2YLIA

Recombinant native cytochrome c prime from alcaligenes xylosoxidans in its ferrous form at 1.45 a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
127
structure length
127
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 50
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yliA00
1CGNA 1CGOA 3C62A 3IQ5A 2YL0A 3HNKA 2XLDA 4D4XA 1E84A 2XM4A 1E83A 3NMKA 3FOOA 4WGYA 4JKVA 2XLHA 4CIPA 1QPUA 1A7VA 5AGFA 4WGZA 1CPRA 4D4NA 3QW1A 3DE9A 3ZWIA 3HNIA 4IARA 1APCA 4CDVA 4IAQA 2J9BA 3U8PA 5JT4A 4JEAA 3NMIA 4IB4A 2YLDA 4N4WA 4CDYA 1CPQA 3L1MA 5JLIA 3QW0A 1GQAA 3M15A 2XLWA 5JSLA 3M4BA 3NMJA 2YLIA 3C63A 3HNJA 2YLGA 1E85A 3QVZA 2XL6A 4U9DA 3ZTZA 3M4CA 4JE9A 3ZTMA 1QQ3A 1RCPA 3ZQYA 2XM0A 2QLAA 4CJOA 2YL3A 2XLOA 4CX9A 3TOLA 3TOMA 1NBBA 4EIYA 3IQ6A 1YYXA 1S05A 2XLEA 3FOPA 5JS5A 4U9EA 5JRAA 1YZCA 2XLVA 2CCYA 3ZQVA 1E86A 5JUAA 3DE8A 4N6HA 5JP7A 4ER9A 2YL1A 1JAFA 4JEBA 1MQVA 2XLMA 2YKZA 4L6RA 1LM3B 2YL7A 1BBHA 1M6TA 2XL8A 1YYJA 256BA 4CJGA 5JVEA 4ULVA 3HNLA 4CDAA 3M79A 2J8WA 1YZAA 5B3IA 1EKYA 2BC5A 3QVYA 4NC3A 3VRCA
chains in the Genus database with same CATH superfamily
2UUIA 1CGNA 4JVSA 1CGOA 4O6MA 2GDCA 3LUTB 5HV9A 2BL2A 2WVQA 5A69A 1E83A 1VTMP 1Q0KA 2LSEA 4AE4B 3LNMB 2J0WA 3AJMA 3F47A 3TULA 2WZGA 4O6NA 3POVA 3FOOA 4N6CA 3U0CA 2YHSA 4XPXA 1A7VA 2HUJA 4WGZA 3DWWA 4D4NA 4JRZA 2WVNA 3EFOA 3BRJA 3QW1A 5T3WA 2Q3TA 3CAXA 3DE9A 3Q7LA 3SXKA 2H7VC 3V7OA 4JIOA 1RKCA 2BE5F 3RFYA 2P61A 4CDVA 1R4TA 1WASA 1ZU4A 1AUEA 2KNHA 2IXMA 2J9BA 3DM9B 4BJ5C 1T6QA 1G4WR 1MMDA 3EHMA 4EWCA 1KU2A 3RF3A 3TD7A 3B0PA 2Q7RA 1H9TA 2RSEB 3EGXB 4AE4A 4DRJB 5B1AC 3A9CA 4Q4ZF 4IB4A 3NYMA 1A7EA 4WJ0A 4JURI 2TMVP 2R7VA 5F5FA 3C8GB 3WODF 5JLIA 1TWHA 2CYDA 3QW0A 4DRIB 2NSGA 3LNRA 2OCCC 1HW2A 1ST6A 1FTSA 3I5QA 1OKKD 4AX2A 1R5ID 4XEVA 4BJ6C 3K1HA 2ZD9A 1EA8A 1D0YA 2DYRC 2M4EA 2B0HA 1JPNA 2GFHA 5KYUB 4JTDB 3RW0A 2J9WA 4RDAA 5D91A 3UMHA 3NKDA 4GYTA 3QVZA 4HFKB 2OEXA 1OKKA 3BEHA 2OKUA 4XEKA 4CS7A 4C7OB 5L0JA 1YARO 1L3PA 2EIJC 3C8GD 3RVZA 1IW7F 2A68F 4XPYA 3VAYA 3F46A 2R7TA 2H7BA 2YWAA 1LS1A 1KTMA 3EGXA 2J9VA 2VH3A 3M1CB 3GWNA 4W8PA 4G78A 3U9MA 1WWPA 2Q4FA 4XLNF 2R05A 2HV7A 1W2WA 2EIKC 3C8GA 4C3BA 1SR2A 4MVOA 2EPMX 1BZ4A 3MX3A 1VYIA 4G0HA 2R02A 4O6YA 3B0UX 3SYNA 4DVZA 3Q6NA 4E18A 4YWQA 5BQHA 1NBBA 3IQ6A 1G8XA 3EZIA 4MVMA 5IY5C 5L0FA 1LS4A 1YYXA 2OU6A 1GGQA 1S05A 1YLMA 2XLEA 1RXQA 3ABKC 5KYUA 5FCLA 3ABLC 1JPJA 3HTKC 2XXAB 1MMNA 2JX0A 1Z3IX 5E33A 2DB4A 2EILC 1XZPA 1ZZPA 4PJLA 4YT8A 4C7OA 3E70C 4J7TA 3K1IC 2CNWD 2R7OA 3ECSA 1YJGA 1ORJA 2J7PD 2KC3A 2XLVA 4U5BE 2L6GA 2CCYA 4HFFB 3UR3C 4XEFA 1BR2A 3Q6MA 2J0XA 3LLKA 2LIGA 1NFOA 3EH1A 3CZ6A 3ZIBA 1V74B 2P0NA 2J7PA 2Y39A 4I3MA 5KYXB 4IGGA 3MBGA 3RKOF 4MTFA 1Q0DA 2R7RA 1LM3B 1U6HA 3QTHA 3LAYA 1ZYRF 4QI0A 2P7VA 3UGOA 2LK4A 3ASOC 1PV3A 4YJWA 