4XEVA

Fusion of pyk2-fat domain with leupaxin ld1 motif, complexed with leupaxin ld4 peptide
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
155
structure length
148
Chain Sequence
NLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHGGEELDALLEELER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fusion protein of Protein-tyrosine kinase 2-beta FAT domain
publication title Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 64
structure length 148
sequence length 155
chains with identical sequence D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4xevA00
1QVXA 3U3FA 3JYYA 3L8IA 4XEKA 3JZ0A 3AJMA 1WOLA 3C8GA 1O3UA 4EBJA 2PBEA 2HSBA 3O10A 4XEFA 4EBKA 1JOGA 3L8JA 3K7DA 1K40A 2L6GA 3GM1A 3C8GB 1OW8A 3C18A 1WTYA 1PV3A 3GM2A 3TULA 1K05A 3RQEA 4R32A 1UFBA 2L6FA 4XEVA 4NQFA 3B71A 3U0CA 1OW7A 2KK1A 1KTMA 1WWPA 3S9OA 2YWAA 2L6HA 3RQGA 2JPUA 3C8GD 2LK4A 1KNYA 3RQFA 3GM3A 2JX0A 3MFNA 1OW6A 3BRJA 1ZZPA 2Q00A 5F28E 1K04A 1V4AA
chains in the Genus database with same CATH superfamily
1CGME 4XEKA 2DI3A 3AJMA 3LESA 1I4YA 4EBJA 2EPLX 3WAQA 4F4BA 3S28A 5KYNA 4U5FE 2R7TA 1OXBA 2HKVA 1IW7F 1YAUO 1LS4A 4JTAB 4J32B 2HMQA 2J45A 3CAXA 5B1BC 2YQYA 3IQ6A 2ZXRA 4OIOF 1PV3A 2NSGA 2OU6A 3F46A 4B6IA 3EG9B 4KI2A 1NBBA 3E70C 4N06A 5FCLA 5DLJA 1JPNA 1OW7A 3V5XA 5JS5A 1VLSA 1NG1A 3K66A 4LDQA 3GEEA 2R02A 1Z23A 4ULWA 2KGOA 2R05A 2YWAA 3C8ZA 3C8GD 4KC9A 1C03A 3RQGA 1APCA 2FAPB 4JCHA 4IGGA 4MTOA 1VTMP 2A0BA 1U0BB 3SXZA 2LCHA 3GEHA 3MFNA 2LFDA 2MHRA 2KSFA 2OG2A 1XWJA 2WVNA 3GODA 3K6BA 4EKWA 1JMWA 3JYHA 4PR9A 2C04A 4AE4A 5JSLA 4E7ZA 1YZCA 2XL6A 3ABMC 2GAQA 3JYYA 2J7PD 1NU7D 3A11A 1WGWA 3C8GA 3DI5A 3QW1A 2M64A 1BR4A 3UMIA 3ZVRA 4P6IC 1GQAA 4EBKA 2EPKX 4H54A 1NZEA 1RJ9A 2W4MA 1EQ1A 3DMDA 1VYKA 3GM1A 1D1BA 1C02A 1HY5A 1TFKB 2OJQA 2YL0A 4OIRF 3T6BA 2W9YA 3TD7A 2NPUA 3EJNA 4G78A 1MNDA 4JIOA 1D0ZA 1R4TA 1UFBA 4N6CA 4YJWA 2VCAA 4E17A 1M2OA 4JKVA 5L0DA 3GANA 1V55C 3DAFA 1KTMA 4C3DA 1H7IA 3R2PA 2OKUA 4IJJA 4C3BA 4DXWA 1S05A 1ZHWA 3FOPA 4FWVA 2GA0A 2AVKA 3W2VA 1Z6AA 3R7CA 1G4WR 2VCBA 2M4EA 3IQ5A 2QUPA 3NYLA 4CX9A 3E9VA 5K0IA 2HSQA 2EPMX 1OXKA 4PACA 2PFDA 4MNDA 3U2MA 4EBBA 5B3IA 1KU2A 4O79A 4CBEA 3U9MA 1DOWA 3I5PA 3M4BA 4JVSA 1FMVA 3W8HA 2Q9CA 4FESA 2L9JA 1LI7A 1ZHZA 4N4WA 3B0UX 5L0HA 3DJUB 4J30B 4FAPB 2DYSC 1ZHXA 2H7BA 1NLXA 2G62A 4C7OB 3I5QA 3KKBA 3US6A 5KYYB 3NDBB 4EHPA 3POVA 3SXMA 4HFKB 2P0NA 4J7YA 4XQ1A 5A6KA 4MVQA 4MVMA 2CNWA 3DM5A 4MVSA 2YVKA 2IYLD 3I4UA 3JSZA 4IAOA 2Y3GA 3BRJA 2HV7A 4NTFA 2UUIA 2XLWA 4XLNF 5DS4A 2H8AA 2ICWG 3IQTA 1SR2A 3LS0A 3OEOA 4JC7A 4CS8A 3IHUA 2ZXOA 2XLMA 2A69F 3ZTZA 3K7DA 2HUJA 3RW0A 2HZ8A 1E85A 3ZC4A 4WGZA 4NY3A 5JVEA 2B0HA 1G4US 5KYWA 1GS9A 4YL1A 2Y69C 3VF0A 1EKYA 3EH2A 3HTKC 1D1CA 4PJJA 3TK0A 4EIYA 2J0WA 3B0PA 3RFYA 2TMVP 1EI7A 1OCCC 3NMIA 1S7ZA 1YA9A 1O87A 1BR1A 1YZAA 1JRAA 2DYRC 1GM5A 2C03A 3DJNB 1RKEA 4YL3A 3MYFA 1LM3B 1LI5A 3L0IA 2HJMA 3M4CA 3LAYA 4HFFB 3IQCA 4PK4A 3AG3C 1FR0A 1A7DA 2H7OA 3T9OA 3JT1A 3KMIA 3U3FA 4LDRA 1BZ4A 5E3AA 3JZ0A 4O6NA 3DXJF 3S27A 4DVZA 5BUOA 1YVIA 3W8IA 2HSBA 1VB5A 1MMGA 2MWQA 2R03A 3OA1A 4MVOA 3X2QC 1FMWA 1FFHA 1BDJB 2RSEB 4C3EA 1Q0KA 2ZD9A 3AQCA 4L6RA 3ABLC 1T01A 2J9VA 1T9KA 3M1CB 3NMKA 5COMA 3F47A 4R32A 1OR2A 4DVYP 5EGYA 3KL4A 3EGXB 3EFOA 1SYQA 4JJGA 2J9BA 4M63A 1M57C 1N1CA 2QLAA 2YZSA 4OIPF 1TWHA 4AL0A 2W45A 2XM0A 1ORSC 2HFIA 2EIMC 3GWNA 3NYJA 2KYHA 4ONSA 4CIHA 3S84A 4G7HF 3V5YA 5F28E 1C17M 3Q6MA 2XXAB 3O55A 2EILC 5BQIA 4E18A 2CW0F 4I1OB 5L3QA 2OJED 3Q7LA 4HE8D 4E0HA 2VASA 3X1OA 3B0VC 2R7UA 2OQMA 4I44A 1HMDA 3LJBA 1PD1A 4LLEA 3VM6A 1ZHTA 2DGJA 1NFNA 1AEPA 1WN0A 2P1AA 2VC9A 4PJMA 1K05A 3V7OA 3RQEA 2R7XA 2PF4E 1QPUA 1YA7O 1OQCA 3JSEO 2VB6A 4JEBA 2HMZA 3QZCA 3J06A 2L6HA 2JPUA 4RBNA 2A0UA 3DWWA 1FFTC 4J7TA 2A1DD 2AWYA 3NMJA 3GM3A 1CPRA 4DRJB 4K0DA 4N6HA 4U5CE 4U9EA 3N24A 4ULVA 5E3CA 2NUTA 5B3SC 3TULA 2OEVA 2XLDA 4CIPA 1YYJA 4E7SA 1OCRC 5E2QA 2OEXA 2OOCA 2B0JA 2GFHA 2XM4A 4MW3A 4W8PA 4P9FA 2QTVA 1OW8A 4P9TA 3RF3A 2BC5A 3C63A 3Q6NA 2PX0A 1SZIA 1GGQA 5KYUB 1A7VA 2QNLA 5COGA 4HEAJ 1M2VA 1OKKA 2CYDA 1E84A 3H65A 4JJFA 5AC5A 1ZVZA 2J0XA 2P6VA 3SXYA 2YL1A 3S29A 2AU5A 5AC4A 3S90A 4UDVA 4IARA 1YLMA 4BEJA 3W2WA 2G3VA 3ZTMA 3K33A 2AP3A 2HS5A 2E87A 5BQGA 4NTAA 5GPGB 3RKOF 3T4RA 3TOLA 2V26A 1TFOB 1LPEA 3L8IA 2HJ3A 1O3UA 2QE9A 3TJ5A 4CSAC 3KYJA 1L7CA 2J8WA 2KNHA 4LERA 3U8PA 2KQ9A 1J8MF 2CNWD 2YLDA 4GQHA 4LDKA 2CGEA 1QQ3A 2Q4FA 3DM9B 2L6FA 3FVYA 3HNIA 2HV6A 2KJGA 2I15A 3ZQVA 4CS7A 1H9TA 4CSAA 4OD4A 3SYNA 3HJCA 3FXHA 3AQBA 3KH2A 2RD9A 1WWPA 3CSKA 4CS9A 3EQLF 4XPWA 4CS8C 2I8BA 4IRUA 4W8KA 4PJLA 1TQGA 5KYXB 5HV9A 3BEHA 3JRMO 2JX0A 2NUPB 5A69A 4BJ6A 2NSFA 1ZZPA 1E86A 5F5HA 1T6IA 1NU9C 4FX5A 1H6GA 2MYSA 3S0XA 1AUEA 3DD7A 4A2NB 3NKEA 3EGDB 5L0GA 1U6HA 3K1IA 4XEFA 4JURI 3C7JA 3EG9A 3FAPB 2R7VA 4I1MA 3ECSA 4JZAA 3QTHA 4WABA 3GM2A 5A6JA 2ASRA 3HKKA 4OIQF 4DJ9A 1LE2A 3LNMB 4MS2A 2EIKC 3C62A 2Q7RA 4NQFA 4CDYA 3U0CA 3DZAA 1M56C 3IPMO 3ZIBA 4IAQA 4YT5A 1YARO 5JLIA 1RCPA 3MBGA 3UMKA 4DBRA 3SZRA 2O9XA 2YL7A 3SEOA 4CDAA 3N2ZB 2LP4A 4BG0A 4IWBA 4GEHA 4XWJA 1PCXA 2YRFA 1QVXA 3WG7C 3U3BA 3PHF2 3TOMA 4G0HA 3AGUA 2NUTB 3ATPA 2PBEA 1OR3A 1MMAA 3CZ6A 4A4AA 4AE4B 2L7AA 1JOGA 1ORJA 1T5OA 4MQ9F 