4JEBA

Crystal structure of an engineered ridc1 tetramer with four interfacial disulfide bonds and four three-coordinate zn(ii) sites
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMADFRHGFWILIGQIHAALHLANCGKVKEAQAAAEQLKCTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords soluble cytochrome b562
publication title In Vitro and Cellular Self-Assembly of a Zn-Binding Protein Cryptand via Templated Disulfide Bonds.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4jebA00
1CGNA 1A7VA 4U9DA 2XL6A 2YL1A 3M4CA 2XM0A 4CJOA 3U8PA 3HNIA 4WGZA 3HNLA 4NC3A 4D4NA 3DE8A 4CX9A 3DE9A 4CDYA 1EKYA 3QVYA 1GQAA 1YZAA 3ZTMA 4ULVA 1CPRA 1NBBA 3HNKA 2XLDA 4D4XA 1CGOA 3C62A 1E86A 1E85A 1BBHA 1MQVA 3VRCA 5JRAA 4JEBA 2XLEA 1S05A 5JVEA 2XLOA 4EIYA 2BC5A 3ZTZA 5JS5A 4N4WA 5JT4A 3TOMA 1RCPA 2YLDA 1QPUA 3NMIA 3M15A 3TOLA 3QVZA 4IAQA 2J8WA 4WGYA 1YZCA 2XM4A 1LM3B 1JAFA 4JKVA 1E83A 4L6RA 4CJGA 1QQ3A 3QW0A 5B3IA 4IARA 5AGFA 2YLIA 4ER9A 2XLMA 4N6HA 5JSLA 3L1MA 4U9EA 3FOOA 1YYXA 4JEAA 3HNJA 2XLHA 256BA 3IQ6A 3FOPA 2YL7A 3C63A 2J9BA 1E84A 4CDAA 2YLGA 3ZWIA 1CPQA 3M4BA 5JLIA 2YKZA 3NMJA 1APCA 4CDVA 1M6TA 4IB4A 3IQ5A 2YL0A 2XLVA 2XL8A 3ZQYA 2XLWA 1YYJA 2YL3A 4JE9A 4CIPA 3QW1A 2QLAA 3M79A 3NMKA 3ZQVA 5JUAA 5JP7A 2CCYA
chains in the Genus database with same CATH superfamily
4XTKA 1XZQA 2P0NA 4DRJB 2J0XA 1CGNA 1JRAA 1JPNA 2EPMX 4U9DA 4BG0A 2XL6A 2Y3GA 3L8JA 4JTCB 3X1OA 2XM0A 1GM5A 4QI0A 3KPHA 4XLPF 3WG7C 3BRJA 3NDBB 1WTYA 4OD4A 4EBJA 3U8PA 3SZRA 3GM2A 3U8VA 3B0VC 3KKBA 2HMZA 4Q7CA 4PFOA 3S84A 3EG9A 4DXWA 2CNWA 4IGGA 4R32A 3K7DA 1EKYA 4PJLA 1ZU4A 2KJGA 3S29A 3UGOA 4XLNF 4ULVA 1A7EA 2Q4FA 4YT4A 1OXKA 1Q0DA 2XLDA 2IBFA 3TJ6A 3RIPA 1E86A 4Z9JA 3MLGA 2E87A 3U0CA 3GWLA 4JEBA 2IXNA 2XLEA 2YQYA 3K1IA 3O6XA 1T6QA 4BJ6C 5JVEA 4JVSA 3PHF2 1AEPA 1GS9A 1OQCA 3AG4C 3RQFA 3AGUA 3ZTZA 4E7ZA 1VYIA 2FFHA 4DOZA 2EIJC 3G4XA 2JD3A 3DXJF 4XPYA 5BQGA 3ZIBA 4EHPA 1T5OA 5JT4A 3KYJA 3TOMA 3POVA 3EGDA 5KYXB 3DAGA 1QPUA 3Q7LA 1RJ9A 4XPWA 5KYYB 3JRMO 4C3DA 1NFOA 1ZYRF 4IWBA 1Z6AA 3DAFA 5KYUB 1IW7F 2VCAA 4JC7A 4XPXA 2F22A 4WABA 2OG2A 4AX2A 4A4AA 3HKKA 3TOLA 4BEJA 5COFA 1TWHA 4RDAA 4XEFA 2VB6A 4DBQA 3FAPB 3W8HA 1MNEA 1KNYA 2BL2A 3DMDA 3LAYA 2R9RB 1JPJA 3C8GB 4MVMA 1K04A 1KU2A 2FGYA 2J7PD 3KL4A 5DQTA 3GODA 5F5HA 1M57C 3NYMA 2GA0A 3BEHA 5DVWA 2EPNA 4IARA 2P6VA 1EQ1A 4H54A 4ANJA 3L1MA 5EHHA 1BZ4A 1PCXA 4NTFA 3CQZA 5E33A 1D1BA 3W2VA 1VMAA 2DB4A 1BR2A 3DWWA 4JIOA 4OINF 2QUPA 2G3KA 1FMVA 2AP3A 3UMHA 5DQZA 4CSAA 2NG1A 4F4BA 2ICWG 2A68F 2OCCC 3IEEA 4Q4ZF 2HSQA 4GQHA 1EA8A 4FESA 3ZWIA 1NZEA 2P61A 3ITFA 5BQHA 3B0UX 2YWAA 3SNHA 3EG9B 1HE9A 4JTDB 2R7WA 2AWYA 3FVYA 1D0YA 1G4US 1NLXA 4HEAJ 1YA9A 2Y3BA 4PFPA 2G3VA 3W8IA 4YL1A 2J45A 1HW1A 4QI2A 1D1CA 4MTGA 3S28A 3W4YA 4YJWA 5KYNA 3QTHA 2EPKX 2NPUA 1O5HA 1QKRA 1WATA 2R7QA 