2YLIA

Recombinant native cytochrome c prime from alcaligenes xylosoxidans in its ferrous form at 1.45 a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
127
structure length
127
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 50
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yliA00
5JLIA 4D4NA 3HNJA 3M4BA 2YL1A 4WGYA 1E86A 4IB4A 3ZTMA 2YLGA 5AGFA 2XL8A 4IAQA 5JVEA 1CPRA 1JAFA 3ZTZA 1APCA 2XLMA 2J8WA 2XLVA 4N4WA 5JS5A 4CJGA 3HNLA 4JEBA 4U9EA 1A7VA 2YLDA 3IQ5A 1YZAA 4JEAA 2XL6A 4N6HA 1YZCA 1GQAA 3C62A 3QVYA 3U8PA 1MQVA 2XLEA 1RCPA 1EKYA 2YL3A 1BBHA 5JUAA 3QW0A 3QW1A 4ER9A 3NMJA 1CPQA 4CDVA 3IQ6A 3VRCA 256BA 3HNKA 3QVZA 4NC3A 2XM0A 3ZQYA 3FOOA 2J9BA 1M6TA 2XM4A 3FOPA 2YKZA 3M4CA 4D4XA 2CCYA 3NMKA 5JP7A 4JKVA 2XLOA 1CGNA 1NBBA 4IARA 3M15A 3M79A 2YLIA 2QLAA 3ZWIA 4ULVA 3L1MA 3TOLA 1YYXA 1S05A 3ZQVA 5B3IA 3C63A 3TOMA 2BC5A 4U9DA 1QQ3A 4CDAA 5JT4A 1YYJA 3DE8A 3DE9A 1E85A 1QPUA 4EIYA 2XLWA 2YL7A 1CGOA 4CIPA 2YL0A 3NMIA 1LM3B 4L6RA 2XLHA 4JE9A 4CDYA 4CX9A 2XLDA 3HNIA 4WGZA 4CJOA 5JSLA 5JRAA 1E83A 1E84A
chains in the Genus database with same CATH superfamily
4W8KA 2J9WA 4O7GA 1YJGA 2VH3A 1O3UA 1RKEB 2HS5A 1Q0FA 3Q6MA 3M4BA 4G7ZF 3N2ZB 2V3CC 5BUOA 3ZTMA 1V54C 3IQTA 4U5HA 2YLGA 2VC9A 5AGFA 4RBNA 2KK1A 3JTLO 4MTOA 4MVRA 5E33A 3H65A 4ANJA 4KI2A 1TWCA 3C18A 4YN0B 1T01A 3KL4A 2G3KA 1RKEA 3LLIA 4NTAA 2VB6A 5BQGA 3RFYA 3DXJF 4DJ9A 2J45A 3S27A 2ZXRA 1MMAA 2Q9AA 3HTKC 1I4ZA 2CW0F 2J8WA 2XLMA 3LS1A 4JCHA 4OIQF 4YJWA 3ITFA 2XLVA 4MVUA 2Q9BA 5JS5A 2A0UA 3HNLA 4C3BA 1A41A 5COMA 1QSPA 1A7VA 2YLDA 1WGWA 2A6EF 2OKUA 3G4ZA 3GEIA 3S84A 1RMVA 4U5EE 4BEJA 4MVQA 1PV3A 2EPOA 1ZYRF 2CYDA 2RSEB 1FFHA 1WOLA 2IXPA 5B1BC 3TJ5A 3NKDA 5DS5A 5CI9A 3EH2A 2XS1A 3WG7C 2BE5F 1T9KA 3DAFA 4DRHB 4DXWA 4OD4A 2KNHA 4OIPF 2R7XA 2WZGA 2IXNA 4DBQA 1V74B 2UUHA 5E3AA 4W8PA 3T6JA 5DLJA 1VB5A 3RVYA 4PFPA 2I8BA 5DS4A 4FWVA 5JUAA 1JPJA 3TULA 3PHF2 2YWAA 2CNWA 1YDIA 4NY3A 3NMJA 1CPQA 1ZHTA 4CDVA 1MMNA 5BQHA 2LCHA 2W45A 256BA 3PMRA 4OIOF 3OA1A 1U89A 3Q7GA 4JIOA 2F22A 3IPMO 4EBBA 3ASOC 4JC7A 3POVA 3CSKA 2A69F 2DYRC 3FXHA 1B68A 1OR2A 3FOOA 3EHNA 4I44A 2EIMC 2J9BA 3FOPA 4MW8A 3I4UA 4XTKA 4YL0A 1HY5A 2J46A 2V26A 2A1DD 1LPEA 5JP7A 5KYXA 1ZHXA 2QTVA 2XLOA 3K1IC 4BPMA 5KYWA 2WVOA 1NZEA 3DAGA 2R7OA 4IARA 3NYJA 2WZLA 4O6NA 2NUPB 3M79A 3U3BA 2QY9A 4GEHA 4JTAB 4PACA 4PJJA 3AGTA 4ULWA 1ZU4A 3R7CA 3S90A 2Q00A 4QDLA 1YLMA 1M2VA 2R7WA 1OW8A 2NPUA 2Q7RA 2NG1A 3V5YA 3EPVA 1FMWA 5COGA 3T9OA 1T6IA 1ZZPA 1FTSA 2EPMX 2NUPA 3ABKC 4BEMJ 1XZQA 1S05A 4XEKA 3S29A 2P1AA 1A7EA 5B3IA 1Q0GA 2QNLA 3V5XA 3VF0A 1E2XA 4LDRA 2BC5A 2OCCC 4O6MA 4ZLCA 4LLEA 4RDAA 1Q0KA 4U5FE 4AK9A 2ZXPA 2IYLD 3AQCA 4A4AA 4CDAA 4BJ1A 4DRIB 1ZU5A 3MX3A 4KNWA 1CGOA 1O87A 4R32A 3W2WA 3W4YA 2TMVP 3SXZA 3UR3C 1Y6DA 1GGQA 3S9OA 1C03A 