2CYDA

Crystal structure of lithium bound rotor ring of the v-atpase from enterococcus hirae
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
156
structure length
156
Chain Sequence
MMDYLITQNGGMVFAVLAMATATIFSGIGSAKGVGMTGEAAAALTTSQPEKFGQALILQLLPGTQGLYGFVIAFLIFINLGSDMSVVQGLNFLGASLPIAFTGLFSGIAQGKVAAAGIQILAKKPEHATKGIIFAAMVETYAILGFVISFLLVLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V-type sodium ATP synthase subunit K
publication title Crystal structure of Lithium bound rotor ring of the V-ATPase from Enterococcus hirae
rcsb
source organism Enterococcus hirae
molecule tags Hydrolase
total genus 74
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2005-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00137 ATP-synt_C ATP synthase subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) lithium bound rotor ring of v- atpase 2cydA00
2CYDA 4BEMJ 3AOUA 2BL2A 5TJ5E 2DB4A
chains in the Genus database with same CATH superfamily
2KK1A 2VCBA 1Z3IX 4K1OA 5AGFA 3SXYA 2ZPAA 3VM6A 3J06A 2KYHA 256BA 2H7OA 3FAJA 3KPHA 1LIHA 1M2VA 1OR3A 3I5PA 3KKBA 1OW7A 4U5GA 3K66A 4JZAA 4NTAA 4GYTA 4O6NA 4YL0A 3WODF 2A0BA 3O39A 2NUTB 4RD9A 4O79A 3DM5A 2BL2A 4G78A 4CJOA 1WGWA 4BJ6A 5HSWA 3RYLA 1T6UA 4KNVA 3LAYA 5JP7A 4G7ZF 3GODA 3BRJA 2YL1A 4E0IA 3FOOA 4RBNA 4KI2A 4OIOF 2AWYA 4L6RA 1ZHXA 3UGOA 2ICWG 1R5ID 1U89A 4ULVA 1OCOC 4XTKA 2MWQA 1MMGA 4W8PA 1F1MA 3CZ6A 4CS9C 3EG9B 2LK4A 2XSEA 3VRCA 2IXOA 3SXZA 5K0IA 2HV7A 1T9KA 4AL1A 3JRTA 1M2VB 3LEVA 4XQ1A 3C63A 4ONSA 3R7CA 2IYLD 3U9JA 2HSQA 2EPOA 2G3KA 3HNLA 4DBRA 4K0DA 4AX2A 1LI7A 4JJGA 3ZTZA 1NSGB 4H54A 2OJED 2H8AA 3H65A 2Q9AA 2XLEA 2Y39A 3N2ZB 3WG7C 5EHHA 2OKUA 4F4BA 1HMDA 2AU5A 5DQZA 1SZIA 2KNHA 4MVQA 3SEOA 3IQ6A 2XLWA 1NLXA 4JIOA 2VH3A 1TWHA 4MQ9F 1RCPA 4E18A 2Q9BA 3FOPA 1LPEA 2Y3GA 4J30B 1OCRC 4PACA 2GDCA 3GEHA 2PFDA 4XEKA 5DQTA 4OD5A 1FFTC 2NSGA 4PR9A 3E70C 2IBFA 3MLGA 3SZRA 3LLKA 2L7AA 3UMIA 4BJTA 4FAPB 1IW7F 4MVRA 3V5XA 4C7OA 3ABKC 3EHMA 5L0GA 4P6IC 5COGA 1UFBA 2B0HA 2M64A 2NPUA 4Z9HA 4XLNF 1AEPA 1OCZC 2YL3A 3H2UA 3JCUQ 3RIPA 3NKDA 3VF0A 2L6HA 2GFHA 2YRFA 3GORA 3CAXA 2XLDA 2EPMX 1PCXA 1ZVZA 3VAYA 1H9GA 3TOLA 3ZWIA 3IQCA 4LDRA 2XM4A 4DXWA 4E0HA 2XLOA 3ECSA 5F5HA 1E85A 4U5CE 3ZC4A 1TWAA 1EI7A 1ZW2A 4XWJA 2D5RB 3K1IA 2GAQA 5A69A 2RSEB 1SMYF 1YAUO 3F46A 3EPVA 1OKKA 1SR2A 1YA9A 5F5FA 3NYJA 2IXPA 2KQ9A 2ZXWC 2R02A 2X51A 4HEAJ 4NTBA 2LSEA 3U2MA 