  2XLD A;  4NY3 A;  1WAS A;  4U5G A;  3RKO F;  3ZWI A;  3IPM O;  4CS9 A;  4OIQ F;  2J9W A;  2ICW G;  2DYS C;  3ITF A;  4L6R A;  3CAX A;  4MTF A;  3H65 A;  3SXK A;  2EIL C;  1EA8 A;  4PJJ A;  1NU9 C;  2R7W A;  4KNW A;  2WZL A;  2Y3G A;  3AG2 C;  3T6J A;  5D92 A;  1MMG A;  4MVS A;  3U8V A;  4AL1 A;  2H7B A;  4YT8 A;  2UUH A;  4ONS A;  1KTM A;  4JZA A;  2L81 A;  1H9G A;  3CQZ A;  3CZ6 A;  1ZU5 A;  2XLM A;  5CI8 A;  3AG4 C;  4D4X A;  2F22 A;  1FMW A;  3G4X A;  4O6N A;  3V5Y A;  4E17 A;  4EBB A;  3DM9 B;  3N24 A;  4ZLC A;  4MVM A;  1R5I D;  1FNT c;  1CGO A;  1MMA A;  1TWG A;  2KSF A;  2E87 A;  3HNI A;  4PJM A;  5L3Q A;  1ZHX A;  3OWT A;  3AG3 C;  3FMS A;  4U9D A;  2L9J A;  1YAU O;  4NQF A;  1B68 A;  1A7D A;  3NMJ A;  3QVY A;  4IAQ A;  1NU7 D;  2GDC A;  1RCP A;  2OCC C;  3Q7G A;  1ZZP A;  4C3D A;  3MBG A;  2KQ9 A;  5KYU A;  1NZE A;  2G3V A;  3HNL A;  3K1I A;  1OXB A;  1CPQ A;  2B0J A;  2LFF A;  256B A;  2J0X A;  2GA0 A;  2TMV P;  4A2N B;  1ORS C;  5E3A A;  2HZ8 A;  3U8P A;  2LD6 A;  2R02 A;  3EHM A;  3PHF 2;  3JSE O;  4MS2 A;  3K33 A;  3RQF A;  2R05 A;  3ASN C;  1Z7Q c;  4XLP F;  4PJN A;  5AC4 A;  1SF8 A;  5JLI A;  3DJN B;  3POV A;  4DVY P;  2DYR C;  2MHR A;  3EGD A;  3RW0 A;  4C3E A;  3VF0 A;  4CS8 A;  2PFD A;  4EWC A;  1YYX A;  4ER9 A;  1PD0 A;  2D4U A;  3FXH A;  2IXM A;  3JRM O;  5B3I A;  3VM6 A;  4K7B A;  3UGO A;  2YL0 A;  4B6I A;  5FZT A;  4BJ1 A;  3J06 A;  1LKX A;  4EBJ A;  2G62 A;  2HSB A;  5A69 A;  3QW0 A;  3ZQV A;  3C62 A;  1XWJ A;  4C3B A;  5FCL A;  3PDM P;  2EPL X;  1JRA A;  5JVE A;  1I4Y A;  4OD4 A;  4MW3 A;  5DLJ A;  1E2X A;  3F47 A;  1JOG A;  3US6 A;  4EHP A;  2BC5 A;  3QW1 A;  4D4N A;  4BJ6 C;  1RKE B;  2EIK C;  3IHU A;  4JJF A;  4E0H A;  4DJ9 A;  5L0J A;  4EKW A;  5F5F A;  2Q7R A;  1ZW3 A;  2XL6 A;  5DS5 A;  4EIY A;  3S0X A;  1T6U A;  4KNV A;  5CI9 A;  3W4Y A;  3QVZ A;  3LLI A;  4G78 A;  5DQZ A;  1E86 A;  2XLH A;  3K1H A;  4O7G A;  3U5S A;  1M6T A;  1W2W A;  1A0B A;  1QPU A;  1YJG A;  4MW8 A;  1YZC A;  1ZHY A;  1WOL A;  3RVZ A;  3H2U A;  3ECS A;  3T4R A;  1TFO B;  3C18 A;  1TWA A;  3GM3 A;  1M2V A;  2RD9 A;  3RH3 A;  3NG1 