3ZG1A 3IEEA 5DVWA 2NG1A 1MQVA 3T6GB 3C8GB 2YEVA 1Q0FA 3M79A 1JAFA 4H4KC 3H2UA 4O7GA 2XLVA 1QKRA 4CJOA 1RJ9B 1O5HA 4K7BA 1TR2A 4KBLA 2EPNA 1D1AA 3MLGA 3NRHA 4NC3A 2IM8A 4WGYA 1LVKA 3AGTA 1D0XA 3B9QA 1Q0MA 4JCZA 2ZPAA 4OINF 4PFPA 4RDAA 3U9JA 3VYWA 3WHNA 1WATA 5IY5C 1QLEC 3FOOA 3MYIA 4BEMJ 2WVOA 5T3TA 2IXNA 4G7OF 4YL0A 2FGYA 1CGNA 3B29A 3LLKA 3LEOA 1IZMA 1D0YA 3L1MA 3QVZA 3TJ6A 2WZLA 1LIHA 4X0RA 5JP7A 4AK9A 2YLIA 5L0FA 2YLGA 4QI0A 1M6TA 4MW8A 3DAGA 4C7OA 2J9WA 5KYYA 1Y4CA 3SXKA 3JRTA 3UNGC 1E2XA 3CQZA 4U5EE 4Q4ZF 5L0IA 4I3MA 1YJGA 2WB7A 5FZTA 3PDMP 4QDLA 1I4ZA 2LFFA 4LACB 2WZGA 2IXMA 2LQGA 3PMRA 5BQHA 1H9GA 3O6XA 4G7ZF 1OCOC 3RQFA 1HMOA 1VYIA 3KPHA 1J8YF 1HE9A 4MTGA 4XLPF 1QZXA 4Z9JA 2XL4A 4MVRA 5A6BA 3ABKC 1V4AA 1JPJA 2PNOA 5DQTA 3PCVA 1YYXA 3EZHA 2ZXPA 2BE5F 4MVZA 4CJGA 2XLOA 2XLHA 2X0CA 4OD5A 2LD6A 4EWCA 3L8JA 2IXOA 1LKXA 2LIGA 2BL2A 1OKKD 3AG4C 3MX3A 3QMKA 3V5ZA 1E83A 2VH3A 1FTSA 4JEAA 2F22A 1Z7Qc 1A0BA 3UGOA 2ZXWC 3VRCA 3FAJA 2YKZA 1VK5A 5KYWB 3RH3A 3WODF 2R7OA 2H7VC 3RVYA 2KK1A 2D5RB 3G50A 2Y3DA 1TWGA 4Z9HA 3FHDA 4JTCB 2CCYA 1L3PA 4YT8A 1EA8A 4DRHB 2GWWA 1JR8A 3EPVA 2YL3A 3SNHA 3DE9A 1MMNA 3JTLO 1ZU4A 4NCQA 2PX3A 3LEVA 5AGFA 1RKEB 3UR3C 2QY9A 2GDCA 1NFOA 1T6QA 2XRHA 2XS1A 5COFA 4DBQA 4MTFA 1AVOB 3ZDLA 2R7SA 3HNKA 3EHNA 3O10A 3QW0A 2Q3TA 2JD3A 4EUKB 5L0CA 2EINC 4YN0B 3ZSUA 4CS9C 2D4UA 2L6GA 2XLEA 5E33A 1WASA 1RMVA 3EGXA 4U5HA 2IXPA 1TWCA 2J7PA 1DOVA 2IOQA 3M15A 4D4NA 1CPQA 4BJ6C 5L3VA 2J9UA 2W4BA 3LNRA 4JTDB 2P7VA 5T3WA 3T6JA 5JUAA 4ZLCA 1NSGB 1VLTA 4ANJA 3HNJA 2IBFA 3Q7GA 3TQOA 1KNYA 3DE8A 2EPOA 3K1IC 1ORYA 2XXAA 2R7QA 3EFOB 4RD9A 4Q7CA 3LLIA 1OW6A 1SMYF 1FNTc 1LS1A 2P61A 5JRAA 2AWCA 2LSEA 4O6MA 3A9CA 2DB4A 5T1DB 3RIPA 1F1MA 4O6YA 5TJ5E 3JCUQ 1MNEA 2Y3HA 4BPMA 1SF8A 1U89A 4JW1A 1RKCA 3GORA 1B68A 3KYIA 2XS8A 3G4ZA 3ITFA 4GYTA 1K40A 5HSWA 3U8VA 3RVZA 5CI9A 3W4YA 1FAPB 4IB4A 1Q0DA 1ZHYA 2WL8A 4NTBA 1V74B 3LS1A 5D92A 3AG1C 4KNVA 2VCCA 4XTKA 2Y39A 4DOZA 1Y6DA 2A6HF 3NG1A 3S9OA 1XZPA 3NYMA 1V54C 3AG2C 1XZQA 1OCZC 5CIVA 3K1HA 1G8XA 2FFHA 2Y3BA 4U5BE 2J46A 1HW2A 2Q9BA 1TKNA 2EIJC 3N0TA 2R9RB 2WVQA 1PD0A 4JRZA 3UGPA 3G4XA 4ZLDA 1RXQA 2XSEA 1ZW3A 3EZIA 2V3CC 1ZYRF 3OWTA 2CDQA 4YT4A 3CEXA 2A68F 4XPXA 3C18A 5KYUA 4YWQA 1I5NA 2UUHA 1Z63A 1CGOA 5D91A 3HNLA 3ZWIA 2L81A 3L34A 2Z15A 256BA 3B71A 4U9DA 4BJ5C 3QVYA 2R7RA 1G5ZA 5JT4A 4WJ0A 4QI2A 1BBHA 3EHMA 1A41A 1LE4A 1YDIA 3H2VA 4ER9A 1W2WA 3VAYA 1HW1A 1UG7A 2KW3C 3AOUA 2ETSA 2YHSA 3ZQYA 4AX2A 5A6AA 2WZFA 1M2VB 2A6EF 3U5SA 5DS6A 1BR2A 1Z3IX 3U2LA 1K04A 3GWLA 4E0IA 4BJ1A 2XL8A 1A7EA 4BJ5A 4BJTA 5L0JA 3ASOC 