4XEVA

Fusion of pyk2-fat domain with leupaxin ld1 motif, complexed with leupaxin ld4 peptide
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
155
structure length
148
Chain Sequence
NLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHGGEELDALLEELER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Fusion protein of Protein-tyrosine kinase 2-beta FAT domain
publication title Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 148
sequence length 155
chains with identical sequence D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4xevA00
3BRJA 2L6HA 4XEKA 1K05A 1WWPA 3GM1A 2LK4A 3U3FA 3GM2A 4NQFA 5F28E 3RQEA 1KTMA 2JPUA 1O3UA 2PBEA 3L8IA 3TULA 2JX0A 3L8JA 3MFNA 4XEVA 3O10A 3S9OA 1JOGA 1K04A 1KNYA 3C8GB 3JZ0A 4EBKA 1UFBA 3JYYA 1K40A 1OW6A 2L6GA 2Q00A 1WOLA 3B71A 4EBJA 3C8GD 3RQGA 2YWAA 3AJMA 3C8GA 2HSBA 3GM3A 3K7DA 4R32A 1OW8A 1QVXA 1ZZPA 1WTYA 2KK1A 3RQFA 3U0CA 3C18A 4XEFA 2L6FA 1OW7A 1V4AA 1PV3A
chains in the Genus database with same CATH superfamily
1JPNA 4D4NA 4N06A 1VMAA 2Q9BA 2BL2A 2PF4E 2BC5A 3DM9B 4M63A 4F4BA 3EHMA 2H8AA 2VCBA 2VC9A 3TJ6A 2CYDA 1VLTA 5KYYB 1UG7A 3V5ZA 2YL1A 5GPGB 5COFA 3ABMC 3FOOA 2J9BA 3HKKA 5CI8A 4YK5A 3Q6MA 3SXZA 2R7UA 2KSFA 1LIHA 3ASOC 3EG9A 3ZQYA 3FAJA 4J30B 3V5YA 3U8PA 1GQAA 3MLGA 3K7DA 2H7BA 1MMAA 2VH3A 4OD5A 4XPWA 3RQFA 3J06A 3HLZA 2XLVA 1MNEA 5T1DB 4O7GA 2J7PD 2QY9A 4KI2A 3EQLF 3LUTB 4I1MA 4ULWA 3HJCA 1YARO 3DWWA 3K1IC 1HE9A 4MS2A 3EHNA 2AWCA 4NY3A 3C7JA 3I5PA 2R05A 3L8IA 3QMKA 4YJWA 5L0DA 1A7DA 2HZ8A 4EUKB 4YT4A 2A0UA 3EH2A 2ZXRA 3K6BA 4J7TA 1MNDA 1XWJA 3ECSA 4LACB 3BEHA 1U89A 2YL3A 5E3AA 5K0IA 4EBBA 2HUJA 1RXQA 3ATPA 3SXMA 3VF0A 2R7OA 3KPHA 1ZHWA 4J32B 3M79A 5JLIA 2XLOA 4NC3A 4AK9A 4R32A 4DRJB 3M4BA 2LP4A 3NRHA 2EPKX 2FFHA 4YWQA 2EPOA 1ZW2A 2VASA 5T3WA 2R7TA 4BG0A 3ABKC 3AG2C 3ZDLA 2J7PA 3W8IA 1GS9A 4WGZA 2OJED 1WWPA 3DD7A 4A2NB 1SZIA 1I4YA 3POVA 4PK4A 3FAPB 3OWTA 1FR0A 2HJ3A 3RW0A 2A1DD 2HJMA 3SYNA 1T9KA 2Y3GA 3AGTA 3O6XA 1JRAA 1OR3A 3RH3A 3TOMA 5COGA 2OEXA 3AOUA 2Q9AA 2AWYA 1C02A 2RSEB 3KL4A 2FGYA 3SZRA 1IW7F 2L6GA 3ZG1A 5BQHA 1HY5A 4OIQF 5HSWA 3HNLA 3AG1C 1F1MA 4NCQA 3UR3C 5L0JA 1OR2A 4DRIB 3QZCA 3S84A 2GWWA 4P6IC 3WHNA 3M15A 4JCHA 1OXKA 4FX5A 3JTLO 3S29A 3MBGA 1DOWA 2G3KA 5B1AC 3NDBB 3WG7C 4XEKA 1BR1A 1Q0KA 1ZVZA 1ZHTA 2J45A 2YLIA 3RIPA 1JPJA 2KC3A 3QW1A 1S05A 4D4XA 5JUAA 1CPRA 1OCCC 2OU6A 2ZD9A 3UNGC 2XXAA 2NUTB 3W2VA 2J9WA 3Q7GA 1WN0A 3EPVA 1KNYA 3TK0A 1NFOA 4JZAA 4CJGA 1UFBA 2EILC 1MMDA 1MMNA 2X0CA 4CIHA 3UMKA 5L3QA 1E84A 1OKKD 1ORJA 2V3CC 3DAGA 5KYUB 1TWAA 2XL4A 5T3TA 2R02A 4JVSA 