4XEVA

Fusion of pyk2-fat domain with leupaxin ld1 motif, complexed with leupaxin ld4 peptide
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
155
structure length
148
Chain Sequence
NLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHGGEELDALLEELER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fusion protein of Protein-tyrosine kinase 2-beta FAT domain
publication title Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 64
structure length 148
sequence length 155
chains with identical sequence D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4xevA00
3RQGA 2L6GA 3B71A 1ZZPA 2YWAA 3L8IA 4EBJA 4XEVA 1KTMA 3S9OA 1JOGA 1WWPA 2HSBA 3K7DA 4NQFA 3C18A 4R32A 3AJMA 5F28E 1O3UA 1KNYA 1WTYA 2L6HA 3O10A 1K40A 1K05A 3RQFA 1OW6A 3RQEA 2L6FA 2LK4A 1OW7A 3TULA 4XEFA 1WOLA 1PV3A 3GM1A 3C8GD 3BRJA 1QVXA 3C8GA 2JPUA 3JYYA 3GM2A 2JX0A 3U0CA 3L8JA 1UFBA 4EBKA 3MFNA 3U3FA 2KK1A 1K04A 1OW8A 3GM3A 4XEKA 1V4AA 2PBEA 3JZ0A 2Q00A 3C8GB
chains in the Genus database with same CATH superfamily
1TFOB 5DS5A 4K1OA 2OOCA 1G8XA 3MLGA 3QZCA 4MTOA 2OCCC 4MTFA 1WWPA 3JSEO 4J7TA 4MVSA 4MVUA 2W4MA 4C7OB 1VK5A 1AVOB 2CCYA 2NSFA 2KGOA 4XTKA 2A6EF 4Z9HA 1PD0A 1K40A 3ITFA 4RBNA 4YT5A 5DQTA 4XEFA 2V26A 3C8GD 1MMAA 2HMQA 2OEXA 1Y6DA 5D92A 3UNGC 1OCCC 4J7YA 5A69A 1Q0DA 2R7VA 3RFYA 4GYTA 4E17A 1T6IA 3MFNA 3G4XA 3RVYA 5B3SC 1OQCA 4NC3A 2OJED 3ZC4A 4CS8A 1TQGA 4G0HA 2Q00A 3MYIA 1TR2A 2VCBA 2XLEA 1MNEA 3A11A 1ZHYA 3L34A 4XPXA 3V7OA 1JPJA 2KSFA 2PX0A 1HE1A 3H2UA 2I8BA 4X0RA 2DYSC 2G3KA 3DM9B 4NY3A 4IJJA 3TJ6A 1G4WR 3HTKC 4AX2A 3ATPA 2NPUA 2PNOA 1AUEA 1TKNA 2WVQA 3ABMC 3H2VA 4JEBA 4JEAA 1TWCA 4U5BE 4UDVA 1ZU5A 256BA 1Y4CA 3NKEA 1BZ4A 4K7BA 4LDQA 1HY5A 4AL1A 3IQ5A 2QE9A 3TJ5A 5BQHA 2H7BA 1YVIA 4JTDB 2R7QA 3ECSA 2Y3DA 2XL4A 3QMKA 1GS9A 3KYJA 4PJLA 1UFBA 4PJJA 5JP7A 1J8YF 1JPNA 2Q9BA 3I5QA 1NU9C 3GM3A 2IXOA 2GWWA 4EWCA 1JMWA 5A6JA 2XXAB 2B0HA 4BJ1A 1GM5A 2EIMC 2X51A 4EBJA 2H7OA 1Z23A 2NUPA 4U5DE 4JCZA 3S0XA 1GGQA 3HLZA 3K1IC 4IWBA 3S9OA 1ZU4A 1JOGA 5KYXA 4YL0A 4EUKB 2Q7RA 3AG1C 2AWCA 3HNIA 4JZAA 1NFOA 1LI5A 2X0CA 3FOOA 3AG4C 4FWVA 3EJNA 1IZMA 2AWYA 2ICWG 3ZQVA 1FMWA 3KMIA 4P9FA 1FFHA 3JYYA 4IAQA 3BEHA 3UGPA 1CPQA 3F46A 4C3BA 4EBKA 4CS9C 4CS7A 3U2LA 4JIOA 2R7OA 3EHMA 2G62A 2HV7A 2J8WA 3GANA 4HE8D 2YEVA 3RQGA 2D5RB 2GDCA 4A2NB 4OIPF 5L0HA 2XLHA 1A7EA 5BUOA 4HFFB 2KQ9A 1D0XA 2YL7A 1XWJA 3B0PA 2M64A 4JTCB 3DWWA 4YL3A 3I4UA 3U2MA 5L0FA 1D1AA 3SNHA 4G78A 4AE4A 3RKOF 3RQFA 3EGDB 2UUHA 1PV3A 2QUPA 1ORSC 5B1BC 1QVXA 3C8GA 2WZFA 3DM5A 4JVSA 4YJWA 1I4ZA 2Y3HA 1Q0MA 5JT4A 3GWNA 3M1CB 