2YQYA 4U5HA 3S28A 1YYJA 2RD9A 3JRMO 2XXAA 2R7XA 4W8KA 1BR4A 1OQCA 1D1CA 5CI8A 3V5YA 2PP4A 4I1MA 1A7DA 4CDAA 3GM1A 1QZXA 1DOVA 2BC5A 3FVYA 3GWLA 3SXYA 4EUKB 1C02A 2Y3BA 4BPMA 3ASNC 2H7OA 4PJMA 3K7DA 5F5HA 3IQ5A 1VB5A 2Q9CA 2NUTB 1OXKA 1T6UA 2CW0F 4QDLA 2XLDA 4BJ5A 3KL4A 4D4XA 4N06A 3OEOA 4FAPB 3ATPA 2OJQA 2L9JA 4WGYA 3LEOA 3I5PA 5KYXA 5AGFA 5CI9A 5L3VA 2NSFA 1V55C 2G3KA 2W9YA 4MVSA 4XQ1A 5DQTA 4EBJA 4LLCA 2J46A 3ZWIA 4DOZA 4H4KC 4G7HF 4U5DE 4C3EA 3JTLO 4K1OA 1BDJB 4OIPF 3H2VA 3HNIA 4MVQA 1APCA 1OR2A 1Y6DA 3W2VA 3J06A 1UG7A 2Q9AA 3N24A 4DXWA 1T5OA 3T9OA 4MVRA 1HY5A 2Y3GA 4XWJA 4CS9C 1RJ9B 1ZHTA 4H54A 2L6HA 3MYFA 3RVYA 1L7CA 2WL8A 3Q7GA 3HKKA 2NUTA 2A0BA 4JEAA 3DD7A 3WHNA 4CBEA 4EBKA 3NMIA 1T6IA 2VCCA 4DBQA 2W45A 2ETSA 3GEHA 4OD4A 1K05A 3DZAA 2HSBA 3L1MA 1VLTA 1EI7A 3TJ5A 5K0IA 2QTVA 2X0CA 2JD3A 3OWTA 2MYSA 4OIOF 3LEVA 5JSLA 4R32A 1RKEB 4PJNA 3MYIA 1SMYF 3GORA 2FAPB 3M4BA 4YN0B 1KNYA 4LDKA 4U5GA 3NDBB 1D1BA 1FAPB 1OCOC 1TWCA 1ZU5A 3R2PA 4IJJA 4U5EE 5EHHA 3R7CA 5A6BD 1I4YA 1RJ9A 1JOGA 1TFKB 2XL6A 4LLEA 3PHF2 2WVOA 3G50A 2OG2A 1YA7O 2QE9A 3M4CA 4JE9A 5DS6A 2KK1A 4NTBA 2A6EF 2KYHA 2V26A 2R7UA 1OCRC 3FMSA 3U3BA 2Q00A 1NLXA 4EKWA 1CGME 4KNWA 3K1IA 4BEMJ 3NG1A 1QQ3A 2ZPAA 4DRHB 5A6BA 3S27A 4E7ZA 4KI2A 1Q0GA 4NY3A 3V5ZA 3EZHA 4CJOA 5BQIA 1F1MA 2Y3DA 4CX9A 1MMAA 3TOMA 4QI2A 3FDQA 1M56C 2AU5A 4Z9HA 1RKEA 1LKXA 2WZLA 3JZ0A 1QKRA 3NYJA 1G4US 4K0DA 5EGYA 1H7IA 1A41A 3FOPA 1OW6A 2EPNA 3N2ZB 2QNLA 4O79A 5L3QA 2AP3A 2KSFA 1FMWA 4EBBA 2JPUA 3SNHA 1Q0MA 2Y3HA 2XS1A 3IQCA 2LFFA 1I4ZA 1SZIA 2LQGA 2IXNA 1LIHA 3JRTA 3KYIA 1M2OA 2GA0A 3T4RA 3W2WA 5DS4A 3S90A 2HJ3A 3AQCA 3DXJF 4ULWA 3ZQVA 1MMGA 3H65A 4PFPA 2A0UA 3MFNA 4CIHA 2A1DD 4BJTA 4CS8A 3IHUA 3JCUQ 1K40A 5COFA 1MQVA 1J8MF 1TWGA 3GM3A 3W4YA 1D0ZA 3VF0A 2HJMA 4KNVA 2V3CC 3GANA 4NCQA 1NG1A 1E2XA 4RD9A 3O39A 1HE1A 4MW3A 4U5FE 3S29A 4CSAA 2PBEA 256BA 1HMOA 5TJ5E 4ULVA 3NRHA 3DMDA 3HNLA 1VMAA 1LE2A 1ZW2A 3K33A 3M79A 1ZHZA 3L34A 3WG7C 5B3IA 4NTAA 3B0VC 4GQHA 1EKYA 4RBNA 3AG3C 4FX5A 5E2QA 1T9KA 1Q0FA 2R9RB 2HS5A 4FWVA 1MNDA 3DAGA 2HV6A 4OD5A 4LDRA 1Z5ZA 3HNKA 2ZXRA 3LESA 4CS9A 2XM4A 2C03A 2OEVA 4IRUA 4YL0A 1A0BA 3DJUB 4A2NB 4ZLCA 1AEPA 3SZRA 3ITFA 2XLHA 3EQLF 1QPUA 1TQGA 1VK5A 3B29A 3RH3A 4CIPA 5BQGA 1TKNA 1CPRA 1LVKA 3N0TA 1Z63A 2IYLD 1VLSA 2I8BA 3L0IA 5B3SC 3EJNA 5BUOA 4YL1A 2HSQA 2A69F 2KW3C 4ER9A 4YT2A 2PNOA 4IARA 4JJFA 3RQEA 3UMKA 3ZVRA 4IAQA 2IBFA 3AG1C 5HSWA 1FFTC 3X1OA 1OW8A 3U3FA 1HMDA 1HE9A 5A6KA 5B1BC 2L81A 3CSKA 2IXOA 5KYNA 3US6A 3PCVA 5JT4A 2YRFA 1H6GA 2D4UA 2EINC 1VOMA 2VCBA 4CS8C 4DVYP 2D5RB 1PCXA 2KGOA 1GS9A 5DS5A 1O87A 2YLDA 4ONSA 4C3DA 3JT1A 2NUPB 2R7QA 4N4WA 3PDMP 1NSGB 1CPQA 1U89A 1E86A 1QSPA 1XZQA 2J9UA 1H9GA 4J32B 3T6JA 4A4AA 2R7SA 3U2LA 3EG9B 1GQAA 4CSAC 2PFDA 3A11A 2WZFA 2ZXOA 3GEEA 