1QVXA 1HMOA 1JR8A 1BR4A 2A6EF 2GDCA 2IXMA 1LPEA 2QE9A 4PR9A 3DKAA 2EINC 4YL0A 2Y39A 1OCOC 1QLEC 4G78A 4CJOA 1OQCA 2L6HA 2YHSA 2CNWD 3AQCA 3GM1A 1D0ZA 4I3MA 4NQFA 4MW3A 5L0FA 1KTMA 2OG2A 2YLGA 4AX2A 4FAPB 1HW1A 2B0HA 2M4EA 2OKUA 2MWQA 3Q7LA 2CW0F 5DS6A 1U0BB 2YZSA 3OA1A 3IQ5A 3NYJA 2PX3A 2XS8A 1C03A 2R7XA 3C62A 3IPMO 4I44A 1JAFA 1HMDA 1NLXA 2L81A 4U5DE 5HV9A 3QVYA 3S28A 1D1CA 5KYYA 2DGJA 2IYLD 3G4ZA 2R7QA 3LEOA 2NPUA 2HMQA 2A69F 2HMZA 2W9YA 2YKZA 4KC9A 5DLJA 5KYNA 3HNJA 4O6MA 4GQHA 5F28E 3C18A 3MYIA 4UDVA 4Z9JA 4FESA 5IY5C 3KYIA 4EHPA 3DJNB 2DYRC 4L6RA 5CI9A 3ABLC 3V7OA 1PD1A 3FMSA 2P1AA 1NG1A 2OEVA 1H7IA 3U9JA 3ZVRA 1WASA 4EWCA 5E3CA 3S27A 3DXJF 5EHHA 3U8VA 1TWHA 2F22A 2MHRA 2QTVA 3MFNA 4ER9A 3UMIA 5D92A 1V55C 4CDYA 4CDAA 3MX3A 3S9OA 2Y3BA 4XPYA 3JRTA 1D0YA 1T01A 2ASRA 3PCVA 4KNVA 1L7CA 1OXBA 5E33A 4A4AA 2WVOA 4Q7CA 4Q4ZF 4HEAJ 4JKVA 4FWVA 1T6IA 1K40A 4N4WA 3H2VA 4PJMA 4BJ5A 4CSAA 3LJBA 3DE8A 3K66A 3VAYA 3N24A 2UUIA 3VM6A 3AG4C 3ITFA 2H7VC 2XL6A 2YL0A 5JRAA 2L6FA 4MVOA 2VCAA 3QVZA 4AL0A 4DJ9A 3B71A 2D4UA 3B29A 1ORYA 3NYMA 3SXYA 3C63A 1LKXA 2QUPA 2YLDA 1B68A 1HE1A 1ZHZA 2OQMA 2Q9CA 2ZXOA 3HTKC 1SF8A 3JSEO 1G8XA 1ZHYA 3I5QA 3Q6NA 1IZMA 3U9MA 4N6HA 4WABA 1WATA 5E2QA 3RQGA 2EIJC 3DMDA 3CSKA 3W8HA 2J9UA 1N1CA 4U9DA 5L0IA 4IJJA 3AGUA 1M2VA 1LM3B 2GAQA 3CZ6A 1TQGA 4G7ZF 3T6JA 4XLPF 2G3VA 1W2WA 3S0XA 3C8ZA 3LS0A 1WTYA 4CBEA 1NU7D 2PX0A 3U3BA 3U0CA 2FAPB 3GWLA 2Q7RA 3DI5A 1FAPB 3EFOB 4LDQA 4MVZA 4DXWA 3QW0A 3T6BA 5BQGA 2GA0A 4KBLA 1RMVA 4LDRA 2HV7A 3TQOA 3FDQA 2JX0A 2CGEA 3B0PA 4JURI 5D91A 5BUOA 4PACA 1H6GA 5FCLA 1KU2A 1JMWA 3O10A 5JS5A 4E17A 3JCUQ 3DJUB 1VTMP 4YN0B 1TKNA 4BJ6A 3ZTMA 1YA9A 4RBNA 1M56C 2NUTA 4MVSA 2J0WA 4E7ZA 2KW3C 2L7AA 3LNMB 1A7EA 1WOLA 3GEHA 3A11A 4LDKA 4U9EA 3UMHA 3ZSUA 4IAQA 1H9GA 1O87A 4CS9A 4E0HA 1MQVA 4C3DA 2R7WA 3FHDA 4HE8D 1T6QA 4MVUA 2EIKC 4MVRA 1GGQA 1YVIA 2J8WA 2G62A 2I8BA 2NSFA 1LS1A 3M4CA 4C7OB 4B6IA 2R25A 5KYWB 2LK4A 2WL8A 3U3FA 4JRZA 1Q0FA 1PCXA 3F47A 3ZTZA 4IARA 4NTAA 1SYQA 2X51A 2XM4A 5KYXA 5AGFA 1A41A 1RKCA 1G4WR 1YDIA 5AC4A 2DYSC 3O39A 3X1OA 1SR2A 2WZGA 1S7ZA 3KH2A 4P9FA 2TMVP 2W45A 2Z15A 1Q0GA 4Z9IA 2ETSA 3LEVA 3C8GD 2KGOA 1E2XA 1DOVA 2WZLA 2Q3TA 2XLMA 1QKRA 1Q0DA 2I15A 2YQYA 3L0IA 1ZZPA 2VB6A 4Q5SF 2H7OA 2OOCA 3NMIA 3AQBA 4G7OF 5JVEA 3WODF 2EPNA 2OCCC 3FVYA 1YYXA 4JE9A 4OD4A 4CIPA 1CGME 4MVQA 3TOLA 3IEEA 4BJ1A 1RCPA 5TJ5E 4C3BA 2HSQA 3QTHA 5B1BC 2XM0A 4O6YA 1TWGA 2J9VA 3GM2A 4E0IA 5JT4A 5DS5A 2IBFA 2IOQA 5JP7A 5F5HA 3LAYA 1TFKB 4JEAA 1YAUO 1YYJA 4EKWA 1H9TA 1T5OA 1D1BA 2YVKA 3K1HA 4XLNF 4MQ9F 4BJ5C 1T6UA 3I4UA 