1LM3B 3JZ0A 3W2VA 2ETSA 3JCUQ 3EG9B 3ZIBA 2UUIA 4L6RA 3TD7A 2E87A 2VCBA 2KJGA 2OG2A 2Y3GA 4J7YA 4CX9A 4PJMA 3FDQA 2XLDA 2YRFA 3HNIA 3UGOA 1WWPA 1H6GA 2H8AA 3EZIA 3NG1A 4CS9A 1L3PA 2C03A 4PFOA 2GWWA 3FMSA 1TWHA 2XRHA 2OJQA 1JPNA 4J30B 1G8XA 2NSFA 2Q4FA 4EKWA 5KYUB 3HNJA 4N6CA 3U5SA 2YL1A 4Q7CA 4ZLDA 3NYMA 3JSEO 1K05A 2GAQA 1OR3A 3UMKA 4KBLA 3G4XA 3JRMO 1CPRA 4X0RA 5JVEA 3KMIA 3LEVA 4QI0A 2KQ9A 1JR8A 1Z3IX 1AEPA 3EGDB 3OEOA 1FAPB 3RH3A 3SXMA 1VYKA 3V7OA 2Z15A 4MTFA 5L0JA 4PJLA 1LS1A 2J0WA 4CJGA 3L0IA 2HZ8A 3AG3C 3T4RA 5L0DA 1CGME 2DB4A 3B71A 3LAYA 5L0GA 2ICWG 3LLKA 1VOMA 2A6HF 4XPWA 1PD1A 1TWAA 5TJ5E 4C3DA 1XZPA 3LESA 1XWJA 2XL6A 4YT5A 1R4TA 3QVYA 3I5QA 3I5PA 3NDBB 2RD9A 4E0IA 5B3SC 3CAXA 3EGXB 2P61A 1Z7Qc 1NFOA 3U8PA 1MQVA 1V55C 2QUPA 3F47A 3ZG1A 1TQGA 3N0TA 4XLPF 4OINF 4EBJA 4C7OB 3K1HA 1LE4A 3GEHA 3UGPA 4G0HA 1VLTA 2WVQA 4WABA 4BJ5C 2ZXWC 3CZ6A 1BDJB 5HV9A 1OKKD 2D4UA 5L0IA 2X0CA 4DBRA 5EGYA 3MFNA 3IQ6A 1SYQA 3EZHA 2H7OA 2WB7A 3VRCA 4DVYP 4MVMA 4NC3A 3JRTA 4FAPB 2Q3TA 2J7PD 4CS8A 1QZXA 4KNVA 3ZQYA 2GA0A 2R05A 1I5NA 2R7QA 2IXMA 3ABLC 1M6TA 1HMOA 1YAUO 2XM4A 4EBKA 1NU7D 1PD0A 3IHUA 4U5BE 2B0HA 2PF4E 3FVYA 1JOGA 2OOCA 3B9QA 2LFFA 1CGNA 3H2VA 1UG7A 2LP4A 3B0PA 4J7TA 4NCQA 3ZVRA 3BEHA 4JZAA 4O79A 1Q0MA 2HV6A 1EA8A 1YA9A 3W8IA 2QLAA 3L8IA 2OEVA 1HW1A 4JRZA 5B1AC 4Q4ZF 3GM2A 1U0BB 4BJTA 3LS0A 4JTCB 4JCZA 2KGOA 4IRUA 2WVNA 3EJNA 3GORA 3WODF 2EIJC 3RYLA 4U5CE 2R7UA 1QVXA 2IOQA 3F46A 3L1MA 1YYXA 1OW7A 3TOLA 1IZMA 3JT1A 1W2WA 4Z9HA 1WASA 2HUJA 2PFDA 2L6GA 2FGYA 4NTBA 1QQ3A 2LSEA 5T3WA 3GODA 4U5GA 2WZFA 1IW7F 5FZTA 5IY5C 4M63A 3SZRA 2BL2A 5FCLA 5JT4A 1U6HA 1DOVA 1QPUA 3ABMC 2YL7A 1WN0A 3A11A 2OEXA 2L7AA 3X2QC 3DD7A 2LFDA 1FR0A 1Z5ZA 3WAQA 4CS8C 4K0DA 4XLNF 3T6BA 2XLHA 5EK0A 2VASA 5D91A 3PDMP 1NG1A 3DI5A 3DJUB 4BJ6A 1L7CA 1RJ9B 4WGZA 3L34A 4J32B 2PNOA 3RQFA 5KYYB 4JTDB 3GEEA 2C04A 1MNDA 4YL3A 1E83A 3J06A 1M2OA 4YT2A 2YEVA 1O5HA 1M56C 2GDCA 3MBGA 4C3EA 4E0HA 2DYSC 3HJCA 1Q0DA 3SXKA 4EUKB 3SP1A 4IB4A 1RJ9A 5A69A 4H54A 5CI8A 3K33A 3DM5A 4U5DE 2P6VA 3RQGA 2JPUA 3B0UX 4QI2A 2AVKA 5COFA 2XL8A 1H9TA 4IGGA 4PK4A 3B29A 1FFTC 1HW2A 3AG4C 4IAQA 4MQ9F 2MYSA 3FAJA 3N24A 3DZAA 3KYJA 3MLGA 4LDQA 4CSAC 5BQIA 4YK5A 5F5FA 2A0BA 1D0ZA 3KYIA 1YA7O 1HE1A 2LIGA 4JJGA 2R7RA 4Z9IA 1FMVA 3KKBA 4U9EA 2L81A 3RF3A 1C02A 2A68F 3IQ5A 3O55A 5A6AA 2R7TA 3TJ6A 4NQFA 5L0CA 3AQBA 4JEAA 3EG9A 1D1BA 3EQLF 3RVZA 1YZCA 1YVIA 3LJBA 3C62A 1BR2A 1ST6A 4O6YA 4KC9A 1KNYA 1TWGA 2AWYA 4CS7A 2OU6A 3RIPA 3MYIA 3JSZA 4CIHA 3DM9B 1LIHA 1J8YF 1HE9A 2VCCA 1M57C 2XL4A 2Y3DA 2H7VC 3QZCA 2W9YA 4YT4A 1A0BA 5A6BA 2XXAB 1JRAA 2YL3A 1ZHWA 1KU2A 2DI3A 5KYUA 3AGUA 2OQMA 3NYLA 4AE4B 4MVOA 1DOWA 3B0VC 3GWLA 1QLEC 3TQOA 1ZW2A 1D0YA 2OJED 4I3MA 2XS8A 1GM5A 1WTYA 3HNKA 1OXBA 4E18A 5L0FA 1OKKA 1SZIA 3O6XA 