3OA1A 3F47A 4HFFB 4MVUA 4N06A 4A4AA 1WOLA 1S05A 1C02A 2NG1A 2OG2A 3NMKA 1BBHA 2LFDA 4JC7A 1IZMA 4EWCA 4NCQA 4NC3A 2ZXOA 2TMVP 2Y3BA 2KC3A 3NMJA 1YYJA 2PX0A 3TJ5A 2HJMA 4CDVA 4YK5A 3UGPA 4MS2A 1OCCC 1QLEC 2VCAA 2XL6A 3QTHA 3QW0A 5KYUA 2YQYA 3SXMA 3NYLA 1EA8A 4AL0A 3V5ZA 3ZVRA 1TR2A 5IY5C 5L0IA 5DS6A 3FDQA 3LS0A 3US6A 5KYYA 3AG2C 4JTCB 1GM5A 4C3BA 1H6GA 1L7CA 3LLIA 5AC4A 2R7QA 3M4CA 2EIKC 1EQ1A 4YL1A 5B1AC 2CGEA 4XPWA 1RKCA 3W8HA 1RJ9A 2Y3DA 4MW8A 1Q0MA 2HMZA 1PD1A 1ZZPA 2MYSA 2R05A 2JX0A 4I1MA 4CDYA 2LD6A 4I1OB 2R7XA 4X0RA 4YWQA 1G8XA 2IXNA 3ABMC 3LJBA 3PCVA 3DJUB 3C8GD 4NQFA 1ORSC 3GEIA 4H4KC 4MTGA 5T3WA 1VYKA 2Q3TA 5L0CA 4CS7A 1BDJB 3SNHA 1TKNA 5KYUB 1A7EA 2IOQA 3IQ5A 3EFOA 2H7BA 2JD3A 1L3PA 2WVNA 5JUAA 1E86A 2HUJA 1K04A 1I4YA 3QMKA 4WGZA 3JT1A 1PV3A 2EPKX 4BJ5A 4P9FA 1LS1A 5KYYB 2CNWD 3U9MA 2OEXA 2E87A 1J8MF 2XRHA 2LQGA 1T01A 2EPLX 2V3CC 5D91A 4LDQA 1QKRA 4ANJA 2HKVA 4MVMA 2HV6A 4CJGA 1GQAA 2VB6A 4U9EA 4WGYA 1RJ9B 2F22A 4OD4A 3CSKA 4CX9A 2PP4A 4KBLA 4EUKB 1VLSA 3Q7GA 3LNRA 5E33A 2DYSC 1HW2A 1MNEA 2AVKA 3KL4A 2CCYA 5TJ5E 1V4AA 3C18A 3S28A 3B71A 1NU9C 4OIQF 2QTVA 3QVYA 1JOGA 2Q00A 1SYQA 1A0BA 4PJNA 3PHF2 3EFOB 4IARA 1OR2A 1H9TA 1O87A 1TQGA 2GA0A 1OKKD 2L6GA 3U2LA 4O7GA 5CIVA 1N1CA 2LFFA 3KYIA 5CI8A 5EGYA 3M15A 1KNYA 2V26A 3KYJA 4CS8C 3IPMO 5B3IA 4N4WA 5E3CA 3QW1A 3WAQA 3QVZA 1D1BA 1YZAA 2BC5A 3GM3A 2HMQA 3ZG1A 4B6IA 3S0XA 4U9DA 4J7TA 1C03A 5DVWA 5KYWA 2HJ3A 4IJJA 3W2WA 2WZFA 3WHNA 3I4UA 1NU7D 1W2WA 2GWWA 3EH1A 5GPGB 2EILC 2R25A 4CSAC 2XL8A 4OINF 3HLZA 3EGXA 1YJGA 4GEHA 3TULA 1G5ZA 1A7VA 3M79A 2ZXRA 4DJ9A 5L0FA 3LEOA 3L8JA 4YT8A 3B29A 5DS4A 5JVEA 2R7TA 3V7OA 1D0YA 3RVZA 1JMWA 3C8GA 1Z6AA 2LCHA 5DS5A 3LS1A 1G4US 5E3AA 4XEVA 1R4TA 4KNWA 1Q0DA 4U5HA 3ZSUA 1VYIA 3A9CA 3HJCA 1OQCA 3JRMO 3JZ0A 3EJNA 4BJ1A 2YL7A 5A6AA 1PD0A 4MTOA 2J45A 5L3VA 2H7VC 4GQHA 3U3FA 3RF3A 5FCLA 3R2PA 3G4XA 1O5HA 2CNWA 4Q5SF 2A69F 3ABLC 1FNTc 1FR0A 3EGDA 3B0UX 1V55C 1JR8A 1ST6A 4LLCA 3X2QC 4AE4A 3JSEO 1NBBA 3MYFA 4LLEA 4ZLCA 3IQTA 4XPYA 3U0CA 1FMVA 1Z23A 4DBQA 4KC9A 3EGXB 3JSZA 3DE9A 3TD7A 3CQZA 3POVA 2HSBA 5D92A 2QE9A 4YT5A 4LDKA 3W2VA 4BEJA 2C04A 1E83A 3EG9A 3T6BA 5L3QA 1WATA 2IM8A 3C8GB 1RMVA 3BEHA 4MVZA 3JYYA 1K05A 3FMSA 2J9BA 2VASA 4WJ0A 4C3EA 5L0JA 2KJGA 3DAGA 3DD7A 4JCHA 4IGGA 4BG0A 2YZSA 3FHDA 3ZIBA 2R7SA 4C7OB 4OIRF 4XEFA 1RKEA 1EKYA 4MNDA 1O3UA 4D4XA 1MQVA 1ZHTA 2RD9A 3EGDB 5FZTA 2P61A 1VK5A 4AE4B 