4JEBA

Crystal structure of an engineered ridc1 tetramer with four interfacial disulfide bonds and four three-coordinate zn(ii) sites
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMADFRHGFWILIGQIHAALHLANCGKVKEAQAAAEQLKCTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords soluble cytochrome b562
publication title In Vitro and Cellular Self-Assembly of a Zn-Binding Protein Cryptand via Templated Disulfide Bonds.
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4jebA00
2XLVA 1CPQA 1YZCA 1YZAA 4CDAA 4D4NA 3ZTMA 4CDVA 3QVYA 1E84A 2XLEA 2YL0A 3HNJA 1S05A 2YLGA 5B3IA 1QPUA 4ER9A 3NMKA 3FOOA 3M4CA 4IARA 2BC5A 4CIPA 2XLHA 2QLAA 1GQAA 2J8WA 3M4BA 4U9EA 3M79A 1E83A 1A7VA 2YLDA 2YLIA 4IB4A 2YKZA 4WGYA 3ZWIA 4JE9A 3HNLA 3TOLA 4ULVA 5AGFA 2YL7A 3DE9A 4JEAA 1M6TA 3HNIA 2J9BA 1YYJA 4CJGA 3NMJA 3TOMA 1CPRA 1CGNA 1APCA 2XM4A 1BBHA 5JVEA 256BA 2XM0A 4JEBA 2XLOA 5JUAA 3L1MA 1EKYA 2YL3A 3NMIA 1CGOA 4WGZA 3ZQYA 2YL1A 5JLIA 4L6RA 1MQVA 4IAQA 2XLDA 3U8PA 3QW0A 2CCYA 2XLWA 1E86A 3IQ5A 1JAFA 5JT4A 4CX9A 3ZTZA 4N4WA 3C63A 4CDYA 2XL8A 4JKVA 1RCPA 4NC3A 3QVZA 5JP7A 5JSLA 3HNKA 5JS5A 4U9DA 3QW1A 1E85A 1LM3B 4N6HA 4D4XA 3IQ6A 3VRCA 3ZQVA 5JRAA 3M15A 2XLMA 4CJOA 4EIYA 1YYXA 3FOPA 3C62A 2XL6A 1QQ3A 1NBBA 3DE8A
chains in the Genus database with same CATH superfamily
4CS7A 3JRTA 4PACA 2R7WA 1YZCA 1YZAA 4CDAA 3ZTMA 3CZ6A 2W4MA 4K1OA 1OCCC 3B0PA 5E2QA 3UMIA 1Q0KA 2EPKX 4C7OA 3N0TA 4BJ1A 1LS1A 5DQZA 3AQBA 2M64A 5L0DA 4MTFA 2R7UA 2PBEA 4J30B 2FAPB 1A41A 5F5HA 4YJWA 5A6BD 5L3QA 1G8XA 4CIPA 4XEKA 4BG0A 3OEOA 4DVZA 4H4KC 4OIQF 2KC3A 2L7AA 4MTOA 4PK4A 2PFDA 1SR2A 5FCLA 2OG2A 3S9OA 4BEMJ 1E83A 2PP4A 4CSAA 4A2NB 3BEHA 2YZSA 4LERA 4IB4A 1D1AA 1OCRC 1F1MA 2C04A 3KMIA 1LPEA 3QMKA 2LIGA 3EGXA 2V26A 4MVMA 3S27A 2EINC 4CBEA 2R7XA 3L0IA 1AEPA 1MMDA 2QTVA 4G7HF 4ULVA 1G4US 1QSPA 3WG7C 4YT8A 1U89A 4O79A 1K04A 4JCZA 1TWCA 5E3AA 3TJ5A 1N1CA 1ZVZA 5A6AA 2I8BA 3RVZA 3SP1A 2YL7A 4GEHA 3UMHA 2HUJA 1DOVA 2NSGA 4JZAA 3K1IA 3V5YA 3RQGA 1HMOA 1WWPA 3LJBA 3TOMA 4C3BA 2W45A 3LNMB 1APCA 3DI5A 1LS4A 1WN0A 2EPMX 2HJ3A 1TR2A 2XM0A 2IBFA 4LDRA 4MW8A 2NUPA 1IW7F 3H2VA 3AG2C 3G4XA 2EIMC 4BEJA 2NG1A 4CS9A 4AL0A 5AC4A 2XLOA 1JOGA 5JUAA 2VCAA 1OCZC 2BL2A 2OQMA 2YQYA 2CGEA 3N2ZB 1Z23A 4HEAJ 5EK0A 3DJNB 3TULA 3AGUA 1H7IA 3BRJA 4B6IA 4BPMA 2Q9CA 2YL1A 4DOZA 4QDLA 3WAQA 5JLIA 4XPWA 1FNTc 1B68A 3GM1A 4WJ0A 3A11A 3EJNA 4C3DA 2PX3A 4P9FA 2Z15A 4RBNA 1MQVA 1I4ZA 1M2VB 1VLSA 2LFDA 5T3WA 3RQEA 3W8IA 4ANJA 1KU2A 3GANA 3K1HA 3T6JA 2GFHA 3C8GD 2CCYA 4NCQA 2IOQA 2Q7RA 2WL8A 3UMKA 1JPJA 1M56C 2GAQA 1I4YA 4KNWA 2TMVP 1ZU5A 5D91A 4AE4A 3N24A 1LKXA 3LESA 3C63A 1Z63A 5BQIA 1VB5A 3TQOA 4IAOA 3CQZA 4J32B 2GDCA 3MYIA 3U3BA 3RF3A 1PV3A 3MYFA 3C8GB 4NC3A 1A0BA 3LUTB 3HNKA 4IRUA 4BJ6A 2QNLA 2YEVA 5CIVA 3NDBB 4U9DA 2Y3GA 4E7SA 4IJJA 