A;  2WL8 A;  2ZXP A;  3KYJ A;  1ZHW A;  1HMD A;  5L0D A;  3H2V A;  2H8A A;  2A68 F;  3FAP B;  1OCO C;  2YRF A;  3DJU B;  3LNR A;  2WVN A;  2R7T A;  2KGO A;  3AG1 C;  1JPN A;  4PK4 A;  3MFN A;  1MMD A;  2LCH A;  3L1M A;  5KYW A;  1APC A;  2VCA A;  5KYX B;  1ST6 A;  4XLN F;  1F1M A;  2L6F A;  5DQT A;  1KU2 A;  4JEA A;  3ZTM A;  1WWP A;  1K05 A;  2AVK A;  3EZI A;  3MX3 A;  4LDK A;  4LLE A;  1RJ9 A;  2JPU A;  2O9X A;  1VYK A;  2ZXR A;  1OQC A;  3W8H A;  3V5X A;  3M79 A;  1MND A;  3DI5 A;  4HEA J;  1C02 A;  1Z3I X;  2HJM A;  3BRJ A;  2PP4 A;  3S27 A;  4AX2 A;  3DAG A;  2HSQ A;  3WOD F;  2XRH A;  2P0N A;  3LES A;  3EPV A;  1IW7 F;  4O79 A;  2R7V A;  3HKK A;  3ZDL A;  3EGX A;  4G7O F;  2W4B A;  1PV3 A;  1DOV A;  3UNG C;  2R9R B;  1LE2 A;  4GEH A;  1BR4 A;  1LIH A;  1S05 A;  2DB4 A;  2EIN C;  3TOM A;  4MTO A;  2KC3 A;  2FAP B;  3RF3 A;  3HTK C;  1A7E A;  1LVK A;  2P61 A;  4E0I A;  1RXQ A;  3DE8 A;  2PX0 A;  2ASR A;  2R03 A;  3DAF A;  2LIG A;  3HLZ A;  3JCU Q;  2Y3D A;  5JRA A;  3RFY A;  1BR1 A;  3EHN A;  2J45 A;  3UR3 C;  2BE5 F;  2LP4 A;  4DRJ B;  1OXK A;  2Y3B A;  3W2W A;  5B3S C;  5KYU B;  4G0H A;  3FHD A;  3MYF A;  3NKD A;  3B29 A;  4RBN A;  3DXJ F;  1G8X A;  4U5H A;  5B1A C;  4E18 A;  2Y69 C;  2QLA A;  2A0B A;  2YKZ A;  3O6X A;  4JTD B;  4LDQ A;  5F5H A;  1BDJ B;  2A69 F;  2KW3 C;  3LJB A;  1MQV A;  4XTK A;  5A6A A;  4KI2 A;  1NG1 A;  2NSG A;  2A6E F;  4FWV A;  4BG0 A;  2EPN A;  1BZ4 A;  2EPO A;  1OW7 A;  1LE4 A;  1NLX A;  2QTV A;  5E2Q A;  3X2Q C;  5BQI A;  4OIO F;  3NMK A;  1Q0F A;  3AJM A;  3EFO A;  4PR9 A;  3ABK C;  3MLG A;  4KC9 A;  4OIP F;  2HUJ A;  2KK1 A;  1ORY A;  3L8J A;  3KMI A;  3IQ5 A;  3AOU A;  2EIJ C;  4BPM A;  1H7I A;  2A6H F;  1Z63 A;  1Q0D A;  2L6G A;  4MVO A;  1T6I A;  1M2V B;  1HW1 A;  1FTS A;  3RIP A;  4AL0 A;  4Z9I A;  3HNJ A;  1EQ1 A;  3SXZ A;  4I3M A;  1FMV A;  2IXP A;  3U9M A;  5KYN A;  1FAP B;  1Y4C A;  2A1D D;  2KYH A;  3ASO C;  3GAN A;  5IY5 C;  4BEJ A;  1M56 C;  3U2L A;  4YL1 A;  1U89 A;  1YLM A;  4N06 A;  1ZU4 A;  4AK9 A;  1CGN A;  2IXN A;  2OQM A;  3JT1 A;  4U5C E;  5L0G A;  5L0H A;  5BQH A;  4N6H A;  