3NKEA 2XLMA 1TFKB 3H2VA 1UG7A 1Z63A 4PFPA 1APCA 4Z9JA 2PX3A 1VOMA 4RDAA 2WVOA 3KH2A 1RXQA 4JW1A 4IB4A 1MMDA 4E17A 5JT4A 1GGQA 3FVYA 5JS5A 2A68F 1SF8A 5JRAA 3KMIA 2J0WA 4JRZA 3FXHA 4YN0B 3RQEA 1M6TA 4OIPF 3T9OA 2XM0A 3U3BA 1M57C 2OOCA 1GS9A 1TWCA 4IRUA 1Q0GA 1XZPA 2C03A 3LNMB 1B68A 1WN0A 3QZCA 2M4EA 1QPUA 1D1CA 1D0XA 1RKEB 3N24A 3RFYA 4CDAA 4DRHB 3T4RA 1WTYA 3M1CB 3RQGA 4EIYA 3NDBB 3UMKA 1ORYA 2XS1A 1NFNA 2A1DD 4JEAA 3X1OA 2A6HF 3RKOF 4HE8D 2YLDA 4FWVA 5BQHA 1LS4A 2QY9A 1Z7Qc 3K7DA 2PBEA 1K40A 1QQ3A 2J46A 2KSFA 2QNLA 3B9QA 2XLVA 3HKKA 4NTFA 4BEMJ 2R7WA 2J7PD 1ZHYA 3UMHA 1ZU4A 4JVSA 1KTMA 1NG1A 1TFOB 3MX3A 3ZQVA 3ASOC 5A6KA 3HNKA 2HZ8A 3EZIA 1V54C 3IHUA 4Z9IA 2OEVA 5AC5A 2W45A 1Q0KA 3S9OA 2P7VA 1VMAA 3CEXA 4U5FE 3ZQYA 1CGOA 5HV9A 3N0TA 1YDIA 3S84A 1MMNA 5BQGA 2YHSA 4LACB 1VTMP 1Y6DA 1MMAA 4PK4A 3NYMA 2NUPA 4BJ6C 4MVSA 2J9UA 4K7BA 1V74B 2HS5A 3GM2A 2R7VA 1JPJA 3U8VA 1LVKA 3AG1C 1JRAA 4U5DE 2ASRA 1ZU5A 4I44A 4D4NA 2WB7A 2OU6A 1WWPA 1OW6A 2W4MA 2KW3C 4EHPA 3I5QA 1HMOA 2WZLA 1E84A 3MYIA 4JE9A 2A0UA 3E9VA 4YL3A 1YVIA 3TK0A 1VLTA 3L8IA 3ATPA 4O6YA 1D1AA 4W8KA 3JTLO 3L34A 2J8WA 1M2OA 4QI2A 2CYDA 2AWCA 4QDLA 1I5NA 1QSPA 3NG1A 3LESA 4JJFA 4A2NB 2Y69C 4IAQA 2WZGA 4MTFA 3O10A 1LKXA 3TOMA 4CIHA 4XLPF 2NUPB 3GWLA 3T6GB 4YJWA 2D4UA 2O9XA 2B0JA 2Q4FA 2W9YA 3AGUA 2KGOA 2MHRA 3EHNA 3S27A 4UDVA 2QUPA 1LI5A 3TQOA 4JEBA 5BUOA 2FFHA 1T6IA 3GANA 3RW0A 4YT4A 4AK9A 3GEEA 5T1DB 1CPRA 2DYRC 4N6HA 2J7PA 2X0CA 2J9WA 2XS8A 3JYHA 4M63A 3UR3C 3VYWA 4BPMA 4CS9A 1AVOB 3W8IA 3ASNC 1U6HA 4JTDB 4CS8A 1G4WR 2OQMA 5A6BD 4ZLDA 4CBEA 3SXKA 1ZW3A 1C17M 1JAFA 1YZCA 2FGYA 3HTKC 5EK0A 3NMIA 3RQFA 3V5YA 1CGNA 1NFOA 3DXJF 2CDQA 3Q6NA 4U5BE 4WABA 2EIMC 5CI9A 3DI5A 4EKWA 5L0DA 4QI0A 3SYNA 2NSFA 5KYWB 1E2XA 1FAPB 5L0HA 1I4ZA 2EIJC 4CSAA 1U0BB 4E7SA 1YYXA 3AJMA 2JPUA 1T6QA 5KYNA 2P6VA 3K1IC 4Q4ZF 2OCCC 4FX5A 2YLIA 1LM3B 1CPQA 2G62A 3DWWA 3FAPB 3GWNA 4IWBA 3U5SA 2XLHA 2R9RB 3IEEA 2DB4A 1NZEA 4I3MA 4U5EE 1OW8A 1BR4A 1MNDA 3G4ZA 3L1MA 3SP1A 4JTAB 1Y4CA 2R7OA 3K33A 1FMWA 4DVZA 2ZD9A 2HFIA 2WL8A 1ZHWA 3M4BA 1HY5A 5F28E 1YA7O 5B1BC 1T5OA 3G50A 3RH3A 4ULWA 4LERA 3AG3C 2YLGA 4FESA 3Q6MA 4DVYP 3AGTA 2P1AA 1TWGA 4HFKB 2XXAA 2CW0F 2Q7RA 3T6JA 4IAOA 3A11A 2Z15A 1YARO 3DE8A 3U8PA 1A7DA 3DKAA 5BQIA 1QVXA 4DRIB 1ZYRF 1Q0FA 4P9TA 2L81A 4MW3A 2R7UA 3PDMP 1AUEA 2YKZA 3TJ6A 1OXKA 2BE5F 2OJQA 2G3VA 4E7ZA 3W4YA 1J8YF 1D0ZA 1VB5A 3C8ZA 1CGME 3ZDLA 