4JC7A 3SXZA 1ORYA 2UUHA 3AGUA 2H8AA 2PX3A 2YLIA 3C63A 3HNJA 1NU9C 3JSZA 2AWCA 2YLGA 4JTCB 4XLPF 4P9TA 4PFOA 3DJNB 4OINF 4NQFA 1TR2A 2DI3A 2Y69C 3TJ6A 4M63A 1IZMA 3G4XA 4MVZA 1NZEA 1YVIA 2QY9A 2YEVA 4JCZA 2R7WA 2CDQA 2FGYA 1M2VB 3UGPA 4XTKA 3TQOA 1WATA 3EHNA 1VYKA 3L8IA 3W8IA 2NUPA 1LI7A 1RCPA 2NPUA 3WAQA 1WTYA 2MHRA 2QLAA 4MQ9F 5FZTA 2YL3A 4J30B 1FNTc 1Z23A 2XLOA 3EG9A 2ZXPA 2IM8A 3AG2C 3FHDA 3TOLA 4AK9A 4B6IA 4NTFA 3X2QC 3KH2A 3DI5A 3JYHA 4DJ9A 4DBRA 4KBLA 1FFHA 1LE4A 4U9EA 2HMZA 2LCHA 2M64A 1YZCA 1ZW3A 2X51A 3C7JA 5COMA 1N1CA 1V4AA 3AGTA 1C03A 3EH2A 4YK5A 3SXMA 3T6BA 3ZC4A 2Z15A 3JYYA 2VASA 5T1DB 2KJGA 1M2VA 3U2MA 3LLIA 3TK0A 2C04A 2G3VA 4N6HA 2HZ8A 4JTAB 4KC9A 3DM5A 4Z9JA 2YL1A 3LS0A 3U8VA 1JAFA 3O55A 3O6XA 1NU7D 2HKVA 1SYQA 5T3TA 3ABMC 5L0GA 4OIRF 1T01A 1D0XA 4L6RA 3GEIA 4E17A 1BR1A 2ICWG 3FXHA 1AVOB 1V54C 4P9FA 4EHPA 5E3AA 3S0XA 2LD6A 1QLEC 2L6FA 1LI5A 4XPWA 4CJGA 5JVEA 3NKEA 4PK4A 2J8WA 4G7OF 2IOQA 3AG4C 2DGJA 2LFDA 1SF8A 3QVYA 4HEAJ 1I5NA 2VCAA 4MTGA 3VRCA 1ZHWA 3ZDLA 1PD1A 3C62A 5KYWB 2MWQA 1EQ1A 4UDVA 3B71A 2P1AA 2YL0A 5KYYB 3KKBA 3LS1A 4MNDA 3L8JA 1E84A 4MS2A 1UFBA 5A6AA 4JW1A 4WABA 4MW8A 1XWJA 4YL3A 2W4MA 3NMKA 1OXBA 1M57C 2PF4E 4JKVA 3KYJA 2XL4A 5A6JA 5DLJA 2A6HF 2J45A 4PACA 2AWYA 5GPGB 2OQMA 2R25A 3K66A 3RQGA 2P6VA 2VC9A 4K7BA 4J7YA 5L0CA 3O10A 5L0IA 1FR0A 5E3CA 1NFNA 4AL0A 3IEEA 3DKAA 3K6BA 3V5XA 4ANJA 2EPLX 3U8PA 3NYLA 5KYWA 1J8YF 2W4BA 3RQFA 5KYYA 3QMKA 1K04A 4YT5A 2XRHA 1OCCC 2PX0A 2EIMC 4PJJA 4E0IA 4JJGA 1ZHXA 4X0RA 1TFOB 3CQZA 1WN0A 4LDQA 5D92A 3GODA 4IWBA 2GAQA 3S9OA 1B68A 5AC4A 3S84A 4G7ZF 4OIQF 4CDYA 3AQBA 5L0HA 4GEHA 3T6GB 1GM5A 4HE8D 4LACB 4I44A 4ZLDA 1FMVA 1Y4CA 2OOCA 1OCZC 3EGDB 2ASRA 2KQ9A 3M15A 3SEOA 2XLWA 3QZCA 4MVUA 1Z6AA 1JRAA 4PR9A 3EPVA 3NMJA 1ORSC 1O5HA 2EPKX 2WB7A 1YDIA 4O7GA 2R03A 1E85A 5EK0A 1YAUO 2F22A 1WGWA 1S7ZA 2VB6A 4U9DA 4E7SA 3I4UA 3ZTZA 2L7AA 3ZTMA 1Z7Qc 5F28E 2XS8A 2YZSA 4Q5SF 3E9VA 5COGA 1JMWA 2LP4A 2B0JA 2CNWA 2O9XA 3GM2A 1OW7A 1TWAA 2IXPA 3DAFA 4YT4A 3ZQYA 2XM0A 4P6IC 1MNEA 1C17M 1HW1A 4Q7CA 3IQTA 4LERA 3VM6A 4MTOA 4BEJA 3EGDA 2HMQA 4EIYA 3UNGC 1PD0A 3RIPA 2I15A 3G4ZA 1YA9A 2GWWA 2NG1A 1D1AA 3H2UA 3KMIA 2CGEA 5JS5A 4Z9IA 4F4BA 5JRAA 1LPEA 1RMVA 3PMRA 3JSEO 2XSEA 3FAPB 3VYWA 5L0DA 3ZG1A 1QVXA 3HJCA 2ZXWC 5CIVA 3RYLA 1JR8A 5DQZA 4BJ1A 3B9QA 1ZVZA 5DVWA 5AC5A 1G5ZA 2E87A 3LJBA 2QUPA 1OR3A 1ZHYA 3CEXA 3DE8A 4JCHA 4BG0A 2FFHA 1DOWA 5JP7A 5JUAA 4IAOA 3KPHA 4JEBA 3C8ZA 2AVKA 2G62A 4FESA 3UMIA 2HFIA 3MLGA 2XLMA 3OA1A 2YKZA 4JZAA 2EPOA 1WOLA 3ZSUA 3IPMO 2OJED 3EFOB 3C18A 2YL7A 1BBHA 1O3UA 1M6TA 4AL1A 2Q9BA 2XL8A 3U5SA 2DYSC 4U5CE 3SP1A 3U9JA 2YVKA 3W8HA 4BJ6A 3FAJA 1U0BB 1YZAA 4I1OB 4E0HA 3AOUA 3HLZA 4NC3A
chains in the Genus database with same CATH topology
