4XEVA

Fusion of pyk2-fat domain with leupaxin ld1 motif, complexed with leupaxin ld4 peptide
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
155
structure length
148
Chain Sequence
NLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHGGEELDALLEELER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Fusion protein of Protein-tyrosine kinase 2-beta FAT domain
total genus 64
structure length 148
sequence length 155
chains with identical sequence D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4xevA00
1OW6A 1K05A 1ZZPA 4XEFA 4XEVA 4XEKA 2PBEA 3S9OA 4NQFA 1QVXA 3RQEA 1WOLA 3K7DA 3JYYA 3C8GA 3L8IA 3U0CA 2L6GA 3BRJA 3JZ0A 1PV3A 1WWPA 3TULA 3AJMA 2JX0A 1KNYA 2YWAA 1WTYA 3GM1A 3O10A 1K04A 3RQFA 1O3UA 1V4AA 4EBJA 1UFBA 1K40A 3C8GD 1OW7A 3GM2A 3GM3A 3B71A 2KK1A 3U3FA 3L8JA 1JOGA 3RQGA 2LK4A 3C18A 2L6FA 3C8GB 1OW8A 2JPUA 5F28E 3MFNA 4EBKA 1KTMA 2L6HA 2HSBA 2Q00A 4R32A
chains in the Genus database with same CATH superfamily
4QDLA 2A0UA 5L0HA 1VLTA 4Z9HA 2GFHA 4U5DE 4W8KA 5D91A 3K66A 1JMWA 4PJMA 3W4YA 2GAQA 3S29A 3SXMA 4C3BA 1YDIA 1H9TA 1L7CA 4YN0B 2R7VA 2V26A 3BRJA 4WGZA 1FFTC 3SXZA 5A6KA 4BJ5C 3OA1A 1RMVA 2VH3A 2KGOA 3DJNB 2VCAA 4IJJA 5IY5C 2EINC 1FMVA 2IXPA 4BJ5A 2TMVP 3VF0A 2RSEB 3AG2C 1SMYF 3UGPA 1YA7O 1U0BB 2I8BA 3CEXA 2HV6A 3RQGA 4WJ0A 3FVYA 2Y39A 5EHHA 3EZIA 1I4ZA 3KYJA 4IRUA 2I15A 4NTBA 3KPHA 5B1BC 4DRIB 3PMRA 3SNHA 2EIJC 2Q3TA 4OIQF 3DM5A 3HNLA 2Y3DA 3B29A 4OIOF 1RKEB 3FAPB 2YRFA 5T1DB 4AE4A 4C3EA 4DVYP 1GS9A 4A2NB 1IW7F 1TFKB 3FOOA 3X2QC 2IBFA 5DQTA 3UNGC 3NG1A 4BEJA 3EGXA 1NBBA 2ASRA 2ZPAA 3B0UX 2LSEA 4FESA 5L0DA 4D4NA 1NU9C 2J7PD 3H65A 4HEAJ 3QW1A 3TULA 2NPUA 2NSGA 3KL4A 4PFOA 2CDQA 3IQ5A 3I5PA 4DVZA 1AVOB 4LERA 2EPMX 3V5ZA 5KYXA 1SF8A 2GWWA 1OXBA 3S28A 1ZVZA 5JT4A 1LM3B 2J9UA 3SEOA 3U3FA 2BL2A 3H2UA 5AGFA 4JVSA 4QI0A 2HV7A 1H9GA 1T5OA 4EWCA 1Y4CA 4P9FA 4N6HA 3ASNC 1E86A 3DE8A 4MW8A 2CYDA 2IYLD 4IGGA 2YHSA 3ZG1A 4JURI 1Y6DA 3HTKC 3L1MA 4BJTA 3T4RA 2LFFA 1R4TA 2VCCA 3POVA 1CGME 4W8PA 3JCUQ 1VYIA 4KC9A 5CI9A 2G62A 3MX3A 1NZEA 4YL3A 2G3KA 4XQ1A 2KSFA 3S27A 3OWTA 4EBJA 3DAFA 3KYIA 4KBLA 3DKAA 2YL3A 1M6TA 4Q5SF 4LACB 4J7YA 4JJGA 5D92A 3LEVA 3SYNA 1TWGA 3RIPA 2HMQA 4DRHB 2ZD9A 4JTCB 2XXAB 1MNDA 3HJCA 4C7OA 1H6GA 2YVKA 4JCHA 1YLMA 3EHNA 1OW6A 3W2VA 1M2OA 1NG1A 4YT5A 2OG2A 4CS8A 2ETSA 3N2ZB 3L34A 1OKKA 5KYWB 1YYXA 4CS9A 2AVKA 1JRAA 1Q0FA 2L9JA 3Q6MA 4JTAB 3R7CA 1FMWA 1WOLA 1E85A 3IQTA 4XLNF 2PX3A 1QLEC 2FGYA 4JE9A 3AJMA 4NTFA 4YJWA 1ZHWA 4CDYA 3ZDLA 4E7SA 2R7SA 2ZXOA 1PD0A 3GM1A 5E3CA 2E87A 3DZAA 2Q4FA 1D0XA 2J9WA 3AG4C 2AU5A 