1O87A 3DAGA 3NMJA 1NU7D 2KC3A 2YL0A 3SXZA 3ZG1A 5JS5A 2Y3BA 3Q6MA 1NZEA 4GQHA 3EH1A 4YN0B 2BC5A 2VASA 3DZAA 1YZAA 5T1DB 1D1BA 2YLDA 1TWGA 3M79A 4ZLCA 1FAPB 2J0XA 1VYKA 2IXNA 2YKZA 4E0HA 3WG7C 1YYXA 4BEJA 2J45A 3JT1A 2YQYA 2AP3A 1E85A 4DBRA 3LS0A 1IW7F 2HS5A 1D0ZA 4BJ6A 2UUIA 2NSGA 1GQAA 1T9KA 1H9GA 1Z3IX 2C03A 3TK0A 3WAQA 3ZQYA 4U5GA 1ZHTA 1L7CA 2W45A 1RKEA 4R32A 4OIOF 4G7OF 5L0JA 1VLTA 3ZVRA 1OW6A 2L6FA 2YL1A 3NMKA 3WODF 1FMVA 3K6BA 1HMOA 2LQGA 4YT8A 1U6HA 1G5ZA 1L3PA 4G7ZF 2J9BA 5L0DA 3U0CA 3UMKA 2OG2A 2QY9A 2YHSA 2YZSA 4CX9A 4O6NA 3O39A 3W4YA 1G4US 3AGTA 3FAJA 4PACA 2PBEA 5DS4A 2MWQA 4XLPF 5KYUA 4P9TA 4CJOA 1WGWA 2J9VA 3LESA 4J32B 5GPGB 4KI2A 3QVYA 1Q0FA 1E86A 4WGYA 3W8HA 1M2VA 2HSBA 3ABKC 2NUTA 2MHRA 2XS8A 1LE2A 2A68F 4JTAB 1E84A 3NG1A 4ONSA 1RCPA 1K05A 2LCHA 3L1MA 1OW7A 3SYNA 3TD7A 3O6XA 2R25A 3KKBA 3BRJA 1OXKA 1ZW3A 3GEHA 4OD4A 1VOMA 1OKKD 2QNLA 4B6IA 2P61A 1YA9A 2J7PD 1R4TA 4JCHA 4CSAC 5E3CA 1BBHA 3U3FA 4YT2A 2RSEB 3R2PA 2A0UA 2W4BA 3LLIA 5JRAA 4JE9A 1XZQA 1MMDA 2A1DD 3JZ0A 2OKUA 4MVRA 4Q5SF 1VYIA 3UMHA 3KL4A 1ZZPA 2CGEA 3HJCA 4PK4A 4W8KA 3EZHA 5A6BD 3IQCA 1NLXA 4ULWA 2DYRC 3K7DA 4JW1A 5HSWA 2DGJA 4I44A 2HJMA 2PF4E 1A41A 3M15A 1VTMP 4N6CA 2IXMA 2XL6A 2NUPB 2R7XA 2HSQA 1LKXA 1YLMA 3O10A 5L0GA 4D4NA 4OIRF 3CSKA 4O6MA 1Z63A 3MX3A 1CPRA 5KYXB 4JKVA 1ZVZA 4IGGA 5AC4A 4JRZA 4PFOA 2BE5F 4MW3A 1SYQA 1LE4A 2LIGA 1JRAA 3FXHA 5EK0A 4N06A 2MYSA 2WL8A 3SZRA 1ZHWA 2ZXRA 4W8PA 2JD3A 2EPLX 4CSAA 3PDMP 3VF0A 2R7SA 4MVMA 5TJ5E 5FZTA 1FTSA 3JTLO 3OWTA 4DVZA 3K33A 3ABLC 1OR2A 2XLOA 3C8ZA 3EFOA 5A6KA 4BG0A 5F5FA 1OCZC 3EGXA 1HE9A 1Z7Qc 3N2ZB 3VRCA 5AGFA 2L81A 3DJUB 4MNDA 4NTBA 4YWQA 5B3IA 4A4AA 1CGOA 1M6TA 2IYLD 3EG9A 4N6HA 3SP1A 2J9UA 4LDRA 3GORA 4WJ0A 5DS6A 1QSPA 1M2OA 1KNYA 1WTYA 1YYJA 3LEVA 3T6JA 4LACB 1QQ3A 4E7SA 2CDQA 3RH3A 2QTVA 3GM1A 3LAYA 1FNTc 2XLWA 1QZXA 1U89A 1E83A 3DE9A 2VB6A 4PR9A 3R7CA 2EPMX 4PFPA 1H9TA 4U5EE 4AE4B 2KK1A 5KYYA 4XEKA 4CDVA 2XRHA 2XLDA 5DQZA 1SMYF 2P0NA 2Q4FA 3C8GB 3JCUQ 3RVZA 4U9DA 3L8IA 2HUJA 3LS1A 4JC7A 4CDAA 2YLGA 3X1OA 3KPHA 1EKYA 4EKWA 5CI8A 1RJ9A 4FX5A 1LS4A 3DJNB 2R05A 3IHUA 3GEIA 3K1IA 4JURI 5COMA 2O9XA 3SXKA 3TOLA 4HFKB 1Z6AA 2QLAA 1C17M 1Q0GA 2AU5A 2XS1A 3FAPB 2H8AA 3PCVA 3CQZA 4LDKA 2CNWD 4NTFA 4I1OB 4PJMA 5T3TA 3H65A 1WOLA 2YLIA 1APCA 3QW1A 4QI0A 3AOUA 1V74B 1W2WA 1OKKA 3Q7GA 4RD9A 1ZHXA 2J7PA 2XL8A 4LERA 2A0BA 3IPMO 1RKEB 2LD6A 4JJFA 4N4WA 3NRHA 4ULVA 4D4XA 2E87A 3ASOC 2CW0F 2P1AA 2VCCA 5BQIA 2EIJC 2Q9AA 2LSEA 3AG2C 4CS9A 2DI3A 4BJ5C 3KYIA 2WVNA 2XSEA 3B71A 2YWAA 3IQ6A 3QW0A 3L0IA 3HNJA 1WATA 2WZGA 3C7JA 1KTMA 1TFKB 