1CGNA 1CGOA 3C62A 3IQ5A 2YL0A 3HNKA 2XLDA 4D4XA 1E84A 2XM4A 1E83A 3NMKA 3FOOA 4WGYA 4JKVA 2XLHA 4CIPA 1QPUA 1A7VA 5AGFA 4WGZA 1CPRA 4D4NA 3QW1A 3DE9A 3ZWIA 3HNIA 4IARA 1APCA 4CDVA 4IAQA 2J9BA 3U8PA 5JT4A 4JEAA 3NMIA 4IB4A 2YLDA 4N4WA 4CDYA 1CPQA 3L1MA 5JLIA 3QW0A 1GQAA 3M15A 2XLWA 5JSLA 3M4BA 3NMJA 2YLIA 3C63A 3HNJA 2YLGA 1E85A 3QVZA 2XL6A 4U9DA 3ZTZA 3M4CA 4JE9A 3ZTMA 1QQ3A 1RCPA 3ZQYA 2XM0A 2QLAA 4CJOA 2YL3A 2XLOA 4CX9A 3TOLA 3TOMA 1NBBA 4EIYA 3IQ6A 1YYXA 1S05A 2XLEA 3FOPA 5JS5A 4U9EA 5JRAA 1YZCA 2XLVA 2CCYA 3ZQVA 1E86A 5JUAA 3DE8A 4N6HA 5JP7A 4ER9A 2YL1A 1JAFA 4JEBA 1MQVA 2XLMA 2YKZA 4L6RA 1LM3B 2YL7A 1BBHA 1M6TA 2XL8A 1YYJA 256BA 4CJGA 5JVEA 4ULVA 3HNLA 4CDAA 3M79A 2J8WA 1YZAA 5B3IA 1EKYA 2BC5A 3QVYA 4NC3A 3VRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CGN A;  1CGO A;  3C62 A;  3IQ5 A;  2YL0 A;  3HNK A;  2XLD A;  4D4X A;  1E84 A;  2XM4 A;  1E83 A;  3NMK A;  3FOO A;  4WGY A;  4JKV A;  2XLH A;  4CIP A;  1QPU A;  1A7V A;  5AGF A;  4WGZ A;  1CPR A;  4D4N A;  3QW1 A;  3DE9 A;  3ZWI A;  3HNI A;  4IAR A;  1APC A;  4CDV A;  4IAQ A;  2J9B A;  3U8P A;  5JT4 A;  4JEA A;  3NMI A;  4IB4 A;  2YLD A;  4N4W A;  4CDY A;  1CPQ A;  3L1M A;  5JLI A;  3QW0 A;  1GQA A;  3M15 A;  2XLW A;  5JSL A;  3M4B A;  3NMJ A;  2YLI A;  3C63 A;  3HNJ A;  2YLG A;  1E85 A;  3QVZ A;  2XL6 A;  4U9D A;  3ZTZ A;  3M4C A;  4JE9 A;  3ZTM A;  1QQ3 A;  1RCP A;  3ZQY A;  2XM0 A;  2QLA A;  4CJO A;  2YL3 A;  2XLO A;  4CX9 A;  3TOL A;  3TOM A;  1NBB A;  4EIY A;  3IQ6 A;  1YYX A;  1S05 A;  2XLE A;  3FOP A;  5JS5 A;  4U9E A;  5JRA A;  1YZC A;  2XLV A;  2CCY A;  3ZQV A;  1E86 A;  5JUA A;  3DE8 A;  4N6H A;  5JP7 A;  4ER9 A;  2YL1 A;  1JAF A;  4JEB A;  1MQV A;  2XLM A;  2YKZ A;  4L6R A;  1LM3 B;  2YL7 A;  1BBH A;  1M6T A;  2XL8 A;  1YYJ A;  256B A;  4CJG A;  5JVE A;  4ULV A;  3HNL A;  4CDA A;  3M79 A;  2J8W A;  1YZA A;  5B3I A;  1EKY A;  2BC5 A;  3QVY A;  4NC3 A;  3VRC A; 
#chains in the Genus database with same CATH topology
 2UUI A;  1CGN A;  4JVS A;  1CGO A;  4O6M A;  2GDC A;  3LUT B;  5HV9 A;  2BL2 A;  2WVQ A;  5A69 A;  1E83 A;  1VTM P;  1Q0K A;  2LSE A;  4AE4 B;  3LNM B;  2J0W A;  3AJM A;  3F47 A;  3TUL A;  2WZG A;  4O6N A;  3POV A;  3FOO A;  4N6C A;  3U0C A;  2YHS A;  4XPX A;  1A7V A;  2HUJ A;  4WGZ A;  3DWW A;  4D4N A;  4JRZ A;  2WVN A;  3EFO A;  3BRJ A;  3QW1 A;  5T3W A;  2Q3T A;  3CAX A;  3DE9 A;  3Q7L A;  3SXK A;  2H7V C;  3V7O A;  4JIO A;  1RKC A;  2BE5 F;  3RFY A;  2P61 A;  4CDV A;  1R4T A;  1WAS A;  1ZU4 A;  1AUE A;  2KNH A;  2IXM A;  2J9B A;  3DM9 B;  4BJ5 C;  1T6Q A;  1G4W R;  1MMD A;  3EHM A;  4EWC A;  1KU2 A;  3RF3 A;  3TD7 A;  3B0P A;  2Q7R A;  1H9T A;  2RSE B;  3EGX B;  4AE4 A;  4DRJ B;  5B1A C;  3A9C A;  4Q4Z F;  4IB4 A;  3NYM A;  1A7E A;  4WJ0 A;  4JUR I;  2TMV P;  2R7V A;  5F5F