4Z9JA 4E7ZA 5B3SC 1SR2A 2J46A 4I44A 3FDQA 1OW8A 5DQZA 1JPNA 1A41A 1CGOA 3QMKA 5F28E 4E0IA 1KTMA 1ZU5A 1BBHA 4L6RA 3TOMA 4BG0A 4MTGA 3TJ6A 1I5NA 1BR1A 1RXQA 2W4MA 4AL0A 3LAYA 4NQFA 1APCA 2QY9A 2CW0F 3K1IC 3TOLA 1QQ3A 2P7VA 3EJNA 2IOQA 4OINF 5HV9A 3U8PA 2J9VA 2XLOA 256BA 4K1OA 4CJGA 2LP4A 3E70C 3RYLA 4K0DA 1WGWA 3V7OA 1RKCA 1XWJA 5FZTA 1T6IA 1V4AA 2R02A 4NC3A 3EZHA 2AP3A 1RJ9B 2R9RB 4ONSA 3H2VA 1LE2A 5JVEA 2YL1A 5CI8A 4G0HA 1GQAA 3M4BA 1FFHA 3RH3A 2EIMC 2L6FA 1HY5A 1OCOC 2R25A 3C7JA 3U2LA 4E0HA 1E84A 3RF3A 2YLDA 3ITFA 2HSBA 1VYKA 3HNJA 4JZAA 5KYUA 1PD1A 1ORYA 4JJFA 4MTOA 3J06A 2VASA 3AG1C 4U5EE 3RW0A 1EKYA 3US6A 1HE9A 2UUHA 4UDVA 4G7ZF 3ZSUA 1S7ZA 1JPJA 4IAQA 2Q9BA 4J7TA 3RQEA 4O6NA 5EGYA 1ORJA 2KNHA 3U0CA 1M2VA 1MMAA 3UMHA 2KW3C 2PF4E 3U2MA 4CDAA 4MVMA 3FAJA 3Q7LA 5CIVA 2OKUA 5GPGB 2PNOA 1WTYA 4FWVA 5KYXB 3O10A 2XLWA 3U8VA 1O3UA 1TQGA 1GGQA 4U9DA 3V5XA 2YZSA 4AK9A 2QLAA 4HFFB 3O6XA 1Q0MA 2WVOA 5COMA 1Z3IX 3C18A 4JEBA 1HE1A 1OKKD 1OR2A 1T6QA 2A6EF 2DYSC 3ZC4A 4YWQA 5BQIA 3G4XA 5KYUB 3W2WA 2AWYA 1E83A 5EK0A 3EH1A 4MVUA 2VC9A 3O55A 3K1HA 2YKZA 5JLIA 4FX5A 2PBEA 5DVWA 1L3PA 4RBNA 2DYRC 4LDRA 3VRCA 4MTFA 4CDVA 2MWQA 1ZHTA 2D4UA 1ORSC 4CS7A 1F1MA 4I1MA 3RFYA 1ZU4A 2GA0A 1Q0GA 3EQLF 4O6MA 2JX0A 5T3WA 4IB4A 2LCHA 3S0XA 4DRJB 2EILC 2J45A 4DBRA 4YT8A 2DI3A 3VYWA 2HS5A 4QI2A 1OW7A 3F47A 3GM3A 3EG9A 4ZLCA 2KK1A 3BEHA 2WVQA 3JRMO 1TR2A 2VCBA 3GANA 1XZPA 4JIOA 3AQCA 2XRHA 2R7UA 4XTKA 2O9XA 4EBKA 1LKXA 2A0BA 3NYLA 1CPQA 2L6HA 3M15A 3ZVRA 2G3VA 1OR3A 4HFKB 1O87A 2EPLX 2UUIA 2HSQA 4PFPA 3SXYA 1RJ9A 5L0CA 2PX0A 3FHDA 3IQCA 3T6GB 1AEPA 3DI5A 1U89A 4N6CA 4EBBA 3C8GA 4DOZA 2XXAA 3EGXB 3W8HA 3UMKA 2MYSA 3DD7A 1LVKA 1M2VB 4JEAA 4PK4A 1A0BA 1H7IA 3JSZA 3PCVA 1WN0A 3EPVA 4O79A 4AX2A 2OJED 1K04A 1Z23A 2XLEA 3CAXA 3LESA 3VAYA 3DJUB 1ZW3A 2YLGA 1DOWA 4OD4A 1OCZC 2L7AA 2CCYA 2L81A 3M4CA 4IARA 4NCQA 3WAQA 1YA9A 1NU7D 3NMKA 4YT4A 4G7OF 3NRHA 3RKOF 3ABMC 3LNMB 4CJOA 2LD6A 3JYHA 2NUPA 4YL0A 3SXKA 4CS9C 5JUAA 3PHF2 3O39A 3GWLA 2IXOA 2KC3A 3M79A 3GEEA 4HE8D 2BC5A 4JKVA 1OQCA 2X51A 1G4WR 2OEXA 1WASA 1ZZPA 4X0RA 3NYMA 1FNTc 2PFDA 4ANJA 4MQ9F 2R7OA 4LLCA 4MVQA 4N06A 2P6VA 3QW0A 3EGDB 2OCCC 1J8MF 2R05A 1J8YF 2L6GA 3EH2A 2WZFA 3JSEO 2W4BA 2NUTB 2BE5F 4CSAC 2KYHA 1OCRC 3AQBA 4XWJA 2R7TA 1ST6A 4CSAA 3TD7A 3WODF 4OD5A 1MMDA 4CIPA 1LI7A 3RVYA 3C8ZA 4Q4ZF 3GODA 3SZRA 4XLPF 3TJ5A 3V5YA 4U9EA 3GEIA 3FOPA 2WL8A 3HLZA 3ZQYA 4C3DA 5BQHA 2Q00A 4LDKA 3QZCA 3I4UA 2J7PA 1K05A 1BR2A 4XEFA 1PCXA 3HNIA 1RKEA 1DOVA 3EG9B 1CGNA 4FAPB 2PP4A 1SYQA 4NY3A 4P9TA 3PDMP 4I1OB 2FFHA 3CSKA 1G8XA 2WB7A 