2D4UA 4O6YA 1ZHZA 5DS5A 2R7RA 4JE9A 2L81A 3B71A 4MW8A 4DJ9A 1R4TA 2HMQA 4PJJA 1OKKA 1V54C 2H8AA 2QLAA 4DVYP 1Y6DA 4M63A 5CI8A 4C7OA 3RH3A 3DD7A 3LLIA 2Q9CA 3VF0A 3C18A 4AE4A 4BPMA 1IZMA 3NRHA 4BJTA 3EGDB 3ZQVA 2C03A 2LIGA 1RJ9B 3HJCA 2W9YA 3NG1A 3JRTA 4P9FA 3T6JA 1OW7A 1RXQA 2Q9BA 4XEVA 4N06A 3S9OA 1Q0FA 1ORSC 5BUOA 4OIOF 5DS4A 4PJNA 2WZGA 5D91A 3N24A 3N2ZB 3A11A 2KC3A 2YL1A 2YEVA 3V5ZA 3AG2C 4HFKB 1U0BB 3TJ5A 4JW1A 5COGA 2Y3DA 4ONSA 3GANA 4CJOA 2GWWA 1OCCC 4Z9IA 3F46A 1AVOB 3FMSA 3HNLA 3LS0A 4LDQA 4NC3A 3ZDLA 3EJNA 5CIVA 4A2NB 2A6EF 3VM6A 4CX9A 2ZD9A 5A69A 2CDQA 1OR3A 4P6IC 4U5DE 1A7DA 1OCZC 4P9TA 2Y69C 3QVYA 1U6HA 1GQAA 3SXYA 1K05A 1CPRA 1M2VA 1YLMA 2WVQA 3DM5A 1TFOB 3HNKA 3E9VA 2R7VA 3OWTA 4IAOA 2LFDA 5D92A 4PK4A 1E85A 1BBHA 3LLKA 1RKEA 4H4KC 5A6JA 5A6BD 5L0HA 2J7PA 4ULWA 2LK4A 4CS8C 4EBBA 5JRAA 1DOWA 3E70C 1S05A 2X0CA 1FAPB 2KNHA 5F28E 1BDJB 2J46A 4KNWA 2OU6A 4OIPF 2ZXPA 3H65A 2XRHA 3V5YA 5JS5A 4LLCA 2XSEA 2IYLD 2HJ3A 1YAUO 3KYIA 4BJ5C 3TD7A 1VTMP 4YN0B 1UG7A 1ZZPA 3LESA 3NMIA 4O6NA 5BQIA 4G7ZF 2Q00A 3T6GB 2KW3C 4YK5A 2XS8A 4I1OB 1PV3A 4MVRA 4RBNA 4YL3A 3W2WA 4CS9C 5B3SC 1NU7D 3I5QA 2W45A 1OKKD 4NTBA 2LP4A 1EI7A 3SXMA 2DGJA 3Q6NA 3QVZA 1QLEC 5FCLA 3US6A 4WGYA 4HFFB 1OCOC 1LM3B 4KBLA 1ZHTA 1NG1A 1JAFA 1N1CA 1WGWA 1D0ZA 4L6RA 4CJGA 1J8YF 2R7TA 5FZTA 2L6HA 2KSFA 3TQOA 3SXZA 2TMVP 4MNDA 1QZXA 1VYKA 3KMIA 3J06A 4C7OB 5B3IA 3C7JA 4AE4B 1V74B 3EQLF 4IRUA 4C3BA 1OCRC 1LI5A 2A69F 2A6HF 4FWVA 5JSLA 4N6HA 3SYNA 4ER9A 1T01A 3V7OA 5HSWA 3DI5A 4U5GA 4MVUA 1XWJA 5E3CA 2WVNA 2VCCA 3HNJA 4OIRF 3AQBA 1T9KA 3AQCA 2PBEA 1Q0GA 4AK9A 256BA 3IQ6A 4DRHB 2V3CC 3PMRA 3C63A 1BR4A 1H9GA 1YJGA 3EZHA 3JTLO 4CDAA 2AU5A 3F47A 4MW3A 2M64A 4CS7A 1GGQA 2IXMA 2PF4E 2PFDA 2XS1A 2MYSA 4I44A 3ZG1A 4O79A 3EGXA 2XXAA 4EUKB 2YKZA 1ZHYA 3B29A 3MYIA 3NMJA 4I1MA 4JTAB 3K33A 1CGME 2NUPA 5CI9A 1O3UA 1FMWA 1M2VB 4MTFA 3U3BA 4MVQA 3IQ5A 1BR1A 1K40A 1HMDA 2YL0A 4DVZA 2UUIA 1RKEB 1LI7A 4UDVA 2CW0F 4G7OF 4DBRA 1ORJA 3NYLA 4Z9HA 3JSZA 1SMYF 4CIPA 3ECSA 4YT5A 5DLJA 2CGEA 3EPVA 1LS4A 3GM1A 4XQ1A 3DKAA 3OEOA 3X2QC 3AOUA 3M79A 1FNTc 2R02A 4EKWA 2H7OA 3JT1A 1I4YA 3NMKA 2B0HA 5A6BA 5COMA 2HKVA 4JURI 2HFIA 2WL8A 3AGTA 2MHRA 5JP7A 5T1DB 3T6BA 2L6FA 3EHMA 2J0WA 3KH2A 1TWAA 4W8PA 1TQGA 2OJQA 4XWJA 3GM3A 3DM9B 1TWGA 3M4CA 2OKUA 4N6CA 3K6BA 4MTOA 1W2WA 1MMAA 1NFNA 3QZCA 2NUTA 2IXPA 4WGZA 5L0IA 4D4NA 3FAJA 1LKXA 3T4RA 3U9MA 1E2XA 2BE5F 4OD5A 3NKDA 1YZAA 1FTSA 1VB5A 1QVXA 1NBBA 2QY9A 3GEHA 4J7YA 3AG3C 4MS2A 1KTMA 1D0XA 1Q0MA 4GYTA 1CGOA 3C62A 3DZAA 1I4ZA 1HMOA 2OOCA 2OJED 2Q9AA 3K1IC 3VRCA 1VLTA 1RMVA 4E18A 3LS1A 3GORA 5L0JA 4U5BE 1PD0A 1YDIA 1H6GA 3FHDA 3ASNC 4JCZA 1T6IA 3Q6MA 2XLOA 4BJ6A 1FFHA 1HY5A 2Q3TA 1YARO 1R5ID 2Y3HA 2GFHA 4IJJA 3LNMB 2J9VA 3B9QA 3JYYA 5B1BC 2H7VC 1RCPA 2YLDA 2XXAB 4I3MA 2WVOA 3VYWA 2NUPB 