3I4UA 4PJNA 1OR3A 1WASA 3RFYA 1VYIA 1FMWA 5DVWA 2A69F 1A7DA 2Q4FA 2W9YA 3NKEA 3IQ6A 3Q6MA 4JCHA 1V4AA 3HLZA 4K7BA 4D4XA 3E70C 3ZQVA 1HW2A 1NU9C 5A69A 2G3VA 1ZU4A 2H7BA 2OCCC 2LFFA 2QE9A 4EIYA 1T9KA 2AWYA 4FESA 3LLKA 2HV6A 2XL6A 2LQGA 3IHUA 1D1CA 3C18A 1OKKD 2MHRA 4BJ5C 5KYWB 2QUPA 2E87A 1J8MF 1YJGA 4FAPB 2DYSC 1C02A 3NRHA 4E0HA 3RQFA 3LLIA 1Q0GA 2XLVA 2ZPAA 1SZIA 1CPQA 4DJ9A 1V54C 2Q9AA 1Z5ZA 3IPMO 2ETSA 3OWTA 3SZRA 1V74B 3FDQA 2A6HF 3B71A 2P7VA 2QY9A 1UG7A 3SXMA 2YWAA 3QVYA 3PMRA 4EUKB 2HFIA 2YVKA 3KL4A 2A6EF 4U5EE 2XLEA 3ABLC 3IQCA 2YL0A 4DBRA 5A6BA 3GM3A 3PDMP 3KH2A 2HV7A 3JT1A 4I3MA 3J06A 3NMKA 3NYJA 3US6A 5CI9A 3S84A 4N6CA 1NG1A 2AVKA 4A4AA 2BC5A 4UDVA 5KYXA 4IWBA 2J8WA 4U5GA 1ZW3A 4YN0B 2YLDA 5L0GA 2YLIA 1HY5A 3F47A 4I44A 2J9UA 2YKZA 4YT5A 3ZWIA 1TWHA 4KI2A 4JTAB 5B1BC 2YHSA 1MMAA 3HNLA 4U5DE 2LP4A 1RKEA 3JSEO 4LDKA 5L0CA 4MVSA 3I5PA 3PCVA 3DMDA 3Q7GA 1TWAA 2I15A 3NYLA 2MYSA 3DE9A 4NTFA 4NQFA 4JEAA 4IGGA 4JC7A 4MVUA 1IZMA 3SXKA 1OW6A 4JJFA 1MNDA 1YYJA 3NMJA 4XQ1A 2XXAA 3QTHA 1S7ZA 2XM4A 3RVYA 4G0HA 4H54A 2L6HA 2EIKC 1V55C 2CW0F 2UUHA 1RXQA 3ZG1A 2O9XA 3LS0A 3L34A 2Y69C 4EWCA 2VB6A 4YL1A 2J0XA 1T01A 3VM6A 1YLMA 1EKYA 3EQLF 4U5BE 2P61A 1SMYF 2ZXRA 1R4TA 3JZ0A 4E17A 3ZQYA 3CSKA 5KYYB 3AG3C 1O87A 1TFKB 4ONSA 4G78A 1E84A 3C8GA 4OIOF 2J7PD 2Y39A 1ZHXA 4L6RA 1PD1A 2DI3A 4IAQA 3G4ZA 4YT2A 2WZGA 5KYNA 3EZIA 3QW0A 3EGDB 1HW1A 1MMGA 2XLWA 4HFFB 1OR2A 3IQ5A 5JT4A 1OW8A 1XZPA 2LSEA 4CX9A 3DD7A 4CS8C 1ORJA 4Z9JA 1T6IA 1NSGB 3JSZA 1M57C 1QVXA 4N06A 5KYUB 2XL8A 2XS8A 1RCPA 3EFOB 3KPHA 4AX2A 3SYNA 3T4RA 4GQHA 4MVQA 5E33A 3O10A 3NKDA 1KNYA 3JYYA 5K0IA 3K7DA 3UR3C 2IYLD 1U0BB 1Z3IX 2A0UA 3C7JA 2P6VA 1OQCA 2KGOA 1M2OA 5A6JA 3MX3A 4ZLDA 2HMZA 2EPLX 4XPYA 5L0IA 3CAXA 3ZSUA 1Z7Qc 2CYDA 4G7ZF 1Z6AA 4PJJA 1C17M 2HS5A 2PF4E 4X0RA 1QKRA 3FOPA 1VMAA 1OKKA 1AUEA 1JMWA 1WOLA 5DS6A 4AL1A 5DS4A 2L81A 1QQ3A 4PJMA 3X2QC 3U2MA 1CGME 3GWNA 3TD7A 4C7OB 1RJ9A 4MNDA 1NBBA 3WHNA 2XL4A 3DE8A 4HFKB 4PFOA 2EILC 1PCXA 2RSEB 2OEXA 2M4EA 1O5HA 1HE9A 2X0CA 1D0ZA 2AP3A 3V5ZA 3M1CB 4YK5A 3VF0A 4CDVA 2RD9A 1OXBA 2ZXWC 2OJQA 2HSQA 2Y3HA 2G62A 3JRMO 4W8KA 3JCUQ 3HNJA 4OIPF 2YLGA 3U8VA 4NY3A 3M4CA 2UUIA 2HSBA 3O39A 4IARA 3EGXB 2LK4A 1FFHA 2VC9A 4NTBA 1TQGA 3JYHA 2XLHA 1YA9A 2ICWG 1ZW2A 1GQAA 2QLAA 3W8HA 3ZIBA 1MMNA 2ASRA 3ITFA 1EI7A 2VASA 3L8IA 3M79A 3VAYA 5KYYA 1A7VA 4LDQA 4XLNF 1Y4CA 2R7SA 1QLEC 3K33A 3EPVA 3B0VC 3GODA 3DAGA 4JRZA 4WGYA 1Y6DA 4JE9A 3X1OA 3DAFA 3PHF2 5L0JA 1WGWA 2J9WA 2R7OA 3FXHA 4ZLCA 4G7OF 1FMVA 1VLTA 3EH1A 4NTAA 3L8JA 4EBJA 1A7EA 5FZTA 2NUPB 4OINF 2R9RB 2XRHA 2IXMA 3G50A 4MW3A 3DM9B 1M6TA 4OIRF 2OKUA 1K05A 4RDAA 3HNIA 4XEFA 2J9BA 5E3CA 3EG9B 4DVYP 1CPRA 1CGNA 3LAYA 3LS1A 3S0XA 2R02A 1R5ID 2KK1A 4LACB 3SNHA 4BJ5A 4JEBA 2VCBA 3F46A 3K66A 2VCCA 1L3PA 3S29A 5COFA 2P0NA 3ZDLA 1TWGA 