3ASOC 2IXMA 1D1AA 3NMIA 2XL8A 2R7RA 4CBEA 5DS4A 1Q0KA 3S90A 1SZIA 5TJ5E 1Z63A 4PJJA 1Z6AA 3DAGA 1CPRA 3G4ZA 1O5HA 3SP1A 3AGUA 1YYJA 4CX9A 4WABA 3ATPA 1FTSA 1YJGA 2P1AA 1JOGA 1JAFA 2XL4A 5COGA 1Z7Qc 1HMDA 3GEHA 2A68F 2HMZA 3DE9A 3FMSA 4JC7A 4XPWA 3NYJA 4R32A 4GEHA 3LNRA 5F5FA 3UMIA 4E17A 2C04A 3Q7GA 2X0CA 1IZMA 2M64A 3A9CA 2XL6A 4YK5A 2M4EA 2Q7RA 3S9OA 1LS4A 2XLDA 5HSWA 5DS5A 3HNKA 3GWNA 2XSEA 1EA8A 3IPMO 1T6UA 3JZ0A 5L3QA 1PV3A 1NFOA 3ZWIA 3LLKA 4Q7CA 1NSGB 2YWAA 4XPYA 1AUEA 2F22A 2OEVA 3LEOA 3CQZA 1ZHXA 2J0XA 4U5BE 3QVYA 3EGDA 2R7QA 2NSFA 1OXKA 2YL0A 3B71A 4EKWA 1HW2A 2EPNA 3EHMA 4K7BA 5BUOA 2Y69C 5AC5A 3E9VA 2JPUA 5B1AC 4CS8C 3DMDA 3OEOA 3ECSA 4BPMA 3MLGA 4RDAA 3NKDA 2R7XA 2XM4A 4G7HF 4MW3A 5JSLA 1M56C 2IM8A 5BQGA 1WATA 4AL1A 3T6BA 3B0VC 3A11A 3JYYA 3AGTA 3U3BA 4KI2A 1LS1A 2OU6A 2XS1A 4PACA 1NLXA 4WGYA 4ULVA 1FAPB 1LI5A 2QTVA 3N24A 2HJ3A 1FR0A 3FXHA 4GQHA 5COFA 5E3AA 2LIGA 3NMJA 4IAOA 5L0IA 2KQ9A 2H7BA 2Q9CA 5E33A 1KU2A 4I3MA 3L0IA 3LS1A 3R2PA 2FAPB 3MBGA 3Q6NA 3K33A 4MNDA 4P6IC 4ULWA 4Z9IA 2R03A 1U6HA 2LFDA 4LLEA 2CGEA 3JTLO 2A6HF 1G4US 1GM5A 1TWHA 3G50A 5B3IA 2HKVA 1A7EA 1E2XA 2H7VC 1S05A 4O6YA 1YVIA 2YQYA 2XLHA 1QZXA 2WZLA 4EIYA 3L8IA 3QTHA 3W8IA 1TKNA 4DXWA 2DGJA 4H54A 1YAUO 3AOUA 2LQGA 4DJ9A 4N4WA 5A6BA 1KNYA 2Y3GA 4ER9A 2HJMA 3S84A 2YL7A 3HKKA 3KH2A 3ZTMA 2C03A 4MS2A 2CNWD 4OIPF 4U5HA 1BDJB 1B68A 1VB5A 4J32B 4YL1A 3JT1A 3ABLC 3L8JA 3LLIA 1YZCA 3EFOA 5JP7A 3TQOA 4BJ6A 5K0IA 1QSPA 1ZHYA 2P0NA 5JS5A 1MMNA 2Q9AA 4PJLA 1M57C 2NUPB 2IXNA 1C02A 3GM2A 4MVRA 4E18A 1VTMP 4BEMJ 5L0JA 1BZ4A 5FCLA 2EPKX 2W45A 1VMAA 3ABKC 4JW1A 4G78A 4AE4B 3IQ6A 3CZ6A 2OQMA 4BJ1A 5KYYB 2A1DD 4D4XA 5A69A 4JTDB 4A4AA 1JR8A 1MMGA 2AWCA 4XPXA 2J0WA 2J8WA 1ZYRF 1XZQA 2ICWG 2P61A 4O7GA 3WG7C 1QPUA 1T9KA 5F5HA 2YEVA 4ZLDA 1QKRA 2QUPA 4M63A 4PJNA 3U9JA 2KJGA 1K40A 4OIRF 4KNVA 3LS0A 1UG7A 2HUJA 1V55C 2MHRA 1R5ID 3K1IA 3RVZA 1BR4A 4F4BA 2Y3HA 2LK4A 1VLSA 1TWAA 3MYIA 1TFOB 2B0HA 4NTAA 2NUTA 4DBQA 4U5FE 1LPEA 2YLIA 1VOMA 2HFIA 4H4KC 2D5RB 5A6AA 1V54C 1OCCC 1T01A 3IEEA 3N0TA 4RD9A 5L3VA 3UGOA 3B0PA 2QE9A 3MYFA 4MVSA 4U5GA 5A6BD 4C7OB 3M1CB 4XEVA 3QVZA 4EHPA 1ZHZA 3LUTB 1QVXA 4BJ6C 3K7DA 2Z15A 3WHNA 3X1OA 1D1BA 4J30B 5L0FA 1N1CA 4JRZA 1WWPA 1A7VA 2EPOA 2WZGA 4U5CE 2A69F 3DXJF 4EUKB 2OOCA 4JCZA 3RQFA 3DM9B 3ZQVA 5KYWA 2ZXRA 2DB4A 3GORA 1YARO 3KKBA 3T6JA 1UFBA 3U9MA 1HW1A 5DS6A 3C63A 1LE4A 2JD3A 2B0JA 1I4YA 1MQVA 5KYYA 4LDQA 1TWCA 2OJQA 4IWBA 1D0ZA 3F46A 3ZTZA 1HMOA 5E2QA 4GYTA 4MVOA 2WVNA 2ZXPA 2RD9A 3I5QA 3K6BA 2Y3BA 1G5ZA 4PR9A 1NFNA 1MNEA 3NKEA 3AG3C 2HZ8A 4XEKA 5JRAA 3KMIA 3T9OA 1C17M 3EFOB 3DWWA 1Q0DA 5L0GA 2XM0A 3IHUA 1RCPA 1W2WA 2CNWA 2J9BA 2V3CC 5AC4A 1YZAA 2EIKC 5DLJA 1EQ1A 3VM6A 1EI7A 1ZW2A 3JRTA 4CIHA 3ZIBA 2GDCA 1V74B 2XLMA 3NDBB 5A6JA 3TK0A 1A7DA 2W9YA 2QNLA 3C8GD 3B9QA 4YT2A 1D0YA 4B6IA 5T3TA 5KYNA 2H7OA 2VB6A 3U5SA 1Z5ZA 3C62A 1C03A 3C8GB 1VK5A 2XLVA 2ZXWC 2H8AA 1LIHA 2XS8A 3LJBA 3MFNA 1D1CA 2NG1A 4KNWA 2R7WA 3UR3C 4MVZA