2PF4E 2DI3A 2VCCA 3ZTMA 4G7OF 1LE4A 1BR2A 5KYXA 1H7IA 2I15A 4J32B 5JSLA 1A41A 2YWAA 2UUIA 2P0NA 1Z5ZA 3EZHA 3B0VC 2AP3A 2LIGA 2L6FA 4DRJB 3S29A 5A6JA 5A6BA 4EBBA 5COFA 1HW1A 1ORJA 2XXAB 2R7RA 1FFHA 2ETSA 3DM9B 3PMRA 2WVQA 2IXMA 4G7HF 1HE9A 2J9VA 2FAPB 4PJLA 2VC9A 4J7YA 2A6EF 4BJ5C 1BZ4A 1QZXA 2W4BA 2Y3HA 2ZXPA 5E2QA 4O6MA 1FTSA 2J0XA 1M56C 3AQCA 5T3TA 3RVYA 1ZHZA 4ER9A 1LE2A 1OXBA 3DAFA 1DOWA 2QLAA 3EQLF 1XZQA 4EBKA 4CIPA 4PJJA 3B0PA 2YL0A 3AG4C 3OEOA 4JURI 3NRHA 1S7ZA 5KYXB 3ITFA 4Q7CA 2Q9CA 4R32A 4EBJA 3HNJA 3HNIA 3O55A 2PNOA 5COMA 1BR1A 2YEVA 2R03A 3DJNB 4PJMA 4G0HA 2NUTA 2EINC 3UNGC 1HE1A 5DLJA 1WASA 4PFOA 4NY3A 2DGJA 1JPNA 3DZAA 3MBGA 4JCZA 4N6CA 2XL4A 3AQBA 2UUHA 2LP4A 3GM1A 1DOVA 3K6BA 2L9JA 3K1HA 3S90A 1XWJA 2EPNA 4JKVA 5JLIA 4DOZA 3C62A 3MFNA 3OWTA 3LUTB 3AOUA 3C7JA 3L0IA 4YT2A 5B3SC 3O6XA 2YVKA 3Q7LA 4MVOA 2I8BA 4C3DA 1YLMA 1KU2A 4XPXA 3EH2A 3DMDA
chains in the Genus database with same CATH topology
2CYDA 4BEMJ 3AOUA 2BL2A 5TJ5E 2DB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CYD A;  4BEM J;  3AOU A;  2BL2 A;  5TJ5 E;  2DB4 A; 
#chains in the Genus database with same CATH topology
 2KK1 A;  2VCB A;  1Z3I X;  4K1O A;  5AGF A;  3SXY A;  2ZPA A;  3VM6 A;  3J06 A;  2KYH A;  256B A;  2H7O A;  3FAJ A;  3KPH A;  1LIH A;  1M2V A;  1OR3 A;  3I5P A;  3KKB A;  1OW7 A;  4U5G A;  3K66 A;  4JZA A;  4NTA A;  4GYT A;  4O6N A;  4YL0 A;  3WOD F;  2A0B A;  3O39 A;  2NUT B;  4RD9 A;  4O79 A;  3DM5 A;  2BL2 A;  4G78 A;  4CJO A;  1WGW A;  4BJ6 A;  5HSW A;  3RYL A;  1T6U A;  4KNV A;  3LAY A;  5JP7 A;  4G7Z F;  3GOD A;  3BRJ A;  2YL1 A;  4E0I A;  3FOO A;  4RBN A;  4KI2 A;  4OIO F;  2AWY A;  4L6R A;  1ZHX A;  3UGO A;  2ICW G;  1R5I D;  1U89 A;  4ULV A;  1OCO C;  4XTK A;  2MWQ A;  1MMG A;  4W8P A;  1F1M A;  3CZ6 A;  4CS9 C;  3EG9 B;  2LK4 A;  2XSE A;  3VRC A;  2IXO A;  3SXZ A;  5K0I A;  2HV7 A;  1T9K A;  4AL1 A;  3JRT A;  1M2V B;  3LEV A;  4XQ1 A;  3C63 A;  4ONS A;  3R7C A;  2IYL D;  3U9J A;  2HSQ A;  2EPO A;  2G3K A;  3HNL A;  4DBR A;  4K0D A;  4AX2 A;  1LI7 A;  4JJG A;  3ZTZ A;  1NSG B;  4H54 A;  2OJE D;  2H8A A;  3H65 A;  2Q9A A;  2XLE A;  2Y39 A;  3N2Z B;  3WG7 C;  5EHH A;  2OKU A;  4F4B A;  1HMD A;  2AU5 A;  5DQZ A;  1SZI A;  2KNH A;  4MVQ A;  3SEO A;  3IQ6 A;  2XLW A;  1NLX A;  4JIO A;  2VH3 A;  1TWH A;  4MQ9 F;  1RCP A;  4E18 A;  2Q9B A;  3FOP A;  1LPE A;  2Y3G A;  4J30 B;  