4JE9A 4U5GA 2R25A 1WOLA 4D4XA 3O39A 3SP1A 1Z5ZA 2R7WA 4AL1A 4Q5SF 1ST6A 1T6UA 3UMHA 1HE1A 3NKDA 4DRIB 5EHHA 5CI8A 4CDVA 3EH1A 1WTYA 4PFOA 5EK0A 1R5ID 4PJNA 2PP4A 5B1AC 3RYLA 4YT2A 4XEVA 5DS5A 2Q9AA 1Q0GA 5KYXA 1ZW2A 2NUPA 3ASNC 4LLCA 4YK5A 5A6BD 3FDQA 3HLZA 2LK4A 4KNWA 1MMDA 3FMSA 2G3KA 4U5DE 1VMAA 5DQZA 2KC3A 1QSPA 3DKAA 3GEIA 5F5FA 1VOMA 3EGDA 1ZU5A 2Q00A 3LUTB 4XPYA 2OCCC 1TWAA 2X51A 4MVUA 4Z9IA 4K1OA
chains in the Genus database with same CATH topology
1QVXA 3U3FA 3JYYA 3L8IA 4XEKA 3JZ0A 3AJMA 1WOLA 3C8GA 1O3UA 4EBJA 2PBEA 2HSBA 3O10A 4XEFA 4EBKA 1JOGA 3L8JA 3K7DA 1K40A 2L6GA 3GM1A 3C8GB 1OW8A 3C18A 1WTYA 1PV3A 3GM2A 3TULA 1K05A 3RQEA 4R32A 1UFBA 2L6FA 4XEVA 4NQFA 3B71A 3U0CA 1OW7A 2KK1A 1KTMA 1WWPA 3S9OA 2YWAA 2L6HA 3RQGA 2JPUA 3C8GD 2LK4A 1KNYA 3RQFA 3GM3A 2JX0A 3MFNA 1OW6A 3BRJA 1ZZPA 2Q00A 5F28E 1K04A 1V4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVX A;  3U3F A;  3JYY A;  3L8I A;  4XEK A;  3JZ0 A;  3AJM A;  1WOL A;  3C8G A;  1O3U A;  4EBJ A;  2PBE A;  2HSB A;  3O10 A;  4XEF A;  4EBK A;  1JOG A;  3L8J A;  3K7D A;  1K40 A;  2L6G A;  3GM1 A;  3C8G B;  1OW8 A;  3C18 A;  1WTY A;  1PV3 A;  3GM2 A;  3TUL A;  1K05 A;  3RQE A;  4R32 A;  1UFB A;  2L6F A;  4XEV A;  4NQF A;  3B71 A;  3U0C A;  1OW7 A;  2KK1 A;  1KTM A;  1WWP A;  3S9O A;  2YWA A;  2L6H A;  3RQG A;  2JPU A;  3C8G D;  2LK4 A;  1KNY A;  3RQF A;  3GM3 A;  2JX0 A;  3MFN A;  1OW6 A;  3BRJ A;  1ZZP A;  2Q00 A;  5F28 E;  1K04 A;  1V4A A; 
#chains in the Genus database with same CATH topology
 1CGM E;  4XEK A;  2DI3 A;  3AJM A;  3LES A;  1I4Y A;  4EBJ A;  2EPL X;  3WAQ A;  4F4B A;  3S28 A;  5KYN A;  4U5F E;  2R7T A;  1OXB A;  2HKV A;  1IW7 F;  1YAU O;  1LS4 A;  4JTA B;  4J32 B;  2HMQ A;  2J45 A;  3CAX A;  5B1B C;  2YQY A;  3IQ6 A;  2ZXR A;  4OIO F;  1PV3 A;  2NSG A;  2OU6 A;  3F46 A;  4B6I A;  3EG9 B;  4KI2 A;  1NBB A;  3E70 C;  4N06 A;  5FCL A;  5DLJ A;  1JPN A;  1OW7 A;  3V5X A;  5JS5 A;  1VLS A;  1NG1 A;  3K66 A;  4LDQ A;  3GEE A;  2R02 A;  1Z23 A;  4ULW A;  2KGO A;  2R05 A;  2YWA A;  3C8Z A;  3C8G D;  4KC9 A;  1C03 A;  3RQG A;  1APC A;  2FAP B;  4JCH A;  4IGG A;  4MTO A;  1VTM P;  2A0B A;  1U0B B;  3SXZ A;  2LCH A;  3GEH A;  3MFN A;  2LFD A;  2MHR A;  2KSF A;  2OG2 A;  1XWJ A;  2WVN A;  3GOD A;  3K6B A;  4EKW A;  1JMW A;  3JYH A;  4PR9 A;  2C04 A;  4AE4 A;  5JSL A;  4E7Z A;  1YZC A;  2XL6 A;  3ABM C;  2GAQ A;  3JYY A;  2J7P D;  1NU7 D;  3A11 A;  1WGW A;  3C8G A;  3DI5 A;  3QW1 A;  2M64 A;  1BR4 A;  3UMI A;  3ZVR A;  4P6I C;  1GQA A;  4EBK A;  2EPK X;  4H54 A;  1NZE A;  1RJ9 A;  