4JEBA

Crystal structure of an engineered ridc1 tetramer with four interfacial disulfide bonds and four three-coordinate zn(ii) sites
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMADFRHGFWILIGQIHAALHLANCGKVKEAQAAAEQLKCTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords soluble cytochrome b562
publication title In Vitro and Cellular Self-Assembly of a Zn-Binding Protein Cryptand via Templated Disulfide Bonds.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4jebA00
3TOMA 5JP7A 1MQVA 5JS5A 4ER9A 4JE9A 1NBBA 1E83A 1YZAA 3IQ6A 4IAQA 2YKZA 4CIPA 1CPQA 3TOLA 3M15A 2YL7A 2QLAA 5JLIA 4N6HA 5AGFA 5JRAA 3NMJA 1YYXA 2J8WA 2XLOA 3QVYA 3FOOA 3DE8A 1E86A 1JAFA 1S05A 4WGZA 1QPUA 2XLEA 1RCPA 3M4BA 2YL1A 2XM0A 4EIYA 4U9DA 3FOPA 3M4CA 5JVEA 4CJGA 3VRCA 1A7VA 1GQAA 256BA 1CGOA 4JKVA 4WGYA 2XLMA 4CJOA 4D4XA 3U8PA 2XM4A 3QW1A 5JT4A 2YLIA 3HNLA 4ULVA 1E85A 5JUAA 3QW0A 4N4WA 3ZWIA 4L6RA 4IARA 2YLDA 1M6TA 2XL8A 5JSLA 3ZTZA 4U9EA 3HNKA 5B3IA 2XLHA 4CDVA 2XLVA 2XLDA 2J9BA 2XL6A 2YL3A 3HNJA 2YLGA 2BC5A 4CX9A 3C62A 2CCYA 3ZQYA 4NC3A 1LM3B 4D4NA 3C63A 4CDYA 3NMIA 1YZCA 4JEBA 1CPRA 1CGNA 2XLWA 1YYJA 1EKYA 1APCA 1BBHA 4JEAA 3HNIA 3L1MA 3M79A 1QQ3A 3ZQVA 3DE9A 2YL0A 3QVZA 4CDAA 3ZTMA 4IB4A 3NMKA 1E84A 3IQ5A
chains in the Genus database with same CATH superfamily
4MNDA 4MTFA 3RIPA 1HW2A 1Q0FA 5JP7A 2EIJC 1FFHA 1KU2A 2YRFA 2Y3GA 4PJJA 3W8IA 4JE9A 3UMHA 2R7SA 1E83A 1TWCA 3V7OA 4AE4B 4YWQA 1V54C 4IRUA 2FAPB 4J32B 3SYNA 3EPVA 4QDLA 1YAUO 4GEHA 4KNVA 1EA8A 1D1CA 1CPQA 3RQEA 4XPXA 2EPMX 2IXOA 2PNOA 3JRTA 4K7BA 1ZHYA 5T3WA 3ABKC 5AGFA 3JT1A 3GEIA 2XSEA 2NPUA 3KKBA 5E3CA 1YYXA 3NKEA 4BJ6C 2J8WA 1L7CA 3C8GA 3DE8A 5F5HA 1OCZC 2EPOA 2CYDA 2ZPAA 3W2VA 1JAFA 2MWQA 4DRJB 4MW8A 2XLEA 1MMGA 2R9RB 1OXBA 2IYLD 4HFFB 2MHRA 4E7SA 3B0PA 3DZAA 1A41A 3H65A 1LE2A 4E0HA 1EI7A 2HJMA 4RDAA 1SR2A 3O6XA 1O3UA 3ASOC 3S28A 3WAQA 5DS6A 4BEMJ 4CS9A 1KNYA 1N1CA 2VC9A 1GQAA 2B0JA 256BA 3AGTA 5KYYB 2HZ8A 5IY5C 4ZLDA 1G5ZA 3EHNA 3U5SA 4WGYA 4BPMA 2XLMA 4YK5A 1QSPA 2P0NA 2PX3A 3PMRA 4A4AA 3SNHA 1YJGA 5B1BC 2LIGA 4NTBA 2A0UA 3QW1A 5HSWA 2YQYA 3V5YA 4A2NB 3U9JA 2IXNA 3CEXA 2C04A 1M2OA 4ULVA 3EHMA 2L7AA 5A6BA 4BJTA 3B0UX 2KC3A 4XEVA 1OKKD 2WVOA 3OEOA 3LLKA 5BQIA 4GQHA 3FAPB 1GM5A 1TR2A 2G3KA 2OEVA 2Y3DA 2KGOA 2YLDA 4IARA 4Z9IA 4IJJA 3SZRA 1MMAA 3LJBA 2ZXPA 4MVUA 4UDVA 4NCQA 1PV3A 1AUEA 3W2WA 4E18A 4JURI 3NDBB 1RXQA 4F4BA 2RSEB 3EGXA 5EGYA 5EHHA 3TK0A 3EGDA 4NY3A 1T9KA 2XLHA 3F47A 2NSFA 4QI2A 1A0BA 2H8AA 4MVSA 3GORA 1LIHA 2XLVA 3JTLO 5D91A 5DQZA 2XLDA 2J9BA 2XL6A 1BR4A 2WZGA 2YL3A 4Z9JA 4EWCA 3HNJA 1FFTC 4O7GA 5CI8A 4U5BE 2BC5A 2NUPA 2CW0F 5DS4A 4G7HF 5A6JA 2YWAA 3Q6MA 2A69F 3C62A 2CCYA 1TWAA 4CX9A 4KNWA 1XWJA 2XS8A 3GWLA 4W8KA 3I5PA 4XEFA 3TQOA 5L0JA 4OINF 1FMWA 4PJNA 3C63A 2B0HA 3K1IA 4FX5A 1MNDA 1ZU5A 