5A6BD 4CSAC 2ZPAA 3G50A 2O9XA 1A0BA 2AU5A 2XLDA 1D1AA 1NZEA 1VYKA 2V26A 3L1MA 3T4RA 2E87A 2Q00A 1XZPA 2AP3A 4O6NA 5FZTA 4ZLDA 4QDLA 1AEPA 4U5HA 4PFOA 3GANA 1OKKA 3EGDB 1OCZC 4MTFA 3LESA 3WAQA 2HSBA 2M64A 3IHUA 2GFHA 3R2PA 1BDJB 2BE5F 4XPXA 1M6TA 4G0HA 3PDMP 2WZFA 4MTOA 2Y3DA 4BEJA 2KJGA 3G4XA 3JYHA 1TFOB 1VB5A 4RD9A 3T9OA 4PJNA 1PV3A 4YT8A 5AC5A 1EQ1A 4PJJA 3IQTA 2R7VA 4MTGA 1LE4A 3EGXB 2CNWA 4GEHA 1AUEA 4CS9C 2HS5A 1O3UA 2RD9A 3TULA 4NTFA 3RYLA 3RKOF 1LI7A 4U5BE 2P0NA 256BA 1E86A 3KKBA 4CS8A 4AE4A 3HNKA 3C8GB 3NMJA 3RVZA 4HFKB 5COMA 4BEMJ 3JZ0A 4E7SA 2LQGA 4XQ1A 2UUHA 2W4MA 1Z23A 2B0JA 2XLWA 2VCCA 2YL7A 4G7HF 3KYJA 4OIPF 3GEIA 5EGYA 1I5NA 1Z7Qc 1M2OA 3IQ6A 2LFFA 3LNRA 4CX9A 1V4AA 4AE4B 3PHF2 1FTSA 3SP1A 1CGOA 4LLEA 2EIMC 4IWBA 3GORA 3O55A 1Z63A 4JTAB 1G4US 3B9QA 3H65A 1NBBA 3K33A 4H4KC 1APCA 1TR2A 5DVWA 3EFOA 3T6GB 4BJ6C 5DQTA 3W2WA 3GWNA 1LS4A 1VYIA 3E70C 2HV6A 3V5XA 2OJQA 2EPLX 5CIVA 4E18A 5L3VA 1FFHA 1JOGA 1G5ZA 3DZAA 4PJLA 1Z6AA 3DM5A 3ZC4A 1U6HA 3IQCA 1VLSA 2NUPB 5F5FA 1ZW3A 1QPUA 1RKEB 2QNLA 2LCHA 2XRHA 5L0CA 4I1OB 1YA7O 1RJ9B 3EJNA 2WB7A 4C3EA 2A68F 1HW2A 4GYTA 2R7SA 3JSZA 4W8KA 2WVNA 1E83A 3E9VA 3CAXA 4JTCB 2LIGA 1OW7A 1C17M 1LVKA 1VOMA 3F46A 2JD3A 2IXNA 1V54C 4LLCA 4XWJA 4YT5A 5A6JA 1GM5A 3RQEA 2C04A 1YLMA 2IM8A 4ONSA 3X2QC 3EZIA 2KNHA 3KMIA 2A0BA 4IGGA 1EI7A 4O79A 1AVOB 2WVQA 4XEVA 2L9JA 3JT1A 3LS1A 3FOPA 2LFDA 4DOZA 5KYWA 5A6KA 1NSGB 1K04A 3EG9B 3U2LA 1QSPA 1TWCA 2EPMX 1ORSC 3M1CB 3DE9A 5BQIA 2Y3HA 4RDAA 4Z9HA 1EA8A 4P9TA 4DVZA 1BBHA 4JW1A 4KNWA 4MNDA 4LERA 1L3PA 1NFNA 5DS4A 3W4YA 2NSGA 2KYHA 1BZ4A 2IXOA 1PD0A 3CEXA 4EIYA 2ICWG 2D5RB 1I4ZA 1ZYRF 4JJGA 3NKDA 2CDQA 4YL3A 1VK5A 4YT2A 4K0DA 3RFYA 5A6AA 5KYUA 4OINF 3BRJA 1ZU4A 3U5SA 2P6VA 3A9CA 3LLIA 4U5EE 4DRHB 5DQZA 1D0XA 2R9RB 4C7OA 4WJ0A 2ZXWC 2XLHA 1M2VB 2IXPA 4JC7A 1J8MF 4X0RA 5L0HA 4DVYP 3TJ5A 2R7RA 3K1IA 2HKVA 4K1OA 3CQZA 3OEOA 4N6CA 3B0VC 1LI5A 3JYYA 4BJTA 1OW6A 1V74B 4WGYA 1OCRC 5A69A 3EZHA 1NU9C 2C03A 4MVMA 4CS7A 1LE2A 2PFDA 4XTKA 3FXHA 5EK0A 1OW8A 4OIOF 1Q0MA 1ZU5A 3U2MA 1Y4CA 1SMYF 3RVYA 1FFTC 4H54A 3EGDA 2YEVA 4IRUA 4U5FE 1M57C 1Z5ZA 4PFPA 2P61A 1QQ3A 4CS8C 3HNIA 4W8PA 2AVKA 2XSEA 1Y6DA 1J8YF 3UGPA 1YJGA 2XLEA 5B3IA 2HFIA 3NKEA 3SNHA 1FMWA 4J7YA 1R4TA 2PP4A 3TD7A 1YZAA 3EGXA 3H2UA 4DBQA 3RF3A 3VRCA 2P7VA 1ZHXA 4IAOA 3ZWIA 2A6HF 4EBKA 4JCZA 2KQ9A 4CDVA 3AG3C 5JSLA 1WGWA 2XS1A 4AL1A 5B3SC 2LSEA 3US6A 3S90A 2LD6A 1MMGA 2Y69C 3C8GA 1R5ID 2XL8A 2R03A 2MYSA 3MYFA 3NG1A 3NYLA 1QZXA 2KK1A 4XEFA 2CCYA 2QLAA 3PMRA 4ULVA 3JRMO 4K7BA 3ZQVA 5KYXB 1YZCA 1BR2A 4ZLCA 2Q4FA 1FMVA 2XXAB 