3FHDA 2R9RB 3KPHA 2J9VA 1WATA 2M64A 3K6BA 2XM0A 3W8HA 3CEXA 4FX5A 4Q5SF 3ZSUA 3EGDA 1TFKB 1Z6AA 1T6UA 1LE2A 2J7PA 2YKZA 3LUTB 3M4CA 3TK0A 4WJ0A 1ORJA 1EQ1A 1SMYF 2D5RB 1G5ZA 2HSQA 4JKVA 3FAPB 3ZC4A 1OCZC 2B0JA 2LD6A 3UMIA 3C8GB 5A6BD 1YARO 1TFOB 1ORSC 2HKVA 2M4EA 2ZPAA 4ONSA 1MMGA 3L8JA 4CS9C 2PP4A 1R5ID 2IM8A 2YHSA 5EHHA 4IJJA 1VYIA 4ULVA 3S0XA 5GPGB 3LNRA 4UDVA 3EGXA 5A6KA 2EPKX 5E2QA 1NU9C 3QMKA 2YVKA 4AL0A 5F5HA 1S7ZA 4C7OA 1C17M 2HJMA 1GS9A 2R02A 3Q7LA 4IWBA 4LERA 5D92A 5T1DB 4MTGA 2O9XA 3GWNA 3U3FA 1OW6A 1KTMA 2YZSA 2CGEA 3SNHA 4F4BA 2R7SA 1E85A 2I15A 3DE9A 4XEFA 2L6FA 3AOUA 4NTFA 2KW3C 2EIKC 3ATPA 4CIPA 2YL0A 3U9JA 1TKNA 2VCAA 2GFHA 2JD3A 3WHNA 3K7DA 3U2LA 3K1IA 4P9FA 3H2UA 4JE9A 1NSGB 4K7BA 2NUTB 3C8GD 4P6IC 1V4AA 2FAPB 4Z9JA 2P0NA 3OWTA 4CBEA 5E3CA 3C7JA 5JRAA 3AG1C 4E7SA 1E84A 1FNTc 1OCOC 5L0HA 1ZHYA 5JLIA 3SXYA 2QE9A 2WL8A 4D4NA 3UMHA 5CIVA 2NUTA 4LDKA 4WGYA 1E86A 1J8MF 3PCVA 3U8VA 3VYWA 1VMAA 2HFIA 4HFKB 4MS2A 3AJMA 3EFOB 3NKEA 5F28E 3UNGC 1VTMP 4OD5A 4I1MA 2HMZA 4HE8D 2PBEA 4BG0A 4XPXA 1JAFA 4JVSA 3EHMA 3VAYA 1F1MA 1ZW3A 2HSBA 2ZD9A 2ZXOA 3AG2C 3K66A 3QTHA 2DGJA 3ZTZA 2R25A 3BRJA 2AU5A 2R7VA 4AL1A 1APCA 1OXKA 1OCCC 2Y69C 2J0XA 3EFOA 1JMWA 4N4WA 5KYXB 4EHPA 2JX0A 2Y3HA 1SR2A 4G78A 4JEBA 5DS6A 1N1CA 3E70C 1OCRC 4AX2A 1PCXA 5KYWB 3CQZA 5HSWA 1YZAA 3O10A 3VM6A 3SEOA 1D1AA 2CDQA 1MNEA 1VLSA 4P9TA 1ZVZA 4N6HA 2XSEA 1GQAA 1M2VB 4I1OB 1LVKA 3HLZA 4FESA 4EWCA 2AWCA 1A7DA 2IXOA 5KYYA 4DOZA 4JURI 2YQYA 1LS4A 2L9JA 2XLEA 3MYFA 1RCPA 1OQCA 4MW3A 1K40A 2LQGA 4YL1A 1K04A 2MWQA 3RW0A 1EKYA 4XEVA 2CNWD 2KSFA 4JJFA 1BBHA 1D1CA 3QW0A 2KYHA 2EPNA 3HKKA 3QW1A 4DVZA 4ER9A 3GM3A 5DQTA 3IEEA 1EI7A 1LKXA 1RKCA 3DMDA 2AP3A 4G7HF 3JYHA 1BR4A 1NLXA 3QVZA 5AC4A 3DJNB 2W4MA 3E9VA 2HJ3A 5AC5A 5L3QA 2W4BA 4CSAA 2HMQA 1T6QA 4GYTA 4D4XA 1G4WR 3EH1A 4XQ1A 3JYYA 2FFHA 2CCYA 4H4KC 2P7VA 3NMKA 4RD9A 2L6HA 1VK5A 4XPYA 4YWQA 3US6A 2Y3BA 3U9MA 4E17A 1D0XA 3U0CA 1NBBA 4PJNA 5T3TA 3U2MA 3ASNC 4BJ6C 3M15A 1Z23A 1H7IA 2YLIA 1TR2A 1SF8A 1UFBA 4XWJA 1RXQA 2Q9CA 2R03A 3RQEA 4MNDA 4IAOA 1QKRA 3ECSA 3ZWIA 3LNMB 4N06A 3A9CA 3NRHA 4LACB 2NSGA 2G62A 3DWWA 4LLCA 3KH2A 4PR9A 5KYNA 4HEAJ 2EINC 2EILC 1MMDA 1ZHZA 2LK4A 5DVWA 2KC3A 3ZQVA 3ZDLA 3C63A 5L3VA 3O39A 4BJ5A 3TOMA 4E7ZA 3SYNA 5A6JA 2XXAA 4K1OA 4AE4A 4GQHA 4U9DA 2X51A 3IQCA 1BR1A 4OIRF 4DRJB 1T5OA 5K0IA 4B6IA 3GM1A 3T6GB 2PX0A 3GANA 1YYJA 1H9GA 3DE8A 1LI5A 1I4YA 3V5ZA 2H7BA 4A2NB 1LI7A 2XLWA 3RKOF 4EIYA 1HMDA 3DKAA 1G4US 4YT8A 3LEOA 3Q6NA 3NMIA 5DQZA 1BZ4A 3C8ZA 1NFNA 2EPLX 4MVZA 1AVOB 4G7OF 2IBFA 1Y4CA 2HV7A 2J9UA 4HFFB 3G50A 2PX3A 1AUEA 4CDYA 4JW1A 1Z63A 3M1CB 4CJOA 5JSLA 2Y39A 1ORYA 2ASRA 3C8GA 3X1OA 4MVSA 2G3VA 3S28A 3R2PA 2MHRA
chains in the Genus database with same CATH topology