A;  3C8G B;  3WOD F;  5JLI A;  1TWH A;  2CYD A;  3QW0 A;  4DRI B;  2NSG A;  3LNR A;  2OCC C;  1HW2 A;  1ST6 A;  1FTS A;  3I5Q A;  1OKK D;  4AX2 A;  1R5I D;  4XEV A;  4BJ6 C;  3K1H A;  2ZD9 A;  1EA8 A;  1D0Y A;  2DYR C;  2M4E A;  2B0H A;  1JPN A;  2GFH A;  5KYU B;  4JTD B;  3RW0 A;  2J9W A;  4RDA A;  5D91 A;  3UMH A;  3NKD A;  4GYT A;  3QVZ A;  4HFK B;  2OEX A;  1OKK A;  3BEH A;  2OKU A;  4XEK A;  4CS7 A;  4C7O B;  5L0J A;  1YAR O;  1L3P A;  2EIJ C;  3C8G D;  3RVZ A;  1IW7 F;  2A68 F;  4XPY A;  3VAY A;  3F46 A;  2R7T A;  2H7B A;  2YWA A;  1LS1 A;  1KTM A;  3EGX A;  2J9V A;  2VH3 A;  3M1C B;  3GWN A;  4W8P A;  4G78 A;  3U9M A;  1WWP A;  2Q4F A;  4XLN F;  2R05 A;  2HV7 A;  1W2W A;  2EIK C;  3C8G A;  4C3B A;  1SR2 A;  4MVO A;  2EPM X;  1BZ4 A;  3MX3 A;  1VYI A;  4G0H A;  2R02 A;  4O6Y A;  3B0U X;  3SYN A;  4DVZ A;  3Q6N A;  4E18 A;  4YWQ A;  5BQH A;  1NBB A;  3IQ6 A;  1G8X A;  3EZI A;  4MVM A;  5IY5 C;  5L0F A;  1LS4 A;  1YYX A;  2OU6 A;  1GGQ A;  1S05 A;  1YLM A;  2XLE A;  1RXQ A;  3ABK C;  5KYU A;  5FCL A;  3ABL C;  1JPJ A;  3HTK C;  2XXA B;  1MMN A;  2JX0 A;  1Z3I X;  5E33 A;  2DB4 A;  2EIL C;  1XZP A;  1ZZP A;  4PJL A;  4YT8 A;  4C7O A;  3E70 C;  4J7T A;  3K1I C;  2CNW D;  2R7O A;  3ECS A;  1YJG A;  1ORJ A;  2J7P D;  2KC3 A;  2XLV A;  4U5B E;  2L6G A;  2CCY A;  4HFF B;  3UR3 C;  4XEF A;  1BR2 A;  3Q6M A;  2J0X A;  3LLK A;  2LIG A;  1NFO A;  3EH1 A;  3CZ6 A;  3ZIB A;  1V74 B;  2P0N A;  2J7P A;  2Y39 A;  4I3M A;  5KYX B;  4IGG A;  3MBG A;  3RKO F;  4MTF A;  1Q0D A;  2R7R A;  1LM3 B;  1U6H A;  3QTH A;  3LAY A;  1ZYR F;  4QI0 A;  2P7V A;  3UGO A;  2LK4 A;  3ASO C;  1PV3 A;  4YJW A;  2YQY A;  4U5H A;  3S28 A;  1YYJ A;  2RD9 A;  3JRM O;  2XXA A;  2R7X A;  4W8K A;  1BR4 A;  1OQC A;  1D1C A;  5CI8 A;  3V5Y A;  2PP4 A;  4I1M A;  1A7D A;  4CDA A;  3GM1 A;  1QZX A;  1DOV A;  2BC5 A;  3FVY A;  3GWL A;  3SXY A;  4EUK B;  1C02 A;  2Y3B A;  4BPM A;  3ASN C;  2H7O A;  4PJM A;  3K7D A;  5F5H A;  3IQ5 A;  1VB5 A;  2Q9C A;  2NUT B;  1OXK A;  1T6U A;  2CW0 F;  4QDL A;  2XLD A;  4BJ5 A;  3KL4 A;  4D4X A;  4N06 A;  3OEO A;  4FAP B;  3ATP A;  2OJQ A;  2L9J A;  4WGY A;  3LEO A;  3I5P A;  5KYX A;  5AGF A;  5CI9 A;  5L3V A;  2NSF A;  1V55 C;  2G3K A;  2W9Y A;  4MVS A;  4XQ1 A;  5DQT A;  4EBJ A;  4LLC A;  2J46 A;  3ZWI A;  4DOZ A;  4H4K C;  4G7H F;  4U5D E;  4C3E A;  3JTL O;  4K1O A;  1BDJ B;  4OIP F;  3H2V A;  3HNI A;  4MVQ A;  1APC A;  1OR2 A;  1Y6D A;  3W2V A;  3J06 A;  1UG7 A;  2Q9A A;  3N24 A;  4DXW A;  1T5O A;  3T9O A;  4MVR A;  1HY5 A;  2Y3G A;  4XWJ A;  4CS9 C;  1RJ9 B;  1ZHT A;  4H54 A;  2L6H A;  3MYF A;  3RVY A;  1L7C A;  2WL8 A;  3Q7G A;  3HKK A;  2NUT A;  2A0B A;  4JEA A;  3DD7 A;  3WHN A;  4CBE A;  4EBK A;  3NMI A;  1T6I A;  2VCC A;  4DBQ A;  2W45 A;  2ETS A;  3GEH A;  4OD4 A;  1K05 A;  3DZA A;  2HSB A;  3L1M A;  1VLT A;  1EI7 A;  3TJ5 A;  5K0I A;  2QTV A;  2X0C A;  2JD3 A;  3OWT A;  2MYS A;  4OIO F;  3LEV A;  5JSL A;  4R32 A;  1RKE B;  4PJN A;  3MYI A;  1SMY F;  3GOR A;  2FAP B;  3M4B A;  4YN0 B;  1KNY A;  4LDK A;  4U5G A;  3NDB B;  1D1B A;  1FAP B;  1OCO C;  1TWC A;  1ZU5 A;  3R2P A;  4IJJ A;  4U5E E;  5EHH A;  3R7C A;  5A6B D;  1I4Y A;  1RJ9 A;  1JOG A;  1TFK B;  2XL6 A;  4LLE A;  3PHF 2;  2WVO A;  3G50 A;  2OG2 A;  1YA7 O;  2QE9 A;  3M4C A;  4JE9 A;  5DS6 A;  2KK1 A;  4NTB A;  2A6E F;  2KYH A;  2V26 A;  2R7U A;  1OCR C;  3FMS A;  3U3B A;  2Q00 A;  1NLX A;  4EKW A;  1CGM E;  4KNW A;  3K1I A;  4BEM J;  3NG1 A;  1QQ3 A;  2ZPA A;  4DRH B;  5A6B A;  3S27 A;  4E7Z A;  4KI2 A;  1Q0G A;  4NY3 A;  3V5Z A;  3EZH A;  4CJO A;  5BQI A;  1F1M A;  2Y3D A;  4CX9 A;  1MMA A;  3TOM A;  4QI2 A;  3FDQ A;  1M56 C;  2AU5 A;  4Z9H A;  1RKE A;  1LKX A;  2WZL A;  3JZ0 A;  1QKR A;  3NYJ A;  1G4U S;  4K0D A;  5EGY A;  1H7I A;  1A41 A;  3FOP A;  1OW6 A;  2EPN A;  3N2Z B;  2QNL A;  4O79 A;  5L3Q A;  2AP3 A;  2KSF A;  1FMW A;  4EBB A;  2JPU A;  3SNH A;  1Q0M A;  2Y3H A;  2XS1 A;  3IQC A;  2LFF A;  1I4Z A;  1SZI A;  2LQG A;  2IXN A;  1LIH A;  3JRT A;  3KYI A;  1M2O A;  2GA0 A;  3T4R A;  3W2W A;  5DS4 A;  3S90 A;  2HJ3 A;  3AQC A;  3DXJ F;  4ULW A;  3ZQV A;  1MMG A;  3H65 A;  4PFP A;  2A0U A;  3MFN A;  4CIH A;  2A1D D;  4BJT A;  4CS8 A;  3IHU A;  3JCU Q;  1K40 A;  5COF A;  1MQV A;  1J8M F;  1TWG A;  3GM3 A;  3W4Y A;  1D0Z A;  3VF0 A;  2HJM A;  4KNV A;  2V3C C;  3GAN A;  4NCQ A;  1NG1 A;  1E2X A;  4RD9 A;  3O39 A;  1HE1 A;  4MW3 A;  4U5F E;  3S29 A;  4CSA A;  2PBE A;  256B A;  1HMO A;  5TJ5 E;  4ULV A;  3NRH A;  3DMD A;  3HNL A;  1VMA A;  1LE2 A;  1ZW2 A;  3K33 A;  3M79 A;  1ZHZ A;  3L34 A;  3WG7 C;  5B3I A;  4NTA A;  3B0V C;  4GQH A;  1EKY A;  4RBN A;  3AG3 C;  4FX5 A;  5E2Q A;  1T9K A;  1Q0F A;  2R9R B;  2HS5 A;  4FWV A;  1MND A;  3DAG A;  2HV6 A;  4OD5 A;  4LDR A;  1Z5Z A;  3HNK A;  2ZXR A;  3LES A;  4CS9 A;  2XM4 A;  2C03 A;  2OEV A;  4IRU A;  4YL0 A;  1A0B A;  3DJU B;  4A2N B;  4ZLC A;  1AEP A;  3SZR A;  3ITF A;  2XLH A;  3EQL F;  1QPU A;  1TQG A;  1VK5 A;  3B29 A;  3RH3 A;  4CIP A;  5BQG A;  1TKN A;  1CPR A;  1LVK A;  3N0T A;  1Z63 A;  2IYL D;  1VLS A;  2I8B A;  3L0I A;  5B3S C;  3EJN A;  5BUO A;  4YL1 A;  2HSQ A;  2A69 F;  2KW3 C;  4ER9 A;  4YT2 A;  2PNO A;  4IAR A;  4JJF A;  3RQE A;  3UMK A;  3ZVR A;  4IAQ A;  2IBF A;  3AG1 C;  5HSW A;  1FFT C;  3X1O A;  1OW8 A;  3U3F A;  1HMD A;  1HE9 A;  5A6K A;  5B1B C;  2L81 A;  3CSK A;  2IXO A;  5KYN A;  3US6 A;  3PCV A;  5JT4 A;  2YRF A;  1H6G A;  2D4U A;  2EIN C;  1VOM A;  2VCB A;  4CS8 C;  4DVY P;  2D5R B;  1PCX A;  2KGO A;  1GS9 A;  5DS5 A;  