1K05A 3N2ZB 2J0XA 1CGNA 3NMKA 3ZIBA 3EH1A 4DBRA 4QI0A 2YRFA 4ANJA 1FNTc 2JPUA 1XZQA 2PBEA 3DAFA 3SEOA 3L8JA 4JTDB 2ZXPA 4MW8A 4JEBA 4YL1A 3SXKA 4BPMA 4HFFB 4IB4A 3UGOA 1A7VA 1ST6A 2PNOA 3N0TA 1Z3IX 2NG1A 4OIRF 5A6BA 4NTBA 1CPQA 1EKYA 3LLKA 5L0GA 3ASNC 3L34A 1E85A 1O5HA 3GODA 4U5GA 4EBJA 2J46A 3GEEA 4QI2A 2YWAA 3AJMA 3GM3A 2NUPA 4U5CE 2W4BA 1RKEA 3B0UX 1RJ9A 4JIOA 3VYWA 2DB4A 3R7CA 2DI3A 4JJFA
chains in the Genus database with same CATH topology
3BRJA 2L6HA 4XEKA 1K05A 1WWPA 3GM1A 2LK4A 3U3FA 3GM2A 4NQFA 5F28E 3RQEA 1KTMA 2JPUA 1O3UA 2PBEA 3L8IA 3TULA 2JX0A 3L8JA 3MFNA 4XEVA 3O10A 3S9OA 1JOGA 1K04A 1KNYA 3C8GB 3JZ0A 4EBKA 1UFBA 3JYYA 1K40A 1OW6A 2L6GA 2Q00A 1WOLA 3B71A 4EBJA 3C8GD 3RQGA 2YWAA 3AJMA 3C8GA 2HSBA 3GM3A 3K7DA 4R32A 1OW8A 1QVXA 1ZZPA 1WTYA 2KK1A 3RQFA 3U0CA 3C18A 4XEFA 2L6FA 1OW7A 1V4AA 1PV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BRJ A;  2L6H A;  4XEK A;  1K05 A;  1WWP A;  3GM1 A;  2LK4 A;  3U3F A;  3GM2 A;  4NQF A;  5F28 E;  3RQE A;  1KTM A;  2JPU A;  1O3U A;  2PBE A;  3L8I A;  3TUL A;  2JX0 A;  3L8J A;  3MFN A;  4XEV A;  3O10 A;  3S9O A;  1JOG A;  1K04 A;  1KNY A;  3C8G B;  3JZ0 A;  4EBK A;  1UFB A;  3JYY A;  1K40 A;  1OW6 A;  2L6G A;  2Q00 A;  1WOL A;  3B71 A;  4EBJ A;  3C8G D;  3RQG A;  2YWA A;  3AJM A;  3C8G A;  2HSB A;  3GM3 A;  3K7D A;  4R32 A;  1OW8 A;  1QVX A;  1ZZP A;  1WTY A;  2KK1 A;  3RQF A;  3U0C A;  3C18 A;  4XEF A;  2L6F A;  1OW7 A;  1V4A A;  1PV3 A; 
#chains in the Genus database with same CATH topology
 1JPN A;  4D4N A;  4N06 A;  1VMA A;  2Q9B A;  2BL2 A;  2PF4 E;  2BC5 A;  3DM9 B;  4M63 A;  4F4B A;  3EHM A;  2H8A A;  2VCB A;  2VC9 A;  3TJ6 A;  2CYD A;  1VLT A;  5KYY B;  1UG7 A;  3V5Z A;  2YL1 A;  5GPG B;  5COF A;  3ABM C;  3FOO A;  2J9B A;  3HKK A;  5CI8 A;  4YK5 A;  3Q6M A;  3SXZ A;  2R7U A;  2KSF A;  1LIH A;  3ASO C;  3EG9 A;  3ZQY A;  3FAJ A;  4J30 B;  3V5Y A;  3U8P A;  1GQA A;  3MLG A;  3K7D A;  2H7B A;  1MMA A;  2VH3 A;  4OD5 A;  4XPW A;  3RQF A;  3J06 A;  3HLZ A;  2XLV A;  1MNE A;  5T1D B;  4O7G A;  2J7P D;  2QY9 A;  4KI2 A;  3EQL F;  3LUT B;  4I1M A;  4ULW A;  3HJC A;  1YAR O;  3DWW A;  3K1I C;  1HE9 A;  4MS2 A;  3EHN A;  2AWC A;  4NY3 A;  3C7J A;  3I5P A;  2R05 A;  3L8I A;  3QMK A;  4YJW A;  5L0D A;  1A7D A;  2HZ8 A;  4EUK B;  4YT4 A;  2A0U A;  3EH2 A;  2ZXR A;  3K6B A;  4J7T A;  1MND A;  1XWJ A;  3ECS A;  4LAC B;  3BEH A;  1U89 A;  2YL3 A;  5E3A A;  5K0I A;  4EBB A;  2HUJ A;  1RXQ A;  3ATP A;  3SXM A;  3VF0 A;  2R7O A;  3KPH A;  1ZHW A;  4J32 B;  3M79 A;  5JLI A;  2XLO A;  4NC3 A;  4AK9 A;  