chains in the Genus database with same CATH topology
1OW6A 1K05A 1ZZPA 4XEFA 4XEVA 4XEKA 2PBEA 3S9OA 4NQFA 1QVXA 3RQEA 1WOLA 3K7DA 3JYYA 3C8GA 3L8IA 3U0CA 2L6GA 3BRJA 3JZ0A 1PV3A 1WWPA 3TULA 3AJMA 2JX0A 1KNYA 2YWAA 1WTYA 3GM1A 3O10A 1K04A 3RQFA 1O3UA 1V4AA 4EBJA 1UFBA 1K40A 3C8GD 1OW7A 3GM2A 3GM3A 3B71A 2KK1A 3U3FA 3L8JA 1JOGA 3RQGA 2LK4A 3C18A 2L6FA 3C8GB 1OW8A 2JPUA 5F28E 3MFNA 4EBKA 1KTMA 2L6HA 2HSBA 2Q00A 4R32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OW6 A;  1K05 A;  1ZZP A;  4XEF A;  4XEV A;  4XEK A;  2PBE A;  3S9O A;  4NQF A;  1QVX A;  3RQE A;  1WOL A;  3K7D A;  3JYY A;  3C8G A;  3L8I A;  3U0C A;  2L6G A;  3BRJ A;  3JZ0 A;  1PV3 A;  1WWP A;  3TUL A;  3AJM A;  2JX0 A;  1KNY A;  2YWA A;  1WTY A;  3GM1 A;  3O10 A;  1K04 A;  3RQF A;  1O3U A;  1V4A A;  4EBJ A;  1UFB A;  1K40 A;  3C8G D;  1OW7 A;  3GM2 A;  3GM3 A;  3B71 A;  2KK1 A;  3U3F A;  3L8J A;  1JOG A;  3RQG A;  2LK4 A;  3C18 A;  2L6F A;  3C8G B;  1OW8 A;  2JPU A;  5F28 E;  3MFN A;  4EBK A;  1KTM A;  2L6H A;  2HSB A;  2Q00 A;  4R32 A; 
#chains in the Genus database with same CATH topology
 4QDL A;  2A0U A;  5L0H A;  1VLT A;  4Z9H A;  2GFH A;  4U5D E;  4W8K A;  5D91 A;  3K66 A;  1JMW A;  4PJM A;  3W4Y A;  2GAQ A;  3S29 A;  3SXM A;  4C3B A;  1YDI A;  1H9T A;  1L7C A;  4YN0 B;  2R7V A;  2V26 A;  3BRJ A;  4WGZ A;  1FFT C;  3SXZ A;  5A6K A;  4BJ5 C;  3OA1 A;  1RMV A;  2VH3 A;  2KGO A;  3DJN B;  2VCA A;  4IJJ A;  5IY5 C;  2EIN C;  1FMV A;  2IXP A;  4BJ5 A;  2TMV P;  3VF0 A;  2RSE B;  3AG2 C;  1SMY F;  3UGP A;  1YA7 O;  1U0B B;  2I8B A;  3CEX A;  2HV6 A;  3RQG A;  4WJ0 A;  3FVY A;  2Y39 A;  5EHH A;  3EZI A;  1I4Z A;  3KYJ A;  4IRU A;  2I15 A;  4NTB A;  3KPH A;  5B1B C;  4DRI B;  3PMR A;  3SNH A;  2EIJ C;  2Q3T A;  4OIQ F;  3DM5 A;  3HNL A;  2Y3D A;  3B29 A;  4OIO F;  1RKE B;  3FAP B;  2YRF A;  5T1D B;  4AE4 A;  4C3E A;  4DVY P;  1GS9 A;  4A2N B;  1IW7 F;  1TFK B;  3FOO A;  3X2Q C;  2IBF A;  5DQT A;  3UNG C;  3NG1 A;  4BEJ A;  3EGX A;  1NBB A;  2ASR A;  2ZPA A;  3B0U X;  2LSE A;  4FES A;  5L0D A;  4D4N A;  1NU9 C;  2J7P D;  3H65 A;  4HEA J;  3QW1 A;  3TUL A;  2NPU A;  2NSG A;  3KL4 A;  4PFO A;  2CDQ A;  3IQ5 A;  