1YARO

Structure of archeabacterial 20s proteasome mutant d9s- pa26 complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
228
structure length
218
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGSDHMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase activator
molecule keywords Proteasome alpha subunit
publication title The 1.9 A structure of a proteasome-11S activator complex and implications for proteasome-PAN/PA700 interactions.
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 86
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1yarO01
1FNTc 1Z7Qc 3JSEO 1AVOB 3JRMO 1YAUO 3IPMO 1YARO 3JTLO 1YA7O
chains in the Genus database with same CATH superfamily
3PDMP 4IAQA 4Q7CA 4DRJB 2LIGA 4W8PA 3U2LA 2HFIA 3JSEO 1HY5A 3OEOA 2XLHA 2P0NA 5T3WA 5EK0A 1NU9C 1NU7D 2PNOA 1U89A 4DVYP 2Q9BA 5F28E 3S27A 3AQBA 1T5OA 2WZGA 3AGTA 4LDQA 1CGNA 1YZCA 3ZC4A 1BDJB 4DVZA 1ZW2A 1ST6A 2L7AA 2GFHA 5L0CA 2IXMA 5A6BA 3U8PA 4X0RA 3MBGA 4U5DE 4ZLCA 2XXAA 2R7RA 5A6KA 3K6BA 2EIKC 1LI7A 1CGME 1ZW3A 1UG7A 1JAFA 4JURI 4ULWA 3JT1A 1QPUA 3KPHA 1Z3IX 1BR1A 1VOMA 4G0HA 3SEOA 5JVEA 4ONSA 1E2XA 4B6IA 2IXOA 4MVQA 4U5CE 2KC3A 3U2MA 4CJOA 5D92A 3UGPA 4OIOF 4PACA 2XL8A 3LAYA 4AL0A 4CDAA 2ZXWC 1OCZC 3DD7A 1ZU4A 3IHUA 3SZRA 4DJ9A 4AE4B 1VLTA 4OD5A 2A0UA 1MMAA 3NMIA 1NZEA 4H4KC 4EWCA 3F47A 2EPOA 1J8YF 2KSFA 1R4TA 3KKBA 3DJNB 2M64A 3LEVA 5COGA 1H7IA 1ZZPA 3GM1A 2W9YA 4P9FA 2VH3A 4NTBA 3MYIA 4G78A 4PJLA 1A0BA 2GA0A 1OXKA 4N6CA 1L3PA 4H54A 3MLGA 3SXYA 2WVNA 4YT2A 3S0XA 1YA9A 1QZXA 2X51A 1LKXA 5KYNA 4MVZA 1LE4A 2LSEA 3C8GA 5E3CA 3K1IC 3TJ5A 2XXAB 3JSZA 4KNVA 4CS9A 1M2VB 4O79A 3UGOA 1BR2A 1TFKB 3ASOC 1ZU5A 1Z63A 2G62A 2J0WA 3DKAA 1D1AA 2P6VA 1FMVA 1Q0FA 3L0IA 4MVSA 1OQCA 5AC5A 1TWHA 1APCA 3JTLO 5JT4A 1SMYF 3FHDA 2V3CC 2DYRC 1W2WA 1ORSC 1WASA 4ZLDA 1Q0MA 2VCCA 1YYJA 3R7CA 4OIPF 4J30B 4MVUA 4E0HA 1C02A 3GODA 4JW1A 