4R32 A;  4DRJ B;  3M4B A;  2LP4 A;  3NRH A;  2EPK X;  2FFH A;  4YWQ A;  2EPO A;  1ZW2 A;  2VAS A;  5T3W A;  2R7T A;  4BG0 A;  3ABK C;  3AG2 C;  3ZDL A;  2J7P A;  3W8I A;  1GS9 A;  4WGZ A;  2OJE D;  1WWP A;  3DD7 A;  4A2N B;  1SZI A;  1I4Y A;  3POV A;  4PK4 A;  3FAP B;  3OWT A;  1FR0 A;  2HJ3 A;  3RW0 A;  2A1D D;  2HJM A;  3SYN A;  1T9K A;  2Y3G A;  3AGT A;  3O6X A;  1JRA A;  1OR3 A;  3RH3 A;  3TOM A;  5COG A;  2OEX A;  3AOU A;  2Q9A A;  2AWY A;  1C02 A;  2RSE B;  3KL4 A;  2FGY A;  3SZR A;  1IW7 F;  2L6G A;  3ZG1 A;  5BQH A;  1HY5 A;  4OIQ F;  5HSW A;  3HNL A;  3AG1 C;  1F1M A;  4NCQ A;  3UR3 C;  5L0J A;  1OR2 A;  4DRI B;  3QZC A;  3S84 A;  2GWW A;  4P6I C;  3WHN A;  3M15 A;  4JCH A;  1OXK A;  4FX5 A;  3JTL O;  3S29 A;  3MBG A;  1DOW A;  2G3K A;  5B1A C;  3NDB B;  3WG7 C;  4XEK A;  1BR1 A;  1Q0K A;  1ZVZ A;  1ZHT A;  2J45 A;  2YLI A;  3RIP A;  1JPJ A;  2KC3 A;  3QW1 A;  1S05 A;  4D4X A;  5JUA A;  1CPR A;  1OCC C;  2OU6 A;  2ZD9 A;  3UNG C;  2XXA A;  2NUT B;  3W2V A;  2J9W A;  3Q7G A;  1WN0 A;  3EPV A;  1KNY A;  3TK0 A;  1NFO A;  4JZA A;  4CJG A;  1UFB A;  2EIL C;  1MMD A;  1MMN A;  2X0C A;  4CIH A;  3UMK A;  5L3Q A;  1E84 A;  1OKK D;  1ORJ A;  2V3C C;  3DAG A;  5KYU B;  1TWA A;  2XL4 A;  5T3T A;  2R02 A;  4JVS A;  1QVX A;  1HMO A;  1JR8 A;  1BR4 A;  2A6E F;  2GDC A;  2IXM A;  1LPE A;  2QE9 A;  4PR9 A;  3DKA A;  2EIN C;  4YL0 A;  2Y39 A;  1OCO C;  1QLE C;  4G78 A;  4CJO A;  1OQC A;  2L6H A;  2YHS A;  2CNW D;  3AQC A;  3GM1 A;  1D0Z A;  4I3M A;  4NQF A;  4MW3 A;  5L0F A;  1KTM A;  2OG2 A;  2YLG A;  4AX2 A;  4FAP B;  1HW1 A;  2B0H A;  2M4E A;  2OKU A;  2MWQ A;  3Q7L A;  2CW0 F;  5DS6 A;  1U0B B;  2YZS A;  3OA1 A;  3IQ5 A;  3NYJ A;  2PX3 A;  2XS8 A;  1C03 A;  2R7X A;  3C62 A;  3IPM O;  4I44 A;  1JAF A;  1HMD A;  1NLX A;  2L81 A;  4U5D E;  5HV9 A;  3QVY A;  3S28 A;  1D1C A;  5KYY A;  2DGJ A;  2IYL D;  3G4Z A;  2R7Q A;  3LEO A;  2NPU A;  2HMQ A;  2A69 F;  2HMZ A;  2W9Y A;  2YKZ A;  4KC9 A;  5DLJ A;  5KYN A;  3HNJ A;  4O6M A;  4GQH A;  5F28 E;  3C18 A;  3MYI A;  4UDV A;  4Z9J A;  4FES A;  5IY5 C;  3KYI A;  4EHP A;  3DJN B;  2DYR C;  4L6R A;  5CI9 A;  3ABL C;  3V7O A;  1PD1 A;  3FMS A;  2P1A A;  1NG1 A;  2OEV A;  1H7I A;  3U9J A;  3ZVR A;  1WAS A;  4EWC A;  5E3C A;  3S27 A;  3DXJ F;  5EHH A;  3U8V A;  1TWH A;  2F22 A;  2MHR A;  2QTV A;  3MFN A;  4ER9 A;  3UMI A;  5D92 A;  1V55 C;  4CDY A;  4CDA A;  3MX3 A;  3S9O A;  2Y3B A;  4XPY A;  3JRT A;  1D0Y A;  1T01 A;  2ASR A;  3PCV A;  4KNV A;  1L7C A;  1OXB A;  5E33 A;  4A4A A;  2WVO A;  4Q7C A;  4Q4Z F;  