4G7HF 2V26A 2PP4A 5HV9A 1Z63A 3I5PA 2MWQA 2J9UA 4U5EE 3GEIA 2YRFA 3PCVA 1Q0KA 1C02A 1TKNA 4IAQA 2XL4A 4YT8A 1YZCA 4LERA 3ATPA 2OEXA 3Q7GA 2XM4A 3U5SA 1M56C 5GPGB 3V5XA 2J9WA 3RVZA 2P1AA 1E83A 4J7TA 4BEMJ 1A41A 1G5ZA 1ORYA 2DI3A 2EPOA 2GDCA 4JJFA 3T9OA 2PX3A 4JJGA 5EGYA 1FR0A 4LACB 2CYDA 4G0HA 3MX3A 4NCQA 2YLIA 4E7SA 1WOLA 2O9XA 4W8KA 2XLMA 4AL1A 1H9TA 1F1MA 4U9EA 4XEKA 3FOOA 4NTAA 1XZPA 2L9JA 3RVYA 1YYXA 3FXHA 3L0IA 4JEAA 2PNOA 4PJMA 4EBKA 1LVKA 2IM8A 2PX0A 3H2VA 2EIKC 2L7AA 4ZLDA 1D1AA 1MMNA 2J9BA 2NUTB 3ASOC 2W4MA 5AC5A 1CPQA 4E0HA 5L0GA 3S0XA 3M4BA 3S27A 3UR3C 5JLIA 1V4AA 3RFYA 1LS1A 1ZW3A 3CZ6A 4O7GA 2NSGA 4E0IA 3K66A 1OW6A 1VLSA 1Z3IX 2HV7A 2VCBA 4FX5A 4JRZA 3WAQA 2YVKA 3EFOA 4IB4A 1H7IA 1Y4CA 4G78A 2XLVA 3SXKA 3R7CA 2XL8A 1M2OA 3ZQYA 2XLWA 1VK5A 1B68A 5L0CA 4K1OA 1ZHXA 2QE9A 4HE8D 2RSEB 5T3TA 3ZC4A 3QW1A 2UUHA 1G4WR 4QDLA 3UMIA 1I5NA 1C03A 2L6GA 3SP1A 2LFFA 3EHNA 4NQFA 1NU9C 4OIQF 2R25A 2AWCA 3NKEA 2OEVA 3MBGA 5JUAA 3CAXA 2Z15A 3FDQA 2HUJA 2WZFA 4YT2A 3LEVA 3IHUA 4C3EA 1C17M 1A7VA 4RD9A 3LJBA 1LPEA 2GAQA 4J30B 4J32B 3G50A 1ST6A 2ZPAA 4U5CE 2R7SA 3LNRA 1AUEA 1NSGB 5E2QA 3HNIA 3IQCA 1TFKB 5EK0A 2ASRA 5KYWA 2ZXOA 1TR2A 4MVOA 4X0RA 3U2MA 1JR8A 1MNDA 3DE8A 3UGPA 1VOMA 3DE9A 4JCHA 4CDYA 2LQGA 2HSBA 1O87A 1ZHWA 3IQTA 3HTKC 2JPUA 1Z7Qc 3VAYA 5L0FA 3ZTMA 1YA7O 3C8GD 2W4BA 4CBEA 3ZSUA 1DOVA 2NSFA 2LSEA 3EH2A 4LLEA 4D4XA 2B0JA 2LD6A 4BJ1A 2HZ8A 4NY3A 4MVSA 1MQVA 1L7CA 4LDRA 4O6MA 1LIHA 5A6KA 2YHSA 3H2UA 4K7BA 4B6IA 5TJ5E 3PDMP 4CS8A 2C04A 3B0PA 5IY5C 2M4EA 2ZXWC 2RD9A 4EIYA 1MMDA 2BC5A 3JSEO 2VH3A 3AG1C 4PR9A 4N4WA 2EILC 2LCHA 3N0TA 2Y39A 4YL0A 1RKCA 2ZXRA 1PD1A 3ABMC 2ETSA 3UNGC 3RYLA 4CSAC 3U2LA 3UMKA 5AC4A 4BJ5A 3EZIA 2VC9A 2CNWD 3EFOB 1J8MF 3M15A 1YVIA 1G8XA 2EIMC 3A9CA 5E3AA 1WASA 4E17A 4CIHA 2HV6A 1OXBA 1Z23A 3U9JA 2IXOA 4CS9A 1HW2A 2J8WA 3DJNB 1S7ZA 3S90A 1HE1A 1JMWA 3G4ZA 2R7UA 1LE2A 2KK1A 3IPMO 2YZSA 2WB7A 4Q5SF 1SZIA 1V55C 1ZU5A 4JKVA 1OR2A 2P7VA 3RKOF 3CSKA 3DJUB 1QQ3A 3TK0A 3WHNA 3K1HA 3QW0A 4U5HA 3C8ZA 2DYSC 1SYQA 1TWCA 1A0BA 5AGFA 2KQ9A 2A0BA 5L0DA 4AL0A 3RF3A 5L3VA 2HS5A 4GEHA 2R03A 2AVKA 1SF8A 2EPLX 2HJMA 2I15A 3CEXA 1FFTC 1UFBA 3EGXB 4KC9A 1ZW2A 2DYRC 1Z5ZA 2QTVA 4KNVA 2XLHA 1ZVZA 5F5FA 1JOGA 2R05A 3TULA 4JZAA 1U89A 1LE4A 3AJMA 3FOPA 4DRIB 5DS6A 2QNLA 2YL7A 1E84A 3JYHA 3NYJA 3EH1A 5T3WA 3RW0A 2YLGA 1OW8A 3ABKC 3WODF 4EWCA 5KYWB 1WWPA 3ABLC 3HLZA 5A6AA 3O55A 1MMGA 5K0IA 3JCUQ 2R7XA 3JZ0A 3RQGA 4ZLCA 4MVZA 5KYXA 3O39A 1APCA 3MFNA 3MYFA 4CDVA 2A0UA 5KYYA 2X51A 3GWNA 5KYUA 1M6TA 2D5RB 2OQMA 4LDKA 2IOQA 3OA1A 4MQ9F 2KYHA 5L3QA 2JX0A 2FAPB 3SEOA 3RQEA 1YYJA 2YL3A 4U5FE 1L3PA 3LEOA 2Q7RA 3ZVRA 2G62A 3O10A 1T6UA 2EINC 3C8GA 2H7BA 3GEEA 4WJ0A 4YWQA 3I4UA 1SR2A 2A1DD 3L34A 2VASA 4PACA 4K0DA 2R7OA 3M1CB 3U3FA 4KI2A 5B1AC 1QSPA 1WN0A 3LUTB 2WZLA 2KGOA 3QMKA 2I8BA 2CCYA 3L8IA 3R2PA 4FAPB