2P7VA 1AUEA 3V5ZA 2F22A 2PFDA 2CYDA 4AX2A 1RKCA 2DYSC 2HS5A 2RSEB 3EHNA 2BL2A 4I3MA 4FESA 5E2QA 4PJMA 3DWWA 3CQZA 2Q4FA 4IWBA 3GEEA 4MTGA 2P1AA 4RD9A 1C17M 1NLXA 2L9JA 3TJ6A 1OW8A 1G4WR 4O6MA 5JRAA 1EI7A 3C8GB 2R7VA 1EQ1A 1TR2A 4IJJA 3EFOA 2OKUA 5T3TA 3SXMA 5L0GA 1CGOA 4BJ6C 1H9GA 2KGOA 2XL6A 3ZTZA 4YT5A 2Y3HA 2W4MA 3JYYA 3NYJA 3O55A 1OCCC 2GWWA 4MTFA 2AVKA 4U5GA 4WJ0A 4CDVA 3JRMO 2IYLD 3B9QA 3IPMO 3DMDA 1VMAA 3ITFA 4LLCA 4XEFA 2B0HA 2G3VA 4BJ5C 4I1OB 1OCOC 4PFOA 3UMHA 1FFHA 4BG0A 4Z9HA 3RYLA 2R7TA 2QY9A 2XL4A 4XWJA 2MYSA 3FDQA 2QTVA 2LFDA 4CSAC 2C03A 3AG2C 2O9XA 2H8AA 4BJTA 1T6UA 3EPVA 5KYYA 2DB4A 2Y3GA 4JTDB 1LE2A 3T6JA 4P9TA 1JPJA 3NMJA 3Q6NA 2Y3BA 2OCCC 5EHHA 2A69F 3S90A 1JMWA 1QVXA 3W2VA 3K1HA 3UNGC 4MVRA 2LCHA 3EFOB 1Z23A 1VTMP 2Y69C 2L81A 3FMSA 3C8GD 1PV3A 3C18A 3EZHA 4M63A 4U9DA 4JRZA 1TQGA 3QVZA 3J06A 4DRIB 3AG3C 1PCXA 3DM9B 2AWCA 4HFFB 1DOVA 1H9TA 2J45A 2OU6A 2DI3A 1YVIA 3AG1C 1A7VA 3ZVRA 4XEVA 1M56C 3V7OA 2FFHA 2Y3DA 4JTAB 3MX3A 5CI9A 2BE5F 1XZPA 1PD0A 1FFTC 1B68A 1WTYA 5JP7A 1OW6A 1C03A 2GAQA 3AGUA 1VB5A 2D4UA 3NG1A 5TJ5E 4AE4A 2VC9A 4JJGA 2TMVP 5BQGA 3ASNC 2JX0A 3JCUQ 4XPYA 3GANA 5KYYB 2KYHA 4YN0B 3RH3A 3U9JA 2A6EF 3TULA 3H2UA 1IW7F 4CIHA 4LERA 4CS8C 1RMVA 3TD7A 1D1CA 2WVQA 3ABLC 1ZHZA 1EA8A 2XLOA 4C7OB 1KNYA 3JYHA 2J46A 2V26A 1OR2A 2WB7A 2YLIA 3EGDB 4K0DA 1E86A 1AEPA 2YLGA 1SYQA 3F46A 3ABKC 4PK4A 4PR9A 3PMRA 1M2VA 1S7ZA 4DOZA 3M4CA 1VYKA 2XM0A 2YKZA 3ABMC 3HNKA 3ZQVA 4E18A 4DBRA 4XEKA 3HNLA 4YWQA 3ZIBA 3L34A 2QNLA 2YVKA 2PX3A 2EIJC 3DJUB 4HFKB 4PJJA 3RIPA 2L6HA 3UMIA 4NCQA 2QLAA 1XZQA 4U9EA 5EGYA 4C3DA 1O87A 3C62A 3R2PA 5DVWA 2HV7A 2A6HF 3IQ6A 4E17A 1D0YA 4JCZA 3DAGA 1A7EA 3EG9A 3A11A 256BA 2FAPB 4AL1A 1HW1A 2ZXPA 3EGXA 3HNJA 4NTAA 4CIPA 1WATA 3EZIA 1TWAA 4Z9JA 3U9MA 2AU5A 1Y4CA 3AG4C 3HLZA 1HMOA 1NBBA 5A6JA 1UFBA 2KJGA 1CPQA 1QKRA 3QTHA 3NKEA 4EIYA 3X2QC 3ATPA 4BEMJ 