4HEA J;  4JKV A;  4FWV A;  1T6I A;  1K40 A;  4N4W A;  3H2V A;  4PJM A;  4BJ5 A;  4CSA A;  3LJB A;  3DE8 A;  3K66 A;  3VAY A;  3N24 A;  2UUI A;  3VM6 A;  3AG4 C;  3ITF A;  2H7V C;  2XL6 A;  2YL0 A;  5JRA A;  2L6F A;  4MVO A;  2VCA A;  3QVZ A;  4AL0 A;  4DJ9 A;  3B71 A;  2D4U A;  3B29 A;  1ORY A;  3NYM A;  3SXY A;  3C63 A;  1LKX A;  2QUP A;  2YLD A;  1B68 A;  1HE1 A;  1ZHZ A;  2OQM A;  2Q9C A;  2ZXO A;  3HTK C;  1SF8 A;  3JSE O;  1G8X A;  1ZHY A;  3I5Q A;  3Q6N A;  1IZM A;  3U9M A;  4N6H A;  4WAB A;  1WAT A;  5E2Q A;  3RQG A;  2EIJ C;  3DMD A;  3CSK A;  3W8H A;  2J9U A;  1N1C A;  4U9D A;  5L0I A;  4IJJ A;  3AGU A;  1M2V A;  1LM3 B;  2GAQ A;  3CZ6 A;  1TQG A;  4G7Z F;  3T6J A;  4XLP F;  2G3V A;  1W2W A;  3S0X A;  3C8Z A;  3LS0 A;  1WTY A;  4CBE A;  1NU7 D;  2PX0 A;  3U3B A;  3U0C A;  2FAP B;  3GWL A;  2Q7R A;  3DI5 A;  1FAP B;  3EFO B;  4LDQ A;  4MVZ A;  4DXW A;  3QW0 A;  3T6B A;  5BQG A;  2GA0 A;  4KBL A;  1RMV A;  4LDR A;  2HV7 A;  3TQO A;  3FDQ A;  2JX0 A;  2CGE A;  3B0P A;  4JUR I;  5D91 A;  5BUO A;  4PAC A;  1H6G A;  5FCL A;  1KU2 A;  1JMW A;  3O10 A;  5JS5 A;  4E17 A;  3JCU Q;  3DJU B;  1VTM P;  4YN0 B;  1TKN A;  4BJ6 A;  3ZTM A;  1YA9 A;  4RBN A;  1M56 C;  2NUT A;  4MVS A;  2J0W A;  4E7Z A;  2KW3 C;  2L7A A;  3LNM B;  1A7E A;  1WOL A;  3GEH A;  3A11 A;  4LDK A;  4U9E A;  3UMH A;  3ZSU A;  4IAQ A;  1H9G A;  1O87 A;  4CS9 A;  4E0H A;  1MQV A;  4C3D A;  2R7W A;  3FHD A;  4HE8 D;  1T6Q A;  4MVU A;  2EIK C;  4MVR A;  1GGQ A;  1YVI A;  2J8W A;  2G62 A;  2I8B A;  2NSF A;  1LS1 A;  3M4C A;  4C7O B;  4B6I A;  2R25 A;  5KYW B;  2LK4 A;  2WL8 A;  3U3F A;  4JRZ A;  1Q0F A;  1PCX A;  3F47 A;  3ZTZ A;  4IAR A;  4NTA A;  1SYQ A;  2X51 A;  2XM4 A;  5KYX A;  5AGF A;  1A41 A;  1RKC A;  1G4W R;  1YDI A;  5AC4 A;  2DYS C;  3O39 A;  3X1O A;  1SR2 A;  2WZG A;  1S7Z A;  3KH2 A;  4P9F A;  2TMV P;  2W45 A;  2Z15 A;  1Q0G A;  4Z9I A;  2ETS A;  3LEV A;  3C8G D;  2KGO A;  1E2X A;  1DOV A;  2WZL A;  2Q3T A;  2XLM A;  1QKR A;  1Q0D A;  2I15 A;  2YQY A;  3L0I A;  1ZZP A;  2VB6 A;  4Q5S F;  2H7O A;  2OOC A;  3NMI A;  3AQB A;  4G7O F;  5JVE A;  3WOD F;  2EPN A;  2OCC C;  3FVY A;  1YYX A;  4JE9 A;  4OD4 A;  4CIP A;  1CGM E;  4MVQ A;  3TOL A;  3IEE A;  4BJ1 A;  1RCP A;  5TJ5 E;  4C3B A;  2HSQ A;  3QTH A;  5B1B C;  2XM0 A;  4O6Y A;  1TWG A;  2J9V A;  3GM2 A;  4E0I A;  5JT4 A;  5DS5 A;  2IBF A;  2IOQ A;  5JP7 A;  5F5H A;  3LAY A;  1TFK B;  4JEA A;  1YAU O;  1YYJ A;  4EKW A;  1H9T A;  1T5O A;  1D1B A;  2YVK A;  3K1H A;  4XLN F;  4MQ9 F;  4BJ5 C;  1T6U A;  3I4U A;  5A6B D;  