chains in the Genus database with same CATH topology
1CGNA 1A7VA 4U9DA 2XL6A 2YL1A 3M4CA 2XM0A 4CJOA 3U8PA 3HNIA 4WGZA 3HNLA 4NC3A 4D4NA 3DE8A 4CX9A 3DE9A 4CDYA 1EKYA 3QVYA 1GQAA 1YZAA 3ZTMA 4ULVA 1CPRA 1NBBA 3HNKA 2XLDA 4D4XA 1CGOA 3C62A 1E86A 1E85A 1BBHA 1MQVA 3VRCA 5JRAA 4JEBA 2XLEA 1S05A 5JVEA 2XLOA 4EIYA 2BC5A 3ZTZA 5JS5A 4N4WA 5JT4A 3TOMA 1RCPA 2YLDA 1QPUA 3NMIA 3M15A 3TOLA 3QVZA 4IAQA 2J8WA 4WGYA 1YZCA 2XM4A 1LM3B 1JAFA 4JKVA 1E83A 4L6RA 4CJGA 1QQ3A 3QW0A 5B3IA 4IARA 5AGFA 2YLIA 4ER9A 2XLMA 4N6HA 5JSLA 3L1MA 4U9EA 3FOOA 1YYXA 4JEAA 3HNJA 2XLHA 256BA 3IQ6A 3FOPA 2YL7A 3C63A 2J9BA 1E84A 4CDAA 2YLGA 3ZWIA 1CPQA 3M4BA 5JLIA 2YKZA 3NMJA 1APCA 4CDVA 1M6TA 4IB4A 3IQ5A 2YL0A 2XLVA 2XL8A 3ZQYA 2XLWA 1YYJA 2YL3A 4JE9A 4CIPA 3QW1A 2QLAA 3M79A 3NMKA 3ZQVA 5JUAA 5JP7A 2CCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CGN A;  1A7V A;  4U9D A;  2XL6 A;  2YL1 A;  3M4C A;  2XM0 A;  4CJO A;  3U8P A;  3HNI A;  4WGZ A;  3HNL A;  4NC3 A;  4D4N A;  3DE8 A;  4CX9 A;  3DE9 A;  4CDY A;  1EKY A;  3QVY A;  1GQA A;  1YZA A;  3ZTM A;  4ULV A;  1CPR A;  1NBB A;  3HNK A;  2XLD A;  4D4X A;  1CGO A;  3C62 A;  1E86 A;  1E85 A;  1BBH A;  1MQV A;  3VRC A;  5JRA A;  4JEB A;  2XLE A;  1S05 A;  5JVE A;  2XLO A;  4EIY A;  2BC5 A;  3ZTZ A;  5JS5 A;  4N4W A;  5JT4 A;  3TOM A;  1RCP A;  2YLD A;  1QPU A;  3NMI A;  3M15 A;  3TOL A;  3QVZ A;  4IAQ A;  2J8W A;  4WGY A;  1YZC A;  2XM4 A;  1LM3 B;  1JAF A;  4JKV A;  1E83 A;  4L6R A;  4CJG A;  1QQ3 A;  3QW0 A;  5B3I A;  4IAR A;  5AGF A;  2YLI A;  4ER9 A;  2XLM A;  4N6H A;  5JSL A;  3L1M A;  4U9E A;  3FOO A;  1YYX A;  4JEA A;  3HNJ A;  2XLH A;  256B A;  3IQ6 A;  3FOP A;  2YL7 A;  3C63 A;  2J9B A;  1E84 A;  4CDA A;  2YLG A;  3ZWI A;  1CPQ A;  3M4B A;  5JLI A;  2YKZ A;  3NMJ A;  1APC A;  4CDV A;  1M6T A;  4IB4 A;  3IQ5 A;  2YL0 A;  2XLV A;  2XL8 A;  3ZQY A;  2XLW A;  1YYJ A;  2YL3 A;  4JE9 A;  4CIP A;  3QW1 A;  2QLA A;  3M79 A;  3NMK A;  3ZQV A;  5JUA A;  5JP7 A;  2CCY A; 
#chains in the Genus database with same CATH topology
 4XTK A;  1XZQ A;  2P0N A;  4DRJ B;  2J0X A;  1CGN A;  1JRA A;  1JPN A;  2EPM X;  4U9D A;  4BG0 A;  2XL6 A;  2Y3G A;  3L8J A;  4JTC B;  3X1O A;  2XM0 A;  1GM5 A;  4QI0 A;  3KPH A;  4XLP F;  3WG7 C;  3BRJ A;  3NDB B;  1WTY A;  4OD4 A;  4EBJ A;  3U8P A;  3SZR A;  3GM2 A;  3U8V A;  3B0V C;  3KKB A;  2HMZ A;  4Q7C A;  4PFO A;  3S84 A;  3EG9 A;  4DXW A;  2CNW A;  4IGG A;  4R32 A;  3K7D A;  1EKY A;  4PJL A;  1ZU4 A;  2KJG A;  3S29 A;  3UGO A;  4XLN F;  4ULV A;  1A7E A;  2Q4F A;  4YT4 A;  1OXK A;  1Q0D A;  2XLD A;  2IBF A;  3TJ6 A;  3RIP A;  1E86 A;  4Z9J A;  3MLG A;  2E87 A;  3U0C A;  3GWL A;  4JEB A;  2IXN A;  2XLE A;  2YQY A;  3K1I A;  3O6X A;  1T6Q A;  4BJ6 C;  5JVE A;  4JVS A;  3PHF 2;  