1OCR C;  4PAC A;  2GDC A;  3GEH A;  2PFD A;  4XEK A;  5DQT A;  4OD5 A;  1FFT C;  2NSG A;  4PR9 A;  3E70 C;  2IBF A;  3MLG A;  3SZR A;  3LLK A;  2L7A A;  3UMI A;  4BJT A;  4FAP B;  1IW7 F;  4MVR A;  3V5X A;  4C7O A;  3ABK C;  3EHM A;  5L0G A;  4P6I C;  5COG A;  1UFB A;  2B0H A;  2M64 A;  2NPU A;  4Z9H A;  4XLN F;  1AEP A;  1OCZ C;  2YL3 A;  3H2U A;  3JCU Q;  3RIP A;  3NKD A;  3VF0 A;  2L6H A;  2GFH A;  2YRF A;  3GOR A;  3CAX A;  2XLD A;  2EPM X;  1PCX A;  1ZVZ A;  3VAY A;  1H9G A;  3TOL A;  3ZWI A;  3IQC A;  4LDR A;  2XM4 A;  4DXW A;  4E0H A;  2XLO A;  3ECS A;  5F5H A;  1E85 A;  4U5C E;  3ZC4 A;  1TWA A;  1EI7 A;  1ZW2 A;  4XWJ A;  2D5R B;  3K1I A;  2GAQ A;  5A69 A;  2RSE B;  1SMY F;  1YAU O;  3F46 A;  3EPV A;  1OKK A;  1SR2 A;  1YA9 A;  5F5F A;  3NYJ A;  2IXP A;  2KQ9 A;  2ZXW C;  2R02 A;  2X51 A;  4HEA J;  4NTB A;  2LSE A;  3U2M A;  3OA1 A;  3F47 A;  4HFF B;  4MVU A;  4N06 A;  4A4A A;  1WOL A;  1S05 A;  1C02 A;  2NG1 A;  2OG2 A;  3NMK A;  1BBH A;  2LFD A;  4JC7 A;  1IZM A;  4EWC A;  4NCQ A;  4NC3 A;  2ZXO A;  2TMV P;  2Y3B A;  2KC3 A;  3NMJ A;  1YYJ A;  2PX0 A;  3TJ5 A;  2HJM A;  4CDV A;  4YK5 A;  3UGP A;  4MS2 A;  1OCC C;  1QLE C;  2VCA A;  2XL6 A;  3QTH A;  3QW0 A;  5KYU A;  2YQY A;  3SXM A;  3NYL A;  1EA8 A;  4AL0 A;  3V5Z A;  3ZVR A;  1TR2 A;  5IY5 C;  5L0I A;  5DS6 A;  3FDQ A;  3LS0 A;  3US6 A;  5KYY A;  3AG2 C;  4JTC B;  1GM5 A;  4C3B A;  1H6G A;  1L7C A;  3LLI A;  5AC4 A;  2R7Q A;  3M4C A;  2EIK C;  1EQ1 A;  4YL1 A;  5B1A C;  2CGE A;  4XPW A;  1RKC A;  3W8H A;  1RJ9 A;  2Y3D A;  4MW8 A;  1Q0M A;  2HMZ A;  1PD1 A;  1ZZP A;  2MYS A;  2R05 A;  2JX0 A;  4I1M A;  4CDY A;  2LD6 A;  4I1O B;  2R7X A;  4X0R A;  4YWQ A;  1G8X A;  2IXN A;  3ABM C;  3LJB A;  3PCV A;  3DJU B;  3C8G D;  4NQF A;  1ORS C;  3GEI A;  4H4K C;  4MTG A;  5T3W A;  1VYK A;  2Q3T A;  5L0C A;  4CS7 A;  1BDJ B;  3SNH A;  1TKN A;  5KYU B;  1A7E A;  2IOQ A;  3IQ5 A;  3EFO A;  2H7B A;  2JD3 A;  1L3P A;  2WVN A;  5JUA A;  1E86 A;  2HUJ A;  1K04 A;  1I4Y A;  3QMK A;  4WGZ A;  3JT1 A;  1PV3 A;  2EPK X;  4BJ5 A;  4P9F A;  1LS1 A;  5KYY B;  2CNW D;  3U9M A;  2OEX A;  2E87 A;  1J8M F;  2XRH A;  2LQG A;  1T01 A;  2EPL X;  2V3C C;  5D91 A;  4LDQ A;  1QKR A;  4ANJ A;  2HKV A;  4MVM A;  2HV6 A;  4CJG A;  1GQA A;  2VB6 A;  4U9E A;  4WGY A;  1RJ9 B;  2F22 A;  4OD4 A;  3CSK A;  4CX9 A;  2PP4 A;  4KBL A;  4EUK B;  1VLS A;  