3MBGA 4KC9A 3NYJA 4W8PA 3SXMA 3NG1A 2WVNA 2Y69C 1T01A 2ZD9A 1BBHA 2OG2A 1ORJA 2L6GA 3ECSA 3IQCA 3L1MA 1QQ3A 4JEAA 3UNGC 3DE9A 3K33A 4AL0A 4BJ1A 1I4ZA 4ANJA 3IEEA 3AQBA 4X0RA 1NLXA 4XQ1A 4DVZA 3CAXA 4CS9C 2W45A 4MVOA 5BUOA 1ZYRF 3C8GB 1E84A 3LEOA 5KYNA 1LS4A 3TOMA 2AWYA 2VH3A 3KYJA 3T9OA 1V55C 2NG1A 1MQVA 2KSFA 3DAFA 3B0VC 2OKUA 3K1HA 3LNMB 4EBBA 1U0BB 4CS8A 3NYLA 2Z15A 1UFBA 2QUPA 3UMIA 1YVIA 1YZAA 1Q0MA 1QKRA 4FAPB 2C03A 4MTOA 1I4YA 4CBEA 2R7TA 3VM6A 3IQ6A 2JX0A 2H7OA 3R7CA 2YKZA 2XS1A 3LESA 4MVQA 4O6NA 5A6KA 2YZSA 4ZLCA 1FTSA 3DM9B 1QVXA 3M15A 3JYHA 3K6BA 2Q4FA 2L9JA 4PACA 3S27A 3JSZA 4DBRA 3FDQA 1V4AA 2HV6A 5T3TA 4E7ZA 1PD0A 1ZU4A 1OQCA 3NMJA 3LS0A 1AEPA 3GODA 2JPUA 4OD4A 2Y3HA 1Y6DA 3FOOA 4QI0A 2P1AA 2R03A 2KK1A 2ICWG 4PJLA 1S05A 2R02A 2VB6A 3GANA 4U5EE 3ZC4A 1LS1A 1WN0A 4WJ0A 3G50A 4K0DA 1SYQA 4B6IA 3S0XA 1Z6AA 2F22A 2QY9A 2A68F 2KNHA 1WATA 1YARO 3DD7A 2GFHA 1OKKA 2YL1A 2OJQA 4G0HA 4JW1A 3FOPA 1SZIA 1LI5A 1Q0DA 1QLEC 2ZXWC 4JJGA 2IBFA 3B29A 4CJGA 1T6IA 1VYIA 2LQGA 4LLCA 1A7VA 4XPYA 3DXJF 1DOWA 2EINC 2D4UA 4JCHA 4JKVA 5T1DB 3SP1A 5EK0A 3EGXB 1HMOA 1SMYF 2QE9A 2W4MA 3AOUA 3EGDB 3RQFA 2P6VA 1VLSA 1QZXA 3C7JA 4FWVA 1VTMP 2R7UA 2EIKC 1RKCA 3K1IC 4JRZA 2PBEA 5B1AC 1ZHZA 2LD6A 3RQGA 3ZVRA 1ZW2A 1FNTc 1HMDA 4DXWA 1OCCC 3E9VA 2Q9CA 3B71A 5DQTA 3F46A 2NUPB 5L3QA 3ZIBA 3L34A 1HW1A 5DS5A 2AVKA 5D92A 1JPJA 4I1MA 5KYWB 3ZSUA 1JR8A 3QW0A 1LE4A 3S9OA 4U5CE 4PK4A 4AX2A 1NU9C 3BEHA 4L6RA 3H2VA 3IPMO 3U3FA 4JZAA 2M64A 1VOMA 2R7RA 3Q6NA 4P9TA 3RFYA 1TKNA 3RW0A 4C7OB 2A0BA 4U9EA 2QTVA 1JMWA 4HEAJ 3HNKA 3PCVA 1D0ZA 2PFDA 3LAYA 4XLNF 4Q5SF 1Z3IX 4LDQA 2OCCC 3W8HA 5B3IA 1RMVA 2CNWD 2WB7A 1C02A 1HY5A 1W2WA 2EILC 3HLZA 3Q7GA 2Q7RA 3LNRA 2OQMA 2J7PD 2JD3A 2L6FA 1G4WR 5KYXB 1H6GA 1D0YA 1JRAA 3L8JA 4JTCB 4AL1A 1RKEB 1YA7O 2A6HF 3KPHA 3O10A 4LERA 4DJ9A 2YVKA 3POVA 1Y4CA 1TWHA 4JTDB 5COGA 2EPLX 4OIRF 1WWPA 3ATPA 1OXKA 2DB4A 3H2UA 3ZQYA 1H9TA 5TJ5E 4BJ5A 1Q0GA 1T5OA 3T6GB 3C8ZA 1R5ID 5F28E 1I5NA 1XZPA 2UUHA 1ZHWA 4DRHB 1TFOB 2CDQA 4CDYA 3CQZA 3X1OA 3GWNA 4I3MA 4J7TA 4H4KC 1EKYA 1BR1A 1D1BA 3DWWA 1NU7D 3GM2A 1OCRC 3ZQVA 4EHPA 1M57C 3QVZA 3S84A 4CIHA 3G4XA 3MYFA 1Z63A 2V3CC 3OWTA 3NMKA 3UGPA 3JZ0A 1RJ9A 2ETSA 4EBKA 3TJ6A 1F1MA 4IAOA 3O55A 4U5FE 4HFKB 5BQHA 1KTMA 2HFIA 4Q4ZF 3DAGA 3LS1A 2OOCA 2EPNA 1D1AA 4PR9A 3LEVA 5KYWA 5E2QA 4J30B 1Z5ZA 4J7YA 4MVMA 3G4ZA 2G62A 2AWCA 2J9VA 4O79A 1D0XA 3AG2C 2YL7A 3BRJA 5KYUA 4C7OA 1K04A 1R4TA 5JLIA 3MLGA 3FMSA 2I15A 2LCHA 3VAYA 4E17A 4YJWA 1M2VA 3US6A 2LK4A 4FESA 4YT5A 4DOZA 3V5XA 5JRAA 2XLOA 3QVYA 2WZFA 5DLJA 3T6BA 4JTAB 3AGUA 4LDRA 4YT4A 1E86A 2NUTA 1O87A 1TWGA 2BE5F 3RH3A 2VASA 3M1CB 4EUKB 1JOGA 1TQGA 2IXMA 4ONSA 1RCPA 3U8VA 3VYWA 5KYXA 3V5ZA 1RKEA 2WL8A 1BR2A 2EIMC 2GAQA 3DMDA 5COMA 1OR3A 4EIYA 4U9DA 2NSGA 4YT2A 3EFOA 4MVZA 5GPGB 1ZZPA 4YL1A 