1AEP A;  1GS9 A;  1OQC A;  3AG4 C;  3RQF A;  3AGU A;  3ZTZ A;  4E7Z A;  1VYI A;  2FFH A;  4DOZ A;  2EIJ C;  3G4X A;  2JD3 A;  3DXJ F;  4XPY A;  5BQG A;  3ZIB A;  4EHP A;  1T5O A;  5JT4 A;  3KYJ A;  3TOM A;  3POV A;  3EGD A;  5KYX B;  3DAG A;  1QPU A;  3Q7L A;  1RJ9 A;  4XPW A;  5KYY B;  3JRM O;  4C3D A;  1NFO A;  1ZYR F;  4IWB A;  1Z6A A;  3DAF A;  5KYU B;  1IW7 F;  2VCA A;  4JC7 A;  4XPX A;  2F22 A;  4WAB A;  2OG2 A;  4AX2 A;  4A4A A;  3HKK A;  3TOL A;  4BEJ A;  5COF A;  1TWH A;  4RDA A;  4XEF A;  2VB6 A;  4DBQ A;  3FAP B;  3W8H A;  1MNE A;  1KNY A;  2BL2 A;  3DMD A;  3LAY A;  2R9R B;  1JPJ A;  3C8G B;  4MVM A;  1K04 A;  1KU2 A;  2FGY A;  2J7P D;  3KL4 A;  5DQT A;  3GOD A;  5F5H A;  1M57 C;  3NYM A;  2GA0 A;  3BEH A;  5DVW A;  2EPN A;  4IAR A;  2P6V A;  1EQ1 A;  4H54 A;  4ANJ A;  3L1M A;  5EHH A;  1BZ4 A;  1PCX A;  4NTF A;  3CQZ A;  5E33 A;  1D1B A;  3W2V A;  1VMA A;  2DB4 A;  1BR2 A;  3DWW A;  4JIO A;  4OIN F;  2QUP A;  2G3K A;  1FMV A;  2AP3 A;  3UMH A;  5DQZ A;  4CSA A;  2NG1 A;  4F4B A;  2ICW G;  2A68 F;  2OCC C;  3IEE A;  4Q4Z F;  2HSQ A;  4GQH A;  1EA8 A;  4FES A;  3ZWI A;  1NZE A;  2P61 A;  3ITF A;  5BQH A;  3B0U X;  2YWA A;  3SNH A;  3EG9 B;  1HE9 A;  4JTD B;  2R7W A;  2AWY A;  3FVY A;  1D0Y A;  1G4U S;  1NLX A;  4HEA J;  1YA9 A;  2Y3B A;  4PFP A;  2G3V A;  3W8I A;  4YL1 A;  2J45 A;  1HW1 A;  4QI2 A;  1D1C A;  4MTG A;  3S28 A;  3W4Y A;  4YJW A;  5KYN A;  3QTH A;  2EPK X;  2NPU A;  1O5H A;  1QKR A;  1WAT A;  2R7Q A;  2D4U A;  4O6Y A;  1ZHZ A;  5DS5 A;  2R7R A;  4JE9 A;  2L81 A;  3B71 A;  4MW8 A;  4DJ9 A;  1R4T A;  2HMQ A;  4PJJ A;  1OKK A;  1V54 C;  2H8A A;  2QLA A;  4DVY P;  1Y6D A;  4M63 A;  5CI8 A;  4C7O A;  3RH3 A;  3DD7 A;  3LLI A;  2Q9C A;  3VF0 A;  3C18 A;  4AE4 A;  4BPM A;  1IZM A;  3NRH A;  4BJT A;  3EGD B;  3ZQV A;  2C03 A;  2LIG A;  1RJ9 B;  3HJC A;  2W9Y A;  3NG1 A;  3JRT A;  4P9F A;  3T6J A;  1OW7 A;  1RXQ A;  2Q9B A;  4XEV A;  4N06 A;  3S9O A;  1Q0F A;  1ORS C;  5BUO A;  4OIO F;  5DS4 A;  4PJN A;  2WZG A;  5D91 A;  3N24 A;  3N2Z B;  3A11 A;  2KC3 A;  2YL1 A;  2YEV A;  3V5Z A;  3AG2 C;  4HFK B;  1U0B B;  3TJ5 A;  4JW1 A;  5COG A;  2Y3D A;  4ONS A;  3GAN A;  4CJO A;  2GWW A;  1OCC C;  4Z9I A;  3F46 A;  1AVO B;  3FMS A;  3HNL A;  3LS0 A;  4LDQ A;  4NC3 A;  3ZDL A;  3EJN A;  5CIV A;  4A2N B;  2A6E F;  3VM6 A;  4CX9 A;  2ZD9 A;  5A69 A;  2CDQ A;  1OR3 A;  4P6I C;  4U5D E;  1A7D A;  1OCZ C;  4P9T A;  2Y69 C;  3QVY A;  1U6H A;  1GQA A;  3SXY A;  1K05 A;  1CPR A;  1M2V A;  1YLM A;  2WVQ A;  3DM5 A;  1TFO B;  3HNK A;  3E9V A;  2R7V A;  3OWT A;  4IAO A;  2LFD A;  5D92 A;  4PK4 A;  1E85 A;  1BBH A;  3LLK A;  1RKE A;  4H4K C;  5A6J A;  5A6B D;  5L0H A;  2J7P A;  4ULW A;  2LK4 A;  4CS8 C;  4EBB A;  5JRA A;  1DOW A;  3E70 C;  1S05 A;  2X0C A;  