3Q7G A;  3LNR A;  5E33 A;  2DYS C;  1HW2 A;  1MNE A;  2AVK A;  3KL4 A;  2CCY A;  5TJ5 E;  1V4A A;  3C18 A;  3S28 A;  3B71 A;  1NU9 C;  4OIQ F;  2QTV A;  3QVY A;  1JOG A;  2Q00 A;  1SYQ A;  1A0B A;  4PJN A;  3PHF 2;  3EFO B;  4IAR A;  1OR2 A;  1H9T A;  1O87 A;  1TQG A;  2GA0 A;  1OKK D;  2L6G A;  3U2L A;  4O7G A;  5CIV A;  1N1C A;  2LFF A;  3KYI A;  5CI8 A;  5EGY A;  3M15 A;  1KNY A;  2V26 A;  3KYJ A;  4CS8 C;  3IPM O;  5B3I A;  4N4W A;  5E3C A;  3QW1 A;  3WAQ A;  3QVZ A;  1D1B A;  1YZA A;  2BC5 A;  3GM3 A;  2HMQ A;  3ZG1 A;  4B6I A;  3S0X A;  4U9D A;  4J7T A;  1C03 A;  5DVW A;  5KYW A;  2HJ3 A;  4IJJ A;  3W2W A;  2WZF A;  3WHN A;  3I4U A;  1NU7 D;  1W2W A;  2GWW A;  3EH1 A;  5GPG B;  2EIL C;  2R25 A;  4CSA C;  2XL8 A;  4OIN F;  3HLZ A;  3EGX A;  1YJG A;  4GEH A;  3TUL A;  1G5Z A;  1A7V A;  3M79 A;  2ZXR A;  4DJ9 A;  5L0F A;  3LEO A;  3L8J A;  4YT8 A;  3B29 A;  5DS4 A;  5JVE A;  2R7T A;  3V7O A;  1D0Y A;  3RVZ A;  1JMW A;  3C8G A;  1Z6A A;  2LCH A;  5DS5 A;  3LS1 A;  1G4U S;  5E3A A;  4XEV A;  1R4T A;  4KNW A;  1Q0D A;  4U5H A;  3ZSU A;  1VYI A;  3A9C A;  3HJC A;  1OQC A;  3JRM O;  3JZ0 A;  3EJN A;  4BJ1 A;  2YL7 A;  5A6A A;  1PD0 A;  4MTO A;  2J45 A;  5L3V A;  2H7V C;  4GQH A;  3U3F A;  3RF3 A;  5FCL A;  3R2P A;  3G4X A;  1O5H A;  2CNW A;  4Q5S F;  2A69 F;  3ABL C;  1FNT c;  1FR0 A;  3EGD A;  3B0U X;  1V55 C;  1JR8 A;  1ST6 A;  4LLC A;  3X2Q C;  4AE4 A;  3JSE O;  1NBB A;  3MYF A;  4LLE A;  4ZLC A;  3IQT A;  4XPY A;  3U0C A;  1FMV A;  1Z23 A;  4DBQ A;  4KC9 A;  3EGX B;  3JSZ A;  3DE9 A;  3TD7 A;  3CQZ A;  3POV A;  2HSB A;  5D92 A;  2QE9 A;  4YT5 A;  4LDK A;  3W2V A;  4BEJ A;  2C04 A;  1E83 A;  3EG9 A;  3T6B A;  5L3Q A;  1WAT A;  2IM8 A;  3C8G B;  1RMV A;  3BEH A;  4MVZ A;  3JYY A;  1K05 A;  3FMS A;  2J9B A;  2VAS A;  4WJ0 A;  4C3E A;  5L0J A;  2KJG A;  3DAG A;  3DD7 A;  4JCH A;  4IGG A;  4BG0 A;  2YZS A;  3FHD A;  3ZIB A;  2R7S A;  4C7O B;  4OIR F;  4XEF A;  1RKE A;  1EKY A;  4MND A;  1O3U A;  4D4X A;  1MQV A;  1ZHT A;  2RD9 A;  3EGD B;  5FZT A;  2P61 A;  1VK5 A;  4AE4 B;  3NKE A;  2XLM A;  1TFK B;  3H2V A;  1UG7 A;  1Z63 A;  4PFP A;  1APC A;  4Z9J A;  2PX3 A;  1VOM A;  4RDA A;  2WVO A;  3KH2 A;  1RXQ A;  4JW1 A;  4IB4 A;  1MMD A;  4E17 A;  5JT4 A;  1GGQ A;  3FVY A;  5JS5 A;  2A68 F;  1SF8 A;  5JRA A;  3KMI A;  2J0W A;  4JRZ A;  3FXH A;  4YN0 B;  3RQE A;  1M6T A;  4OIP F;  3T9O