1YDIA 3AQCA 3M4CA 1NG1A 3SEOA 3T6JA 5JVEA 3KMIA 2Q9AA 3PHF2 3C18A 3ZG1A 3VRCA 3IHUA 3JYYA 1CGOA 2X51A 4NTAA 4YL0A 3CSKA 4XTKA 1UG7A 4BJ5C 2CGEA 1LVKA 2IOQA 2OU6A 2KYHA 4AK9A 4CJOA 4CSAA 2HMQA 4ULWA 3ASNC 4D4XA 4P6IC 2CNWA 4DVYP 2XM4A 3X2QC 2TMVP 2AP3A 1OCOC 3FHDA 2J7PA 1OW8A 2HKVA 5A6BD 2A6EF 1SF8A 1ORYA 1H7IA 4XEKA 1E85A 3ITFA 3U2LA 1VK5A 3EH2A 3FAJA 2H7BA 3N24A 4O6YA 1O5HA 1S7ZA 2LSEA 5A69A 2QNLA 5L0FA 3ABMC 4BEJA 3EQLF 4MQ9F 3T4RA 2XL8A 3DKAA 3AG3C 5COFA 1HE9A 3TULA 4BG0A 5FZTA 4JCZA 2J0XA 1JPNA 4EBJA 2R7QA 4PFOA 1T6QA 2RD9A 3CZ6A 4CDVA 1IW7F 4N06A 3B9QA 2L6HA 1RJ9B 4MS2A 5L0DA 1GS9A 2XL4A 3FVYA 2IXPA 3OA1A 4XLPF 2HS5A 5A6AA 4I44A 4OIQF 3VF0A 4LDKA 5AC5A 4JC7A 4JIOA 3TJ5A 1B68A 2Y39A 3EH1A 3DM5A 2W4BA 1T6UA 1K40A 3LUTB 4YT8A 3PDMP 1VMAA 4PFPA 3I5QA 4CS7A 2HUJA 4GYTA 2HMZA 5AC4A 4OIOF 3RF3A 1OW6A 2Q3TA 1OR2A 3E70C 2WVQA 3KL4A 1PCXA 3UMKA 3N2ZB 1J8MF 3NMIA 3WODF 1WOLA 2J46A 4JEBA 2R7OA 1XZQA 2XLWA 3R2PA 1YYJA 1V74B 3WHNA 4CS8C 2ASRA 5KYUB 1NZEA 3M79A 3SXKA 1GGQA 2BL2A 2OEXA 4U5DE 3RYLA 2YL0A 1M2VB 4WABA 4U5HA 1OW7A 4IB4A 1VB5A 1ORSC 3EJNA 3UGOA 2L81A 2ZXRA 2NUTB 4EKWA 3IQ5A 2J9WA 4O6MA 3NYMA 2VCAA 1YA9A 3NRHA 5JS5A 1TFKB 2XXAA 4ER9A 4CSAC 2W9YA 1VYKA 2P7VA 1LI7A 3SXZA 1ZW3A 1NBBA 3GM3A 1G4US 1ST6A 3EFOB 4DBQA 1HE1A 1MMDA 3GEEA 3K7DA 1Z23A 2FFHA 2MYSA 2P61A 3EZIA 4IAQA 3EG9A 4K1OA 2R7WA 4CIPA 2XRHA 2KJGA 2WZLA 1MNEA 3TOLA 2Q00A 3RKOF 2QLAA 4D4NA 4N6HA 3RVZA 3KH2A 5HV9A 1CGME 1Q0KA 4IGGA 3S29A 3U2MA 2VCCA 2J9UA 4JJFA 3HTKC 5L0GA 1YLMA 2PF4E 1G8XA 2Q9BA 4P9FA 3DJUB 5E3AA 1FR0A 4WGZA 2ZXOA 1LKXA 1QPUA 2HSBA 4U5GA 5L0IA 5F5FA 1M56C 4IWBA 3M4BA 1PD1A 1LPEA 2R25A 3JCUQ 4PJMA 1WGWA 4MW3A 3N0TA 2XM0A 1A7DA 4C3DA 4I1OB 4AE4A 4MTGA 3DI5A 2R05A 3AG1C 3O39A 2G3VA 3L0IA 2KQ9A 3K66A 3Q7LA 1C03A 1Z7Qc 2H7VC 3MFNA 4G78A 1ZHXA 1ZHTA 2VCBA 4N6CA 2I8BA 2PX0A 4M63A 4Z9HA 3SXYA 4OIPF 2X0CA 2AU5A 5B3SC 5FCLA 2J45A 3IQTA 3C8GD 1WTYA 4RD9A 5BQGA 3U8PA 5JT4A 5L0CA 2HSQA 2YLIA 4XWJA 3GM1A 1VLTA 5CIVA 1WASA 4HE8D 3HNLA 2J0WA 2M4EA 3KYIA 2DYRC 3TD7A 4LACB 4E0IA 3HJCA 5JUAA 1ZVZA 4KBLA 2KW3C 1NFOA 1C17M 3LLIA 4N4WA 4OD5A 1K05A 3NKDA 3ZWIA 3WG7C 2HV7A 1M6TA 3FXHA 2DGJA 2GA0A 5L3VA 1L3PA 3GEHA 4BJ6A 5JSLA 1E2XA 3A9CA 4JVSA 1H9GA 3ABLC 3ZTZA 2FGYA 5KYYA 2LFDA 2IM8A 4G7ZF 1FMVA 3AG4C 3J06A 1AVOB 2R7XA 1U6HA 3A11A 2YEVA 1NSGB 3I4UA 4C3EA 2GWWA 3JSEO 3RVYA 4YL3A 2Y3BA 1FAPB 2YLGA 2EPKX 3QMKA 4DRIB 4KI2A 2XXAB 5E33A 2UUIA 5DVWA 3L8IA 3ZDLA 4H54A 5L0HA 3U0CA 4R32A 2V26A 3QZCA 3MX3A 2DYSC 2O9XA 1A7EA 5CI9A 1MMNA 4LLEA 4NC3A 2LP4A 3QTHA 3U3BA 4Q7CA 1LM3B 4YN0B 2OJED 3S90A 1EQ1A 4RBNA 3EG9B 2D5RB 1NFNA 1IZMA 3EZHA 4MVRA 4NTFA 2R7VA 1YZCA 1CPRA 1CGNA 1U89A 3HKKA 1APCA 2PP4A 2YHSA 3HNIA 1BDJB 4C3BA 1BZ4A 2A1DD 1DOVA 4G7OF 3W4YA 2HJ3A 2GDCA 4XPWA 3UR3C 4CDAA 3ZTMA 3U9MA 3MYIA 2E87A 2LFFA 2DI3A 3JRMO 4NQFA 1J8YF 5K0IA 3AJMA 3DJNB