1O87 A;  2YLD A;  4ONS A;  4C3D A;  3JT1 A;  2NUP B;  2R7Q A;  4N4W A;  3PDM P;  1NSG B;  1CPQ A;  1U89 A;  1E86 A;  1QSP A;  1XZQ A;  2J9U A;  1H9G A;  4J32 B;  3T6J A;  4A4A A;  2R7S A;  3U2L A;  3EG9 B;  1GQA A;  4CSA C;  2PFD A;  3A11 A;  2WZF A;  2ZXO A;  3GEE A;  4JC7 A;  3SXZ A;  1ORY A;  2UUH A;  3AGU A;  2H8A A;  2PX3 A;  2YLI A;  3C63 A;  3HNJ A;  1NU9 C;  3JSZ A;  2AWC A;  2YLG A;  4JTC B;  4XLP F;  4P9T A;  4PFO A;  3DJN B;  4OIN F;  4NQF A;  1TR2 A;  2DI3 A;  2Y69 C;  3TJ6 A;  4M63 A;  1IZM A;  3G4X A;  4MVZ A;  1NZE A;  1YVI A;  2QY9 A;  2YEV A;  4JCZ A;  2R7W A;  2CDQ A;  2FGY A;  1M2V B;  3UGP A;  4XTK A;  3TQO A;  1WAT A;  3EHN A;  1VYK A;  3L8I A;  3W8I A;  2NUP A;  1LI7 A;  1RCP A;  2NPU A;  3WAQ A;  1WTY A;  2MHR A;  2QLA A;  4MQ9 F;  5FZT A;  2YL3 A;  4J30 B;  1FNT c;  1Z23 A;  2XLO A;  3EG9 A;  2ZXP A;  2IM8 A;  3AG2 C;  3FHD A;  3TOL A;  4AK9 A;  4B6I A;  4NTF A;  3X2Q C;  3KH2 A;  3DI5 A;  3JYH A;  4DJ9 A;  4DBR A;  4KBL A;  1FFH A;  1LE4 A;  4U9E A;  2HMZ A;  2LCH A;  2M64 A;  1YZC A;  1ZW3 A;  2X51 A;  3C7J A;  5COM A;  1N1C A;  1V4A A;  3AGT A;  1C03 A;  3EH2 A;  4YK5 A;  3SXM A;  3T6B A;  3ZC4 A;  2Z15 A;  3JYY A;  2VAS A;  5T1D B;  2KJG A;  1M2V A;  3U2M A;  3LLI A;  3TK0 A;  2C04 A;  2G3V A;  4N6H A;  2HZ8 A;  4JTA B;  4KC9 A;  3DM5 A;  4Z9J A;  2YL1 A;  3LS0 A;  3U8V A;  1JAF A;  3O55 A;  3O6X A;  1NU7 D;  2HKV A;  1SYQ A;  5T3T A;  3ABM C;  5L0G A;  4OIR F;  1T01 A;  1D0X A;  4L6R A;  3GEI A;  4E17 A;  1BR1 A;  2ICW G;  3FXH A;  1AVO B;  1V54 C;  4P9F A;  4EHP A;  5E3A A;  3S0X A;  2LD6 A;  1QLE C;  2L6F A;  1LI5 A;  4XPW A;  4CJG A;  5JVE A;  3NKE A;  4PK4 A;  2J8W A;  4G7O F;  2IOQ A;  3AG4 C;  2DGJ A;  2LFD A;  1SF8 A;  3QVY A;  4HEA J;  1I5N A;  2VCA A;  4MTG A;  3VRC A;  1ZHW A;  3ZDL A;  1PD1 A;  3C62 A;  5KYW B;  2MWQ A;  1EQ1 A;  4UDV A;  3B71 A;  2P1A A;  2YL0 A;  5KYY B;  3KKB A;  3LS1 A;  4MND A;  3L8J A;  1E84 A;  4MS2 A;  1UFB A;  5A6A A;  4JW1 A;  4WAB A;  4MW8 A;  1XWJ A;  4YL3 A;  2W4M A;  3NMK A;  1OXB A;  1M57 C;  2PF4 E;  4JKV A;  3KYJ A;  2XL4 A;  5A6J A;  5DLJ A;  2A6H F;  2J45 A;  4PAC A;  2AWY A;  5GPG B;  2OQM A;  2R25 A;  3K66 A;  3RQG A;  2P6V A;  2VC9 A;  4K7B A;  4J7Y A;  5L0C A;  3O10 A;  5L0I A;  1FR0 A;  5E3C A;  1NFN A;  4AL0 A;  3IEE A;  3DKA A;  3K6B A;  3V5X A;  4ANJ A;  2EPL X;  3U8P A;  3NYL A;  5KYW A;  1J8Y F;  2W4B A;  3RQF A;  5KYY A;  3QMK A;  1K04 A;  4YT5 A;  2XRH A;  1OCC C;  2PX0 A;  2EIM C;  4PJJ A;  4E0I A;  4JJG A;  1ZHX A;  4X0R A;  1TFO B;  3CQZ A;  1WN0 A;  4LDQ A;  5D92 A;  3GOD A;  4IWB A;  2GAQ A;  3S9O A;  1B68 A;  5AC4 A;  3S84 A;  4G7Z F;  4OIQ F;  4CDY A;  3AQB A;  5L0H A;  4GEH A;  3T6G B;  1GM5 A;  4HE8 D;  4LAC B;  4I44 A;  4ZLD A;  1FMV