4CSA C;  2ZPA A;  3G50 A;  2O9X A;  1A0B A;  2AU5 A;  2XLD A;  1D1A A;  1NZE A;  1VYK A;  2V26 A;  3L1M A;  3T4R A;  2E87 A;  2Q00 A;  1XZP A;  2AP3 A;  4O6N A;  5FZT A;  4ZLD A;  4QDL A;  1AEP A;  4U5H A;  4PFO A;  3GAN A;  1OKK A;  3EGD B;  1OCZ C;  4MTF A;  3LES A;  3WAQ A;  2HSB A;  2M64 A;  3IHU A;  2GFH A;  3R2P A;  1BDJ B;  2BE5 F;  4XPX A;  1M6T A;  4G0H A;  3PDM P;  2WZF A;  4MTO A;  2Y3D A;  4BEJ A;  2KJG A;  3G4X A;  3JYH A;  1TFO B;  1VB5 A;  4RD9 A;  3T9O A;  4PJN A;  1PV3 A;  4YT8 A;  5AC5 A;  1EQ1 A;  4PJJ A;  3IQT A;  2R7V A;  4MTG A;  1LE4 A;  3EGX B;  2CNW A;  4GEH A;  1AUE A;  4CS9 C;  2HS5 A;  1O3U A;  2RD9 A;  3TUL A;  4NTF A;  3RYL A;  3RKO F;  1LI7 A;  4U5B E;  2P0N A;  256B A;  1E86 A;  3KKB A;  4CS8 A;  4AE4 A;  3HNK A;  3C8G B;  3NMJ A;  3RVZ A;  4HFK B;  5COM A;  4BEM J;  3JZ0 A;  4E7S A;  2LQG A;  4XQ1 A;  2UUH A;  2W4M A;  1Z23 A;  2B0J A;  2XLW A;  2VCC A;  2YL7 A;  4G7H F;  3KYJ A;  4OIP F;  3GEI A;  5EGY A;  1I5N A;  1Z7Q c;  1M2O A;  3IQ6 A;  2LFF A;  3LNR A;  4CX9 A;  1V4A A;  4AE4 B;  3PHF 2;  1FTS A;  3SP1 A;  1CGO A;  4LLE A;  2EIM C;  4IWB A;  3GOR A;  3O55 A;  1Z63 A;  4JTA B;  1G4U S;  3B9Q A;  3H65 A;  1NBB A;  3K33 A;  4H4K C;  1APC A;  1TR2 A;  5DVW A;  3EFO A;  3T6G B;  4BJ6 C;  5DQT A;  3W2W A;  3GWN A;  1LS4 A;  1VYI A;  3E70 C;  2HV6 A;  3V5X A;  2OJQ A;  2EPL X;  5CIV A;  4E18 A;  5L3V A;  1FFH A;  1JOG A;  1G5Z A;  3DZA A;  4PJL A;  1Z6A A;  3DM5 A;  3ZC4 A;  1U6H A;  3IQC A;  1VLS A;  2NUP B;  5F5F A;  1ZW3 A;  1QPU A;  1RKE B;  2QNL A;  2LCH A;  2XRH A;  5L0C A;  4I1O B;  1YA7 O;  1RJ9 B;  3EJN A;  2WB7 A;  4C3E A;  2A68 F;  1HW2 A;  4GYT A;  2R7S A;  3JSZ A;  4W8K A;  2WVN A;  1E83 A;  3E9V A;  3CAX A;  4JTC B;  2LIG A;  1OW7 A;  1C17 M;  1LVK A;  1VOM A;  3F46 A;  2JD3 A;  2IXN A;  1V54 C;  4LLC A;  4XWJ A;  4YT5 A;  5A6J A;  1GM5 A;  3RQE A;  2C04 A;  1YLM A;  2IM8 A;  4ONS A;  3X2Q C;  3EZI A;  2KNH A;  3KMI A;  2A0B A;  4IGG A;  1EI7 A;  4O79 A;  1AVO B;  2WVQ A;  4XEV A;  2L9J A;  3JT1 A;  3LS1 A;  3FOP A;  2LFD A;  4DOZ A;  5KYW A;  5A6K A;  1NSG B;  1K04 A;  3EG9 B;  3U2L A;  1QSP A;  1TWC A;  2EPM X;  1ORS C;  3M1C B;  3DE9 A;  5BQI A;  2Y3H A;  4RDA A;  4Z9H A;  1EA8 A;  4P9T A;  4DVZ A;  1BBH A;  4JW1 A;  4KNW A;  4MND A;  4LER A;  1L3P A;  1NFN A;  5DS4 A;  3W4Y A;  2NSG A;  2KYH A;  1BZ4 A;  2IXO A;  1PD0 A;  3CEX A;  4EIY A;  2ICW G;  2D5R B;  1I4Z A;  1ZYR F;  4JJG A;  3NKD A;  2CDQ A;  4YL3 A;  1VK5 A;  4YT2 A;  4K0D A;  3RFY A;  5A6A A;  5KYU A;  4OIN F;  3BRJ A;  1ZU4 