2NPUA 4FWVA 2Y3BA 2L6GA 3JTLO 3L1MA 5DLJA 3IEEA 3W2VA 1K40A 5HV9A 1L7CA 1CGOA 1ZZPA 2J7PA 4EBKA 2KNHA 3AJMA 3GM2A 4JVSA 3DJUB 5B3SC 3NG1A 4MVRA 4QI0A 1WTYA 1ORYA 1NLXA 2HZ8A 3T6GB 2D5RB 1LI7A 3MFNA 3SEOA 1YVIA 2R05A 4AK9A 3U8PA 4U5FE 2OJED 3S28A 2H8AA 5T1DB 2PX0A 3KYJA 1OCOC 2GWWA 1BR4A 3HJCA 3RIPA 1HMDA 1FFTC 4K0DA 3T9OA 4E18A 4N4WA 1C03A 5F28E 3B9QA 2Y3DA 4U5HA 1M2VA 5EHHA 4JIOA 4RD9A 5BUOA 4YL3A 2WVQA 2WZFA 1TKNA 1W2WA 3QVZA 4PFPA 2J46A 5JP7A 3TJ6A 5JS5A 1D0XA 2YRFA 2V3CC 3GEIA 3HTKC 4CSAC 5HSWA 3AG1C 2OEVA 2NUTB 4N6HA 3GEEA 1UFBA 3K6BA 2R7QA 4OD5A 5A6KA 3MLGA 1BR1A 1JRAA 4E0IA 1TFOB 2EPOA 4GYTA 1EQ1A 2KYHA 1OW7A 5L0FA 1D0YA 3DXJF 3KYIA 2IM8A 5F5FA 4YL0A 2ZXOA 5L3VA 4YWQA 3S90A 1JPNA 2KW3C 3C62A 3K1IC 4MVZA 4O6MA 5DQTA 3ABMC 2CNWD 3AOUA 4LLEA 4Q5SF 1NFNA 1T5OA 3FAPB 1BR2A 3UGOA 1SYQA 1NU7D 1YDIA 2CDQA 3A9CA 4XTKA 5T3TA 4CS9C 1BDJB 4KC9A 1T6UA 4R32A 1J8YF 2Q00A 5GPGB 4PJLA 3U2LA 1RMVA 1D1BA 4O6NA 3V5XA 4D4NA 2IXPA 3C8ZA 3LNRA 3FVYA 3DWWA 4C3EA 2NSFA 3GWLA 3IQTA 3U0CA 3EHMA 2MWQA 2XS1A 1NZEA 2ZXPA 4U5CE 3U9JA 4BJTA 2HJMA 5IY5C 3AGTA 5KYWA 1ZHZA 3ZVRA 5KYXB 2ZD9A 2KJGA 1G4WR 1ZHTA 3SXYA 2LCHA 3TK0A 4EBBA 1S05A 3Q7LA 5B3IA 1QPUA 4XWJA 4Z9HA 4ER9A 4MVOA 3FOOA 4M63A 1E2XA 4CS8A 1FAPB 1SF8A 5D92A 4QI2A 2WVOA 2HMQA 1YARO 2VH3A 3M4BA 3LEOA 4U9EA 2HKVA 4WABA 3MBGA 1RKEB 3I5QA 2L6FA 1VTMP 4O6YA 4JJGA 4XEVA 4F4BA 3EG9A 3RYLA 1H9TA 3ZC4A 4I1OB 1GGQA 1ZHYA 4Z9IA 3O6XA 4JTCB 4ULWA 4BJ6C 3ABKC 4PR9A 4CIHA 3POVA 2XXAB 1VYKA 2OU6A 5JVEA 3V7OA 2Q9BA 2KQ9A 3TOLA 1EA8A 3U3FA 1QZXA 2IXOA 1LE2A 1WATA 2FGYA 2OOCA 5AGFA 1H6GA 4MQ9F 3FMSA 2KSFA 2XSEA 1Q0FA 4JW1A 3FHDA 1VOMA 3ATPA 4CJGA 5BQGA 3ECSA 4P6IC 3NYMA 1BBHA 3RW0A 4YT4A 2F22A 256BA 2D4UA 1LVKA 4J7YA 3CEXA 4DRJB 1YA7O 4EKWA 3UGPA 4EHPA 2PNOA 2FFHA 3RH3A 4JURI 2EPNA 4DXWA 3SXZA 1ORSC 3W2WA 2YL3A 1DOWA 1U6HA 2J45A 3AQCA 3R7CA 3DZAA 3NMIA 1H9GA 2EIJC 4O7GA 3DM5A 4WGZA 1ZHWA 1O3UA 3VYWA 2W4BA 5L0HA 5TJ5E 1XZQA 2J0WA 3QZCA 5BQHA 3B0UX 3R2PA 5CI8A 5COMA 1RKCA 1LIHA 4OD4A 3UNGC 1Q0DA 4XLPF 2B0JA 2B0HA 2LD6A 3B29A 3FAJA 1VK5A 4J7TA 4MS2A 5B1AC 1AVOB 1ZYRF 2G3KA 3RKOF 2L9JA 4DBQA 3EZHA 3AG4C 2NUTA 1GM5A 1E86A 4FX5A 3U5SA 2BE5F 2WZLA 1JAFA 3HKKA 2R7VA 2R25A 2JX0A 3W4YA 2C03A 3ZTZA 4DRIB 3EHNA 2WB7A 4CDYA 4KNVA 1YAUO 3ASNC 1BZ4A 4JKVA 4KBLA 4XPXA 3EGDA 1JR8A 1GS9A 2GA0A 3H2UA 3E9VA 2A1DD 3KKBA 1LI5A 3LEVA 5JSLA 1G5ZA 3T6BA 1LE4A 1OXKA 2J9VA 3QW1A 4Q7CA 5COGA 3H65A 1LM3B 1NFOA 2AWCA 3ASOC 1E85A 2R7RA 1Q0MA 1FR0A 1MNEA 4P9TA 3OA1A 2DB4A 3WODF 5KYUA 3O55A 3EFOA 3VRCA 4HE8D 4AE4B 2H7VC 5AC5A 1I5NA 5JRAA 3M15A 1RJ9B 2DGJA 1PD0A 2JPUA 2XLMA 4MTGA 3U9MA 1HE1A 3EH2A 4CJOA 2CNWA 1T6QA 2IXNA 1ST6A 1YYXA 2A68F 2R03A 2WVNA 2X51A 1XWJA 3GORA 4JTDB 2R7TA 5EGYA 4Q4ZF 2JD3A 2DYRC 5DS5A 2Q3TA 3Q6NA 4I1MA 4DRHB 3GEHA 4E7ZA 4W8PA 2AU5A 4LLCA 2H7OA 1FTSA 1KTMA 3DKAA 2P1AA 2A0BA 2XLDA