chains in the Genus database with same CATH topology
3TOMA 5JP7A 1MQVA 5JS5A 4ER9A 4JE9A 1NBBA 1E83A 1YZAA 3IQ6A 4IAQA 2YKZA 4CIPA 1CPQA 3TOLA 3M15A 2YL7A 2QLAA 5JLIA 4N6HA 5AGFA 5JRAA 3NMJA 1YYXA 2J8WA 2XLOA 3QVYA 3FOOA 3DE8A 1E86A 1JAFA 1S05A 4WGZA 1QPUA 2XLEA 1RCPA 3M4BA 2YL1A 2XM0A 4EIYA 4U9DA 3FOPA 3M4CA 5JVEA 4CJGA 3VRCA 1A7VA 1GQAA 256BA 1CGOA 4JKVA 4WGYA 2XLMA 4CJOA 4D4XA 3U8PA 2XM4A 3QW1A 5JT4A 2YLIA 3HNLA 4ULVA 1E85A 5JUAA 3QW0A 4N4WA 3ZWIA 4L6RA 4IARA 2YLDA 1M6TA 2XL8A 5JSLA 3ZTZA 4U9EA 3HNKA 5B3IA 2XLHA 4CDVA 2XLVA 2XLDA 2J9BA 2XL6A 2YL3A 3HNJA 2YLGA 2BC5A 4CX9A 3C62A 2CCYA 3ZQYA 4NC3A 1LM3B 4D4NA 3C63A 4CDYA 3NMIA 1YZCA 4JEBA 1CPRA 1CGNA 2XLWA 1YYJA 1EKYA 1APCA 1BBHA 4JEAA 3HNIA 3L1MA 3M79A 1QQ3A 3ZQVA 3DE9A 2YL0A 3QVZA 4CDAA 3ZTMA 4IB4A 3NMKA 1E84A 3IQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TOM A;  5JP7 A;  1MQV A;  5JS5 A;  4ER9 A;  4JE9 A;  1NBB A;  1E83 A;  1YZA A;  3IQ6 A;  4IAQ A;  2YKZ A;  4CIP A;  1CPQ A;  3TOL A;  3M15 A;  2YL7 A;  2QLA A;  5JLI A;  4N6H A;  5AGF A;  5JRA A;  3NMJ A;  1YYX A;  2J8W A;  2XLO A;  3QVY A;  3FOO A;  3DE8 A;  1E86 A;  1JAF A;  1S05 A;  4WGZ A;  1QPU A;  2XLE A;  1RCP A;  3M4B A;  2YL1 A;  2XM0 A;  4EIY A;  4U9D A;  3FOP A;  3M4C A;  5JVE A;  4CJG A;  3VRC A;  1A7V A;  1GQA A;  256B A;  1CGO A;  4JKV A;  4WGY A;  2XLM A;  4CJO A;  4D4X A;  3U8P A;  2XM4 A;  3QW1 A;  5JT4 A;  2YLI A;  3HNL A;  4ULV A;  1E85 A;  5JUA A;  3QW0 A;  4N4W A;  3ZWI A;  4L6R A;  4IAR A;  2YLD A;  1M6T A;  2XL8 A;  5JSL A;  3ZTZ A;  4U9E A;  3HNK A;  5B3I A;  2XLH A;  4CDV A;  2XLV A;  2XLD A;  2J9B A;  2XL6 A;  2YL3 A;  3HNJ A;  2YLG A;  2BC5 A;  4CX9 A;  3C62 A;  2CCY A;  3ZQY A;  4NC3 A;  1LM3 B;  4D4N A;  3C63 A;  4CDY A;  3NMI A;  1YZC A;  4JEB A;  1CPR A;  1CGN A;  2XLW A;  1YYJ A;  1EKY A;  1APC A;  1BBH A;  4JEA A;  3HNI A;  3L1M A;  3M79 A;  1QQ3 A;  3ZQV A;  3DE9 A;  2YL0 A;  3QVZ A;  4CDA A;  3ZTM A;  4IB4 A;  3NMK A;  1E84 A;  3IQ5 A; 
#chains in the Genus database with same CATH topology
 4MND A;  4MTF A;  3RIP A;  1HW2 A;  1Q0F A;  5JP7 A;  2EIJ C;  1FFH A;  1KU2 A;  2YRF A;  2Y3G A;  4PJJ A;  3W8I A;  4JE9 A;  3UMH A;  2R7S A;  1E83 A;  1TWC A;  3V7O A;  4AE4 B;  4YWQ A;  1V54 C;  4IRU A;  2FAP B;  4J32 B;  3SYN A;  3EPV A;  4QDL A;  1YAU O;  4GEH A;  4KNV A;  1EA8 A;  1D1C A;  1CPQ A;  3RQE A;  4XPX A;  2EPM X;  2IXO A;  2PNO A;  3JRT A;  4K7B A;  1ZHY A;  5T3W A;  3ABK C;  5AGF A;  3JT1 A;  3GEI A;  2XSE A;  2NPU A;  3KKB A;  5E3C A;  1YYX A;  3NKE A;  4BJ6 C;  2J8W A;  1L7C A;  3C8G A;  3DE8 A;  5F5H A;  1OCZ C;  2EPO A;  2CYD A;  2ZPA A;  3W2V A;  1JAF A;  2MWQ A;  4DRJ B;  4MW8 A;  2XLE A;  1MMG A;  2R9R B;  1OXB A;  2IYL D;  4HFF B;  2MHR A;  4E7S A;  3B0P A;  