2W4M A;  1EQ1 A;  3DMD A;  1VYK A;  3GM1 A;  1D1B A;  1C02 A;  1HY5 A;  1TFK B;  2OJQ A;  2YL0 A;  4OIR F;  3T6B A;  2W9Y A;  3TD7 A;  2NPU A;  3EJN A;  4G78 A;  1MND A;  4JIO A;  1D0Z A;  1R4T A;  1UFB A;  4N6C A;  4YJW A;  2VCA A;  4E17 A;  1M2O A;  4JKV A;  5L0D A;  3GAN A;  1V55 C;  3DAF A;  1KTM A;  4C3D A;  1H7I A;  3R2P A;  2OKU A;  4IJJ A;  4C3B A;  4DXW A;  1S05 A;  1ZHW A;  3FOP A;  4FWV A;  2GA0 A;  2AVK A;  3W2V A;  1Z6A A;  3R7C A;  1G4W R;  2VCB A;  2M4E A;  3IQ5 A;  2QUP A;  3NYL A;  4CX9 A;  3E9V A;  5K0I A;  2HSQ A;  2EPM X;  1OXK A;  4PAC A;  2PFD A;  4MND A;  3U2M A;  4EBB A;  5B3I A;  1KU2 A;  4O79 A;  4CBE A;  3U9M A;  1DOW A;  3I5P A;  3M4B A;  4JVS A;  1FMV A;  3W8H A;  2Q9C A;  4FES A;  2L9J A;  1LI7 A;  1ZHZ A;  4N4W A;  3B0U X;  5L0H A;  3DJU B;  4J30 B;  4FAP B;  2DYS C;  1ZHX A;  2H7B A;  1NLX A;  2G62 A;  4C7O B;  3I5Q A;  3KKB A;  3US6 A;  5KYY B;  3NDB B;  4EHP A;  3POV A;  3SXM A;  4HFK B;  2P0N A;  4J7Y A;  4XQ1 A;  5A6K A;  4MVQ A;  4MVM A;  2CNW A;  3DM5 A;  4MVS A;  2YVK A;  2IYL D;  3I4U A;  3JSZ A;  4IAO A;  2Y3G A;  3BRJ A;  2HV7 A;  4NTF A;  2UUI A;  2XLW A;  4XLN F;  5DS4 A;  2H8A A;  2ICW G;  3IQT A;  1SR2 A;  3LS0 A;  3OEO A;  4JC7 A;  4CS8 A;  3IHU A;  2ZXO A;  2XLM A;  2A69 F;  3ZTZ A;  3K7D A;  2HUJ A;  3RW0 A;  2HZ8 A;  1E85 A;  3ZC4 A;  4WGZ A;  4NY3 A;  5JVE A;  2B0H A;  1G4U S;  5KYW A;  1GS9 A;  4YL1 A;  2Y69 C;  3VF0 A;  1EKY A;  3EH2 A;  3HTK C;  1D1C A;  4PJJ A;  3TK0 A;  4EIY A;  2J0W A;  3B0P A;  3RFY A;  2TMV P;  1EI7 A;  1OCC C;  3NMI A;  1S7Z A;  1YA9 A;  1O87 A;  1BR1 A;  1YZA A;  1JRA A;  2DYR C;  1GM5 A;  2C03 A;  3DJN B;  1RKE A;  4YL3 A;  3MYF A;  1LM3 B;  1LI5 A;  3L0I A;  2HJM A;  3M4C A;  3LAY A;  4HFF B;  3IQC A;  4PK4 A;  3AG3 C;  1FR0 A;  1A7D A;  2H7O A;  3T9O A;  3JT1 A;  3KMI A;  3U3F A;  4LDR A;  1BZ4 A;  5E3A A;  3JZ0 A;  4O6N A;  3DXJ F;  3S27 A;  4DVZ A;  5BUO A;  1YVI A;  3W8I A;  2HSB A;  1VB5 A;  1MMG A;  2MWQ A;  2R03 A;  3OA1 A;  4MVO A;  3X2Q C;  1FMW A;  1FFH A;  1BDJ B;  2RSE B;  4C3E A;  1Q0K A;  2ZD9 A;  3AQC A;  4L6R A;  3ABL C;  1T01 A;  2J9V A;  1T9K A;  3M1C B;  3NMK A;  5COM A;  3F47 A;  4R32 A;  1OR2 A;  4DVY P;  5EGY A;  3KL4 A;  3EGX B;  3EFO A;  1SYQ A;  4JJG A;  2J9B A;  4M63 A;  1M57 C;  1N1C A;  2QLA A;  2YZS A;  4OIP F;  1TWH A;  4AL0 A;  2W45 A;  2XM0 A;  1ORS C;  2HFI A;  2EIM C;  3GWN A;  3NYJ A;  2KYH A;  4ONS A;  4CIH A;  3S84 A;  4G7H F;  3V5Y A;  5F28 E;  1C17 M;  3Q6M A;  2XXA B;  3O55 A;  2EIL C;  5BQI A;  4E18 A;  2CW0 F;  4I1O B;  