chains in the Genus database with same CATH topology
2XLVA 1CPQA 1YZCA 1YZAA 4CDAA 4D4NA 3ZTMA 4CDVA 3QVYA 1E84A 2XLEA 2YL0A 3HNJA 1S05A 2YLGA 5B3IA 1QPUA 4ER9A 3NMKA 3FOOA 3M4CA 4IARA 2BC5A 4CIPA 2XLHA 2QLAA 1GQAA 2J8WA 3M4BA 4U9EA 3M79A 1E83A 1A7VA 2YLDA 2YLIA 4IB4A 2YKZA 4WGYA 3ZWIA 4JE9A 3HNLA 3TOLA 4ULVA 5AGFA 2YL7A 3DE9A 4JEAA 1M6TA 3HNIA 2J9BA 1YYJA 4CJGA 3NMJA 3TOMA 1CPRA 1CGNA 1APCA 2XM4A 1BBHA 5JVEA 256BA 2XM0A 4JEBA 2XLOA 5JUAA 3L1MA 1EKYA 2YL3A 3NMIA 1CGOA 4WGZA 3ZQYA 2YL1A 5JLIA 4L6RA 1MQVA 4IAQA 2XLDA 3U8PA 3QW0A 2CCYA 2XLWA 1E86A 3IQ5A 1JAFA 5JT4A 4CX9A 3ZTZA 4N4WA 3C63A 4CDYA 2XL8A 4JKVA 1RCPA 4NC3A 3QVZA 5JP7A 5JSLA 3HNKA 5JS5A 4U9DA 3QW1A 1E85A 1LM3B 4N6HA 4D4XA 3IQ6A 3VRCA 3ZQVA 5JRAA 3M15A 2XLMA 4CJOA 4EIYA 1YYXA 3FOPA 3C62A 2XL6A 1QQ3A 1NBBA 3DE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLV A;  1CPQ A;  1YZC A;  1YZA A;  4CDA A;  4D4N A;  3ZTM A;  4CDV A;  3QVY A;  1E84 A;  2XLE A;  2YL0 A;  3HNJ A;  1S05 A;  2YLG A;  5B3I A;  1QPU A;  4ER9 A;  3NMK A;  3FOO A;  3M4C A;  4IAR A;  2BC5 A;  4CIP A;  2XLH A;  2QLA A;  1GQA A;  2J8W A;  3M4B A;  4U9E A;  3M79 A;  1E83 A;  1A7V A;  2YLD A;  2YLI A;  4IB4 A;  2YKZ A;  4WGY A;  3ZWI A;  4JE9 A;  3HNL A;  3TOL A;  4ULV A;  5AGF A;  2YL7 A;  3DE9 A;  4JEA A;  1M6T A;  3HNI A;  2J9B A;  1YYJ A;  4CJG A;  3NMJ A;  3TOM A;  1CPR A;  1CGN A;  1APC A;  2XM4 A;  1BBH A;  5JVE A;  256B A;  2XM0 A;  4JEB A;  2XLO A;  5JUA A;  3L1M A;  1EKY A;  2YL3 A;  3NMI A;  1CGO A;  4WGZ A;  3ZQY A;  2YL1 A;  5JLI A;  4L6R A;  1MQV A;  4IAQ A;  2XLD A;  3U8P A;  3QW0 A;  2CCY A;  2XLW A;  1E86 A;  3IQ5 A;  1JAF A;  5JT4 A;  4CX9 A;  3ZTZ A;  4N4W A;  3C63 A;  4CDY A;  2XL8 A;  4JKV A;  1RCP A;  4NC3 A;  3QVZ A;  5JP7 A;  5JSL A;  3HNK A;  5JS5 A;  4U9D A;  3QW1 A;  1E85 A;  1LM3 B;  4N6H A;  4D4X A;  3IQ6 A;  3VRC A;  3ZQV A;  5JRA A;  3M15 A;  2XLM A;  4CJO A;  4EIY A;  1YYX A;  3FOP A;  3C62 A;  2XL6 A;  1QQ3 A;  1NBB A;  3DE8 A; 
#chains in the Genus database with same CATH topology
 4CS7 A;  3JRT A;  4PAC A;  2R7W A;  1YZC A;  1YZA A;  4CDA A;  3ZTM A;  3CZ6 A;  2W4M A;  4K1O A;  1OCC C;  3B0P A;  5E2Q A;  3UMI A;  1Q0K A;  2EPK X;  4C7O A;  3N0T A;  4BJ1 A;  1LS1 A;  5DQZ A;  3AQB A;  2M64 A;  5L0D A;  4MTF A;  2R7U A;  2PBE A;  4J30 B;  2FAP B;  1A41 A;  5F5H A;  4YJW A;  5A6B D;  5L3Q A;  1G8X A;  4CIP A;  4XEK A;  4BG0 A;  3OEO A;  4DVZ A;  4H4K C;  4OIQ F;  2KC3 A;  2L7A A;  4MTO A;  4PK4 A;  2PFD A;  1SR2 A;  5FCL A;  2OG2 A;  3S9O A;  4BEM J;  1E83 A;  2PP4 A;  4CSA A;  4A2N B;  3BEH A;  2YZS A;  4LER A;  4IB4 A;  1D1A A;  1OCR C;  1F1M A;  2C04 A;  3KMI A;  1LPE A;  3QMK A;  2LIG A;  3EGX A;  2V26 A;  4MVM A;  3S27 A;  2EIN C;  4CBE A;  2R7X A;  3L0I A;  