3I5P A;  4DVZ A;  1AVO B;  4LER A;  2EPM X;  3V5Z A;  5KYX A;  1SF8 A;  2GWW A;  1OXB A;  3S28 A;  1ZVZ A;  5JT4 A;  1LM3 B;  2J9U A;  3SEO A;  3U3F A;  2BL2 A;  3H2U A;  5AGF A;  4JVS A;  4QI0 A;  2HV7 A;  1H9G A;  1T5O A;  4EWC A;  1Y4C A;  4P9F A;  4N6H A;  3ASN C;  1E86 A;  3DE8 A;  4MW8 A;  2CYD A;  2IYL D;  4IGG A;  2YHS A;  3ZG1 A;  4JUR I;  1Y6D A;  3HTK C;  3L1M A;  4BJT A;  3T4R A;  2LFF A;  1R4T A;  2VCC A;  3POV A;  1CGM E;  4W8P A;  3JCU Q;  1VYI A;  4KC9 A;  5CI9 A;  2G62 A;  3MX3 A;  1NZE A;  4YL3 A;  2G3K A;  4XQ1 A;  2KSF A;  3S27 A;  3OWT A;  4EBJ A;  3DAF A;  3KYI A;  4KBL A;  3DKA A;  2YL3 A;  1M6T A;  4Q5S F;  4LAC B;  4J7Y A;  4JJG A;  5D92 A;  3LEV A;  3SYN A;  1TWG A;  3RIP A;  2HMQ A;  4DRH B;  2ZD9 A;  4JTC B;  2XXA B;  1MND A;  3HJC A;  4C7O A;  1H6G A;  2YVK A;  4JCH A;  1YLM A;  3EHN A;  1OW6 A;  3W2V A;  1M2O A;  1NG1 A;  4YT5 A;  2OG2 A;  4CS8 A;  2ETS A;  3N2Z B;  3L34 A;  1OKK A;  5KYW B;  1YYX A;  4CS9 A;  2AVK A;  1JRA A;  1Q0F A;  2L9J A;  3Q6M A;  4JTA B;  3R7C A;  1FMW A;  1WOL A;  1E85 A;  3IQT A;  4XLN F;  2PX3 A;  1QLE C;  2FGY A;  4JE9 A;  3AJM A;  4NTF A;  4YJW A;  1ZHW A;  4CDY A;  3ZDL A;  4E7S A;  2R7S A;  2ZXO A;  1PD0 A;  3GM1 A;  5E3C A;  2E87 A;  3DZA A;  2Q4F A;  1D0X A;  2J9W A;  3AG4 C;  2AU5 A;  4Z9J A;  4E7Z A;  5B3S C;  1SR2 A;  2J46 A;  4I44 A;  3FDQ A;  1OW8 A;  5DQZ A;  1JPN A;  1A41 A;  1CGO A;  3QMK A;  5F28 E;  4E0I A;  1KTM A;  1ZU5 A;  1BBH A;  4L6R A;  3TOM A;  4BG0 A;  4MTG A;  3TJ6 A;  1I5N A;  1BR1 A;  1RXQ A;  2W4M A;  4AL0 A;  3LAY A;  4NQF A;  1APC A;  2QY9 A;  2CW0 F;  3K1I C;  3TOL A;  1QQ3 A;  2P7V A;  3EJN A;  2IOQ A;  4OIN F;  5HV9 A;  3U8P A;  2J9V A;  2XLO A;  256B A;  4K1O A;  4CJG A;  2LP4 A;  3E70 C;  3RYL A;  4K0D A;  1WGW A;  3V7O A;  1RKC A;  1XWJ A;  5FZT A;  1T6I A;  1V4A A;  2R02 A;  4NC3 A;  3EZH A;  2AP3 A;  1RJ9 B;  2R9R B;  4ONS A;  3H2V A;  1LE2 A;  5JVE A;  2YL1 A;  5CI8 A;  4G0H A;  1GQA A;  3M4B A;  1FFH A;  3RH3 A;  2EIM C;  2L6F A;  1HY5 A;  1OCO C;  2R25 A;  3C7J A;  3U2L A;  4E0H A;  1E84 A;  3RF3 A;  2YLD A;  3ITF A;  2HSB A;  1VYK A;  3HNJ A;  4JZA A;  5KYU A;  1PD1 A;  1ORY A;  4JJF A;  4MTO A;  3J06 A;  2VAS A;  3AG1 C;  4U5E E;  3RW0 A;  1EKY A;  3US6 A;  1HE9 A;  2UUH A;  4UDV A;  4G7Z F;  3ZSU A;  1S7Z A;  1JPJ A;  4IAQ A;  2Q9B A;  4J7T A;  3RQE A;  4O6N A;  5EGY A;  1ORJ A;  2KNH A;  3U0C A;  1M2V A;  1MMA A;  3UMH A;  2KW3 C;  2PF4 E;  3U2M A;  4CDA A;  4MVM A;  3FAJ A;  3Q7L A;  5CIV A;  2OKU A;  5GPG B;  2PNO A;  1WTY A;  4FWV