3DZA A;  1A41 A;  3H65 A;  1LE2 A;  4E0H A;  1EI7 A;  2HJM A;  4RDA A;  1SR2 A;  3O6X A;  1O3U A;  3ASO C;  3S28 A;  3WAQ A;  5DS6 A;  4BEM J;  4CS9 A;  1KNY A;  1N1C A;  2VC9 A;  1GQA A;  2B0J A;  256B A;  3AGT A;  5KYY B;  2HZ8 A;  5IY5 C;  4ZLD A;  1G5Z A;  3EHN A;  3U5S A;  4WGY A;  4BPM A;  2XLM A;  4YK5 A;  1QSP A;  2P0N A;  2PX3 A;  3PMR A;  4A4A A;  3SNH A;  1YJG A;  5B1B C;  2LIG A;  4NTB A;  2A0U A;  3QW1 A;  5HSW A;  2YQY A;  3V5Y A;  4A2N B;  3U9J A;  2IXN A;  3CEX A;  2C04 A;  1M2O A;  4ULV A;  3EHM A;  2L7A A;  5A6B A;  4BJT A;  3B0U X;  2KC3 A;  4XEV A;  1OKK D;  2WVO A;  3OEO A;  3LLK A;  5BQI A;  4GQH A;  3FAP B;  1GM5 A;  1TR2 A;  2G3K A;  2OEV A;  2Y3D A;  2KGO A;  2YLD A;  4IAR A;  4Z9I A;  4IJJ A;  3SZR A;  1MMA A;  3LJB A;  2ZXP A;  4MVU A;  4UDV A;  4NCQ A;  1PV3 A;  1AUE A;  3W2W A;  4E18 A;  4JUR I;  3NDB B;  1RXQ A;  4F4B A;  2RSE B;  3EGX A;  5EGY A;  5EHH A;  3TK0 A;  3EGD A;  4NY3 A;  1T9K A;  2XLH A;  3F47 A;  2NSF A;  4QI2 A;  1A0B A;  2H8A A;  4MVS A;  3GOR A;  1LIH A;  2XLV A;  3JTL O;  5D91 A;  5DQZ A;  2XLD A;  2J9B A;  2XL6 A;  1BR4 A;  2WZG A;  2YL3 A;  4Z9J A;  4EWC A;  3HNJ A;  1FFT C;  4O7G A;  5CI8 A;  4U5B E;  2BC5 A;  2NUP A;  2CW0 F;  5DS4 A;  4G7H F;  5A6J A;  2YWA A;  3Q6M A;  2A69 F;  3C62 A;  2CCY A;  1TWA A;  4CX9 A;  4KNW A;  1XWJ A;  2XS8 A;  3GWL A;  4W8K A;  3I5P A;  4XEF A;  3TQO A;  5L0J A;  4OIN F;  1FMW A;  4PJN A;  3C63 A;  2B0H A;  3K1I A;  4FX5 A;  1MND A;  1ZU5 A;  3MBG A;  4KC9 A;  3NYJ A;  4W8P A;  3SXM A;  3NG1 A;  2WVN A;  2Y69 C;  1T01 A;  2ZD9 A;  1BBH A;  2OG2 A;  1ORJ A;  2L6G A;  3ECS A;  3IQC A;  3L1M A;  1QQ3 A;  4JEA A;  3UNG C;  3DE9 A;  3K33 A;  4AL0 A;  4BJ1 A;  1I4Z A;  4ANJ A;  3IEE A;  3AQB A;  4X0R A;  1NLX A;  4XQ1 A;  4DVZ A;  3CAX A;  4CS9 C;  2W45 A;  4MVO A;  5BUO A;  1ZYR F;  3C8G B;  1E84 A;  3LEO A;  5KYN A;  1LS4 A;  3TOM A;  2AWY A;  2VH3 A;  3KYJ A;  3T9O A;  1V55 C;  2NG1 A;  1MQV A;  2KSF A;  3DAF A;  3B0V C;  2OKU A;  3K1H A;  3LNM B;  4EBB A;  1U0B B;  4CS8 A;  3NYL A;  2Z15 A;  1UFB A;  2QUP A;  3UMI A;  1YVI A;  1YZA A;  1Q0M A;  1QKR A;  4FAP B;  2C03 A;  4MTO A;  1I4Y A;  4CBE A;  2R7T A;  3VM6 A;  3IQ6 A;  2JX0 A;  2H7O A;  3R7C A;  2YKZ A;  2XS1 A;  3LES A;  4MVQ A;  4O6N A;  5A6K A;  2YZS A;  4ZLC A;  1FTS A;  3DM9 B;  1QVX A;  3M15 A;  3JYH A;  3K6B A;  2Q4F A;  2L9J A;  4PAC A;  3S27 A;  3JSZ A;  4DBR A;  3FDQ A;  1V4A A;  2HV6 A;  5T3T A;  4E7Z A;  1PD0 A;  1ZU4 A;  1OQC A;  3NMJ A;  3LS0 A;  1AEP A;  3GOD A;  2JPU A;  4OD4 A;  2Y3H A;  1Y6D A;  3FOO A;  4QI0 A;  2P1A A;  2R03 A;  2KK1 A;  2ICW G;  4PJL A;  1S05 A;  2R02 A;  2VB6 A;  3GAN A;  4U5E E;  3ZC4 A;  1LS1 A;  1WN0 A;  4WJ0 A;  3G50 A;  4K0D A;  1SYQ A;  4B6I A;  3S0X A;  1Z6A A;  2F22 A;  