1AEP A;  1MMD A;  2QTV A;  4G7H F;  4ULV A;  1G4U S;  1QSP A;  3WG7 C;  4YT8 A;  1U89 A;  4O79 A;  1K04 A;  4JCZ A;  1TWC A;  5E3A A;  3TJ5 A;  1N1C A;  1ZVZ A;  5A6A A;  2I8B A;  3RVZ A;  3SP1 A;  2YL7 A;  4GEH A;  3UMH A;  2HUJ A;  1DOV A;  2NSG A;  4JZA A;  3K1I A;  3V5Y A;  3RQG A;  1HMO A;  1WWP A;  3LJB A;  3TOM A;  4C3B A;  2W45 A;  3LNM B;  1APC A;  3DI5 A;  1LS4 A;  1WN0 A;  2EPM X;  2HJ3 A;  1TR2 A;  2XM0 A;  2IBF A;  4LDR A;  4MW8 A;  2NUP A;  1IW7 F;  3H2V A;  3AG2 C;  3G4X A;  2EIM C;  4BEJ A;  2NG1 A;  4CS9 A;  4AL0 A;  5AC4 A;  2XLO A;  1JOG A;  5JUA A;  2VCA A;  1OCZ C;  2BL2 A;  2OQM A;  2YQY A;  2CGE A;  3N2Z B;  1Z23 A;  4HEA J;  5EK0 A;  3DJN B;  3TUL A;  3AGU A;  1H7I A;  3BRJ A;  4B6I A;  4BPM A;  2Q9C A;  2YL1 A;  4DOZ A;  4QDL A;  3WAQ A;  5JLI A;  4XPW A;  1FNT c;  1B68 A;  3GM1 A;  4WJ0 A;  3A11 A;  3EJN A;  4C3D A;  2PX3 A;  4P9F A;  2Z15 A;  4RBN A;  1MQV A;  1I4Z A;  1M2V B;  1VLS A;  2LFD A;  5T3W A;  3RQE A;  3W8I A;  4ANJ A;  1KU2 A;  3GAN A;  3K1H A;  3T6J A;  2GFH A;  3C8G D;  2CCY A;  4NCQ A;  2IOQ A;  2Q7R A;  2WL8 A;  3UMK A;  1JPJ A;  1M56 C;  2GAQ A;  1I4Y A;  4KNW A;  2TMV P;  1ZU5 A;  5D91 A;  4AE4 A;  3N24 A;  1LKX A;  3LES A;  3C63 A;  1Z63 A;  5BQI A;  1VB5 A;  3TQO A;  4IAO A;  3CQZ A;  4J32 B;  2GDC A;  3MYI A;  3U3B A;  3RF3 A;  1PV3 A;  3MYF A;  3C8G B;  4NC3 A;  1A0B A;  3LUT B;  3HNK A;  4IRU A;  4BJ6 A;  2QNL A;  2YEV A;  5CIV A;  3NDB B;  4U9D A;  2Y3G A;  4E7S A;  4IJJ A;  3I4U A;  4PJN A;  1OR3 A;  1WAS A;  3RFY A;  1VYI A;  1FMW A;  5DVW A;  2A69 F;  1A7D A;  2Q4F A;  2W9Y A;  3NKE A;  3IQ6 A;  3Q6M A;  4JCH A;  1V4A A;  3HLZ A;  4K7B A;  4D4X A;  3E70 C;  3ZQV A;  1HW2 A;  1NU9 C;  5A69 A;  2G3V A;  1ZU4 A;  2H7B A;  2OCC C;  2LFF A;  2QE9 A;  4EIY A;  1T9K A;  2AWY A;  4FES A;  3LLK A;  2HV6 A;  2XL6 A;  2LQG A;  3IHU A;  1D1C A;  3C18 A;  1OKK D;  2MHR A;  4BJ5 C;  5KYW B;  2QUP A;  2E87 A;  1J8M F;  1YJG A;  4FAP B;  2DYS C;  1C02 A;  3NRH A;  4E0H A;  3RQF A;  3LLI A;  1Q0G A;  2XLV A;  2ZPA A;  1SZI A;  1CPQ A;  4DJ9 A;  1V54 C;  2Q9A A;  1Z5Z A;  3IPM O;  2ETS A;  3OWT A;  3SZR A;  1V74 B;  3FDQ A;  2A6H F;  3B71 A;  2P7V A;  2QY9 A;  1UG7 A;  3SXM A;  2YWA A;  3QVY A;  3PMR A;  4EUK B;  2HFI A;  2YVK A;  3KL4 A;  2A6E F;  4U5E E;  2XLE A;  3ABL C;  3IQC A;  2YL0 A;  4DBR A;  5A6B A;  3GM3 A;  3PDM P;  3KH2 A;  2HV7 A;  3JT1 A;  4I3M A;  3J06 A;  3NMK A;  3NYJ A;  3US6 A;  5CI9 A;  3S84 A;  4N6C A;  1NG1 A;  2AVK A;  4A4A A;  2BC5 A;  4UDV A;  5KYX A;  4IWB A;  2J8W A;  4U5G A;  1ZW3 A;  4YN0 B;  2YLD A;  5L0G A;  2YLI A;  1HY5 A;  3F47 A;  4I44 A;  2J9U A;  2YKZ A;  4YT5 A;  3ZWI A;  1TWH A;  4KI2 A;  4JTA B;  5B1B C;  2YHS A;  1MMA A;  3HNL A;  4U5D E;  2LP4 A;  1RKE A;  3JSE O;  4LDK A;  