3IEEA 5COFA 2LFFA 5A6BA 2ETSA 3V5XA 1TWAA 1LS1A 4C3DA 3E9VA 2A6HF 3T4RA 4KBLA 3QVZA 3T6BA 4DXWA 1BDJB 4CIHA 2HMZA 5KYUB 4XLNF 3SXMA 3RF3A 2KJGA 4NTAA 5F5HA 4XPYA 1Q0KA 4QDLA 3SXYA 1M2VB 5JUAA 2ASRA 3M4BA 2Y69C 2Y3GA 4DJ9A 3G4ZA 2D4UA 3W8IA 4NCQA 3K66A 1J8MF 4EIYA 5KYWA 1YDIA 1CGME 4ANJA 5DVWA 5B1AC 2ZXPA 1EA8A 4Q7CA 5L0IA 3LEOA 3MYFA 1SR2A 1EI7A 3U9MA 5EGYA 4I3MA 5HV9A 3PHF2 3LUTB 4BJ5A 3HNLA 5T3WA 1M56C 4YT4A 3ASNC 1B68A 3EQLF 1PCXA 2LFDA 4O7GA 4E18A 3KH2A 1T6UA 2CYDA 2P7VA 3NYMA 3M4CA 3Q6NA 3RIPA 3AQCA 3RYLA 4AL0A 4QI2A 4YL1A 2YRFA 1AEPA 3Q7LA 1ST6A 2LP4A 4DBQA 4H4KC 3AGUA 5COGA 4BPMA 3OA1A 3TULA 1MNDA 3OEOA 1C02A 2A69F 4MW8A 1FR0A 4DRHB 4O6YA 2JX0A 1I4YA 1ORYA 3ZDLA 3B0UX 3US6A 2NG1A 2XM4A 1NG1A 2EILC 2FFHA 3FHDA 3LNRA 1HW2A 1DOWA 1M57C 3ZTMA 3HNKA 2BL2A 2HZ8A 3B29A 4U5HA 4AK9A 1H7IA 2Q3TA 3GEEA 4CBEA 1T6QA 2EIKC 4JJGA 2VC9A 1VB5A 4OD5A 4XEVA 2YVKA 5E33A 5IY5C 1MMNA 3UR3C 4Z9IA 3S90A 3MBGA 3J06A 3NKDA 1QPUA 2R7RA 3PMRA 4Z9JA 1XZPA 2XLVA 3V5ZA 3NMIA 3EFOB 3VAYA 4E7ZA 1A0BA 3S27A 4ZLDA 2CNWA 2J9WA 2PFDA 3VYWA 3EGXB 3LNMB 1HMDA 4MTGA 2EPOA 3DKAA 3UMIA 3A9CA 5CIVA 3S28A 3EG9B 2Q9CA 1BR4A 2R9RB 4KNVA 3ZTZA 4F4BA 1BR1A 1OCRC 5JSLA 5K0IA 2FGYA 2Y39A 2M4EA 3CAXA 1OCOC 4DRJB 3JSZA 3QTHA 4C7OA 4L6RA 2HJ3A 3AQBA 4GEHA 4YK5A 4IRUA 2R7TA 4FESA 1JAFA 3O55A 2ZXOA 1YJGA 5KYYB 2W9YA 5JLIA 3NYJA 4NQFA 2J46A 4U5CE 1QLEC 1ORJA 2IM8A 2I15A 1WASA 1KU2A 2L9JA 1VLSA 2PX3A 3K1HA 4MVOA 1N1CA 2EPKX 3F47A 1UG7A 4XWJA 4MS2A 1LPEA 5D91A 1FFTC 1D1CA 1RJ9B 1TWHA 1ZHZA 3DD7A 3E70C 2YL3A 2Z15A 3TQOA 4WGZA 3X2QC 4EBBA 1SF8A 3W2WA 2EPNA 2H7VC 2NUTB 5FCLA 4O79A 1NSGB 1WN0A 2EINC 2WVOA 3DXJF 3T9OA 1YA7O 3GWLA 4BJTA 4WABA 4K0DA 3G50A 1CGNA 3U8PA 2FAPB 2R7WA 3C62A 2V3CC 3DAFA 3GODA 2VCAA 3C63A 1U0BB 5L3QA 1YAUO 4MQ9F 3U5SA 2IXPA 3FOPA 2KYHA 3NYLA 1LIHA 3I5PA 4CJGA 2IOQA 4BEMJ 5A6AA 4KC9A 5JVEA 1O3UA 2XM0A 1NBBA 5E2QA 2R03A 4U9EA 2WZLA 4IAOA 4XQ1A 3ZSUA 2KW3C 4MVQA 2XXAA 3FMSA 3JRTA 2AVKA 1YARO 4H54A 2OQMA 3HKKA 3DI5A 3B9QA 1HW1A 3DE8A 3GM2A 3JYHA 4OIQF 1EQ1A 3AG3C 2IBFA 4RDAA 4DOZA 4KNWA 2XLMA 1LM3B 2B0JA 4EHPA 5EHHA 3IQTA 1T01A 1DOVA 5BQGA 1H6GA 2HKVA 2KNHA 1JR8A 1RKCA 4P6IC 2OU6A 4BJ6C 3S84A 4M63A 3W2VA 3TOMA 1MQVA 5CI9A 3U3BA 5KYWB 1LI7A 4MVZA 3EPVA 1F1MA 1RXQA 2G3VA 3C18A 3FVYA 4LLCA 5F28E 2ZD9A 1PD1A 3DMDA 3ZWIA 2HV6A 3RQEA 1ZYRF 1A7DA 2TMVP 2GAQA 3LLKA 4CDYA 3CZ6A 4IB4A 2DB4A 3CEXA 5KYNA 2GA0A 5L0CA 1SZIA 3SEOA 3WHNA 3L8JA 2F22A 4J30B 1K04A 1OW8A 3N0TA 1V4AA 1ZW2A 2HFIA 4XPWA 5AC5A 4OINF 2C04A 2OEVA 4FAPB 4C3EA 4IARA 2L6GA 4U5FE 4I1MA 1OXBA 1S05A 2ZXWC 3EGDA 4HEAJ 1V54C 