2QY9 A;  2A68 F;  2KNH A;  1WAT A;  1YAR O;  3DD7 A;  2GFH A;  1OKK A;  2YL1 A;  2OJQ A;  4G0H A;  4JW1 A;  3FOP A;  1SZI A;  1LI5 A;  1Q0D A;  1QLE C;  2ZXW C;  4JJG A;  2IBF A;  3B29 A;  4CJG A;  1T6I A;  1VYI A;  2LQG A;  4LLC A;  1A7V A;  4XPY A;  3DXJ F;  1DOW A;  2EIN C;  2D4U A;  4JCH A;  4JKV A;  5T1D B;  3SP1 A;  5EK0 A;  3EGX B;  1HMO A;  1SMY F;  2QE9 A;  2W4M A;  3AOU A;  3EGD B;  3RQF A;  2P6V A;  1VLS A;  1QZX A;  3C7J A;  4FWV A;  1VTM P;  2R7U A;  2EIK C;  1RKC A;  3K1I C;  4JRZ A;  2PBE A;  5B1A C;  1ZHZ A;  2LD6 A;  3RQG A;  3ZVR A;  1ZW2 A;  1FNT c;  1HMD A;  4DXW A;  1OCC C;  3E9V A;  2Q9C A;  3B71 A;  5DQT A;  3F46 A;  2NUP B;  5L3Q A;  3ZIB A;  3L34 A;  1HW1 A;  5DS5 A;  2AVK A;  5D92 A;  1JPJ A;  4I1M A;  5KYW B;  3ZSU A;  1JR8 A;  3QW0 A;  1LE4 A;  3S9O A;  4U5C E;  4PK4 A;  4AX2 A;  1NU9 C;  3BEH A;  4L6R A;  3H2V A;  3IPM O;  3U3F A;  4JZA A;  2M64 A;  1VOM A;  2R7R A;  3Q6N A;  4P9T A;  3RFY A;  1TKN A;  3RW0 A;  4C7O B;  2A0B A;  4U9E A;  2QTV A;  1JMW A;  4HEA J;  3HNK A;  3PCV A;  1D0Z A;  2PFD A;  3LAY A;  4XLN F;  4Q5S F;  1Z3I X;  4LDQ A;  2OCC C;  3W8H A;  5B3I A;  1RMV A;  2CNW D;  2WB7 A;  1C02 A;  1HY5 A;  1W2W A;  2EIL C;  3HLZ A;  3Q7G A;  2Q7R A;  3LNR A;  2OQM A;  2J7P D;  2JD3 A;  2L6F A;  1G4W R;  5KYX B;  1H6G A;  1D0Y A;  1JRA A;  3L8J A;  4JTC B;  4AL1 A;  1RKE B;  1YA7 O;  2A6H F;  3KPH A;  3O10 A;  4LER A;  4DJ9 A;  2YVK A;  3POV A;  1Y4C A;  1TWH A;  4JTD B;  5COG A;  2EPL X;  4OIR F;  1WWP A;  3ATP A;  1OXK A;  2DB4 A;  3H2U A;  3ZQY A;  1H9T A;  5TJ5 E;  4BJ5 A;  1Q0G A;  1T5O A;  3T6G B;  3C8Z A;  1R5I D;  5F28 E;  1I5N A;  1XZP A;  2UUH A;  1ZHW A;  4DRH B;  1TFO B;  2CDQ A;  4CDY A;  3CQZ A;  3X1O A;  3GWN A;  4I3M A;  4J7T A;  4H4K C;  1EKY A;  1BR1 A;  1D1B A;  3DWW A;  1NU7 D;  3GM2 A;  1OCR C;  3ZQV A;  4EHP A;  1M57 C;  3QVZ A;  3S84 A;  4CIH A;  3G4X A;  3MYF A;  1Z63 A;  2V3C C;  3OWT A;  3NMK A;  3UGP A;  3JZ0 A;  1RJ9 A;  2ETS A;  4EBK A;  3TJ6 A;  1F1M A;  4IAO A;  3O55 A;  4U5F E;  4HFK B;  5BQH A;  1KTM A;  2HFI A;  4Q4Z F;  3DAG A;  3LS1 A;  2OOC A;  2EPN A;  1D1A A;  4PR9 A;  3LEV A;  5KYW A;  5E2Q A;  4J30 B;  1Z5Z A;  4J7Y A;  4MVM A;  3G4Z A;  2G62 A;  2AWC A;  2J9V A;  4O79 A;  1D0X A;  3AG2 C;  2YL7 A;  3BRJ A;  5KYU A;  4C7O A;  1K04 A;  1R4T A;  5JLI A;  3MLG A;  3FMS A;  2I15 A;  2LCH A;  3VAY A;  4E17 A;  4YJW A;  1M2V A;  3US6 A;  2LK4 A;  4FES A;  4YT5 A;  4DOZ A;  3V5X A;  5JRA A;  2XLO A;  3QVY A;  2WZF A;  5DLJ A;  3T6B A;  4JTA B;  3AGU A;  4LDR A;  4YT4 A;  1E86 A;  2NUT A;  1O87 A;  1TWG A;  2BE5 F;  3RH3 A;  2VAS A;  3M1C B;  4EUK B;  1JOG A;  1TQG A;  2IXM A;  4ONS A;  1RCP A;  3U8V A;  3VYW A;  5KYX A;  3V5Z A;  1RKE A;  2WL8 A;  1BR2 A;  2EIM C;  2GAQ A;  3DMD A;  