3K33A 5JS5A 2CCYA 4MTOA 3I5QA 2BC5A 2YL7A 1CPRA 2I15A 3MYFA 4U5BE 2XS1A 3NKDA 4NY3A 3WG7C 2CW0F 3GWLA 4KC9A 1K05A 3FAPB 2LK4A 4P6IC 4CBEA 1ZHXA 2L6FA 3IEEA 2LD6A 2LFFA 4CDYA 1TFOB 2J0XA 3OWTA 1BZ4A 5E33A 4IB4A 1MMDA 1FAPB 1T01A 2KK1A 1LPEA 3RFYA 1PD1A 2J7PD 5D91A 5L0DA 2EPLX 4RBNA 2KQ9A 4W8KA 4JVSA 3EHMA 4F4BA 3GEIA 4Q4ZF 4LLEA 2XLEA 3S9OA 4BPMA 2R03A 1SR2A 2UUIA 3EG9B 3VAYA 5BQIA 1YAUO 1Y6DA 5GPGB 3EGXB 4N6HA 4BJ6A 4CS7A 1ZVZA 4U5EE 2NSGA 1VYIA 1WGWA 3GORA 3PCVA 1LS1A 1MMGA 1ZYRF 3AJMA 1Q0GA 3FOPA 2OG2A 4K1OA 1HMDA 3N24A 3IQTA 2YZSA 5T1DB 2A68F 4NQFA 4U5HA 4BJ5A 1S05A 2IXPA 2J9WA 2OEXA 5DS6A 4JEAA 4MVMA 3LUTB 2R7WA 4O7GA 1RJ9B 3DZAA 2HZ8A 3LS1A 4G7HF 1M2OA 1LM3B 2ICWG 4XTKA 4XPWA 4KBLA 4D4XA 2J9BA 1JPNA 2IM8A 4HE8D 2Q9AA 2QUPA 1RKEB 3H65A 4JKVA 3TOMA 3LESA 3NYLA 2A1DD 1E84A 1AVOB 4MNDA 1XWJA 2CGEA 2YL0A 3RQFA 4CJGA 1ORJA 1V55C 3M79A 2ZPAA 3NMKA 4K7BA 4XPXA 3U3BA 2Q9CA 2DGJA 3WAQA 1TWGA 2WZLA 4BJ1A 4KI2A 1BR4A 3LJBA 3N2ZB 3US6A 1MQVA 3WHNA 1L7CA 2HMZA 3G4XA 1Q0KA 2EPKX 5BQHA 5L0JA 2GDCA 1YDIA 4IGGA 5COMA 4JEBA 4JTCB 4DRHB 2VCBA 1VK5A 2ZD9A 3EJNA 1O3UA 3H2VA 2YL1A 3VM6A 4CX9A 5DQZA 1KTMA 4N4WA 4E7SA 2Z15A 5L3VA 1A41A 3T4RA 4UDVA 1GS9A 3GWNA 2W45A 2XRHA 3U3FA 1YARO 2J8WA 1MMNA 2QE9A 3OA1A 5B3IA 4J7TA 3VYWA 4EHPA 4C7OA 2H7OA 4JZAA 5F5HA 2XM4A 4C3EA 3FOOA 1T6IA 3EGDA 4JIOA 3SXKA 4ER9A 3KL4A 2NUTA 4JCHA 3C63A 3QVYA 3LLIA 1JOGA 1Q0DA 4L6RA 1Z7Qc 1OW7A 4PFPA 3TQOA 3X1OA 3ZG1A 4D4NA 4EBJA 4E7ZA 2J7PA 1D0XA 4CS8A 2EILC 3TOLA 5B3SC 2MHRA 3EQLF 3O6XA 4GYTA 2RD9A 1FTSA 4YT4A 2M4EA 2YRFA 4QI2A 4N06A 3C8ZA 3DI5A 5B1BC 3VRCA 1T6QA 1GGQA 1IZMA 1NG1A 5IY5C 1OKKD 2WZFA 3BRJA 3C7JA 2YL3A 2EINC 3O39A 3DAFA 4IAOA 3UMKA 2OJED 4OD4A 4I44A 5AGFA 2R9RB 2R7QA 3S28A 4A4AA 4YL0A 3W8IA 1SZIA 3DE9A 1LI5A 5K0IA 1I4ZA 2HUJA 3RW0A 3TK0A 1TWCA 2VASA 2H7BA 2HSQA 3AQCA 3QW0A 4G7ZF 1A7DA 2PBEA 3LLKA 1JRAA 1NFNA 4JE9A 