A;  2XM0 A;  3U3B A;  1M57 C;  2OOC A;  1GS9 A;  1TWC A;  4IRU A;  1Q0G A;  1XZP A;  2C03 A;  3LNM B;  1B68 A;  1WN0 A;  3QZC A;  2M4E A;  1QPU A;  1D1C A;  1D0X A;  1RKE B;  3N24 A;  3RFY A;  4CDA A;  4DRH B;  3T4R A;  1WTY A;  3M1C B;  3RQG A;  4EIY A;  3NDB B;  3UMK A;  1ORY A;  2XS1 A;  1NFN A;  2A1D D;  4JEA A;  3X1O A;  2A6H F;  3RKO F;  4HE8 D;  2YLD A;  4FWV A;  5BQH A;  1LS4 A;  2QY9 A;  1Z7Q c;  3K7D A;  2PBE A;  1K40 A;  1QQ3 A;  2J46 A;  2KSF A;  2QNL A;  3B9Q A;  2XLV A;  3HKK A;  4NTF A;  4BEM J;  2R7W A;  2J7P D;  1ZHY A;  3UMH A;  1ZU4 A;  4JVS A;  1KTM A;  1NG1 A;  1TFO B;  3MX3 A;  3ZQV A;  3ASO C;  5A6K A;  3HNK A;  2HZ8 A;  3EZI A;  1V54 C;  3IHU A;  4Z9I A;  2OEV A;  5AC5 A;  2W45 A;  1Q0K A;  3S9O A;  2P7V A;  1VMA A;  3CEX A;  4U5F E;  3ZQY A;  1CGO A;  5HV9 A;  3N0T A;  1YDI A;  3S84 A;  1MMN A;  5BQG A;  2YHS A;  4LAC B;  1VTM P;  1Y6D A;  1MMA A;  4PK4 A;  3NYM A;  2NUP A;  4BJ6 C;  4MVS A;  2J9U A;  4K7B A;  1V74 B;  2HS5 A;  3GM2 A;  2R7V A;  1JPJ A;  3U8V A;  1LVK A;  3AG1 C;  1JRA A;  4U5D E;  2ASR A;  1ZU5 A;  4I44 A;  4D4N A;  2WB7 A;  2OU6 A;  1WWP A;  1OW6 A;  2W4M A;  2KW3 C;  4EHP A;  3I5Q A;  1HMO A;  2WZL A;  1E84 A;  3MYI A;  4JE9 A;  2A0U A;  3E9V A;  4YL3 A;  1YVI A;  3TK0 A;  1VLT A;  3L8I A;  3ATP A;  4O6Y A;  1D1A A;  4W8K A;  3JTL O;  3L34 A;  2J8W A;  1M2O A;  4QI2 A;  2CYD A;  2AWC A;  4QDL A;  1I5N A;  1QSP A;  3NG1 A;  3LES A;  4JJF A;  4A2N B;  2Y69 C;  4IAQ A;  2WZG A;  4MTF A;  3O10 A;  1LKX A;  3TOM A;  4CIH A;  4XLP F;  2NUP B;  3GWL A;  3T6G B;  4YJW A;  2D4U A;  2O9X A;  2B0J A;  2Q4F A;  2W9Y A;  3AGU A;  2KGO A;  2MHR A;  3EHN A;  3S27 A;  4UDV A;  2QUP A;  1LI5 A;  3TQO A;  4JEB A;  5BUO A;  2FFH A;  1T6I A;  3GAN A;  3RW0 A;  4YT4 A;  4AK9 A;  3GEE A;  5T1D B;  1CPR A;  2DYR C;  4N6H A;  2J7P A;  2X0C A;  2J9W A;  2XS8 A;  3JYH A;  4M63 A;  3UR3 C;  3VYW A;  4BPM A;  4CS9 A;  1AVO B;  3W8I A;  3ASN C;  1U6H A;  4JTD B;  4CS8 A;  1G4W R;  2OQM A;  5A6B D;  4ZLD A;  4CBE A;  3SXK A;  1ZW3 A;  1C17 M;  1JAF A;  1YZC A;  2FGY A;  3HTK C;  5EK0 A;  3NMI A;  3RQF A;  3V5Y A;  1CGN A;  1NFO A;  3DXJ F;  2CDQ A;  3Q6N A;  4U5B E;  4WAB A;  2EIM C;  5CI9 A;  3DI5 A;  4EKW A;  5L0D A;  4QI0 A;  3SYN A;  2NSF A;  5KYW B;  1E2X A;  1FAP B;  5L0H A;  1I4Z A;  2EIJ C;  4CSA A;  1U0B B;  4E7S A;  1YYX A;  3AJM A;  2JPU A;  1T6Q