5COM A;  1OR3 A;  4EIY A;  4U9D A;  2NSG A;  4YT2 A;  3EFO A;  4MVZ A;  5GPG B;  1ZZP A;  4YL1 A;  1YDI A;  3AQC A;  3M4C A;  1NG1 A;  3SEO A;  3T6J A;  5JVE A;  3KMI A;  2Q9A A;  3PHF 2;  3C18 A;  3ZG1 A;  3VRC A;  3IHU A;  3JYY A;  1CGO A;  2X51 A;  4NTA A;  4YL0 A;  3CSK A;  4XTK A;  1UG7 A;  4BJ5 C;  2CGE A;  1LVK A;  2IOQ A;  2OU6 A;  2KYH A;  4AK9 A;  4CJO A;  4CSA A;  2HMQ A;  4ULW A;  3ASN C;  4D4X A;  4P6I C;  2CNW A;  4DVY P;  2XM4 A;  3X2Q C;  2TMV P;  2AP3 A;  1OCO C;  3FHD A;  2J7P A;  1OW8 A;  2HKV A;  5A6B D;  2A6E F;  1SF8 A;  1ORY A;  1H7I A;  4XEK A;  1E85 A;  3ITF A;  3U2L A;  1VK5 A;  3EH2 A;  3FAJ A;  2H7B A;  3N24 A;  4O6Y A;  1O5H A;  1S7Z A;  2LSE A;  5A69 A;  2QNL A;  5L0F A;  3ABM C;  4BEJ A;  3EQL F;  4MQ9 F;  3T4R A;  2XL8 A;  3DKA A;  3AG3 C;  5COF A;  1HE9 A;  3TUL A;  4BG0 A;  5FZT A;  4JCZ A;  2J0X A;  1JPN A;  4EBJ A;  2R7Q A;  4PFO A;  1T6Q A;  2RD9 A;  3CZ6 A;  4CDV A;  1IW7 F;  4N06 A;  3B9Q A;  2L6H A;  1RJ9 B;  4MS2 A;  5L0D A;  1GS9 A;  2XL4 A;  3FVY A;  2IXP A;  3OA1 A;  4XLP F;  2HS5 A;  5A6A A;  4I44 A;  4OIQ F;  3VF0 A;  4LDK A;  5AC5 A;  4JC7 A;  4JIO A;  3TJ5 A;  1B68 A;  2Y39 A;  3EH1 A;  3DM5 A;  2W4B A;  1T6U A;  1K40 A;  3LUT B;  4YT8 A;  3PDM P;  1VMA A;  4PFP A;  3I5Q A;  4CS7 A;  2HUJ A;  4GYT A;  2HMZ A;  5AC4 A;  4OIO F;  3RF3 A;  1OW6 A;  2Q3T A;  1OR2 A;  3E70 C;  2WVQ A;  3KL4 A;  1PCX A;  3UMK A;  3N2Z B;  1J8M F;  3NMI A;  3WOD F;  1WOL A;  2J46 A;  4JEB A;  2R7O A;  1XZQ A;  2XLW A;  3R2P A;  1YYJ A;  1V74 B;  3WHN A;  4CS8 C;  2ASR A;  5KYU B;  1NZE A;  3M79 A;  3SXK A;  1GGQ A;  2BL2 A;  2OEX A;  4U5D E;  3RYL A;  2YL0 A;  1M2V B;  4WAB A;  4U5H A;  1OW7 A;  4IB4 A;  1VB5 A;  1ORS C;  3EJN A;  3UGO A;  2L81 A;  2ZXR A;  2NUT B;  4EKW A;  3IQ5 A;  2J9W A;  4O6M A;  3NYM A;  2VCA A;  1YA9 A;  3NRH A;  5JS5 A;  1TFK B;  2XXA A;  4ER9 A;  4CSA C;  2W9Y A;  1VYK A;  2P7V A;  1LI7 A;  3SXZ A;  1ZW3 A;  1NBB A;  3GM3 A;  1G4U S;  1ST6 A;  3EFO B;  4DBQ A;  1HE1 A;  1MMD A;  3GEE A;  3K7D A;  1Z23 A;  2FFH A;  2MYS A;  2P61 A;  3EZI A;  4IAQ A;  3EG9 A;  4K1O A;  2R7W A;  4CIP A;  2XRH A;  2KJG A;  2WZL A;  1MNE A;  3TOL A;  2Q00 A;  3RKO F;  2QLA A;  4D4N A;  4N6H A;  3RVZ A;  3KH2 A;  5HV9 A;  1CGM E;  1Q0K A;  4IGG A;  3S29 A;  3U2M A;  2VCC A;  2J9U A;  4JJF A;  3HTK C;  5L0G A;  1YLM A;  2PF4 E;  1G8X A;  2Q9B A;  4P9F A;  3DJU B;  5E3A A;  1FR0 A;  4WGZ A;  2ZXO A;  1LKX A;  1QPU A;  2HSB A;  4U5G A;  5L0I A;  5F5F A;  1M56 C;  4IWB A;  3M4B A;  1PD1 A;  1LPE A;  2R25 A;  3JCU Q;  4PJM A;  1WGW A;  4MW3 A;  3N0T A;  2XM0 A;  1A7D A;  4C3D A;  4I1O B;  4AE4 A;  4MTG A;  3DI5 A;  2R05 A;  3AG1 C;  3O39 A;  2G3V A;  3L0I A;  2KQ9 A;  3K66 A;  3Q7L A;  1C03 A;  1Z7Q c;  2H7V C;  3MFN A;  4G78 