3POVA 4FAPB 2R7XA 4NTFA 2NUPB 1WN0A 4EKWA 2YLDA 3RVYA 3T6GB 2NUTB 3NYMA 5L0IA 3U5SA 1WOLA 1YYXA 1Z6AA 4J32B 3CZ6A 3BEHA 4FWVA 5AC4A 3JZ0A 1M57C 2I8BA 1U6HA 4JJFA 4LDRA 4ULVA 4YT8A 5L0FA 4HEAJ 3HTKC 2OOCA 3L1MA 5FCLA 1E85A 2E87A 1RXQA 4G7OF 5HSWA 1H6GA 3L8IA 4DXWA 4IRUA 2XLVA 3QW1A 3IQ5A 3K1IA 3CAXA 4LACB 3T6BA 2CNWD 2LP4A 4O6NA 1YLMA 2R7OA 5CIVA 5KYXA 3AOUA 1KU2A 1MNDA 2R25A 5KYWB 3G4ZA 5DQTA 4YJWA 1QQ3A 1VLSA 3W8HA 1WWPA 2VB6A 2Y39A 2G3KA 3LEOA 4U5FE 3B0VC 2VCAA 2YEVA 3JRTA 2XLDA 2Q7RA 3ZQYA 1NSGB 3V5XA 4EUKB 1RJ9A 1OXBA 1YJGA 1LS4A 5DS5A 2AP3A 1V74B 3EH1A 3S84A 1YA7O 2R7SA 1NFOA 2HV6A 1I5NA 5L3QA 1RKEA 3K7DA 3LNRA 3S29A 3I4UA 4YL1A 2OEVA 4MS2A 1F1MA 1G4US 3M15A 3W2WA 3FAJA 3Q7GA 2PF4E 2R02A 2XSEA 3RVZA 1K04A 3V5YA 1D0ZA 2C04A 1G8XA 2L6GA 4QDLA 3B71A 4ANJA 3KMIA 2JD3A 3FVYA 4E0IA 3B0UX 2YWAA 2HSBA 5E3AA 1OKKA 2NPUA 2UUHA 2A0BA 2XLWA 5KYXB 2AWYA 2ETSA 2R05A 3LS0A 3K66A 1OR3A 1T9KA 2OQMA 3QZCA 4MVOA 4QI0A 4C3BA 2ZXRA 5BUOA 2ZXOA 5KYUA 4AK9A 2NG1A 5A6AA 3G50A 2PP4A 3DM5A 4Z9IA 1HE1A 3ZWIA 1E83A 4MQ9F 3RQGA 2EPNA 5FZTA 1ZHWA 4CSAA 1ORYA 2XLMA 2LQGA 5JUAA 2PX0A 1U0BB 3N0TA 2HMQA 3PHF2 3IQCA 3U0CA 3ZDLA 2J9UA 1HW2A 3NRHA 4CS9C 4O6YA 3SYNA 3FXHA 4R32A 2MWQA 5B1AC 5F5FA 5JLIA 2EIMC 4FX5A 3Q7LA 4I1MA 2FGYA 4NC3A 2CNWA 1R5ID 3GEHA 5L0HA 4XLPF 5JSLA 1V54C 2WL8A 3ZTMA 3HKKA 3O10A 1G5ZA 2CDQA 4YL3A 5A6BD 5KYUB 1JR8A 2HJMA 1M6TA 1DOWA 2XS8A 3NDBB 3DE8A 1BBHA 2ASRA 2B0JA 3GM3A 1GM5A 4XLNF 3KH2A 1EKYA 3M1CB 3CEXA 2R7UA 4BEJA 1SF8A 3E70C 4A2NB 4OINF 4Q5SF 4GQHA 3VF0A 2NUPA 1FMWA 3DXJF 3RKOF 5A69A 3ECSA 1QSPA 1RCPA 1TKNA 3QMKA 3I5PA 4XQ1A 3W4YA 4KNWA 2EPMX 1D1BA 2IBFA 1ZHYA 3B0PA 2Q3TA 4MW3A 1FNTc 3KYIA 3SP1A 3L8JA 1V4AA 3EH2A 2WVOA 4WGYA 5DS4A 4DBQA 2KW3C 1ZHTA 2H7VC 2OJQA 5HV9A 4LDKA 3RF3A 3RQEA 3ZSUA 5CI8A 4RDAA 4YK5A 1FR0A 3U8VA 3SNHA 2W4BA 3WODF 1O5HA 1QLEC 2P61A 2J9VA 5COFA 4EBKA 1YZAA 1GQAA 