5JLIA 4D4NA 3HNJA 3M4BA 2YL1A 4WGYA 1E86A 4IB4A 3ZTMA 2YLGA 5AGFA 2XL8A 4IAQA 5JVEA 1CPRA 1JAFA 3ZTZA 1APCA 2XLMA 2J8WA 2XLVA 4N4WA 5JS5A 4CJGA 3HNLA 4JEBA 4U9EA 1A7VA 2YLDA 3IQ5A 1YZAA 4JEAA 2XL6A 4N6HA 1YZCA 1GQAA 3C62A 3QVYA 3U8PA 1MQVA 2XLEA 1RCPA 1EKYA 2YL3A 1BBHA 5JUAA 3QW0A 3QW1A 4ER9A 3NMJA 1CPQA 4CDVA 3IQ6A 3VRCA 256BA 3HNKA 3QVZA 4NC3A 2XM0A 3ZQYA 3FOOA 2J9BA 1M6TA 2XM4A 3FOPA 2YKZA 3M4CA 4D4XA 2CCYA 3NMKA 5JP7A 4JKVA 2XLOA 1CGNA 1NBBA 4IARA 3M15A 3M79A 2YLIA 2QLAA 3ZWIA 4ULVA 3L1MA 3TOLA 1YYXA 1S05A 3ZQVA 5B3IA 3C63A 3TOMA 2BC5A 4U9DA 1QQ3A 4CDAA 5JT4A 1YYJA 3DE8A 3DE9A 1E85A 1QPUA 4EIYA 2XLWA 2YL7A 1CGOA 4CIPA 2YL0A 3NMIA 1LM3B 4L6RA 2XLHA 4JE9A 4CDYA 4CX9A 2XLDA 3HNIA 4WGZA 4CJOA 5JSLA 5JRAA 1E83A 1E84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JLI A;  4D4N A;  3HNJ A;  3M4B A;  2YL1 A;  4WGY A;  1E86 A;  4IB4 A;  3ZTM A;  2YLG A;  5AGF A;  2XL8 A;  4IAQ A;  5JVE A;  1CPR A;  1JAF A;  3ZTZ A;  1APC A;  2XLM A;  2J8W A;  2XLV A;  4N4W A;  5JS5 A;  4CJG A;  3HNL A;  4JEB A;  4U9E A;  1A7V A;  2YLD A;  3IQ5 A;  1YZA A;  4JEA A;  2XL6 A;  4N6H A;  1YZC A;  1GQA A;  3C62 A;  3QVY A;  3U8P A;  1MQV A;  2XLE A;  1RCP A;  1EKY A;  2YL3 A;  1BBH A;  5JUA A;  3QW0 A;  3QW1 A;  4ER9 A;  3NMJ A;  1CPQ A;  4CDV A;  3IQ6 A;  3VRC A;  256B A;  3HNK A;  3QVZ A;  4NC3 A;  2XM0 A;  3ZQY A;  3FOO A;  2J9B A;  1M6T A;  2XM4 A;  3FOP A;  2YKZ A;  3M4C A;  4D4X A;  2CCY A;  3NMK A;  5JP7 A;  4JKV A;  2XLO A;  1CGN A;  1NBB A;  4IAR A;  3M15 A;  3M79 A;  2YLI A;  2QLA A;  3ZWI A;  4ULV A;  3L1M A;  3TOL A;  1YYX A;  1S05 A;  3ZQV A;  5B3I A;  3C63 A;  3TOM A;  2BC5 A;  4U9D A;  1QQ3 A;  4CDA A;  5JT4 A;  1YYJ A;  3DE8 A;  3DE9 A;  1E85 A;  1QPU A;  4EIY A;  2XLW A;  2YL7 A;  1CGO A;  4CIP A;  2YL0 A;  3NMI A;  1LM3 B;  4L6R A;  2XLH A;  4JE9 A;  4CDY A;  4CX9 A;  2XLD A;  3HNI A;  4WGZ A;  4CJO A;  5JSL A;  5JRA A;  1E83 A;  1E84 A; 
#chains in the Genus database with same CATH topology
 4W8K A;  2J9W A;  4O7G A;  1YJG A;  2VH3 A;  1O3U A;  1RKE B;  2HS5 A;  1Q0F A;  3Q6M A;  3M4B A;  4G7Z F;  3N2Z B;  2V3C C;  5BUO A;  3ZTM A;  1V54 C;  3IQT A;  4U5H A;  2YLG A;  2VC9 A;  5AGF A;  4RBN A;  2KK1 A;  3JTL O;  4MTO A;  4MVR A;  5E33 A;  3H65 A;  4ANJ A;  4KI2 A;  1TWC A;  3C18 A;  4YN0 B;  1T01 A;  3KL4 A;  2G3K A;  1RKE A;  3LLI A;  4NTA A;  2VB6 A;  5BQG A;  3RFY A;  3DXJ F;  4DJ9 A;  2J45 A;  3S27 A;  2ZXR A;  1MMA A;  2Q9A A;  3HTK C;  1I4Z A;  2CW0 F;  2J8W A;  2XLM A;  3LS1 A;  4JCH A;  4OIQ F;  4YJW A;  3ITF A;  2XLV A;  4MVU A;  2Q9B A;  5JS5 A;  2A0U A;  3HNL A;  4C3B A;  1A41 A;  5COM A;  1QSP A;  1A7V A;  2YLD A;  1WGW A;  2A6E F;  2OKU A;  3G4Z A;  3GEI A;  3S84 A;  1RMV A;  4U5E E;  4BEJ A;  4MVQ A;  1PV3 A;  2EPO A;  1ZYR F;  2CYD A;  2RSE B;  1FFH