2P6VA 4G7HF 3UGOA 1C03A 1E2XA 3U8VA 2J0WA 3U9JA 1V55C 4ER9A 4DVYP 1NFNA 3ZIBA 3VM6A 2VH3A 1OR3A 3POVA 3AJMA 1S7ZA 2RD9A 1R5ID 2L6HA 1BR2A 1LVKA 2R02A 1A7VA 2LK4A 2PP4A 3EH2A 4DRIB 4Q4ZF 1I5NA 1T5OA 5L3VA 2JPUA 1VMAA 3N24A 2ZPAA 4E0IA 1RMVA 2L7AA 1D0YA 2GFHA 4CS8C 4LLEA 3FDQA 3T6GB 3NDBB 4CIPA 5DLJA 1YZCA 1MMGA 1O5HA 1Z5ZA 3EHNA 3JRMO 1QKRA 4PJNA 5E3AA 3V5YA 3B0VC 3LJBA 3S29A 2R7UA 2WB7A 2OJQA 3RW0A 3EZIA
chains in the Genus database with same CATH topology
3RQGA 2L6GA 3B71A 1ZZPA 2YWAA 3L8IA 4EBJA 4XEVA 1KTMA 3S9OA 1JOGA 1WWPA 2HSBA 3K7DA 4NQFA 3C18A 4R32A 3AJMA 5F28E 1O3UA 1KNYA 1WTYA 2L6HA 3O10A 1K40A 1K05A 3RQFA 1OW6A 3RQEA 2L6FA 2LK4A 1OW7A 3TULA 4XEFA 1WOLA 1PV3A 3GM1A 3C8GD 3BRJA 1QVXA 3C8GA 2JPUA 3JYYA 3GM2A 2JX0A 3U0CA 3L8JA 1UFBA 4EBKA 3MFNA 3U3FA 2KK1A 1K04A 1OW8A 3GM3A 4XEKA 1V4AA 2PBEA 3JZ0A 2Q00A 3C8GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQG A;  2L6G A;  3B71 A;  1ZZP A;  2YWA A;  3L8I A;  4EBJ A;  4XEV A;  1KTM A;  3S9O A;  1JOG A;  1WWP A;  2HSB A;  3K7D A;  4NQF A;  3C18 A;  4R32 A;  3AJM A;  5F28 E;  1O3U A;  1KNY A;  1WTY A;  2L6H A;  3O10 A;  1K40 A;  1K05 A;  3RQF A;  1OW6 A;  3RQE A;  2L6F A;  2LK4 A;  1OW7 A;  3TUL A;  4XEF A;  1WOL A;  1PV3 A;  3GM1 A;  3C8G D;  3BRJ A;  1QVX A;  3C8G A;  2JPU A;  3JYY A;  3GM2 A;  2JX0 A;  3U0C A;  3L8J A;  1UFB A;  4EBK A;  3MFN A;  3U3F A;  2KK1 A;  1K04 A;  1OW8 A;  3GM3 A;  4XEK A;  1V4A A;  2PBE A;  3JZ0 A;  2Q00 A;  3C8G B; 
#chains in the Genus database with same CATH topology
 1TFO B;  5DS5 A;  4K1O A;  2OOC A;  1G8X A;  3MLG A;  3QZC A;  4MTO A;  2OCC C;  4MTF A;  1WWP A;  3JSE O;  4J7T A;  4MVS A;  4MVU A;  2W4M A;  4C7O B;  1VK5 A;  1AVO B;  2CCY A;  2NSF A;  2KGO A;  4XTK A;  2A6E F;  4Z9H A;  1PD0 A;  1K40 A;  3ITF A;  4RBN A;  4YT5 A;  5DQT A;  4XEF A;  2V26 A;  3C8G D;  1MMA A;  2HMQ A;  2OEX A;  1Y6D A;  5D92 A;  3UNG C;  1OCC C;  4J7Y A;  5A69 A;  1Q0D A;  2R7V A;  3RFY A;  4GYT A;  4E17 A;  1T6I A;  3MFN A;  3G4X A;  3RVY A;  5B3S C;  1OQC A;  4NC3 A;  2OJE D;  3ZC4 A;  4CS8 A;  1TQG A;  4G0H A;  2Q00 A;  3MYI A;  1TR2 A;  2VCB A;  2XLE A;  1MNE A;  3A11 A;  1ZHY A;  3L34 A;  4XPX A;  3V7O A;  1JPJ A;  2KSF A;  2PX0 A;  1HE1 A;  3H2U A;  2I8B A;  4X0R A;  2DYS C;  2G3K A;  3DM9 B;  4NY3 A;  4IJJ A;  3TJ6 A;  1G4W R;  3HTK C;  4AX2 A;  3ATP A;  2NPU A;  2PNO A;  1AUE A;  1TKN A;  2WVQ A;  3ABM C;  3H2V A;  4JEB A;  4JEA A;  1TWC A;  4U5B E;  4UDV A;  1ZU5 A;  256B A;  1Y4C A;  3NKE A;  1BZ4 A;  4K7B A;  4LDQ A;  1HY5 A;  4AL1 A;  3IQ5 A;  2QE9 A;  3TJ5 A;  