A;  5KYX B;  3O10 A;  2XLW A;  3U8V A;  1O3U A;  1TQG A;  1GGQ A;  4U9D A;  3V5X A;  2YZS A;  4AK9 A;  2QLA A;  4HFF B;  3O6X A;  1Q0M A;  2WVO A;  5COM A;  1Z3I X;  3C18 A;  4JEB A;  1HE1 A;  1OKK D;  1OR2 A;  1T6Q A;  2A6E F;  2DYS C;  3ZC4 A;  4YWQ A;  5BQI A;  3G4X A;  5KYU B;  3W2W A;  2AWY A;  1E83 A;  5EK0 A;  3EH1 A;  4MVU A;  2VC9 A;  3O55 A;  3K1H A;  2YKZ A;  5JLI A;  4FX5 A;  2PBE A;  5DVW A;  1L3P A;  4RBN A;  2DYR C;  4LDR A;  3VRC A;  4MTF A;  4CDV A;  2MWQ A;  1ZHT A;  2D4U A;  1ORS C;  4CS7 A;  1F1M A;  4I1M A;  3RFY A;  1ZU4 A;  2GA0 A;  1Q0G A;  3EQL F;  4O6M A;  2JX0 A;  5T3W A;  4IB4 A;  2LCH A;  3S0X A;  4DRJ B;  2EIL C;  2J45 A;  4DBR A;  4YT8 A;  2DI3 A;  3VYW A;  2HS5 A;  4QI2 A;  1OW7 A;  3F47 A;  3GM3 A;  3EG9 A;  4ZLC A;  2KK1 A;  3BEH A;  2WVQ A;  3JRM O;  1TR2 A;  2VCB A;  3GAN A;  1XZP A;  4JIO A;  3AQC A;  2XRH A;  2R7U A;  4XTK A;  2O9X A;  4EBK A;  1LKX A;  2A0B A;  3NYL A;  1CPQ A;  2L6H A;  3M15 A;  3ZVR A;  2G3V A;  1OR3 A;  4HFK B;  1O87 A;  2EPL X;  2UUI A;  2HSQ A;  4PFP A;  3SXY A;  1RJ9 A;  5L0C A;  2PX0 A;  3FHD A;  3IQC A;  3T6G B;  1AEP A;  3DI5 A;  1U89 A;  4N6C A;  4EBB A;  3C8G A;  4DOZ A;  2XXA A;  3EGX B;  3W8H A;  3UMK A;  2MYS A;  3DD7 A;  1LVK A;  1M2V B;  4JEA A;  4PK4 A;  1A0B A;  1H7I A;  3JSZ A;  3PCV A;  1WN0 A;  3EPV A;  4O79 A;  4AX2 A;  2OJE D;  1K04 A;  1Z23 A;  2XLE A;  3CAX A;  3LES A;  3VAY A;  3DJU B;  1ZW3 A;  2YLG A;  1DOW A;  4OD4 A;  1OCZ C;  2L7A A;  2CCY A;  2L81 A;  3M4C A;  4IAR A;  4NCQ A;  3WAQ A;  1YA9 A;  1NU7 D;  3NMK A;  4YT4 A;  4G7O F;  3NRH A;  3RKO F;  3ABM C;  3LNM B;  4CJO A;  2LD6 A;  3JYH A;  2NUP A;  4YL0 A;  3SXK A;  4CS9 C;  5JUA A;  3PHF 2;  3O39 A;  3GWL A;  2IXO A;  2KC3 A;  3M79 A;  3GEE A;  4HE8 D;  2BC5 A;  4JKV A;  1OQC A;  2X51 A;  1G4W R;  2OEX A;  1WAS A;  1ZZP A;  4X0R A;  3NYM A;  1FNT c;  2PFD A;  4ANJ A;  4MQ9 F;  2R7O A;  4LLC A;  4MVQ A;  4N06 A;  2P6V A;  3QW0 A;  3EGD B;  2OCC C;  1J8M F;  2R05 A;  1J8Y F;  2L6G A;  3EH2 A;  2WZF A;  3JSE O;  2W4B A;  2NUT B;  2BE5 F;  4CSA C;  2KYH A;  1OCR C;  3AQB A;  4XWJ A;  2R7T A;  1ST6 A;  4CSA A;  3TD7 A;  3WOD F;  4OD5 A;  1MMD A;  4CIP A;  1LI7 A;  3RVY A;  3C8Z A;  4Q4Z F;  3GOD A;  3SZR A;  4XLP F;  3TJ5 A;  3V5Y A;  4U9E A;  3GEI A;  3FOP A;  2WL8 A;  3HLZ A;  3ZQY A;  4C3D A;  5BQH A;  2Q00 A;  4LDK A;  3QZC A;  3I4U A;  2J7P A;  1K05 A;  1BR2 A;  4XEF A;  1PCX A;  3HNI A;  1RKE A;  1DOV A;  3EG9 B;  1CGN A;  4FAP B;  2PP4 A;  1SYQ A;  4NY3 A;  4P9T A;  3PDM P;  4I1O B;  2FFH A;  