4RD9 A;  2HFI A;  3JSZ A;  2XLE A;  1OCR C;  2Q3T A;  4PJL A;  2G3K A;  3IQC A;  4X0R A;  3B9Q A;  2P7V A;  1D1B A;  1WN0 A;  2YLD A;  2Y39 A;  3DWW A;  2W45 A;  4YT2 A;  3SZR A;  2J0W A;  4GYT A;  3E70 C;  1L3P A;  1HMO A;  4JTC B;  2BL2 A;  3TUL A;  3B0P A;  3GEH A;  4N4W A;  4I1O B;  1VTM P;  2Q9B A;  3AQC A;  1YVI A;  4Z9H A;  2JD3 A;  2P1A A;  2VB6 A;  4FES A;  2YVK A;  2P6V A;  5AC5 A;  4JJG A;  4E7Z A;  2CGE A;  1BR2 A;  1D0Y A;  4P9F A;  4E7S A;  1LM3 B;  3O55 A;  4CSA C;  4YL0 A;  2C03 A;  2X0C A;  5A6J A;  3SNH A;  1CPR A;  1TFK B;  3TJ5 A;  2EPM X;  5E3C A;  1SMY F;  4HE8 D;  5HV9 A;  3V5Z A;  2Q9A A;  3EJN A;  2CYD A;  4U5B E;  3RVY A;  5KYY A;  3VAY A;  1HY5 A;  3FDQ A;  5JUA A;  1BBH A;  1HE9 A;  3LAY A;  3O10 A;  3M15 A;  3JTL O;  4W8P A;  2VCC A;  2LQG A;  3I5P A;  4IWB A;  4YN0 B;  1XZQ A;  2OG2 A;  1V4A A;  1IZM A;  2L6H A;  4CS8 C;  1QSP A;  3K7D A;  3LEO A;  4CDV A;  1SZI A;  4MND A;  1LS1 A;  1AVO B;  2AU5 A;  3DZA A;  2J7P A;  4KBL A;  1KNY A;  5A6K A;  1YZA A;  3ATP A;  2J9B A;  4NTB A;  2OKU A;  1VOM A;  1Z5Z A;  2Y3H A;  4XPX A;  3V7O A;  2A0U A;  2M64 A;  1G4W R;  3S29 A;  1N1C A;  3WHN A;  3NYL A;  4N6C A;  5HSW A;  1OCZ C;  1ORJ A;  1K40 A;  3G4Z A;  4CSA A;  4JW1 A;  4WAB A;  2NSF A;  3B0V C;  2V26 A;  2WZG A;  4CJG A;  4YWQ A;  1ZYR F;  2OEV A;  4WGZ A;  3UMI A;  3MYI A;  3E9V A;  1A7V A;  2XS8 A;  1Z6A A;  2AP3 A;  3WAQ A;  2QY9 A;  2WVQ A;  4LER A;  4MVZ A;  1VYI A;  3FAJ A;  1RJ9 B;  1VB5 A;  2YLG A;  2ZXW C;  3L34 A;  4U5E E;  4ULW A;  2NUP B;  2C04 A;  4LLC A;  3RYL A;  3NDB B;  1PD1 A;  2YL1 A;  4EUK B;  2GAQ A;  2IBF A;  5BQG A;  2L7A A;  3ZIB A;  2NG1 A;  3JRT A;  3PCV A;  1FR0 A;  4MVQ A;  5GPG B;  1D0Z A;  2XL4 A;  4M63 A;  5A6B D;  3ZC4 A;  1JR8 A;  4HFF B;  5COM A;  2QUP A;  1G5Z A;  1Q0G A;  1NSG B;  1O87 A;  2W4M A;  2WVO A;  4JUR I;  4IAR A;  4MVR A;  2ETS A;  2XSE A;  4OIN F;  1TWH A;  2D5R B;  4XPW A;  2NUT B;  3UMH A;  3ZG1 A;  2GFH A;  2IM8 A;  3JYH A;  4QDL A;  1XZP A;  5KYW B;  3HJC A;  1D1A A;  3GWL A;  5COG A;  3S84 A;  4Q4Z F;  2LFD A;  1R4T A;  4Q7C A;  3BEH A;  5L0I A;  2HJ3 A;  