5L3Q A;  2OJE D;  3Q7L A;  4HE8 D;  4E0H A;  2VAS A;  3X1O A;  3B0V C;  2R7U A;  2OQM A;  4I44 A;  1HMD A;  3LJB A;  1PD1 A;  4LLE A;  3VM6 A;  1ZHT A;  2DGJ A;  1NFN A;  1AEP A;  1WN0 A;  2P1A A;  2VC9 A;  4PJM A;  1K05 A;  3V7O A;  3RQE A;  2R7X A;  2PF4 E;  1QPU A;  1YA7 O;  1OQC A;  3JSE O;  2VB6 A;  4JEB A;  2HMZ A;  3QZC A;  3J06 A;  2L6H A;  2JPU A;  4RBN A;  2A0U A;  3DWW A;  1FFT C;  4J7T A;  2A1D D;  2AWY A;  3NMJ A;  3GM3 A;  1CPR A;  4DRJ B;  4K0D A;  4N6H A;  4U5C E;  4U9E A;  3N24 A;  4ULV A;  5E3C A;  2NUT A;  5B3S C;  3TUL A;  2OEV A;  2XLD A;  4CIP A;  1YYJ A;  4E7S A;  1OCR C;  5E2Q A;  2OEX A;  2OOC A;  2B0J A;  2GFH A;  2XM4 A;  4MW3 A;  4W8P A;  4P9F A;  2QTV A;  1OW8 A;  4P9T A;  3RF3 A;  2BC5 A;  3C63 A;  3Q6N A;  2PX0 A;  1SZI A;  1GGQ A;  5KYU B;  1A7V A;  2QNL A;  5COG A;  4HEA J;  1M2V A;  1OKK A;  2CYD A;  1E84 A;  3H65 A;  4JJF A;  5AC5 A;  1ZVZ A;  2J0X A;  2P6V A;  3SXY A;  2YL1 A;  3S29 A;  2AU5 A;  5AC4 A;  3S90 A;  4UDV A;  4IAR A;  1YLM A;  4BEJ A;  3W2W A;  2G3V A;  3ZTM A;  3K33 A;  2AP3 A;  2HS5 A;  2E87 A;  5BQG A;  4NTA A;  5GPG B;  3RKO F;  3T4R A;  3TOL A;  2V26 A;  1TFO B;  1LPE A;  3L8I A;  2HJ3 A;  1O3U A;  2QE9 A;  3TJ5 A;  4CSA C;  3KYJ A;  1L7C A;  2J8W A;  2KNH A;  4LER A;  3U8P A;  2KQ9 A;  1J8M F;  2CNW D;  2YLD A;  4GQH A;  4LDK A;  2CGE A;  1QQ3 A;  2Q4F A;  3DM9 B;  2L6F A;  3FVY A;  3HNI A;  2HV6 A;  2KJG A;  2I15 A;  3ZQV A;  4CS7 A;  1H9T A;  4CSA A;  4OD4 A;  3SYN A;  3HJC A;  3FXH A;  3AQB A;  3KH2 A;  2RD9 A;  1WWP A;  3CSK A;  4CS9 A;  3EQL F;  4XPW A;  4CS8 C;  2I8B A;  4IRU A;  4W8K A;  4PJL A;  1TQG A;  5KYX B;  5HV9 A;  3BEH A;  3JRM O;  2JX0 A;  2NUP B;  5A69 A;  4BJ6 A;  2NSF A;  1ZZP A;  1E86 A;  5F5H A;  1T6I A;  1NU9 C;  4FX5 A;  1H6G A;  2MYS A;  3S0X A;  1AUE A;  3DD7 A;  4A2N B;  3NKE A;  3EGD B;  5L0G A;  1U6H A;  3K1I A;  4XEF A;  4JUR I;  3C7J A;  3EG9 A;  3FAP B;  2R7V A;  4I1M A;  3ECS A;  4JZA A;  3QTH A;  4WAB A;  3GM2 A;  5A6J A;  2ASR A;  3HKK A;  4OIQ F;  4DJ9 A;  1LE2 A;  3LNM B;  4MS2 A;  2EIK C;  3C62 A;  2Q7R A;  4NQF A;  4CDY A;  3U0C A;  3DZA A;  1M56 C;  3IPM O;  3ZIB A;  4IAQ A;  4YT5 A;  1YAR O;  5JLI A;  1RCP A;  3MBG A;  3UMK A;  4DBR A;  3SZR A;  2O9X A;  2YL7 A;  3SEO A;  4CDA A;  3N2Z B;  2LP4 A;  4BG0 A;  4IWB A;  4GEH A;  4XWJ A;  1PCX A;  2YRF A;  1QVX A;  3WG7 C;  3U3B A;  3PHF 2;  3TOM A;  4G0H A;  3AGU A;  2NUT B;  3ATP A;  2PBE A;  1OR3 A;  1MMA A;  3CZ6 A;  4A4A A;  4AE4 B;  2L7A A;  1JOG A;  1ORJ A;  1T5O A;  4MQ9 F;  3ZG1 A;  3IEE A;  