1Z5ZA 2X0CA 1N1CA 3HNIA 2HKVA 2IOQA 1HE9A 5KYWA 1K40A 1OCRC 2IXNA 4JC7A 1J8MF 1LVKA 3SXZA 4MW8A 1LIHA 3HJCA 3M4BA 4IARA 4OIRF 3KYJA 4PJNA 4WABA 1MNEA 3MFNA 3E9VA 4GEHA 1I4YA 2YQYA 3Q6MA 3CSKA 3T9OA 3B29A 2HJ3A 5DLJA 2KNHA 3UR3C 3GM2A 2YHSA 4EBBA 4OIQF 3A9CA 3LNMB 2D5RB 4J7YA 4WGZA 2NSFA 2JPUA 2Q00A
chains in the Genus database with same CATH topology
1FNTc 1Z7Qc 3JSEO 1AVOB 3JRMO 1YAUO 3IPMO 1YARO 3JTLO 1YA7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNT c;  1Z7Q c;  3JSE O;  1AVO B;  3JRM O;  1YAU O;  3IPM O;  1YAR O;  3JTL O;  1YA7 O; 
#chains in the Genus database with same CATH topology
 3PDM P;  4IAQ A;  4Q7C A;  4DRJ B;  2LIG A;  4W8P A;  3U2L A;  2HFI A;  3JSE O;  1HY5 A;  3OEO A;  2XLH A;  2P0N A;  5T3W A;  5EK0 A;  1NU9 C;  1NU7 D;  2PNO A;  1U89 A;  4DVY P;  2Q9B A;  5F28 E;  3S27 A;  3AQB A;  1T5O A;  2WZG A;  3AGT A;  4LDQ A;  1CGN A;  1YZC A;  3ZC4 A;  1BDJ B;  4DVZ A;  1ZW2 A;  1ST6 A;  2L7A A;  2GFH A;  5L0C A;  2IXM A;  5A6B A;  3U8P A;  4X0R A;  3MBG A;  4U5D E;  4ZLC A;  2XXA A;  2R7R A;  5A6K A;  3K6B A;  2EIK C;  1LI7 A;  1CGM E;  1ZW3 A;  1UG7 A;  1JAF A;  4JUR I;  4ULW A;  3JT1 A;  1QPU A;  3KPH A;  1Z3I X;  1BR1 A;  1VOM A;  4G0H A;  3SEO A;  5JVE A;  4ONS A;  1E2X A;  4B6I A;  2IXO A;  4MVQ A;  4U5C E;  2KC3 A;  3U2M A;  4CJO A;  5D92 A;  3UGP A;  4OIO F;  4PAC A;  2XL8 A;  3LAY A;  4AL0 A;  4CDA A;  2ZXW C;  1OCZ C;  3DD7 A;  1ZU4 A;  3IHU A;  3SZR A;  4DJ9 A;  4AE4 B;  1VLT A;  4OD5 A;  2A0U A;  1MMA A;  3NMI A;  1NZE A;  4H4K C;  4EWC A;  3F47 A;  2EPO A;  1J8Y F;  2KSF A;  1R4T A;  3KKB A;  3DJN B;  2M64 A;  3LEV A;  5COG A;  1H7I A;  1ZZP A;  3GM1 A;  2W9Y A;  4P9F A;  2VH3 A;  4NTB A;  3MYI A;  4G78 A;  4PJL A;  1A0B A;  2GA0 A;  1OXK A;  4N6C A;  1L3P A;  4H54 A;  3MLG A;  3SXY A;  2WVN A;  4YT2 A;  3S0X A;  1YA9 A;  1QZX A;  2X51 A;  1LKX