1FAP B;  2KNH A;  5F28 E;  1BDJ B;  2J46 A;  4KNW A;  2OU6 A;  4OIP F;  2ZXP A;  3H65 A;  2XRH A;  3V5Y A;  5JS5 A;  4LLC A;  2XSE A;  2IYL D;  2HJ3 A;  1YAU O;  3KYI A;  4BJ5 C;  3TD7 A;  1VTM P;  4YN0 B;  1UG7 A;  1ZZP A;  3LES A;  3NMI A;  4O6N A;  5BQI A;  4G7Z F;  2Q00 A;  3T6G B;  2KW3 C;  4YK5 A;  2XS8 A;  4I1O B;  1PV3 A;  4MVR A;  4RBN A;  4YL3 A;  3W2W A;  4CS9 C;  5B3S C;  1NU7 D;  3I5Q A;  2W45 A;  1OKK D;  4NTB A;  2LP4 A;  1EI7 A;  3SXM A;  2DGJ A;  3Q6N A;  3QVZ A;  1QLE C;  5FCL A;  3US6 A;  4WGY A;  4HFF B;  1OCO C;  1LM3 B;  4KBL A;  1ZHT A;  1NG1 A;  1JAF A;  1N1C A;  1WGW A;  1D0Z A;  4L6R A;  4CJG A;  1J8Y F;  2R7T A;  5FZT A;  2L6H A;  2KSF A;  3TQO A;  3SXZ A;  2TMV P;  4MND A;  1QZX A;  1VYK A;  3KMI A;  3J06 A;  4C7O B;  5B3I A;  3C7J A;  4AE4 B;  1V74 B;  3EQL F;  4IRU A;  4C3B A;  1OCR C;  1LI5 A;  2A69 F;  2A6H F;  4FWV A;  5JSL A;  4N6H A;  3SYN A;  4ER9 A;  1T01 A;  3V7O A;  5HSW A;  3DI5 A;  4U5G A;  4MVU A;  1XWJ A;  5E3C A;  2WVN A;  2VCC A;  3HNJ A;  4OIR F;  3AQB A;  1T9K A;  3AQC A;  2PBE A;  1Q0G A;  4AK9 A;  256B A;  3IQ6 A;  4DRH B;  2V3C C;  3PMR A;  3C63 A;  1BR4 A;  1H9G A;  1YJG A;  3EZH A;  3JTL O;  4CDA A;  2AU5 A;  3F47 A;  4MW3 A;  2M64 A;  4CS7 A;  1GGQ A;  2IXM A;  2PF4 E;  2PFD A;  2XS1 A;  2MYS A;  4I44 A;  3ZG1 A;  4O79 A;  3EGX A;  2XXA A;  4EUK B;  2YKZ A;  1ZHY A;  3B29 A;  3MYI A;  3NMJ A;  4I1M A;  4JTA B;  3K33 A;  1CGM E;  2NUP A;  5CI9 A;  1O3U A;  1FMW A;  1M2V B;  4MTF A;  3U3B A;  4MVQ A;  3IQ5 A;  1BR1 A;  1K40 A;  1HMD A;  2YL0 A;  4DVZ A;  2UUI A;  1RKE B;  1LI7 A;  4UDV A;  2CW0 F;  4G7O F;  4DBR A;  1ORJ A;  3NYL A;  4Z9H A;  3JSZ A;  1SMY F;  4CIP A;  3ECS A;  4YT5 A;  5DLJ A;  2CGE A;  3EPV A;  1LS4 A;  3GM1 A;  4XQ1 A;  3DKA A;  3OEO A;  3X2Q C;  3AOU A;  3M79 A;  1FNT c;  2R02 A;  4EKW A;  2H7O A;  3JT1 A;  1I4Y A;  3NMK A;  2B0H A;  5A6B A;  5COM A;  2HKV A;  4JUR I;  2HFI A;  2WL8 A;  3AGT A;  2MHR A;  5JP7 A;  5T1D B;  3T6B A;  2L6F A;  3EHM A;  2J0W A;  3KH2 A;  1TWA A;  4W8P A;  1TQG A;  2OJQ A;  4XWJ A;  3GM3 A;  3DM9 B;  1TWG A;  3M4C A;  2OKU A;  4N6C A;  3K6B A;  4MTO A;  1W2W A;  1MMA A;  1NFN A;  3QZC A;  2NUT A;  2IXP A;  4WGZ A;  5L0I A;  4D4N A;  3FAJ A;  1LKX A;  3T4R A;  3U9M A;  1E2X A;  2BE5 F;  4OD5 A;  3NKD A;  1YZA A;  1FTS A;  1VB5 A;  1QVX A;  1NBB A;  2QY9 A;  3GEH A;  4J7Y A;  3AG3 C;  4MS2 A;  1KTM A;  1D0X A;  1Q0M A;  4GYT A;  1CGO A;  3C62 A;  3DZA A;  1I4Z A;  1HMO A;  2OOC A;  2OJE D;  2Q9A A;  3K1I C;  3VRC A;  1VLT A;  1RMV A;  4E18 A;  3LS1 A;  3GOR A;  5L0J A;  4U5B E;  1PD0 A;  1YDI A;  1H6G A;  3FHD A;  3ASN C;  4JCZ A;  1T6I A;  3Q6M A;  2XLO A;  4BJ6 A;  1FFH A;  1HY5 A;  2Q3T A;  1YAR O;  1R5I D;  2Y3H A;  2GFH A;  4IJJ A;  3LNM B;  2J9V A;  