A;  1Y4C A;  2OOC A;  1OCZ C;  3EGD B;  2ASR A;  2KQ9 A;  3M15 A;  3SEO A;  2XLW A;  3QZC A;  4MVU A;  1Z6A A;  1JRA A;  4PR9 A;  3EPV A;  3NMJ A;  1ORS C;  1O5H A;  2EPK X;  2WB7 A;  1YDI A;  4O7G A;  2R03 A;  1E85 A;  5EK0 A;  1YAU O;  2F22 A;  1WGW A;  1S7Z A;  2VB6 A;  4U9D A;  4E7S A;  3I4U A;  3ZTZ A;  2L7A A;  3ZTM A;  1Z7Q c;  5F28 E;  2XS8 A;  2YZS A;  4Q5S F;  3E9V A;  5COG A;  1JMW A;  2LP4 A;  2B0J A;  2CNW A;  2O9X A;  3GM2 A;  1OW7 A;  1TWA A;  2IXP A;  3DAF A;  4YT4 A;  3ZQY A;  2XM0 A;  4P6I C;  1MNE A;  1C17 M;  1HW1 A;  4Q7C A;  3IQT A;  4LER A;  3VM6 A;  4MTO A;  4BEJ A;  3EGD A;  2HMQ A;  4EIY A;  3UNG C;  1PD0 A;  3RIP A;  2I15 A;  3G4Z A;  1YA9 A;  2GWW A;  2NG1 A;  1D1A A;  3H2U A;  3KMI A;  2CGE A;  5JS5 A;  4Z9I A;  4F4B A;  5JRA A;  1LPE A;  1RMV A;  3PMR A;  3JSE O;  2XSE A;  3FAP B;  3VYW A;  5L0D A;  3ZG1 A;  1QVX A;  3HJC A;  2ZXW C;  5CIV A;  3RYL A;  1JR8 A;  5DQZ A;  4BJ1 A;  3B9Q A;  1ZVZ A;  5DVW A;  5AC5 A;  1G5Z A;  2E87 A;  3LJB A;  2QUP A;  1OR3 A;  1ZHY A;  3CEX A;  3DE8 A;  4JCH A;  4BG0 A;  2FFH A;  1DOW A;  5JP7 A;  5JUA A;  4IAO A;  3KPH A;  4JEB A;  3C8Z A;  2AVK A;  2G62 A;  4FES A;  3UMI A;  2HFI A;  3MLG A;  2XLM A;  3OA1 A;  2YKZ A;  4JZA A;  2EPO A;  1WOL A;  3ZSU A;  3IPM O;  2OJE D;  3EFO B;  3C18 A;  2YL7 A;  1BBH A;  1O3U A;  1M6T A;  4AL1 A;  2Q9B A;  2XL8 A;  3U5S A;  2DYS C;  4U5C E;  3SP1 A;  3U9J A;  2YVK A;  3W8H A;  4BJ6 A;  3FAJ A;  1U0B B;  1YZA A;  4I1O B;  4E0H A;  3AOU A;  3HLZ A;  4NC3 A; 
#chains in the Genus database with same CATH homology
 1CGN A;  1CGO A;  3C62 A;  3IQ5 A;  2YL0 A;  3HNK A;  2XLD A;  4D4X A;  1E84 A;  2XM4 A;  1E83 A;  3NMK A;  3FOO A;  4WGY A;  4JKV A;  2XLH A;  4CIP A;  1QPU A;  1A7V A;  5AGF A;  4WGZ A;  1CPR A;  4D4N A;  3QW1 A;  3DE9 A;  3ZWI A;  3HNI A;  4IAR A;  1APC A;  4CDV A;  4IAQ A;  2J9B A;  3U8P A;  5JT4 A;  4JEA A;  3NMI A;  4IB4 A;  2YLD A;  4N4W A;  4CDY A;  1CPQ A;  3L1M A;  5JLI A;  3QW0 A;  1GQA A;  3M15 A;  2XLW A;  5JSL A;  3M4B A;  3NMJ A;  2YLI A;  3C63 A;  3HNJ A;  2YLG A;  1E85 A;  3QVZ A;  2XL6 A;  4U9D A;  3ZTZ A;  3M4C A;  4JE9 A;  3ZTM A;  1QQ3 A;  1RCP A;  3ZQY A;  2XM0 A;  2QLA A;  4CJO A;  2YL3 A;  2XLO A;  4CX9 A;  3TOL A;  3TOM A;  1NBB A;  4EIY A;  3IQ6 A;  1YYX A;  1S05 A;  2XLE A;  3FOP A;  5JS5 A;  4U9E A;  5JRA A;  1YZC A;  2XLV A;  2CCY A;  3ZQV A;  1E86 A;  5JUA A;  3DE8 A;  4N6H A;  5JP7 A;  4ER9 A;  2YL1 A;  1JAF A;  4JEB A;  1MQV A;  2XLM A;  2YKZ A;  4L6R A;  1LM3 B;  2YL7 A;  1BBH A;  1M6T A;  2XL8 A;  1YYJ A;  256B A;  4CJG A;  5JVE A;  4ULV A;  3HNL A;  4CDA A;  3M79 A;  2J8W A;  1YZA A;  5B3I A;  1EKY A;  2BC5 A;  3QVY A;  4NC3 A;  3VRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...