A;  5KYN A;  4MVZ A;  1LE4 A;  2LSE A;  3C8G A;  5E3C A;  3K1I C;  3TJ5 A;  2XXA B;  3JSZ A;  4KNV A;  4CS9 A;  1M2V B;  4O79 A;  3UGO A;  1BR2 A;  1TFK B;  3ASO C;  1ZU5 A;  1Z63 A;  2G62 A;  2J0W A;  3DKA A;  1D1A A;  2P6V A;  1FMV A;  1Q0F A;  3L0I A;  4MVS A;  1OQC A;  5AC5 A;  1TWH A;  1APC A;  3JTL O;  5JT4 A;  1SMY F;  3FHD A;  2V3C C;  2DYR C;  1W2W A;  1ORS C;  1WAS A;  4ZLD A;  1Q0M A;  2VCC A;  1YYJ A;  3R7C A;  4OIP F;  4J30 B;  4MVU A;  4E0H A;  1C02 A;  3GOD A;  4JW1 A;  2P7V A;  1AUE A;  3V5Z A;  2F22 A;  2PFD A;  2CYD A;  4AX2 A;  1RKC A;  2DYS C;  2HS5 A;  2RSE B;  3EHN A;  2BL2 A;  4I3M A;  4FES A;  5E2Q A;  4PJM A;  3DWW A;  3CQZ A;  2Q4F A;  4IWB A;  3GEE A;  4MTG A;  2P1A A;  4RD9 A;  1C17 M;  1NLX A;  2L9J A;  3TJ6 A;  1OW8 A;  1G4W R;  4O6M A;  5JRA A;  1EI7 A;  3C8G B;  2R7V A;  1EQ1 A;  1TR2 A;  4IJJ A;  3EFO A;  2OKU A;  5T3T A;  3SXM A;  5L0G A;  1CGO A;  4BJ6 C;  1H9G A;  2KGO A;  2XL6 A;  3ZTZ A;  4YT5 A;  2Y3H A;  2W4M A;  3JYY A;  3NYJ A;  3O55 A;  1OCC C;  2GWW A;  4MTF A;  2AVK A;  4U5G A;  4WJ0 A;  4CDV A;  3JRM O;  2IYL D;  3B9Q A;  3IPM O;  3DMD A;  1VMA A;  3ITF A;  4LLC A;  4XEF A;  2B0H A;  2G3V A;  4BJ5 C;  4I1O B;  1OCO C;  4PFO A;  3UMH A;  1FFH A;  4BG0 A;  4Z9H A;  3RYL A;  2R7T A;  2QY9 A;  2XL4 A;  4XWJ A;  2MYS A;  3FDQ A;  2QTV A;  2LFD A;  4CSA C;  2C03 A;  3AG2 C;  2O9X A;  2H8A A;  4BJT A;  1T6U A;  3EPV A;  5KYY A;  2DB4 A;  2Y3G A;  4JTD B;  1LE2 A;  3T6J A;  4P9T A;  1JPJ A;  3NMJ A;  3Q6N A;  2Y3B A;  2OCC C;  5EHH A;  2A69 F;  3S90 A;  1JMW A;  1QVX A;  3W2V A;  3K1H A;  3UNG C;  4MVR A;  2LCH A;  3EFO B;  1Z23 A;  1VTM P;  2Y69 C;  2L81 A;  3FMS A;  3C8G D;  1PV3 A;  3C18 A;  3EZH A;  4M63 A;  4U9D A;  4JRZ A;  1TQG A;  3QVZ A;  3J06 A;  4DRI B;  3AG3 C;  1PCX A;  3DM9 B;  2AWC A;  4HFF B;  1DOV A;  1H9T A;  2J45 A;  2OU6 A;  