5DVW A;  2NG1 A;  1MQV A;  3T6G B;  3C8G B;  2YEV A;  1Q0F A;  3M79 A;  1JAF A;  4H4K C;  3H2U A;  4O7G A;  2XLV A;  1QKR A;  4CJO A;  1RJ9 B;  1O5H A;  4K7B A;  1TR2 A;  4KBL A;  2EPN A;  1D1A A;  3MLG A;  3NRH A;  4NC3 A;  2IM8 A;  4WGY A;  1LVK A;  3AGT A;  1D0X A;  3B9Q A;  1Q0M A;  4JCZ A;  2ZPA A;  4OIN F;  4PFP A;  4RDA A;  3U9J A;  3VYW A;  3WHN A;  1WAT A;  5IY5 C;  1QLE C;  3FOO A;  3MYI A;  4BEM J;  2WVO A;  5T3T A;  2IXN A;  4G7O F;  4YL0 A;  2FGY A;  1CGN A;  3B29 A;  3LLK A;  3LEO A;  1IZM A;  1D0Y A;  3L1M A;  3QVZ A;  3TJ6 A;  2WZL A;  1LIH A;  4X0R A;  5JP7 A;  4AK9 A;  2YLI A;  5L0F A;  2YLG A;  4QI0 A;  1M6T A;  4MW8 A;  3DAG A;  4C7O A;  2J9W A;  5KYY A;  1Y4C A;  3SXK A;  3JRT A;  3UNG C;  1E2X A;  3CQZ A;  4U5E E;  4Q4Z F;  5L0I A;  4I3M A;  1YJG A;  2WB7 A;  5FZT A;  3PDM P;  4QDL A;  1I4Z A;  2LFF A;  4LAC B;  2WZG A;  2IXM A;  2LQG A;  3PMR A;  5BQH A;  1H9G A;  3O6X A;  4G7Z F;  1OCO C;  3RQF A;  1HMO A;  1VYI A;  3KPH A;  1J8Y F;  1HE9 A;  4MTG A;  4XLP F;  1QZX A;  4Z9J A;  2XL4 A;  4MVR A;  5A6B A;  3ABK C;  1V4A A;  1JPJ A;  2PNO A;  5DQT A;  3PCV A;  1YYX A;  3EZH A;  2ZXP A;  2BE5 F;  4MVZ A;  4CJG A;  2XLO A;  2XLH A;  2X0C A;  4OD5 A;  2LD6 A;  4EWC A;  3L8J A;  2IXO A;  1LKX A;  2LIG A;  2BL2 A;  1OKK D;  3AG4 C;  3MX3 A;  3QMK A;  3V5Z A;  1E83 A;  2VH3 A;  1FTS A;  4JEA A;  2F22 A;  1Z7Q c;  1A0B A;  3UGO A;  2ZXW C;  3VRC A;  3FAJ A;  2YKZ A;  1VK5 A;  5KYW B;  3RH3 A;  3WOD F;  2R7O A;  2H7V C;  3RVY A;  2KK1 A;  2D5R B;  3G50 A;  2Y3D A;  1TWG A;  4Z9H A;  3FHD A;  4JTC B;  2CCY A;  1L3P A;  4YT8 A;  1EA8 A;  4DRH B;  2GWW A;  1JR8 A;  3EPV A;  2YL3 A;  3SNH A;  3DE9 A;  1MMN A;  3JTL O;  1ZU4 A;  4NCQ A;  2PX3 A;  3LEV A;  5AGF A;  1RKE B;  3UR3 C;  2QY9 A;  2GDC A;  1NFO A;  1T6Q A;  2XRH A;  2XS1 A;  5COF A;  4DBQ A;  4MTF A;  1AVO B;  3ZDL A;  2R7S A;  3HNK A;  3EHN A;  3O10 A;  3QW0 A;  2Q3T A;  2JD3 A;  4EUK B;  5L0C A;  2EIN C;  4YN0 B;  3ZSU A;  4CS9 C;  2D4U A;  2L6G A;  2XLE A;  5E33 A;  1WAS A;  1RMV A;  3EGX A;  4U5H A;  2IXP A;  1TWC A;  2J7P A;  1DOV A;  2IOQ A;  3M15 A;  4D4N A;  1CPQ A;  4BJ6 C;  5L3V A;  2J9U A;  2W4B A;  3LNR A;  4JTD B;  2P7V A;  5T3W A;  3T6J A;  5JUA A;  4ZLC A;  1NSG B;  1VLT A;  4ANJ A;  3HNJ A;  2IBF A;  3Q7G A;  3TQO A;  1KNY A;  3DE8 A;  2EPO A;  3K1I C;  1ORY A;  2XXA A;  2R7Q A;  3EFO B;  4RD9 A;  4Q7C A;  3LLI A;  1OW6 A;  1SMY F;  1FNT c;  1LS1 A;  2P61 A;  5JRA A;  2AWC A;  2LSE A;  4O6M A;  3A9C A;  2DB4 A;  5T1D B;  3RIP A;  1F1M A;  4O6Y A;  5TJ5 E;  3JCU