5BQH A;  2H7B A;  1YVI A;  4JTD B;  2R7Q A;  3ECS A;  2Y3D A;  2XL4 A;  3QMK A;  1GS9 A;  3KYJ A;  4PJL A;  1UFB A;  4PJJ A;  5JP7 A;  1J8Y F;  1JPN A;  2Q9B A;  3I5Q A;  1NU9 C;  3GM3 A;  2IXO A;  2GWW A;  4EWC A;  1JMW A;  5A6J A;  2XXA B;  2B0H A;  4BJ1 A;  1GM5 A;  2EIM C;  2X51 A;  4EBJ A;  2H7O A;  1Z23 A;  2NUP A;  4U5D E;  4JCZ A;  3S0X A;  1GGQ A;  3HLZ A;  3K1I C;  4IWB A;  3S9O A;  1ZU4 A;  1JOG A;  5KYX A;  4YL0 A;  4EUK B;  2Q7R A;  3AG1 C;  2AWC A;  3HNI A;  4JZA A;  1NFO A;  1LI5 A;  2X0C A;  3FOO A;  3AG4 C;  4FWV A;  3EJN A;  1IZM A;  2AWY A;  2ICW G;  3ZQV A;  1FMW A;  3KMI A;  4P9F A;  1FFH A;  3JYY A;  4IAQ A;  3BEH A;  3UGP A;  1CPQ A;  3F46 A;  4C3B A;  4EBK A;  4CS9 C;  4CS7 A;  3U2L A;  4JIO A;  2R7O A;  3EHM A;  2G62 A;  2HV7 A;  2J8W A;  3GAN A;  4HE8 D;  2YEV A;  3RQG A;  2D5R B;  2GDC A;  4A2N B;  4OIP F;  5L0H A;  2XLH A;  1A7E A;  5BUO A;  4HFF B;  2KQ9 A;  1D0X A;  2YL7 A;  1XWJ A;  3B0P A;  2M64 A;  4JTC B;  3DWW A;  4YL3 A;  3I4U A;  3U2M A;  5L0F A;  1D1A A;  3SNH A;  4G78 A;  4AE4 A;  3RKO F;  3RQF A;  3EGD B;  2UUH A;  1PV3 A;  2QUP A;  1ORS C;  5B1B C;  1QVX A;  3C8G A;  2WZF A;  3DM5 A;  4JVS A;  4YJW A;  1I4Z A;  2Y3H A;  1Q0M A;  5JT4 A;  3GWN A;  3M1C B;  1O87 A;  3DAG A;  3NMJ A;  1NU7 D;  2KC3 A;  2YL0 A;  3SXZ A;  3ZG1 A;  5JS5 A;  2Y3B A;  3Q6M A;  1NZE A;  4GQH A;  3EH1 A;  4YN0 B;  2BC5 A;  2VAS A;  3DZA A;  1YZA A;  5T1D B;  1D1B A;  2YLD A;  1TWG A;  3M79 A;  4ZLC A;  1FAP B;  2J0X A;  1VYK A;  2IXN A;  2YKZ A;  4E0H A;  3WG7 C;  1YYX A;  4BEJ A;  2J45 A;  3JT1 A;  2YQY A;  2AP3 A;  1E85 A;  4DBR A;  3LS0 A;  1IW7 F;  2HS5 A;  1D0Z A;  4BJ6 A;  2UUI A;  2NSG A;  1GQA A;  1T9K A;  1H9G A;  1Z3I X;  2C03 A;  3TK0 A;  3WAQ A;  3ZQY A;  4U5G A;  1ZHT A;  1L7C A;  2W45 A;  1RKE A;  4R32 A;  4OIO F;  4G7O F;  5L0J A;  1VLT A;  3ZVR A;  1OW6 A;  2L6F A;  2YL1 A;  3NMK A;  3WOD F;  1FMV A;  3K6B A;  1HMO A;  2LQG A;  4YT8 A;  1U6H A;  1G5Z A;  1L3P A;  4G7Z F;  2J9B A;  5L0D A;  3U0C A;  3UMK A;  2OG2 A;  2QY9 A;  2YHS A;  2YZS A;  4CX9 A;  4O6N A;  3O39 A;  3W4Y A;  1G4U S;  3AGT A;  3FAJ A;  4PAC A;  2PBE A;  5DS4 A;  2MWQ A;  4XLP F;  5KYU A;  4P9T A;  4CJO A;  1WGW A;  2J9V A;  3LES A;  4J32 B;  5GPG B;  4KI2 A;  3QVY A;  1Q0F A;  1E86 A;  4WGY A;  3W8H A;  1M2V A;  2HSB A;  3ABK C;  2NUT A;  2MHR A;  2XS8 A;  1LE2 A;  2A68 F;  4JTA B;  1E84 A;  3NG1 A;  4ONS A;  1RCP A;  1K05 A;  2LCH A;  3L1M A;  1OW7 A;  3SYN A;  3TD7 A;  3O6X A;  2R25 A;  3KKB A;  3BRJ A;  1OXK A;  1ZW3 A;  3GEH A;  4OD4 A;  