2DI3 A;  1YVI A;  3AG1 C;  1A7V A;  3ZVR A;  4XEV A;  1M56 C;  3V7O A;  2FFH A;  2Y3D A;  4JTA B;  3MX3 A;  5CI9 A;  2BE5 F;  1XZP A;  1PD0 A;  1FFT C;  1B68 A;  1WTY A;  5JP7 A;  1OW6 A;  1C03 A;  2GAQ A;  3AGU A;  1VB5 A;  2D4U A;  3NG1 A;  5TJ5 E;  4AE4 A;  2VC9 A;  4JJG A;  2TMV P;  5BQG A;  3ASN C;  2JX0 A;  3JCU Q;  4XPY A;  3GAN A;  5KYY B;  2KYH A;  4YN0 B;  3RH3 A;  3U9J A;  2A6E F;  3TUL A;  3H2U A;  1IW7 F;  4CIH A;  4LER A;  4CS8 C;  1RMV A;  3TD7 A;  1D1C A;  2WVQ A;  3ABL C;  1ZHZ A;  1EA8 A;  2XLO A;  4C7O B;  1KNY A;  3JYH A;  2J46 A;  2V26 A;  1OR2 A;  2WB7 A;  2YLI A;  3EGD B;  4K0D A;  1E86 A;  1AEP A;  2YLG A;  1SYQ A;  3F46 A;  3ABK C;  4PK4 A;  4PR9 A;  3PMR A;  1M2V A;  1S7Z A;  4DOZ A;  3M4C A;  1VYK A;  2XM0 A;  2YKZ A;  3ABM C;  3HNK A;  3ZQV A;  4E18 A;  4DBR A;  4XEK A;  3HNL A;  4YWQ A;  3ZIB A;  3L34 A;  2QNL A;  2YVK A;  2PX3 A;  2EIJ C;  3DJU B;  4HFK B;  4PJJ A;  3RIP A;  2L6H A;  3UMI A;  4NCQ A;  2QLA A;  1XZQ A;  4U9E A;  5EGY A;  4C3D A;  1O87 A;  3C62 A;  3R2P A;  5DVW A;  2HV7 A;  2A6H F;  3IQ6 A;  4E17 A;  1D0Y A;  4JCZ A;  3DAG A;  1A7E A;  3EG9 A;  3A11 A;  256B A;  2FAP B;  4AL1 A;  1HW1 A;  2ZXP A;  3EGX A;  3HNJ A;  4NTA A;  4CIP A;  1WAT A;  3EZI A;  1TWA A;  4Z9J A;  3U9M A;  2AU5 A;  1Y4C A;  3AG4 C;  3HLZ A;  1HMO A;  1NBB A;  5A6J A;  1UFB A;  2KJG A;  1CPQ A;  1QKR A;  3QTH A;  3NKE A;  4EIY A;  3X2Q C;  3ATP A;  4BEM J;  3K33 A;  5JS5 A;  2CCY A;  4MTO A;  3I5Q A;  2BC5 A;  2YL7 A;  1CPR A;  2I15 A;  3MYF A;  4U5B E;  2XS1 A;  3NKD A;  4NY3 A;  3WG7 C;  2CW0 F;  3GWL A;  4KC9 A;  1K05 A;  3FAP B;  2LK4 A;  4P6I C;  4CBE A;  1ZHX A;  2L6F A;  3IEE A;  2LD6 A;  2LFF A;  4CDY A;  1TFO B;  2J0X A;  3OWT A;  1BZ4 A;  5E33 A;  4IB4 A;  1MMD A;  1FAP B;  1T01 A;  2KK1 A;  1LPE A;  3RFY A;  1PD1 A;  2J7P D;  5D91 A;  5L0D A;  2EPL X;  4RBN