Q;  1MNE A;  2Y3H A;  4BPM A;  1SF8 A;  1U89 A;  4JW1 A;  1RKC A;  3GOR A;  1B68 A;  3KYI A;  2XS8 A;  3G4Z A;  3ITF A;  4GYT A;  1K40 A;  5HSW A;  3U8V A;  3RVZ A;  5CI9 A;  3W4Y A;  1FAP B;  4IB4 A;  1Q0D A;  1ZHY A;  2WL8 A;  4NTB A;  1V74 B;  3LS1 A;  5D92 A;  3AG1 C;  4KNV A;  2VCC A;  4XTK A;  2Y39 A;  4DOZ A;  1Y6D A;  2A6H F;  3NG1 A;  3S9O A;  1XZP A;  3NYM A;  1V54 C;  3AG2 C;  1XZQ A;  1OCZ C;  5CIV A;  3K1H A;  1G8X A;  2FFH A;  2Y3B A;  4U5B E;  2J46 A;  1HW2 A;  2Q9B A;  1TKN A;  2EIJ C;  3N0T A;  2R9R B;  2WVQ A;  1PD0 A;  4JRZ A;  3UGP A;  3G4X A;  4ZLD A;  1RXQ A;  2XSE A;  1ZW3 A;  3EZI A;  2V3C C;  1ZYR F;  3OWT A;  2CDQ A;  4YT4 A;  3CEX A;  2A68 F;  4XPX A;  3C18 A;  5KYU A;  4YWQ A;  1I5N A;  2UUH A;  1Z63 A;  1CGO A;  5D91 A;  3HNL A;  3ZWI A;  2L81 A;  3L34 A;  2Z15 A;  256B A;  3B71 A;  4U9D A;  4BJ5 C;  3QVY A;  2R7R A;  1G5Z A;  5JT4 A;  4WJ0 A;  4QI2 A;  1BBH A;  3EHM A;  1A41 A;  1LE4 A;  1YDI A;  3H2V A;  4ER9 A;  1W2W A;  3VAY A;  1HW1 A;  1UG7 A;  2KW3 C;  3AOU A;  2ETS A;  2YHS A;  3ZQY A;  4AX2 A;  5A6A A;  2WZF A;  1M2V B;  2A6E F;  3U5S A;  5DS6 A;  1BR2 A;  1Z3I X;  3U2L A;  1K04 A;  3GWL A;  4E0I A;  4BJ1 A;  2XL8 A;  1A7E A;  4BJ5 A;  4BJT A;  5L0J A;  3ASO C;  4JE9 A;  4U5G A;  2R25 A;  1WOL A;  4D4X A;  3O39 A;  3SP1 A;  1Z5Z A;  2R7W A;  4AL1 A;  4Q5S F;  1ST6 A;  1T6U A;  3UMH A;  1HE1 A;  3NKD A;  4DRI B;  5EHH A;  5CI8 A;  4CDV A;  3EH1 A;  1WTY A;  4PFO A;  5EK0 A;  1R5I D;  4PJN A;  2PP4 A;  5B1A C;  3RYL A;  4YT2 A;  4XEV A;  5DS5 A;  2Q9A A;  1Q0G A;  5KYX A;  1ZW2 A;  2NUP A;  3ASN C;  4LLC A;  4YK5 A;  5A6B D;  3FDQ A;  3HLZ A;  2LK4 A;  4KNW A;  1MMD A;  3FMS A;  2G3K A;  4U5D E;  1VMA A;  5DQZ A;  2KC3 A;  1QSP A;  3DKA A;  3GEI A;  5F5F A;  1VOM A;  3EGD A;  1ZU5 A;  2Q00 A;  3LUT B;  4XPY A;  2OCC C;  1TWA A;  2X51 A;  4MVU A;  4Z9I A;  4K1O A; 
#chains in the Genus database with same CATH homology
 1QVX A;  3U3F A;  3JYY A;  3L8I A;  4XEK A;  3JZ0 A;  3AJM A;  1WOL A;  3C8G A;  1O3U A;  4EBJ A;  2PBE A;  2HSB A;  3O10 A;  4XEF A;  4EBK A;  1JOG A;  3L8J A;  3K7D A;  1K40 A;  2L6G A;  3GM1 A;  3C8G B;  1OW8 A;  3C18 A;  1WTY A;  1PV3 A;  3GM2 A;  3TUL A;  1K05 A;  3RQE A;  4R32 A;  1UFB A;  2L6F A;  4XEV A;  4NQF A;  3B71 A;  3U0C A;  1OW7 A;  2KK1 A;  1KTM A;  1WWP A;  3S9O A;  2YWA A;  2L6H A;  3RQG A;  2JPU A;  3C8G D;  2LK4 A;  1KNY A;  3RQF A;  3GM3 A;  2JX0 A;  3MFN A;  1OW6 A;  3BRJ A;  1ZZP A;  2Q00 A;  5F28 E;  1K04 A;  1V4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...