A;  5KYN A;  2P6V A;  3K1I C;  4Q4Z F;  2OCC C;  4FX5 A;  2YLI A;  1LM3 B;  1CPQ A;  2G62 A;  3DWW A;  3FAP B;  3GWN A;  4IWB A;  3U5S A;  2XLH A;  2R9R B;  3IEE A;  2DB4 A;  1NZE A;  4I3M A;  4U5E E;  1OW8 A;  1BR4 A;  1MND A;  3G4Z A;  3L1M A;  3SP1 A;  4JTA B;  1Y4C A;  2R7O A;  3K33 A;  1FMW A;  4DVZ A;  2ZD9 A;  2HFI A;  2WL8 A;  1ZHW A;  3M4B A;  1HY5 A;  5F28 E;  1YA7 O;  5B1B C;  1T5O A;  3G50 A;  3RH3 A;  4ULW A;  4LER A;  3AG3 C;  2YLG A;  4FES A;  3Q6M A;  4DVY P;  3AGT A;  2P1A A;  1TWG A;  4HFK B;  2XXA A;  2CW0 F;  2Q7R A;  3T6J A;  4IAO A;  3A11 A;  2Z15 A;  1YAR O;  3DE8 A;  3U8P A;  1A7D A;  3DKA A;  5BQI A;  1QVX A;  4DRI B;  1ZYR F;  1Q0F A;  4P9T A;  2L81 A;  4MW3 A;  2R7U A;  3PDM P;  1AUE A;  2YKZ A;  3TJ6 A;  1OXK A;  2BE5 F;  2OJQ A;  2G3V A;  4E7Z A;  3W4Y A;  1J8Y F;  1D0Z A;  1VB5 A;  3C8Z A;  1CGM E;  3ZDL A;  2PF4 E;  2DI3 A;  2VCC A;  3ZTM A;  4G7O F;  1LE4 A;  1BR2 A;  5KYX A;  1H7I A;  2I15 A;  4J32 B;  5JSL A;  1A41 A;  2YWA A;  2UUI A;  2P0N A;  1Z5Z A;  3EZH A;  3B0V C;  2AP3 A;  2LIG A;  2L6F A;  4DRJ B;  3S29 A;  5A6J A;  5A6B A;  4EBB A;  5COF A;  1HW1 A;  1ORJ A;  2XXA B;  2R7R A;  1FFH A;  2ETS A;  3DM9 B;  3PMR A;  2WVQ A;  2IXM A;  4G7H F;  1HE9 A;  2J9V A;  2FAP B;  4PJL A;  2VC9 A;  4J7Y A;  2A6E F;  4BJ5 C;  1BZ4 A;  1QZX A;  2W4B A;  2Y3H A;  2ZXP A;  5E2Q A;  4O6M A;  1FTS A;  2J0X A;  1M56 C;  3AQC A;  5T3T A;  3RVY A;  1ZHZ A;  4ER9 A;  1LE2 A;  1OXB A;  3DAF A;  1DOW A;  2QLA A;  3EQL F;  1XZQ A;  4EBK A;  4CIP A;  4PJJ A;  3B0P A;  2YL0 A;  3AG4 C;  3OEO A;  4JUR I;  3NRH A;  1S7Z A;  5KYX B;  3ITF A;  4Q7C A;  2Q9C A;  4R32 A;  4EBJ A;  3HNJ A;  3HNI A;  3O55 A;  2PNO A;  5COM A;  1BR1 A;  2YEV A;  2R03 A;  3DJN B;  4PJM A;  4G0H A;  2NUT A;  2EIN C;  3UNG C;  1HE1 A;  5DLJ A;  1WAS A;  4PFO A;  4NY3 A;  2DGJ A;  1JPN A;  3DZA A;  3MBG A;  4JCZ A;  4N6C A;  2XL4 A;  3AQB A;  2UUH A;  2LP4 A;  3GM1 A;  1DOV A;  3K6B A;  2L9J A;  3K1H A;  3S90 A;  1XWJ A;  2EPN A;  4JKV A;  5JLI A;  4DOZ A;  3C62 A;  3MFN A;  3OWT A;  3LUT B;  3AOU A;  3C7J A;  3L0I A;  4YT2 A;  5B3S C;  3O6X A;  2YVK A;  3Q7L A;  4MVO A;  2I8B A;  4C3D A;  1YLM A;  1KU2 A;  4XPX A;  3EH2 A;  3DMD A; 
#chains in the Genus database with same CATH homology
 2CYD A;  4BEM J;  3AOU A;  2BL2 A;  5TJ5 E;  2DB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...