A;  3U5S A;  2P6V A;  3A9C A;  3LLI A;  4U5E E;  4DRH B;  5DQZ A;  1D0X A;  2R9R B;  4C7O A;  4WJ0 A;  2ZXW C;  2XLH A;  1M2V B;  2IXP A;  4JC7 A;  1J8M F;  4X0R A;  5L0H A;  4DVY P;  3TJ5 A;  2R7R A;  3K1I A;  2HKV A;  4K1O A;  3CQZ A;  3OEO A;  4N6C A;  3B0V C;  1LI5 A;  3JYY A;  4BJT A;  1OW6 A;  1V74 B;  4WGY A;  1OCR C;  5A69 A;  3EZH A;  1NU9 C;  2C03 A;  4MVM A;  4CS7 A;  1LE2 A;  2PFD A;  4XTK A;  3FXH A;  5EK0 A;  1OW8 A;  4OIO F;  1Q0M A;  1ZU5 A;  3U2M A;  1Y4C A;  1SMY F;  3RVY A;  1FFT C;  4H54 A;  3EGD A;  2YEV A;  4IRU A;  4U5F E;  1M57 C;  1Z5Z A;  4PFP A;  2P61 A;  1QQ3 A;  4CS8 C;  3HNI A;  4W8P A;  2AVK A;  2XSE A;  1Y6D A;  1J8Y F;  3UGP A;  1YJG A;  2XLE A;  5B3I A;  2HFI A;  3NKE A;  3SNH A;  1FMW A;  4J7Y A;  1R4T A;  2PP4 A;  3TD7 A;  1YZA A;  3EGX A;  3H2U A;  4DBQ A;  3RF3 A;  3VRC A;  2P7V A;  1ZHX A;  4IAO A;  3ZWI A;  2A6H F;  4EBK A;  4JCZ A;  2KQ9 A;  4CDV A;  3AG3 C;  5JSL A;  1WGW A;  2XS1 A;  4AL1 A;  5B3S C;  2LSE A;  3US6 A;  3S90 A;  2LD6 A;  1MMG A;  2Y69 C;  3C8G A;  1R5I D;  2XL8 A;  2R03 A;  2MYS A;  3MYF A;  3NG1 A;  3NYL A;  1QZX A;  2KK1 A;  4XEF A;  2CCY A;  2QLA A;  3PMR A;  4ULV A;  3JRM O;  4K7B A;  3ZQV A;  5KYX B;  1YZC A;  1BR2 A;  4ZLC A;  2Q4F A;  1FMV A;  2XXA B;  1K05 A;  3N2Z B;  2J0X A;  1CGN A;  3NMK A;  3ZIB A;  3EH1 A;  4DBR A;  4QI0 A;  2YRF A;  4ANJ A;  1FNT c;  2JPU A;  1XZQ A;  2PBE A;  3DAF A;  3SEO A;  3L8J A;  4JTD B;  2ZXP A;  4MW8 A;  4JEB A;  4YL1 A;  3SXK A;  4BPM A;  4HFF B;  4IB4 A;  3UGO A;  1A7V A;  1ST6 A;  2PNO A;  3N0T A;  1Z3I X;  2NG1 A;  4OIR F;  5A6B A;  4NTB A;  1CPQ A;  1EKY A;  3LLK A;  5L0G A;  3ASN C;  3L34 A;  1E85 A;  1O5H A;  3GOD A;  4U5G A;  4EBJ A;  2J46 A;  3GEE A;  4QI2 A;  2YWA A;  3AJM A;  3GM3 A;  2NUP A;  4U5C E;  2W4B A;  1RKE A;  3B0U X;  1RJ9 A;  4JIO A;  3VYW A;  2DB4 A;  3R7C A;  2DI3 A;  4JJF A; 
#chains in the Genus database with same CATH homology
 3BRJ A;  2L6H A;  4XEK A;  1K05 A;  1WWP A;  3GM1 A;  2LK4 A;  3U3F A;  3GM2 A;  4NQF A;  5F28 E;  3RQE A;  1KTM A;  2JPU A;  1O3U A;  2PBE A;  3L8I A;  3TUL A;  2JX0 A;  3L8J A;  3MFN A;  4XEV A;  3O10 A;  3S9O A;  1JOG A;  1K04 A;  1KNY A;  3C8G B;  3JZ0 A;  4EBK A;  1UFB A;  3JYY A;  1K40 A;  1OW6 A;  2L6G A;  2Q00 A;  1WOL A;  3B71 A;  4EBJ A;  3C8G D;  3RQG A;  2YWA A;  3AJM A;  3C8G A;  2HSB A;  3GM3 A;  3K7D A;  4R32 A;  1OW8 A;  1QVX A;  1ZZP A;  1WTY A;  2KK1 A;  3RQF A;  3U0C A;  3C18 A;  4XEF A;  2L6F A;  1OW7 A;  1V4A A;  1PV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...