1VOM A;  1OKK D;  2QNL A;  4B6I A;  2P61 A;  1YA9 A;  2J7P D;  1R4T A;  4JCH A;  4CSA C;  5E3C A;  1BBH A;  3U3F A;  4YT2 A;  2RSE B;  3R2P A;  2A0U A;  2W4B A;  3LLI A;  5JRA A;  4JE9 A;  1XZQ A;  1MMD A;  2A1D D;  3JZ0 A;  2OKU A;  4MVR A;  4Q5S F;  1VYI A;  3UMH A;  3KL4 A;  1ZZP A;  2CGE A;  3HJC A;  4PK4 A;  4W8K A;  3EZH A;  5A6B D;  3IQC A;  1NLX A;  4ULW A;  2DYR C;  3K7D A;  4JW1 A;  5HSW A;  2DGJ A;  4I44 A;  2HJM A;  2PF4 E;  1A41 A;  3M15 A;  1VTM P;  4N6C A;  2IXM A;  2XL6 A;  2NUP B;  2R7X A;  2HSQ A;  1LKX A;  1YLM A;  3O10 A;  5L0G A;  4D4N A;  4OIR F;  3CSK A;  4O6M A;  1Z63 A;  3MX3 A;  1CPR A;  5KYX B;  4JKV A;  1ZVZ A;  4IGG A;  5AC4 A;  4JRZ A;  4PFO A;  2BE5 F;  4MW3 A;  1SYQ A;  1LE4 A;  2LIG A;  1JRA A;  3FXH A;  5EK0 A;  4N06 A;  2MYS A;  2WL8 A;  3SZR A;  1ZHW A;  2ZXR A;  4W8P A;  2JD3 A;  2EPL X;  4CSA A;  3PDM P;  3VF0 A;  2R7S A;  4MVM A;  5TJ5 E;  5FZT A;  1FTS A;  3JTL O;  3OWT A;  4DVZ A;  3K33 A;  3ABL C;  1OR2 A;  2XLO A;  3C8Z A;  3EFO A;  5A6K A;  4BG0 A;  5F5F A;  1OCZ C;  3EGX A;  1HE9 A;  1Z7Q c;  3N2Z B;  3VRC A;  5AGF A;  2L81 A;  3DJU B;  4MND A;  4NTB A;  4YWQ A;  5B3I A;  4A4A A;  1CGO A;  1M6T A;  2IYL D;  3EG9 A;  4N6H A;  3SP1 A;  2J9U A;  4LDR A;  3GOR A;  4WJ0 A;  5DS6 A;  1QSP A;  1M2O A;  1KNY A;  1WTY A;  1YYJ A;  3LEV A;  3T6J A;  4LAC B;  1QQ3 A;  4E7S A;  2CDQ A;  3RH3 A;  2QTV A;  3GM1 A;  3LAY A;  1FNT c;  2XLW A;  1QZX A;  1U89 A;  1E83 A;  3DE9 A;  2VB6 A;  4PR9 A;  3R7C A;  2EPM X;  4PFP A;  1H9T A;  4U5E E;  4AE4 B;  2KK1 A;  5KYY A;  4XEK A;  4CDV A;  2XRH A;  2XLD A;  5DQZ A;  1SMY F;  2P0N A;  2Q4F A;  3C8G B;  3JCU Q;  3RVZ A;  4U9D A;  3L8I A;  2HUJ A;  3LS1 A;  4JC7 A;  4CDA A;  2YLG A;  3X1O A;  3KPH A;  1EKY A;  4EKW A;  5CI8 A;  1RJ9 A;  4FX5 A;  1LS4 A;  3DJN B;  2R05 A;  3IHU A;  3GEI A;  3K1I A;  4JUR I;  5COM A;  2O9X A;  3SXK A;  3TOL A;  4HFK B;  1Z6A A;  2QLA A;  1C17 M;  1Q0G A;  2AU5 A;  2XS1 A;  3FAP B;  2H8A A;  3PCV A;  3CQZ A;  4LDK A;  2CNW D;  4NTF A;  4I1O B;  4PJM A;  5T3T A;  3H65 A;  1WOL A;  2YLI A;  1APC A;  3QW1 A;  4QI0 A;  3AOU A;  1V74 B;  1W2W A;  1OKK A;  3Q7G A;  4RD9 A;  1ZHX A;  2J7P A;  2XL8 A;  4LER A;  2A0B A;  3IPM O;  1RKE B;  2LD6 A;  4JJF A;  4N4W A;  3NRH A;  4ULV A;  4D4X A;  2E87 A;  3ASO C;  2CW0 F;  2P1A A;  2VCC A;  5BQI A;  2EIJ C;  2Q9A A;  2LSE A;  3AG2 C;  4CS9 A;  2DI3 A;  4BJ5 C;  3KYI A;  2WVN A;  2XSE A;  3B71 A;  2YWA A;  3IQ6 A;  3QW0 A;  3L0I A;  3HNJ A;  1WAT A;  2WZG A;  3C7J A;  1KTM A;  1TFK B;  3IEE A;  5COF A;  2LFF