3B9Q A;  3JYY A;  5B1B C;  2H7V C;  1RCP A;  2YLD A;  2XXA B;  4I3M A;  2WVO A;  3VYW A;  2NUP B;  4G7H F;  2V26 A;  2PP4 A;  5HV9 A;  1Z63 A;  3I5P A;  2MWQ A;  2J9U A;  4U5E E;  3GEI A;  2YRF A;  3PCV A;  1Q0K A;  1C02 A;  1TKN A;  4IAQ A;  2XL4 A;  4YT8 A;  1YZC A;  4LER A;  3ATP A;  2OEX A;  3Q7G A;  2XM4 A;  3U5S A;  1M56 C;  5GPG B;  3V5X A;  2J9W A;  3RVZ A;  2P1A A;  1E83 A;  4J7T A;  4BEM J;  1A41 A;  1G5Z A;  1ORY A;  2DI3 A;  2EPO A;  2GDC A;  4JJF A;  3T9O A;  2PX3 A;  4JJG A;  5EGY A;  1FR0 A;  4LAC B;  2CYD A;  4G0H A;  3MX3 A;  4NCQ A;  2YLI A;  4E7S A;  1WOL A;  2O9X A;  4W8K A;  2XLM A;  4AL1 A;  1H9T A;  1F1M A;  4U9E A;  4XEK A;  3FOO A;  4NTA A;  1XZP A;  2L9J A;  3RVY A;  1YYX A;  3FXH A;  3L0I A;  4JEA A;  2PNO A;  4PJM A;  4EBK A;  1LVK A;  2IM8 A;  2PX0 A;  3H2V A;  2EIK C;  2L7A A;  4ZLD A;  1D1A A;  1MMN A;  2J9B A;  2NUT B;  3ASO C;  2W4M A;  5AC5 A;  1CPQ A;  4E0H A;  5L0G A;  3S0X A;  3M4B A;  3S27 A;  3UR3 C;  5JLI A;  1V4A A;  3RFY A;  1LS1 A;  1ZW3 A;  3CZ6 A;  4O7G A;  2NSG A;  4E0I A;  3K66 A;  1OW6 A;  1VLS A;  1Z3I X;  2HV7 A;  2VCB A;  4FX5 A;  4JRZ A;  3WAQ A;  2YVK A;  3EFO A;  4IB4 A;  1H7I A;  1Y4C A;  4G78 A;  2XLV A;  3SXK A;  3R7C A;  2XL8 A;  1M2O A;  3ZQY A;  2XLW A;  1VK5 A;  1B68 A;  5L0C A;  4K1O A;  1ZHX A;  2QE9 A;  4HE8 D;  2RSE B;  5T3T A;  3ZC4 A;  3QW1 A;  2UUH A;  1G4W R;  4QDL A;  3UMI A;  1I5N A;  1C03 A;  2L6G A;  3SP1 A;  2LFF A;  3EHN A;  4NQF A;  1NU9 C;  4OIQ F;  2R25 A;  2AWC A;  3NKE A;  2OEV A;  3MBG A;  5JUA A;  3CAX A;  2Z15 A;  3FDQ A;  2HUJ A;  2WZF A;  4YT2 A;  3LEV A;  3IHU A;  4C3E A;  1C17 M;  1A7V A;  4RD9 A;  3LJB A;  1LPE A;  2GAQ A;  4J30 B;  4J32 B;  3G50 A;  1ST6 A;  2ZPA A;  4U5C E;  2R7S A;  3LNR A;  1AUE A;  1NSG B;  5E2Q A;  3HNI A;  3IQC A;  1TFK B;  5EK0 A;  2ASR A;  5KYW A;  2ZXO A;  1TR2 A;  4MVO A;  4X0R A;  3U2M A;  1JR8 A;  1MND A;  3DE8 A;  3UGP A;  1VOM A;  3DE9 A;  4JCH A;  4CDY A;  2LQG A;  2HSB A;  1O87 A;  1ZHW A;  3IQT A;  3HTK C;  2JPU A;  1Z7Q c;  3VAY A;  5L0F A;  3ZTM A;  1YA7 O;  3C8G D;  2W4B A;  4CBE A;  3ZSU A;  1DOV A;  2NSF A;  2LSE A;  3EH2 A;  4LLE A;  4D4X A;  2B0J A;  2LD6 A;  4BJ1 A;  2HZ8 A;  4NY3 A;  4MVS A;  1MQV A;  1L7C A;  4LDR A;  4O6M A;  1LIH A;  5A6K A;  2YHS A;  3H2U A;  4K7B A;  4B6I A;  5TJ5 E;  3PDM P;  4CS8 A;  2C04 A;  3B0P A;  5IY5 C;  2M4E A;  2ZXW C;  2RD9 A;  4EIY A;  1MMD A;  2BC5 A;  3JSE O;  2VH3 A;  3AG1 C;  4PR9 A;  4N4W A;  2EIL C;  2LCH A;  3N0T A;  2Y39 A;  4YL0 A;  1RKC A;  2ZXR A;  1PD1 A;  3ABM C;  2ETS A;  3UNG C;  3RYL A;  4CSA C;  3U2L A;  3UMK A;  5AC4 A;  4BJ5 A;  3EZI A;  2VC9 A;  2CNW D;  3EFO B;  1J8M F;  3M15 A;  1YVI A;  1G8X A;  2EIM C;  3A9C A;  5E3A A;  1WAS A;  4E17 A;  4CIH A;  2HV6 A;  1OXB