5L0C A;  4MVS A;  3I5P A;  3PCV A;  3DMD A;  3Q7G A;  1TWA A;  2I15 A;  3NYL A;  2MYS A;  3DE9 A;  4NTF A;  4NQF A;  4JEA A;  4IGG A;  4JC7 A;  4MVU A;  1IZM A;  3SXK A;  1OW6 A;  4JJF A;  1MND A;  1YYJ A;  3NMJ A;  4XQ1 A;  2XXA A;  3QTH A;  1S7Z A;  2XM4 A;  3RVY A;  4G0H A;  4H54 A;  2L6H A;  2EIK C;  1V55 C;  2CW0 F;  2UUH A;  1RXQ A;  3ZG1 A;  2O9X A;  3LS0 A;  3L34 A;  2Y69 C;  4EWC A;  2VB6 A;  4YL1 A;  2J0X A;  1T01 A;  3VM6 A;  1YLM A;  1EKY A;  3EQL F;  4U5B E;  2P61 A;  1SMY F;  2ZXR A;  1R4T A;  3JZ0 A;  4E17 A;  3ZQY A;  3CSK A;  5KYY B;  3AG3 C;  1O87 A;  1TFK B;  4ONS A;  4G78 A;  1E84 A;  3C8G A;  4OIO F;  2J7P D;  2Y39 A;  1ZHX A;  4L6R A;  1PD1 A;  2DI3 A;  4IAQ A;  3G4Z A;  4YT2 A;  2WZG A;  5KYN A;  3EZI A;  3QW0 A;  3EGD B;  1HW1 A;  1MMG A;  2XLW A;  4HFF B;  1OR2 A;  3IQ5 A;  5JT4 A;  1OW8 A;  1XZP A;  2LSE A;  4CX9 A;  3DD7 A;  4CS8 C;  1ORJ A;  4Z9J A;  1T6I A;  1NSG B;  3JSZ A;  1M57 C;  1QVX A;  4N06 A;  5KYU B;  2XL8 A;  2XS8 A;  1RCP A;  3EFO B;  3KPH A;  4AX2 A;  3SYN A;  3T4R A;  4GQH A;  4MVQ A;  5E33 A;  3O10 A;  3NKD A;  1KNY A;  3JYY A;  5K0I A;  3K7D A;  3UR3 C;  2IYL D;  1U0B B;  1Z3I X;  2A0U A;  3C7J A;  2P6V A;  1OQC A;  2KGO A;  1M2O A;  5A6J A;  3MX3 A;  4ZLD A;  2HMZ A;  2EPL X;  4XPY A;  5L0I A;  3CAX A;  3ZSU A;  1Z7Q c;  2CYD A;  4G7Z F;  1Z6A A;  4PJJ A;  1C17 M;  2HS5 A;  2PF4 E;  4X0R A;  1QKR A;  3FOP A;  1VMA A;  1OKK A;  1AUE A;  1JMW A;  1WOL A;  5DS6 A;  4AL1 A;  5DS4 A;  2L81 A;  1QQ3 A;  4PJM A;  3X2Q C;  3U2M A;  1CGM E;  3GWN A;  3TD7 A;  4C7O B;  1RJ9 A;  4MND A;  1NBB A;  3WHN A;  2XL4 A;  3DE8 A;  4HFK B;  4PFO A;  2EIL C;  1PCX A;  2RSE B;  2OEX A;  2M4E A;  1O5H A;  1HE9 A;  2X0C A;  1D0Z A;  2AP3 A;  3V5Z A;  3M1C B;  4YK5 A;  3VF0 A;  4CDV A;  2RD9 A;  1OXB A;  2ZXW C;  2OJQ A;  2HSQ A;  2Y3H A;  2G62 A;  3JRM O;  4W8K A;  3JCU Q;  3HNJ A;  4OIP F;  2YLG A;  3U8V A;  4NY3 A;  3M4C A;  2UUI A;  2HSB A;  3O39 A;  4IAR A;  3EGX B;  2LK4 A;  1FFH A;  2VC9 A;  4NTB A;  1TQG A;  3JYH A;  2XLH A;  1YA9 A;  2ICW G;  1ZW2 A;  1GQA A;  2QLA A;  3W8H A;  3ZIB A;  1MMN A;  2ASR A;  3ITF A;  1EI7 A;  2VAS A;  3L8I A;  3M79 A;  3VAY A;  5KYY A;  1A7V A;  4LDQ A;  4XLN F;  1Y4C A;  2R7S A;  1QLE C;  3K33 A;  3EPV A;  3B0V C;  3GOD A;  3DAG A;  4JRZ A;  4WGY A;  1Y6D A;  4JE9 A;  3X1O A;  3DAF A;  3PHF 2;  5L0J A;  1WGW A;  2J9W A;  2R7O A;  3FXH A;  4ZLC A;  4G7O F;  1FMV A;  1VLT A;  3EH1 A;  4NTA A;  3L8J A;  4EBJ A;  1A7E A;  5FZT A;  2NUP B;  4OIN F;  2R9R B;  2XRH A;  2IXM A;  3G50 A;  4MW3 A;  3DM9 B;  1M6T A;  4OIR F;  2OKU A;  1K05 A;  4RDA A;  3HNI A;  4XEF A;  2J9B A;  5E3C A;  3EG9 B;  4DVY P;  1CPR A;  1CGN A;  3LAY A;  3LS1 A;  3S0X A;  2R02 A;  1R5I D;  2KK1 A;  4LAC B;  3SNH A;  4BJ5 A;  