A;  1WOL A;  2IXP A;  5B1B C;  3TJ5 A;  3NKD A;  5DS5 A;  5CI9 A;  3EH2 A;  2XS1 A;  3WG7 C;  2BE5 F;  1T9K A;  3DAF A;  4DRH B;  4DXW A;  4OD4 A;  2KNH A;  4OIP F;  2R7X A;  2WZG A;  2IXN A;  4DBQ A;  1V74 B;  2UUH A;  5E3A A;  4W8P A;  3T6J A;  5DLJ A;  1VB5 A;  3RVY A;  4PFP A;  2I8B A;  5DS4 A;  4FWV A;  5JUA A;  1JPJ A;  3TUL A;  3PHF 2;  2YWA A;  2CNW A;  1YDI A;  4NY3 A;  3NMJ A;  1CPQ A;  1ZHT A;  4CDV A;  1MMN A;  5BQH A;  2LCH A;  2W45 A;  256B A;  3PMR A;  4OIO F;  3OA1 A;  1U89 A;  3Q7G A;  4JIO A;  2F22 A;  3IPM O;  4EBB A;  3ASO C;  4JC7 A;  3POV A;  3CSK A;  2A69 F;  2DYR C;  3FXH A;  1B68 A;  1OR2 A;  3FOO A;  3EHN A;  4I44 A;  2EIM C;  2J9B A;  3FOP A;  4MW8 A;  3I4U A;  4XTK A;  4YL0 A;  1HY5 A;  2J46 A;  2V26 A;  2A1D D;  1LPE A;  5JP7 A;  5KYX A;  1ZHX A;  2QTV A;  2XLO A;  3K1I C;  4BPM A;  5KYW A;  2WVO A;  1NZE A;  3DAG A;  2R7O A;  4IAR A;  3NYJ A;  2WZL A;  4O6N A;  2NUP B;  3M79 A;  3U3B A;  2QY9 A;  4GEH A;  4JTA B;  4PAC A;  4PJJ A;  3AGT A;  4ULW A;  1ZU4 A;  3R7C A;  3S90 A;  2Q00 A;  4QDL A;  1YLM A;  1M2V A;  2R7W A;  1OW8 A;  2NPU A;  2Q7R A;  2NG1 A;  3V5Y A;  3EPV A;  1FMW A;  5COG A;  3T9O A;  1T6I A;  1ZZP A;  1FTS A;  2EPM X;  2NUP A;  3ABK C;  4BEM J;  1XZQ A;  1S05 A;  4XEK A;  3S29 A;  2P1A A;  1A7E A;  5B3I A;  1Q0G A;  2QNL A;  3V5X A;  3VF0 A;  1E2X A;  4LDR A;  2BC5 A;  2OCC C;  4O6M A;  4ZLC A;  4LLE A;  4RDA A;  1Q0K A;  4U5F E;  4AK9 A;  2ZXP A;  2IYL D;  3AQC A;  4A4A A;  4CDA A;  4BJ1 A;  4DRI B;  1ZU5 A;  3MX3 A;  4KNW A;  1CGO A;  1O87 A;  4R32 A;  3W2W A;  3W4Y A;  2TMV P;  3SXZ A;  3UR3 C;  1Y6D A;  1GGQ A;  3S9O A;  1C03 A;  1LM3 B;  3JZ0 A;  3W2V A;  2ETS A;  3JCU Q;  3EG9 B;  3ZIB A;  2UUI A;  4L6R A;  3TD7 A;  2E87 A;  2VCB A;  2KJG A;  2OG2 A;  2Y3G A;  4J7Y A;  4CX9 A;  4PJM A;  3FDQ A;  2XLD A;  2YRF A;  3HNI A;  3UGO A;  1WWP A;  1H6G A;  2H8A A;  3EZI A;  3NG1 A;  4CS9 A;  1L3P A;  2C03 A;  4PFO A;  2GWW A;  3FMS A;  1TWH A;  2XRH A;  2OJQ A;  1JPN A;  4J30 B;  1G8X A;  2NSF A;  2Q4F A;  4EKW A;  5KYU B;  3HNJ A;  4N6C A;  3U5S A;  2YL1 A;  4Q7C A;  4ZLD A;  3NYM A;  3JSE O;  1K05 A;  2GAQ A;  1OR3 A;  3UMK A;  4KBL A;  3G4X A;  3JRM O;  1CPR A;  4X0R A;  5JVE A;  3KMI A;  3LEV A;  4QI0 A;  2KQ9 A;  1JR8 A;  1Z3I X;  1AEP A;  3EGD B;  3OEO A;  1FAP B;  3RH3 A;  3SXM A;  1VYK A;  3V7O A;  2Z15 A;  4MTF A;  5L0J A;  4PJL A;  1LS1 A;  2J0W A;  4CJG A;  3L0I A;  2HZ8 A;  3AG3 C;  3T4R A;  5L0D A;  1CGM E;  2DB4 A;  3B71 A;  3LAY A;  5L0G A;  2ICW G;  3LLK A;  1VOM A;  2A6H F;  4XPW A;  1PD1 A;  1TWA A;  5TJ5 E;  4C3D A;  1XZP A;  3LES A;  1XWJ A;  2XL6 A;  4YT5 A;  1R4T A;  3QVY A;  3I5Q A;  3I5P A;  3NDB B;  2RD9 A;  4E0I A;  5B3S C;  3CAX A;  3EGX B;  2P61 A;  1Z7Q