A;  1Z23 A;  3U9J A;  2IXO A;  4CS9 A;  1HW2 A;  2J8W A;  3DJN B;  1S7Z A;  3S90 A;  1HE1 A;  1JMW A;  3G4Z A;  2R7U A;  1LE2 A;  2KK1 A;  3IPM O;  2YZS A;  2WB7 A;  4Q5S F;  1SZI A;  1V55 C;  1ZU5 A;  4JKV A;  1OR2 A;  2P7V A;  3RKO F;  3CSK A;  3DJU B;  1QQ3 A;  3TK0 A;  3WHN A;  3K1H A;  3QW0 A;  4U5H A;  3C8Z A;  2DYS C;  1SYQ A;  1TWC A;  1A0B A;  5AGF A;  2KQ9 A;  2A0B A;  5L0D A;  4AL0 A;  3RF3 A;  5L3V A;  2HS5 A;  4GEH A;  2R03 A;  2AVK A;  1SF8 A;  2EPL X;  2HJM A;  2I15 A;  3CEX A;  1FFT C;  1UFB A;  3EGX B;  4KC9 A;  1ZW2 A;  2DYR C;  1Z5Z A;  2QTV A;  4KNV A;  2XLH A;  1ZVZ A;  5F5F A;  1JOG A;  2R05 A;  3TUL A;  4JZA A;  1U89 A;  1LE4 A;  3AJM A;  3FOP A;  4DRI B;  5DS6 A;  2QNL A;  2YL7 A;  1E84 A;  3JYH A;  3NYJ A;  3EH1 A;  5T3W A;  3RW0 A;  2YLG A;  1OW8 A;  3ABK C;  3WOD F;  4EWC A;  5KYW B;  1WWP A;  3ABL C;  3HLZ A;  5A6A A;  3O55 A;  1MMG A;  5K0I A;  3JCU Q;  2R7X A;  3JZ0 A;  3RQG A;  4ZLC A;  4MVZ A;  5KYX A;  3O39 A;  1APC A;  3MFN A;  3MYF A;  4CDV A;  2A0U A;  5KYY A;  2X51 A;  3GWN A;  5KYU A;  1M6T A;  2D5R B;  2OQM A;  4LDK A;  2IOQ A;  3OA1 A;  4MQ9 F;  2KYH A;  5L3Q A;  2JX0 A;  2FAP B;  3SEO A;  3RQE A;  1YYJ A;  2YL3 A;  4U5F E;  1L3P A;  3LEO A;  2Q7R A;  3ZVR A;  2G62 A;  3O10 A;  1T6U A;  2EIN C;  3C8G A;  2H7B A;  3GEE A;  4WJ0 A;  4YWQ A;  3I4U A;  1SR2 A;  2A1D D;  3L34 A;  2VAS A;  4PAC A;  4K0D A;  2R7O A;  3M1C B;  3U3F A;  4KI2 A;  5B1A C;  1QSP A;  1WN0 A;  3LUT B;  2WZL A;  2KGO A;  3QMK A;  2I8B A;  2CCY A;  3L8I A;  3R2P A;  4FAP B; 
#chains in the Genus database with same CATH homology
 1CGN A;  1A7V A;  4U9D A;  2XL6 A;  2YL1 A;  3M4C A;  2XM0 A;  4CJO A;  3U8P A;  3HNI A;  4WGZ A;  3HNL A;  4NC3 A;  4D4N A;  3DE8 A;  4CX9 A;  3DE9 A;  4CDY A;  1EKY A;  3QVY A;  1GQA A;  1YZA A;  3ZTM A;  4ULV A;  1CPR A;  1NBB A;  3HNK A;  2XLD A;  4D4X A;  1CGO A;  3C62 A;  1E86 A;  1E85 A;  1BBH A;  1MQV A;  3VRC A;  5JRA A;  4JEB A;  2XLE A;  1S05 A;  5JVE A;  2XLO A;  4EIY A;  2BC5 A;  3ZTZ A;  5JS5 A;  4N4W A;  5JT4 A;  3TOM A;  1RCP A;  2YLD A;  1QPU A;  3NMI A;  3M15 A;  3TOL A;  3QVZ A;  4IAQ A;  2J8W A;  4WGY A;  1YZC A;  2XM4 A;  1LM3 B;  1JAF A;  4JKV A;  1E83 A;  4L6R A;  4CJG A;  1QQ3 A;  3QW0 A;  5B3I A;  4IAR A;  5AGF A;  2YLI A;  4ER9 A;  2XLM A;  4N6H A;  5JSL A;  3L1M A;  4U9E A;  3FOO A;  1YYX A;  4JEA A;  3HNJ A;  2XLH A;  256B A;  3IQ6 A;  3FOP A;  2YL7 A;  3C63 A;  2J9B A;  1E84 A;  4CDA A;  2YLG A;  3ZWI A;  1CPQ A;  3M4B A;  5JLI A;  2YKZ A;  3NMJ A;  1APC A;  4CDV A;  1M6T A;  4IB4 A;  3IQ5 A;  2YL0 A;  2XLV A;  2XL8 A;  3ZQY A;  2XLW A;  1YYJ A;  2YL3 A;  4JE9 A;  4CIP A;  3QW1 A;  2QLA A;  3M79 A;  3NMK A;  3ZQV A;  5JUA A;  5JP7 A;  2CCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...