3CSK A;  1G8X A;  2WB7 A;  3ASO C;  2IXM A;  1D1A A;  3NMI A;  2XL8 A;  2R7R A;  4CBE A;  5DS4 A;  1Q0K A;  3S90 A;  1SZI A;  5TJ5 E;  1Z63 A;  4PJJ A;  1Z6A A;  3DAG A;  1CPR A;  3G4Z A;  1O5H A;  3SP1 A;  3AGU A;  1YYJ A;  4CX9 A;  4WAB A;  3ATP A;  1FTS A;  1YJG A;  2P1A A;  1JOG A;  1JAF A;  2XL4 A;  5COG A;  1Z7Q c;  1HMD A;  3GEH A;  2A68 F;  2HMZ A;  3DE9 A;  3FMS A;  4JC7 A;  4XPW A;  3NYJ A;  4R32 A;  4GEH A;  3LNR A;  5F5F A;  3UMI A;  4E17 A;  2C04 A;  3Q7G A;  2X0C A;  1IZM A;  2M64 A;  3A9C A;  2XL6 A;  4YK5 A;  2M4E A;  2Q7R A;  3S9O A;  1LS4 A;  2XLD A;  5HSW A;  5DS5 A;  3HNK A;  3GWN A;  2XSE A;  1EA8 A;  3IPM O;  1T6U A;  3JZ0 A;  5L3Q A;  1PV3 A;  1NFO A;  3ZWI A;  3LLK A;  4Q7C A;  1NSG B;  2YWA A;  4XPY A;  1AUE A;  2F22 A;  2OEV A;  3LEO A;  3CQZ A;  1ZHX A;  2J0X A;  4U5B E;  3QVY A;  3EGD A;  2R7Q A;  2NSF A;  1OXK A;  2YL0 A;  3B71 A;  4EKW A;  1HW2 A;  2EPN A;  3EHM A;  4K7B A;  5BUO A;  2Y69 C;  5AC5 A;  3E9V A;  2JPU A;  5B1A C;  4CS8 C;  3DMD A;  3OEO A;  3ECS A;  4BPM A;  3MLG A;  4RDA A;  3NKD A;  2R7X A;  2XM4 A;  4G7H F;  4MW3 A;  5JSL A;  1M56 C;  2IM8 A;  5BQG A;  1WAT A;  4AL1 A;  3T6B A;  3B0V C;  3A11 A;  3JYY A;  3AGT A;  3U3B A;  4KI2 A;  1LS1 A;  2OU6 A;  2XS1 A;  4PAC A;  1NLX A;  4WGY A;  4ULV A;  1FAP B;  1LI5 A;  2QTV A;  3N24 A;  2HJ3 A;  1FR0 A;  3FXH A;  4GQH A;  5COF A;  5E3A A;  2LIG A;  3NMJ A;  4IAO A;  5L0I A;  2KQ9 A;  2H7B A;  2Q9C A;  5E33 A;  1KU2 A;  4I3M A;  3L0I A;  3LS1 A;  3R2P A;  2FAP B;  3MBG A;  3Q6N A;  3K33 A;  4MND A;  4P6I C;  4ULW A;  4Z9I A;  2R03 A;  1U6H A;  2LFD A;  4LLE A;  2CGE A;  3JTL O;  2A6H F;  1G4U S;  1GM5 A;  1TWH A;  3G50 A;  5B3I A;  2HKV A;  1A7E A;  1E2X A;  2H7V C;  1S05 A;  4O6Y A;  1YVI A;  2YQY A;  2XLH A;  1QZX A;  2WZL A;  4EIY A;  3L8I A;  3QTH A;  3W8I A;  1TKN A;  4DXW A;  2DGJ A;  4H54 A;  1YAU O;  3AOU A;  2LQG A;  4DJ9 A;  4N4W A;  5A6B A;  1KNY A;  2Y3G A;  4ER9 A;  2HJM A;  3S84 A;  2YL7 A;  3HKK A;  3KH2 A;  3ZTM A;  2C03 A;  4MS2 A;  2CNW D;  4OIP F;  4U5H A;  1BDJ B;  1B68 A;  1VB5 A;  4J32 B;  4YL1 A;  3JT1 A;  3ABL C;  3L8J A;  3LLI A;  1YZC A;  3EFO A;  5JP7 A;  3TQO A;  4BJ6 A;  5K0I A;  1QSP A;  1ZHY A;  2P0N A;  5JS5 A;  1MMN A;  2Q9A A;  4PJL A;  1M57 C;  2NUP B;  2IXN A;  1C02 A;  3GM2 A;  4MVR A;  4E18 A;  1VTM P;  4BEM J;  5L0J A;  1BZ4 A;  5FCL A;  2EPK X;  2W45 A;  1VMA A;  3ABK C;  4JW1 A;  4G78 A;  4AE4 B;  3IQ6 A;  3CZ6 A;  2OQM A;  4BJ1 A;  5KYY B;  2A1D D;  4D4X A;  5A69 A;  4JTD B;  4A4A A;  1JR8 A;  1MMG A;  2AWC