c;  1NFO A;  3U8P A;  1MQV A;  1V55 C;  2QUP A;  3F47 A;  3ZG1 A;  1TQG A;  3N0T A;  4XLP F;  4OIN F;  4EBJ A;  4C7O B;  3K1H A;  1LE4 A;  3GEH A;  3UGP A;  4G0H A;  1VLT A;  2WVQ A;  4WAB A;  4BJ5 C;  2ZXW C;  3CZ6 A;  1BDJ B;  5HV9 A;  1OKK D;  2D4U A;  5L0I A;  2X0C A;  4DBR A;  5EGY A;  3MFN A;  3IQ6 A;  1SYQ A;  3EZH A;  2H7O A;  2WB7 A;  3VRC A;  4DVY P;  4MVM A;  4NC3 A;  3JRT A;  4FAP B;  2Q3T A;  2J7P D;  4CS8 A;  1QZX A;  4KNV A;  3ZQY A;  2GA0 A;  2R05 A;  1I5N A;  2R7Q A;  2IXM A;  3ABL C;  1M6T A;  1HMO A;  1YAU O;  2XM4 A;  4EBK A;  1NU7 D;  1PD0 A;  3IHU A;  4U5B E;  2B0H A;  2PF4 E;  3FVY A;  1JOG A;  2OOC A;  3B9Q A;  2LFF A;  1CGN A;  3H2V A;  1UG7 A;  2LP4 A;  3B0P A;  4J7T A;  4NCQ A;  3ZVR A;  3BEH A;  4JZA A;  4O79 A;  1Q0M A;  2HV6 A;  1EA8 A;  1YA9 A;  3W8I A;  2QLA A;  3L8I A;  2OEV A;  1HW1 A;  4JRZ A;  5B1A C;  4Q4Z F;  3GM2 A;  1U0B B;  4BJT A;  3LS0 A;  4JTC B;  4JCZ A;  2KGO A;  4IRU A;  2WVN A;  3EJN A;  3GOR A;  3WOD F;  2EIJ C;  3RYL A;  4U5C E;  2R7U A;  1QVX A;  2IOQ A;  3F46 A;  3L1M A;  1YYX A;  1OW7 A;  3TOL A;  1IZM A;  3JT1 A;  1W2W A;  4Z9H A;  1WAS A;  2HUJ A;  2PFD A;  2L6G A;  2FGY A;  4NTB A;  1QQ3 A;  2LSE A;  5T3W A;  3GOD A;  4U5G A;  2WZF A;  1IW7 F;  5FZT A;  5IY5 C;  4M63 A;  3SZR A;  2BL2 A;  5FCL A;  5JT4 A;  1U6H A;  1DOV A;  1QPU A;  3ABM C;  2YL7 A;  1WN0 A;  3A11 A;  2OEX A;  2L7A A;  3X2Q C;  3DD7 A;  2LFD A;  1FR0 A;  1Z5Z A;  3WAQ A;  4CS8 C;  4K0D A;  4XLN F;  3T6B A;  2XLH A;  5EK0 A;  2VAS A;  5D91 A;  3PDM P;  1NG1 A;  3DI5 A;  3DJU B;  4BJ6 A;  1L7C A;  1RJ9 B;  4WGZ A;  3L34 A;  4J32 B;  2PNO A;  3RQF A;  5KYY B;  4JTD B;  3GEE A;  2C04 A;  1MND A;  4YL3 A;  1E83 A;  3J06 A;  1M2O A;  4YT2 A;  2YEV A;  1O5H A;  1M56 C;  2GDC A;  3MBG A;  4C3E A;  4E0H A;  2DYS C;  3HJC A;  1Q0D A;  3SXK A;  4EUK B;  3SP1 A;  4IB4 A;  1RJ9 A;  5A69 A;  4H54 A;  5CI8 A;  3K33 A;  3DM5 A;  4U5D E;  2P6V A;  3RQG A;  2JPU A;  3B0U X;  4QI2 A;  2AVK A;  5COF A;  2XL8 A;  1H9T A;  4IGG A;  4PK4 A;  3B29 A;  1FFT C;  1HW2 A;  3AG4 C;  4IAQ A;  4MQ9 F;  2MYS A;  3FAJ A;  3N24 A;  3DZA A;  3KYJ A;  3MLG A;  4LDQ A;  4CSA C;  5BQI A;  4YK5 A;  5F5F A;  2A0B A;  1D0Z A;  3KYI A;  1YA7 O;  1HE1 A;  2LIG A;  4JJG A;  2R7R A;  4Z9I A;  1FMV A;  3KKB A;  4U9E A;  2L81 A;  3RF3 A;  1C02 A;  2A68 F;  3IQ5 A;  3O55 A;  5A6A A;  2R7T A;  3TJ6 A;  4NQF A;  5L0C A;  3AQB A;  4JEA A;  3EG9 A;  1D1B A;  3EQL F;  3RVZ A;  1YZC A;  1YVI A;  3LJB A;  3C62 A;  1BR2 A;  1ST6 A;  4O6Y A;  4KC9 A;  1KNY A;  1TWG A;  2AWY A;  4CS7 A;  2OU6 A;  3RIP A;  3MYI A;  3JSZ A;  4CIH A;  3DM9 B;  1LIH A;  1J8Y F;  1HE9 A;  2VCC A;  1M57 C;  2XL4 A;  2Y3D A;  2H7V C;  3QZC A;  2W9Y A;  4YT4 A;  1A0B A;  5A6B A;  2XXA B;  