A;  5A6B A;  2ETS A;  3V5X A;  1TWA A;  1LS1 A;  4C3D A;  3E9V A;  2A6H F;  3T4R A;  4KBL A;  3QVZ A;  3T6B A;  4DXW A;  1BDJ B;  4CIH A;  2HMZ A;  5KYU B;  4XLN F;  3SXM A;  3RF3 A;  2KJG A;  4NTA A;  5F5H A;  4XPY A;  1Q0K A;  4QDL A;  3SXY A;  1M2V B;  5JUA A;  2ASR A;  3M4B A;  2Y69 C;  2Y3G A;  4DJ9 A;  3G4Z A;  2D4U A;  3W8I A;  4NCQ A;  3K66 A;  1J8M F;  4EIY A;  5KYW A;  1YDI A;  1CGM E;  4ANJ A;  5DVW A;  5B1A C;  2ZXP A;  1EA8 A;  4Q7C A;  5L0I A;  3LEO A;  3MYF A;  1SR2 A;  1EI7 A;  3U9M A;  5EGY A;  4I3M A;  5HV9 A;  3PHF 2;  3LUT B;  4BJ5 A;  3HNL A;  5T3W A;  1M56 C;  4YT4 A;  3ASN C;  1B68 A;  3EQL F;  1PCX A;  2LFD A;  4O7G A;  4E18 A;  3KH2 A;  1T6U A;  2CYD A;  2P7V A;  3NYM A;  3M4C A;  3Q6N A;  3RIP A;  3AQC A;  3RYL A;  4AL0 A;  4QI2 A;  4YL1 A;  2YRF A;  1AEP A;  3Q7L A;  1ST6 A;  2LP4 A;  4DBQ A;  4H4K C;  3AGU A;  5COG A;  4BPM A;  3OA1 A;  3TUL A;  1MND A;  3OEO A;  1C02 A;  2A69 F;  4MW8 A;  1FR0 A;  4DRH B;  4O6Y A;  2JX0 A;  1I4Y A;  1ORY A;  3ZDL A;  3B0U X;  3US6 A;  2NG1 A;  2XM4 A;  1NG1 A;  2EIL C;  2FFH A;  3FHD A;  3LNR A;  1HW2 A;  1DOW A;  1M57 C;  3ZTM A;  3HNK A;  2BL2 A;  2HZ8 A;  3B29 A;  4U5H A;  4AK9 A;  1H7I A;  2Q3T A;  3GEE A;  4CBE A;  1T6Q A;  2EIK C;  4JJG A;  2VC9 A;  1VB5 A;  4OD5 A;  4XEV A;  2YVK A;  5E33 A;  5IY5 C;  1MMN A;  3UR3 C;  4Z9I A;  3S90 A;  3MBG A;  3J06 A;  3NKD A;  1QPU A;  2R7R A;  3PMR A;  4Z9J A;  1XZP A;  2XLV A;  3V5Z A;  3NMI A;  3EFO B;  3VAY A;  4E7Z A;  1A0B A;  3S27 A;  4ZLD A;  2CNW A;  2J9W A;  2PFD A;  3VYW A;  3EGX B;  3LNM B;  1HMD A;  4MTG A;  2EPO A;  3DKA A;  3UMI A;  3A9C A;  5CIV A;  3S28 A;  3EG9 B;  2Q9C A;  1BR4 A;  2R9R B;  4KNV A;  3ZTZ A;  4F4B A;  1BR1 A;  1OCR C;  5JSL A;  5K0I A;  2FGY A;  2Y39 A;  2M4E A;  3CAX A;  1OCO C;  4DRJ B;  3JSZ A;  3QTH A;  4C7O A;  4L6R A;  2HJ3 A;  3AQB A;  4GEH A;  4YK5 A;  4IRU A;  2R7T A;  4FES A;  1JAF A;  3O55 A;  2ZXO A;  1YJG A;  5KYY B;  2W9Y A;  5JLI A;  3NYJ A;  4NQF A;  2J46 A;  4U5C E;  1QLE C;  1ORJ A;  2IM8 A;  2I15 A;  1WAS A;  1KU2 A;  2L9J A;  1VLS A;  2PX3 A;  3K1H A;  4MVO A;  1N1C A;  2EPK X;  3F47 A;  1UG7 A;  4XWJ A;  4MS2 A;  1LPE A;  5D91 A;  1FFT C;  1D1C A;  1RJ9 B;  1TWH A;  1ZHZ A;  3DD7 A;  3E70 C;  2YL3 A;  2Z15 A;  3TQO A;  4WGZ A;  3X2Q C;  4EBB A;  1SF8 A;  3W2W A;  2EPN A;  2H7V C;  2NUT B;  5FCL A;  4O79 A;  1NSG B;  1WN0 A;  2EIN C;  2WVO A;  3DXJ F;  3T9O A;  1YA7 O;  3GWL A;  4BJT A;  4WAB A;  4K0D A;  3G50 A;  1CGN A;  3U8P A;  2FAP B;  2R7W A;  3C62 A;  2V3C C;  3DAF A;  3GOD