4JEB A;  2VCB A;  3F46 A;  3K66 A;  2VCC A;  1L3P A;  3S29 A;  5COF A;  2P0N A;  3ZDL A;  1TWG A;  2NPU A;  4FWV A;  2Y3B A;  2L6G A;  3JTL O;  3L1M A;  5DLJ A;  3IEE A;  3W2V A;  1K40 A;  5HV9 A;  1L7C A;  1CGO A;  1ZZP A;  2J7P A;  4EBK A;  2KNH A;  3AJM A;  3GM2 A;  4JVS A;  3DJU B;  5B3S C;  3NG1 A;  4MVR A;  4QI0 A;  1WTY A;  1ORY A;  1NLX A;  2HZ8 A;  3T6G B;  2D5R B;  1LI7 A;  3MFN A;  3SEO A;  1YVI A;  2R05 A;  4AK9 A;  3U8P A;  4U5F E;  2OJE D;  3S28 A;  2H8A A;  5T1D B;  2PX0 A;  3KYJ A;  1OCO C;  2GWW A;  1BR4 A;  3HJC A;  3RIP A;  1HMD A;  1FFT C;  4K0D A;  3T9O A;  4E18 A;  4N4W A;  1C03 A;  5F28 E;  3B9Q A;  2Y3D A;  4U5H A;  1M2V A;  5EHH A;  4JIO A;  4RD9 A;  5BUO A;  4YL3 A;  2WVQ A;  2WZF A;  1TKN A;  1W2W A;  3QVZ A;  4PFP A;  2J46 A;  5JP7 A;  3TJ6 A;  5JS5 A;  1D0X A;  2YRF A;  2V3C C;  3GEI A;  3HTK C;  4CSA C;  5HSW A;  3AG1 C;  2OEV A;  2NUT B;  4N6H A;  3GEE A;  1UFB A;  3K6B A;  2R7Q A;  4OD5 A;  5A6K A;  3MLG A;  1BR1 A;  1JRA A;  4E0I A;  1TFO B;  2EPO A;  4GYT A;  1EQ1 A;  2KYH A;  1OW7 A;  5L0F A;  1D0Y A;  3DXJ F;  3KYI A;  2IM8 A;  5F5F A;  4YL0 A;  2ZXO A;  5L3V A;  4YWQ A;  3S90 A;  1JPN A;  2KW3 C;  3C62 A;  3K1I C;  4MVZ A;  4O6M A;  5DQT A;  3ABM C;  2CNW D;  3AOU A;  4LLE A;  4Q5S F;  1NFN A;  1T5O A;  3FAP B;  1BR2 A;  3UGO A;  1SYQ A;  1NU7 D;  1YDI A;  2CDQ A;  3A9C A;  4XTK A;  5T3T A;  4CS9 C;  1BDJ B;  4KC9 A;  1T6U A;  4R32 A;  1J8Y F;  2Q00 A;  5GPG B;  4PJL A;  3U2L A;  1RMV A;  1D1B A;  4O6N A;  3V5X A;  4D4N A;  2IXP A;  3C8Z A;  3LNR A;  3FVY A;  3DWW A;  4C3E A;  2NSF A;  3GWL A;  3IQT A;  3U0C A;  3EHM A;  2MWQ A;  2XS1 A;  1NZE A;  2ZXP A;  4U5C E;  3U9J A;  4BJT A;  2HJM A;  5IY5 C;  3AGT A;  5KYW A;  1ZHZ A;  3ZVR A;  5KYX B;  2ZD9 A;  2KJG A;  1G4W R;  1ZHT A;  3SXY A;  2LCH A;  3TK0 A;  4EBB A;  1S05 A;  3Q7L A;  5B3I A;  1QPU A;  4XWJ A;  4Z9H A;  4ER9 A;  4MVO A;  3FOO A;  4M63 A;  1E2X A;  4CS8 A;  1FAP B;  1SF8 A;  5D92 A;  4QI2 A;  2WVO A;  2HMQ A;  1YAR O;  2VH3 A;  3M4B A;  3LEO A;  4U9E A;  2HKV A;  4WAB A;  3MBG A;  1RKE B;  3I5Q A;  2L6F A;  1VTM P;  4O6Y A;  4JJG A;  4XEV A;  4F4B A;  3EG9 A;  3RYL A;  1H9T A;  3ZC4 A;  4I1O B;  1GGQ A;  1ZHY A;  4Z9I A;  3O6X A;  4JTC B;  4ULW A;  4BJ6 C;  3ABK C;  4PR9 A;  4CIH A;  3POV A;  2XXA B;  1VYK A;  2OU6 A;  5JVE A;  3V7O A;  2Q9B A;  2KQ9 A;  3TOL A;  1EA8 A;  3U3F A;  1QZX A;  2IXO A;  1LE2 A;  1WAT A;  2FGY A;  2OOC A;  5AGF A;  1H6G A;  4MQ9 F;  3FMS A;  2KSF A;  2XSE A;  1Q0F A;  4JW1 A;  3FHD A;  1VOM A;  3ATP A;  4CJG A;  5BQG A;  3ECS A;  4P6I C;  3NYM A;  1BBH A;  3RW0 A;  4YT4 A;  2F22 A;  256B A;  2D4U A;  1LVK A;  4J7Y A;  3CEX A;  4DRJ B;  1YA7 O;  4EKW A;  3UGP A;  4EHP A;  2PNO A;  2FFH A;  3RH3 A;  4JUR I;  2EPN A;  4DXW