3N0T A;  1OW6 A;  3WG7 C;  4F4B A;  1LPE A;  4DRH B;  2KJG A;  2ZD9 A;  3IEE A;  3VRC A;  1GM5 A;  4NTA A;  2XLW A;  3SP1 A;  4DBQ A;  2H7V C;  5K0I A;  1OR3 A;  3ABL C;  2YEV A;  1RKE A;  4XEV A;  3EG9 A;  4PAC A;  4CX9 A;  1VLS A;  1UFB A;  4C7O B;  2YWA A;  4OIR F;  2H7O A;  4BJT A;  1E85 A;  3GWN A;  1AUE A;  5EHH A;  3U9J A;  3DE9 A;  4NTF A;  4LAC B;  1NBB A;  4BJ5 C;  2R7O A;  2J7P D;  1LS4 A;  1VK5 A;  3GEE A;  3A9C A;  2IXO A;  3GOD A;  3HNK A;  4IB4 A;  4JTA B;  3B0U X;  2YZS A;  2B0H A;  2Q00 A;  4MVU A;  1U0B B;  3LNM B;  5JT4 A;  2KNH A;  5CIV A;  3T6G B;  1WTY A;  3DMD A;  1JPJ A;  4J30 B;  2Q9C A;  1FFT C;  1SYQ A;  3IQT A;  1PCX A;  3R2P A;  2V3C C;  1Q0M A;  2WB7 A;  2XXA A;  2R7X A;  1T5O A;  1JMW A;  2X51 A;  2I8B A;  2R7Q A;  5L0F A;  2R25 A;  3QTH A;  3TQO A;  1GS9 A;  3KH2 A;  1QZX A;  3C8G D;  4ULV A;  3VYW A;  3SXM A;  3ZTZ A;  1J8M F;  1Q0K A;  3EG9 B;  1OCC C;  4C7O A;  4K1O A;  1D1C A;  4G7H F;  3C8G B;  2J9U A;  4W8K A;  3FOP A;  3SYN A;  1S7Z A;  2OU6 A;  2XL8 A;  3TK0 A;  4OD5 A;  3A11 A;  4CJO A;  5T1D B;  3KPH A;  2JX0 A;  4ANJ A;  4DRI B;  1YYJ A;  1MMN A;  1YAR O;  3W2V A;  5AGF A;  4O6Y A;  3S28 A;  4P6I C;  4YT5 A;  3C8Z A;  4RDA A;  3T9O A;  1OR2 A;  1JAF A;  2IYL D;  3KYI A;  3L0I A;  3NYJ A;  4AE4 A;  4J32 B;  4CS7 A;  1I5N A;  1T6Q A;  2GWW A;  2WZF A;  3ZSU A;  1V74 B;  3CEX A;  4WGY A;  2HMQ A;  4MQ9 F;  3NYM A;  2AWY A;  4DOZ A;  5KYX A;  4H4K C;  2EIM C;  2NPU A;  2HV6 A;  3KL4 A;  1E84 A;  2R7U A;  3M1C B;  5D91 A;  1U6H A;  1VMA A;  2QNL A;  3DKA A;  1YA9 A;  2LK4 A;  3JYY A;  3I4U A;  4XEK A;  4FAP B;  2MYS A;  4J7Y A;  1T9K A;  4HFK B;  1GGQ A;  3GM1 A;  3KKB A;  4QI2 A;  1E83 A;  2J8W A;  4WJ0 A;  1J8Y F;  2PX3 A;  5DS6 A;  4XPY A;  5BUO A;  4DXW A;  4GQH A;  4O6M A;  2CCY A;  4PFP A;  1V55 C;  4CDA A;  2YL3 A;  4J7T A;  4AE4 B;  2OOC A;  3TOL A;  2DI3 A;  4CS9 C;  1OKK A;  4A4A A;  3G50 A;  1OW8 A;  4IAO A;  3C7J A;  4P9T A; 
#chains in the Genus database with same CATH homology
 3AOU A;  2CYD A;  4BEM J;  2DB4 A;  5TJ5 E;  2BL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...