A;  2VCA A;  3C63 A;  1U0B B;  5L3Q A;  1YAU O;  4MQ9 F;  3U5S A;  2IXP A;  3FOP A;  2KYH A;  3NYL A;  1LIH A;  3I5P A;  4CJG A;  2IOQ A;  4BEM J;  5A6A A;  4KC9 A;  5JVE A;  1O3U A;  2XM0 A;  1NBB A;  5E2Q A;  2R03 A;  4U9E A;  2WZL A;  4IAO A;  4XQ1 A;  3ZSU A;  2KW3 C;  4MVQ A;  2XXA A;  3FMS A;  3JRT A;  2AVK A;  1YAR O;  4H54 A;  2OQM A;  3HKK A;  3DI5 A;  3B9Q A;  1HW1 A;  3DE8 A;  3GM2 A;  3JYH A;  4OIQ F;  1EQ1 A;  3AG3 C;  2IBF A;  4RDA A;  4DOZ A;  4KNW A;  2XLM A;  1LM3 B;  2B0J A;  4EHP A;  5EHH A;  3IQT A;  1T01 A;  1DOV A;  5BQG A;  1H6G A;  2HKV A;  2KNH A;  1JR8 A;  1RKC A;  4P6I C;  2OU6 A;  4BJ6 C;  3S84 A;  4M63 A;  3W2V A;  3TOM A;  1MQV A;  5CI9 A;  3U3B A;  5KYW B;  1LI7 A;  4MVZ A;  3EPV A;  1F1M A;  1RXQ A;  2G3V A;  3C18 A;  3FVY A;  4LLC A;  5F28 E;  2ZD9 A;  1PD1 A;  3DMD A;  3ZWI A;  2HV6 A;  3RQE A;  1ZYR F;  1A7D A;  2TMV P;  2GAQ A;  3LLK A;  4CDY A;  3CZ6 A;  4IB4 A;  2DB4 A;  3CEX A;  5KYN A;  2GA0 A;  5L0C A;  1SZI A;  3SEO A;  3WHN A;  3L8J A;  2F22 A;  4J30 B;  1K04 A;  1OW8 A;  3N0T A;  1V4A A;  1ZW2 A;  2HFI A;  4XPW A;  5AC5 A;  4OIN F;  2C04 A;  2OEV A;  4FAP B;  4C3E A;  4IAR A;  2L6G A;  4U5F E;  4I1M A;  1OXB A;  1S05 A;  2ZXW C;  3EGD A;  4HEA J;  1V54 C;  2P6V A;  4G7H F;  3UGO A;  1C03 A;  1E2X A;  3U8V A;  2J0W A;  3U9J A;  1V55 C;  4ER9 A;  4DVY P;  1NFN A;  3ZIB A;  3VM6 A;  2VH3 A;  1OR3 A;  3POV A;  3AJM A;  1S7Z A;  2RD9 A;  1R5I D;  2L6H A;  1BR2 A;  1LVK A;  2R02 A;  1A7V A;  2LK4 A;  2PP4 A;  3EH2 A;  4DRI B;  4Q4Z F;  1I5N A;  1T5O A;  5L3V A;  2JPU A;  1VMA A;  3N24 A;  2ZPA A;  4E0I A;  1RMV A;  2L7A A;  1D0Y A;  2GFH A;  4CS8 C;  4LLE A;  3FDQ A;  3T6G B;  3NDB B;  4CIP A;  5DLJ A;  1YZC A;  1MMG A;  1O5H A;  1Z5Z A;  3EHN A;  3JRM O;  1QKR A;  4PJN A;  5E3A A;  3V5Y A;  3B0V C;  3LJB A;  3S29 A;  2R7U A;  2WB7 A;  2OJQ A;  3RW0 A;  3EZI A; 
#chains in the Genus database with same CATH homology
 3RQG A;  2L6G A;  3B71 A;  1ZZP A;  2YWA A;  3L8I A;  4EBJ A;  4XEV A;  1KTM A;  3S9O A;  1JOG A;  1WWP A;  2HSB A;  3K7D A;  4NQF A;  3C18 A;  4R32 A;  3AJM A;  5F28 E;  1O3U A;  1KNY A;  1WTY A;  2L6H A;  3O10 A;  1K40 A;  1K05 A;  3RQF A;  1OW6 A;  3RQE A;  2L6F A;  2LK4 A;  1OW7 A;  3TUL A;  4XEF A;  1WOL A;  1PV3 A;  3GM1 A;  3C8G D;  3BRJ A;  1QVX A;  3C8G A;  2JPU A;  3JYY A;  3GM2 A;  2JX0 A;  3U0C A;  3L8J A;  1UFB A;  4EBK A;  3MFN A;  3U3F A;  2KK1 A;  1K04 A;  1OW8 A;  3GM3 A;  4XEK A;  1V4A A;  2PBE A;  3JZ0 A;  2Q00 A;  3C8G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...