1JRA A;  2YL3 A;  1ZHW A;  1KU2 A;  2DI3 A;  5KYU A;  3AGU A;  2OQM A;  3NYL A;  4AE4 B;  4MVO A;  1DOW A;  3B0V C;  3GWL A;  1QLE C;  3TQO A;  1ZW2 A;  1D0Y A;  2OJE D;  4I3M A;  2XS8 A;  1GM5 A;  1WTY A;  3HNK A;  1OXB A;  4E18 A;  5L0F A;  1OKK A;  1SZI A;  3O6X A;  3FHD A;  2R9R B;  3KPH A;  2J9V A;  1WAT A;  2M64 A;  3K6B A;  2XM0 A;  3W8H A;  3CEX A;  4FX5 A;  4Q5S F;  3ZSU A;  3EGD A;  1TFK B;  1Z6A A;  1T6U A;  1LE2 A;  2J7P A;  2YKZ A;  3LUT B;  3M4C A;  3TK0 A;  4WJ0 A;  1ORJ A;  1EQ1 A;  1SMY F;  2D5R B;  1G5Z A;  2HSQ A;  4JKV A;  3FAP B;  3ZC4 A;  1OCZ C;  2B0J A;  2LD6 A;  3UMI A;  3C8G B;  5A6B D;  1YAR O;  1TFO B;  1ORS C;  2HKV A;  2M4E A;  2ZPA A;  4ONS A;  1MMG A;  3L8J A;  4CS9 C;  2PP4 A;  1R5I D;  2IM8 A;  2YHS A;  5EHH A;  4IJJ A;  1VYI A;  4ULV A;  3S0X A;  5GPG B;  3LNR A;  4UDV A;  3EGX A;  5A6K A;  2EPK X;  5E2Q A;  1NU9 C;  3QMK A;  2YVK A;  4AL0 A;  5F5H A;  1S7Z A;  4C7O A;  1C17 M;  2HJM A;  1GS9 A;  2R02 A;  3Q7L A;  4IWB A;  4LER A;  5D92 A;  5T1D B;  4MTG A;  2O9X A;  3GWN A;  3U3F A;  1OW6 A;  1KTM A;  2YZS A;  2CGE A;  3SNH A;  4F4B A;  2R7S A;  1E85 A;  2I15 A;  3DE9 A;  4XEF A;  2L6F A;  3AOU A;  4NTF A;  2KW3 C;  2EIK C;  3ATP A;  4CIP A;  2YL0 A;  3U9J A;  1TKN A;  2VCA A;  2GFH A;  2JD3 A;  3WHN A;  3K7D A;  3U2L A;  3K1I A;  4P9F A;  3H2U A;  4JE9 A;  1NSG B;  4K7B A;  2NUT B;  3C8G D;  4P6I C;  1V4A A;  2FAP B;  4Z9J A;  2P0N A;  3OWT A;  4CBE A;  5E3C A;  3C7J A;  5JRA A;  3AG1 C;  4E7S A;  1E84 A;  1FNT c;  1OCO C;  5L0H A;  1ZHY A;  5JLI A;  3SXY A;  2QE9 A;  2WL8 A;  4D4N A;  3UMH A;  5CIV A;  2NUT A;  4LDK A;  4WGY A;  1E86 A;  1J8M F;  3PCV A;  3U8V A;  3VYW A;  1VMA A;  2HFI A;  4HFK B;  4MS2 A;  3AJM A;  3EFO B;  3NKE A;  5F28 E;  3UNG C;  1VTM P;  4OD5 A;  4I1M A;  2HMZ A;  4HE8 D;  2PBE A;  4BG0 A;  4XPX A;  1JAF A;  4JVS A;  3EHM A;  3VAY A;  1F1M A;  1ZW3 A;  2HSB A;  2ZD9 A;  2ZXO A;  3AG2 C;  3K66 A;  3QTH A;  2DGJ A;  3ZTZ A;  2R25 A;  3BRJ A;  2AU5 A;  2R7V A;  4AL1 A;  1APC A;  1OXK A;  1OCC C;  2Y69 C;  2J0X A;  3EFO A;  1JMW A;  4N4W A;  5KYX B;  4EHP A;  2JX0 A;  2Y3H A;  1SR2 A;  4G78 A;  4JEB A;  5DS6 A;  1N1C A;  3E70 C;  1OCR C;  4AX2 A;  1PCX A;  5KYW B;  3CQZ A;  5HSW A;  1YZA A;  3O10 A;  3VM6 A;  3SEO A;  1D1A A;  2CDQ A;  1MNE A;  1VLS A;  4P9T A;  1ZVZ A;  4N6H A;  2XSE A;  1GQA A;  1M2V B;  4I1O B;  1LVK A;  3HLZ A;  4FES A;  4EWC A;  2AWC A;  1A7D A;  2IXO A;  5KYY A;  4DOZ A;  4JUR I;  2YQY A;  1LS4 A;  2L9J A;  2XLE A;  3MYF A;  1RCP A;  1OQC A;  4MW3 A;  1K40 A;  2LQG A;  4YL1 A;  1K04 A;  2MWQ A;  3RW0 A;  1EKY A;  4XEV A;  2CNW D;  2KSF A;  4JJF A;  1BBH A;  1D1C A;  3QW0 A;  2KYH A;  2EPN A;  3HKK A;  3QW1 A;  4DVZ A;  4ER9 A;  3GM3 A;  5DQT A;  3IEE