A;  4XPX A;  2J0W A;  2J8W A;  1ZYR F;  1XZQ A;  2ICW G;  2P61 A;  4O7G A;  3WG7 C;  1QPU A;  1T9K A;  5F5H A;  2YEV A;  4ZLD A;  1QKR A;  2QUP A;  4M63 A;  4PJN A;  3U9J A;  2KJG A;  1K40 A;  4OIR F;  4KNV A;  3LS0 A;  1UG7 A;  2HUJ A;  1V55 C;  2MHR A;  1R5I D;  3K1I A;  3RVZ A;  1BR4 A;  4F4B A;  2Y3H A;  2LK4 A;  1VLS A;  1TWA A;  3MYI A;  1TFO B;  2B0H A;  4NTA A;  2NUT A;  4DBQ A;  4U5F E;  1LPE A;  2YLI A;  1VOM A;  2HFI A;  4H4K C;  2D5R B;  5A6A A;  1V54 C;  1OCC C;  1T01 A;  3IEE A;  3N0T A;  4RD9 A;  5L3V A;  3UGO A;  3B0P A;  2QE9 A;  3MYF A;  4MVS A;  4U5G A;  5A6B D;  4C7O B;  3M1C B;  4XEV A;  3QVZ A;  4EHP A;  1ZHZ A;  3LUT B;  1QVX A;  4BJ6 C;  3K7D A;  2Z15 A;  3WHN A;  3X1O A;  1D1B A;  4J30 B;  5L0F A;  1N1C A;  4JRZ A;  1WWP A;  1A7V A;  2EPO A;  2WZG A;  4U5C E;  2A69 F;  3DXJ F;  4EUK B;  2OOC A;  4JCZ A;  3RQF A;  3DM9 B;  3ZQV A;  5KYW A;  2ZXR A;  2DB4 A;  3GOR A;  1YAR O;  3KKB A;  3T6J A;  1UFB A;  3U9M A;  1HW1 A;  5DS6 A;  3C63 A;  1LE4 A;  2JD3 A;  2B0J A;  1I4Y A;  1MQV A;  5KYY A;  4LDQ A;  1TWC A;  2OJQ A;  4IWB A;  1D0Z A;  3F46 A;  3ZTZ A;  1HMO A;  5E2Q A;  4GYT A;  4MVO A;  2WVN A;  2ZXP A;  2RD9 A;  3I5Q A;  3K6B A;  2Y3B A;  1G5Z A;  4PR9 A;  1NFN A;  1MNE A;  3NKE A;  3AG3 C;  2HZ8 A;  4XEK A;  5JRA A;  3KMI A;  3T9O A;  1C17 M;  3EFO B;  3DWW A;  1Q0D A;  5L0G A;  2XM0 A;  3IHU A;  1RCP A;  1W2W A;  2CNW A;  2J9B A;  2V3C C;  5AC4 A;  1YZA A;  2EIK C;  5DLJ A;  1EQ1 A;  3VM6 A;  1EI7 A;  1ZW2 A;  3JRT A;  4CIH A;  3ZIB A;  2GDC A;  1V74 B;  2XLM A;  3NDB B;  5A6J A;  3TK0 A;  1A7D A;  2W9Y A;  2QNL A;  3C8G D;  3B9Q A;  4YT2 A;  1D0Y A;  4B6I A;  5T3T A;  5KYN A;  2H7O A;  2VB6 A;  3U5S A;  1Z5Z A;  3C62 A;  1C03 A;  3C8G B;  1VK5 A;  2XLV A;  2ZXW C;  2H8A A;  1LIH A;  2XS8 A;  3LJB A;  3MFN A;  1D1C A;  2NG1 A;  4KNW A;  2R7W A;  3UR3 C;  4MVZ A; 
#chains in the Genus database with same CATH homology
 1OW6 A;  1K05 A;  1ZZP A;  4XEF A;  4XEV A;  4XEK A;  2PBE A;  3S9O A;  4NQF A;  1QVX A;  3RQE A;  1WOL A;  3K7D A;  3JYY A;  3C8G A;  3L8I A;  3U0C A;  2L6G A;  3BRJ A;  3JZ0 A;  1PV3 A;  1WWP A;  3TUL A;  3AJM A;  2JX0 A;  1KNY A;  2YWA A;  1WTY A;  3GM1 A;  3O10 A;  1K04 A;  3RQF A;  1O3U A;  1V4A A;  4EBJ A;  1UFB A;  1K40 A;  3C8G D;  1OW7 A;  3GM2 A;  3GM3 A;  3B71 A;  2KK1 A;  3U3F A;  3L8J A;  1JOG A;  3RQG A;  2LK4 A;  3C18 A;  2L6F A;  3C8G B;  1OW8 A;  2JPU A;  5F28 E;  3MFN A;  4EBK A;  1KTM A;  2L6H A;  2HSB A;  2Q00 A;  4R32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...