A;  1ZHX A;  1ZHT A;  2VCB A;  4N6C A;  2I8B A;  2PX0 A;  4M63 A;  4Z9H A;  3SXY A;  4OIP F;  2X0C A;  2AU5 A;  5B3S C;  5FCL A;  2J45 A;  3IQT A;  3C8G D;  1WTY A;  4RD9 A;  5BQG A;  3U8P A;  5JT4 A;  5L0C A;  2HSQ A;  2YLI A;  4XWJ A;  3GM1 A;  1VLT A;  5CIV A;  1WAS A;  4HE8 D;  3HNL A;  2J0W A;  2M4E A;  3KYI A;  2DYR C;  3TD7 A;  4LAC B;  4E0I A;  3HJC A;  5JUA A;  1ZVZ A;  4KBL A;  2KW3 C;  1NFO A;  1C17 M;  3LLI A;  4N4W A;  4OD5 A;  1K05 A;  3NKD A;  3ZWI A;  3WG7 C;  2HV7 A;  1M6T A;  3FXH A;  2DGJ A;  2GA0 A;  5L3V A;  1L3P A;  3GEH A;  4BJ6 A;  5JSL A;  1E2X A;  3A9C A;  4JVS A;  1H9G A;  3ABL C;  3ZTZ A;  2FGY A;  5KYY A;  2LFD A;  2IM8 A;  4G7Z F;  1FMV A;  3AG4 C;  3J06 A;  1AVO B;  2R7X A;  1U6H A;  3A11 A;  2YEV A;  1NSG B;  3I4U A;  4C3E A;  2GWW A;  3JSE O;  3RVY A;  4YL3 A;  2Y3B A;  1FAP B;  2YLG A;  2EPK X;  3QMK A;  4DRI B;  4KI2 A;  2XXA B;  5E33 A;  2UUI A;  5DVW A;  3L8I A;  3ZDL A;  4H54 A;  5L0H A;  3U0C A;  4R32 A;  2V26 A;  3QZC A;  3MX3 A;  2DYS C;  2O9X A;  1A7E A;  5CI9 A;  1MMN A;  4LLE A;  4NC3 A;  2LP4 A;  3QTH A;  3U3B A;  4Q7C A;  1LM3 B;  4YN0 B;  2OJE D;  3S90 A;  1EQ1 A;  4RBN A;  3EG9 B;  2D5R B;  1NFN A;  1IZM A;  3EZH A;  4MVR A;  4NTF A;  2R7V A;  1YZC A;  1CPR A;  1CGN A;  1U89 A;  3HKK A;  1APC A;  2PP4 A;  2YHS A;  3HNI A;  1BDJ B;  4C3B A;  1BZ4 A;  2A1D D;  1DOV A;  4G7O F;  3W4Y A;  2HJ3 A;  2GDC A;  4XPW A;  3UR3 C;  4CDA A;  3ZTM A;  3U9M A;  3MYI A;  2E87 A;  2LFF A;  2DI3 A;  3JRM O;  4NQF A;  1J8Y F;  5K0I A;  3AJM A;  3DJN B; 
#chains in the Genus database with same CATH homology
 3TOM A;  5JP7 A;  1MQV A;  5JS5 A;  4ER9 A;  4JE9 A;  1NBB A;  1E83 A;  1YZA A;  3IQ6 A;  4IAQ A;  2YKZ A;  4CIP A;  1CPQ A;  3TOL A;  3M15 A;  2YL7 A;  2QLA A;  5JLI A;  4N6H A;  5AGF A;  5JRA A;  3NMJ A;  1YYX A;  2J8W A;  2XLO A;  3QVY A;  3FOO A;  3DE8 A;  1E86 A;  1JAF A;  1S05 A;  4WGZ A;  1QPU A;  2XLE A;  1RCP A;  3M4B A;  2YL1 A;  2XM0 A;  4EIY A;  4U9D A;  3FOP A;  3M4C A;  5JVE A;  4CJG A;  3VRC A;  1A7V A;  1GQA A;  256B A;  1CGO A;  4JKV A;  4WGY A;  2XLM A;  4CJO A;  4D4X A;  3U8P A;  2XM4 A;  3QW1 A;  5JT4 A;  2YLI A;  3HNL A;  4ULV A;  1E85 A;  5JUA A;  3QW0 A;  4N4W A;  3ZWI A;  4L6R A;  4IAR A;  2YLD A;  1M6T A;  2XL8 A;  5JSL A;  3ZTZ A;  4U9E A;  3HNK A;  5B3I A;  2XLH A;  4CDV A;  2XLV A;  2XLD A;  2J9B A;  2XL6 A;  2YL3 A;  3HNJ A;  2YLG A;  2BC5 A;  4CX9 A;  3C62 A;  2CCY A;  3ZQY A;  4NC3 A;  1LM3 B;  4D4N A;  3C63 A;  4CDY A;  3NMI A;  1YZC A;  4JEB A;  1CPR A;  1CGN A;  2XLW A;  1YYJ A;  1EKY A;  1APC A;  1BBH A;  4JEA A;  3HNI A;  3L1M A;  3M79 A;  1QQ3 A;  3ZQV A;  3DE9 A;  2YL0 A;  3QVZ A;  4CDA A;  3ZTM A;  4IB4 A;  3NMK A;  1E84 A;  3IQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...