A;  3SXZ A;  1ORS C;  3W2W A;  2YL3 A;  1DOW A;  1U6H A;  2J45 A;  3AQC A;  3R7C A;  3DZA A;  3NMI A;  1H9G A;  2EIJ C;  4O7G A;  3DM5 A;  4WGZ A;  1ZHW A;  1O3U A;  3VYW A;  2W4B A;  5L0H A;  5TJ5 E;  1XZQ A;  2J0W A;  3QZC A;  5BQH A;  3B0U X;  3R2P A;  5CI8 A;  5COM A;  1RKC A;  1LIH A;  4OD4 A;  3UNG C;  1Q0D A;  4XLP F;  2B0J A;  2B0H A;  2LD6 A;  3B29 A;  3FAJ A;  1VK5 A;  4J7T A;  4MS2 A;  5B1A C;  1AVO B;  1ZYR F;  2G3K A;  3RKO F;  2L9J A;  4DBQ A;  3EZH A;  3AG4 C;  2NUT A;  1GM5 A;  1E86 A;  4FX5 A;  3U5S A;  2BE5 F;  2WZL A;  1JAF A;  3HKK A;  2R7V A;  2R25 A;  2JX0 A;  3W4Y A;  2C03 A;  3ZTZ A;  4DRI B;  3EHN A;  2WB7 A;  4CDY A;  4KNV A;  1YAU O;  3ASN C;  1BZ4 A;  4JKV A;  4KBL A;  4XPX A;  3EGD A;  1JR8 A;  1GS9 A;  2GA0 A;  3H2U A;  3E9V A;  2A1D D;  3KKB A;  1LI5 A;  3LEV A;  5JSL A;  1G5Z A;  3T6B A;  1LE4 A;  1OXK A;  2J9V A;  3QW1 A;  4Q7C A;  5COG A;  3H65 A;  1LM3 B;  1NFO A;  2AWC A;  3ASO C;  1E85 A;  2R7R A;  1Q0M A;  1FR0 A;  1MNE A;  4P9T A;  3OA1 A;  2DB4 A;  3WOD F;  5KYU A;  3O55 A;  3EFO A;  3VRC A;  4HE8 D;  4AE4 B;  2H7V C;  5AC5 A;  1I5N A;  5JRA A;  3M15 A;  1RJ9 B;  2DGJ A;  1PD0 A;  2JPU A;  2XLM A;  4MTG A;  3U9M A;  1HE1 A;  3EH2 A;  4CJO A;  2CNW A;  1T6Q A;  2IXN A;  1ST6 A;  1YYX A;  2A68 F;  2R03 A;  2WVN A;  2X51 A;  1XWJ A;  3GOR A;  4JTD B;  2R7T A;  5EGY A;  4Q4Z F;  2JD3 A;  2DYR C;  5DS5 A;  2Q3T A;  3Q6N A;  4I1M A;  4DRH B;  3GEH A;  4E7Z A;  4W8P A;  2AU5 A;  4LLC A;  2H7O A;  1FTS A;  1KTM A;  3DKA A;  2P1A A;  2A0B A;  2XLD A; 
#chains in the Genus database with same CATH homology
 2XLV A;  1CPQ A;  1YZC A;  1YZA A;  4CDA A;  4D4N A;  3ZTM A;  4CDV A;  3QVY A;  1E84 A;  2XLE A;  2YL0 A;  3HNJ A;  1S05 A;  2YLG A;  5B3I A;  1QPU A;  4ER9 A;  3NMK A;  3FOO A;  3M4C A;  4IAR A;  2BC5 A;  4CIP A;  2XLH A;  2QLA A;  1GQA A;  2J8W A;  3M4B A;  4U9E A;  3M79 A;  1E83 A;  1A7V A;  2YLD A;  2YLI A;  4IB4 A;  2YKZ A;  4WGY A;  3ZWI A;  4JE9 A;  3HNL A;  3TOL A;  4ULV A;  5AGF A;  2YL7 A;  3DE9 A;  4JEA A;  1M6T A;  3HNI A;  2J9B A;  1YYJ A;  4CJG A;  3NMJ A;  3TOM A;  1CPR A;  1CGN A;  1APC A;  2XM4 A;  1BBH A;  5JVE A;  256B A;  2XM0 A;  4JEB A;  2XLO A;  5JUA A;  3L1M A;  1EKY A;  2YL3 A;  3NMI A;  1CGO A;  4WGZ A;  3ZQY A;  2YL1 A;  5JLI A;  4L6R A;  1MQV A;  4IAQ A;  2XLD A;  3U8P A;  3QW0 A;  2CCY A;  2XLW A;  1E86 A;  3IQ5 A;  1JAF A;  5JT4 A;  4CX9 A;  3ZTZ A;  4N4W A;  3C63 A;  4CDY A;  2XL8 A;  4JKV A;  1RCP A;  4NC3 A;  3QVZ A;  5JP7 A;  5JSL A;  3HNK A;  5JS5 A;  4U9D A;  3QW1 A;  1E85 A;  1LM3 B;  4N6H A;  4D4X A;  3IQ6 A;  3VRC A;  3ZQV A;  5JRA A;  3M15 A;  2XLM A;  4CJO A;  4EIY A;  1YYX A;  3FOP A;  3C62 A;  2XL6 A;  1QQ3 A;  1NBB A;  3DE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...