A;  1EI7 A;  1LKX A;  1RKC A;  3DMD A;  2AP3 A;  4G7H F;  3JYH A;  1BR4 A;  1NLX A;  3QVZ A;  5AC4 A;  3DJN B;  2W4M A;  3E9V A;  2HJ3 A;  5AC5 A;  5L3Q A;  2W4B A;  4CSA A;  2HMQ A;  1T6Q A;  4GYT A;  4D4X A;  1G4W R;  3EH1 A;  4XQ1 A;  3JYY A;  2FFH A;  2CCY A;  4H4K C;  2P7V A;  3NMK A;  4RD9 A;  2L6H A;  1VK5 A;  4XPY A;  4YWQ A;  3US6 A;  2Y3B A;  3U9M A;  4E17 A;  1D0X A;  3U0C A;  1NBB A;  4PJN A;  5T3T A;  3U2M A;  3ASN C;  4BJ6 C;  3M15 A;  1Z23 A;  1H7I A;  2YLI A;  1TR2 A;  1SF8 A;  1UFB A;  4XWJ A;  1RXQ A;  2Q9C A;  2R03 A;  3RQE A;  4MND A;  4IAO A;  1QKR A;  3ECS A;  3ZWI A;  3LNM B;  4N06 A;  3A9C A;  3NRH A;  4LAC B;  2NSG A;  2G62 A;  3DWW A;  4LLC A;  3KH2 A;  4PR9 A;  5KYN A;  4HEA J;  2EIN C;  2EIL C;  1MMD A;  1ZHZ A;  2LK4 A;  5DVW A;  2KC3 A;  3ZQV A;  3ZDL A;  3C63 A;  5L3V A;  3O39 A;  4BJ5 A;  3TOM A;  4E7Z A;  3SYN A;  5A6J A;  2XXA A;  4K1O A;  4AE4 A;  4GQH A;  4U9D A;  2X51 A;  3IQC A;  1BR1 A;  4OIR F;  4DRJ B;  1T5O A;  5K0I A;  4B6I A;  3GM1 A;  3T6G B;  2PX0 A;  3GAN A;  1YYJ A;  1H9G A;  3DE8 A;  1LI5 A;  1I4Y A;  3V5Z A;  2H7B A;  4A2N B;  1LI7 A;  2XLW A;  3RKO F;  4EIY A;  1HMD A;  3DKA A;  1G4U S;  4YT8 A;  3LEO A;  3Q6N A;  3NMI A;  5DQZ A;  1BZ4 A;  3C8Z A;  1NFN A;  2EPL X;  4MVZ A;  1AVO B;  4G7O F;  2IBF A;  1Y4C A;  2HV7 A;  2J9U A;  4HFF B;  3G50 A;  2PX3 A;  1AUE A;  4CDY A;  4JW1 A;  1Z63 A;  3M1C B;  4CJO A;  5JSL A;  2Y39 A;  1ORY A;  2ASR A;  3C8G A;  3X1O A;  4MVS A;  2G3V A;  3S28 A;  3R2P A;  2MHR A; 
#chains in the Genus database with same CATH homology
 5JLI A;  4D4N A;  3HNJ A;  3M4B A;  2YL1 A;  4WGY A;  1E86 A;  4IB4 A;  3ZTM A;  2YLG A;  5AGF A;  2XL8 A;  4IAQ A;  5JVE A;  1CPR A;  1JAF A;  3ZTZ A;  1APC A;  2XLM A;  2J8W A;  2XLV A;  4N4W A;  5JS5 A;  4CJG A;  3HNL A;  4JEB A;  4U9E A;  1A7V A;  2YLD A;  3IQ5 A;  1YZA A;  4JEA A;  2XL6 A;  4N6H A;  1YZC A;  1GQA A;  3C62 A;  3QVY A;  3U8P A;  1MQV A;  2XLE A;  1RCP A;  1EKY A;  2YL3 A;  1BBH A;  5JUA A;  3QW0 A;  3QW1 A;  4ER9 A;  3NMJ A;  1CPQ A;  4CDV A;  3IQ6 A;  3VRC A;  256B A;  3HNK A;  3QVZ A;  4NC3 A;  2XM0 A;  3ZQY A;  3FOO A;  2J9B A;  1M6T A;  2XM4 A;  3FOP A;  2YKZ A;  3M4C A;  4D4X A;  2CCY A;  3NMK A;  5JP7 A;  4JKV A;  2XLO A;  1CGN A;  1NBB A;  4IAR A;  3M15 A;  3M79 A;  2YLI A;  2QLA A;  3ZWI A;  4ULV A;  3L1M A;  3TOL A;  1YYX A;  1S05 A;  3ZQV A;  5B3I A;  3C63 A;  3TOM A;  2BC5 A;  4U9D A;  1QQ3 A;  4CDA A;  5JT4 A;  1YYJ A;  3DE8 A;  3DE9 A;  1E85 A;  1QPU A;  4EIY A;  2XLW A;  2YL7 A;  1CGO A;  4CIP A;  2YL0 A;  3NMI A;  1LM3 B;  4L6R A;  2XLH A;  4JE9 A;  4CDY A;  4CX9 A;  2XLD A;  3HNI A;  4WGZ A;  4CJO A;  5JSL A;  5JRA A;  1E83 A;  1E84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...