A;  2KQ9 A;  4W8K A;  4JVS A;  3EHM A;  4F4B A;  3GEI A;  4Q4Z F;  4LLE A;  2XLE A;  3S9O A;  4BPM A;  2R03 A;  1SR2 A;  2UUI A;  3EG9 B;  3VAY A;  5BQI A;  1YAU O;  1Y6D A;  5GPG B;  3EGX B;  4N6H A;  4BJ6 A;  4CS7 A;  1ZVZ A;  4U5E E;  2NSG A;  1VYI A;  1WGW A;  3GOR A;  3PCV A;  1LS1 A;  1MMG A;  1ZYR F;  3AJM A;  1Q0G A;  3FOP A;  2OG2 A;  4K1O A;  1HMD A;  3N24 A;  3IQT A;  2YZS A;  5T1D B;  2A68 F;  4NQF A;  4U5H A;  4BJ5 A;  1S05 A;  2IXP A;  2J9W A;  2OEX A;  5DS6 A;  4JEA A;  4MVM A;  3LUT B;  2R7W A;  4O7G A;  1RJ9 B;  3DZA A;  2HZ8 A;  3LS1 A;  4G7H F;  1M2O A;  1LM3 B;  2ICW G;  4XTK A;  4XPW A;  4KBL A;  4D4X A;  2J9B A;  1JPN A;  2IM8 A;  4HE8 D;  2Q9A A;  2QUP A;  1RKE B;  3H65 A;  4JKV A;  3TOM A;  3LES A;  3NYL A;  2A1D D;  1E84 A;  1AVO B;  4MND A;  1XWJ A;  2CGE A;  2YL0 A;  3RQF A;  4CJG A;  1ORJ A;  1V55 C;  3M79 A;  2ZPA A;  3NMK A;  4K7B A;  4XPX A;  3U3B A;  2Q9C A;  2DGJ A;  3WAQ A;  1TWG A;  2WZL A;  4BJ1 A;  4KI2 A;  1BR4 A;  3LJB A;  3N2Z B;  3US6 A;  1MQV A;  3WHN A;  1L7C A;  2HMZ A;  3G4X A;  1Q0K A;  2EPK X;  5BQH A;  5L0J A;  2GDC A;  1YDI A;  4IGG A;  5COM A;  4JEB A;  4JTC B;  4DRH B;  2VCB A;  1VK5 A;  2ZD9 A;  3EJN A;  1O3U A;  3H2V A;  2YL1 A;  3VM6 A;  4CX9 A;  5DQZ A;  1KTM A;  4N4W A;  4E7S A;  2Z15 A;  5L3V A;  1A41 A;  3T4R A;  4UDV A;  1GS9 A;  3GWN A;  2W45 A;  2XRH A;  3U3F A;  1YAR O;  2J8W A;  1MMN A;  2QE9 A;  3OA1 A;  5B3I A;  4J7T A;  3VYW A;  4EHP A;  4C7O A;  2H7O A;  4JZA A;  5F5H A;  2XM4 A;  4C3E A;  3FOO A;  1T6I A;  3EGD A;  4JIO A;  3SXK A;  4ER9 A;  3KL4 A;  2NUT A;  4JCH A;  3C63 A;  3QVY A;  3LLI A;  1JOG A;  1Q0D A;  4L6R A;  1Z7Q c;  1OW7 A;  4PFP A;  3TQO A;  3X1O A;  3ZG1 A;  4D4N A;  4EBJ A;  4E7Z A;  2J7P A;  1D0X A;  4CS8 A;  2EIL C;  3TOL A;  5B3S C;  2MHR A;  3EQL F;  3O6X A;  4GYT A;  2RD9 A;  1FTS A;  4YT4 A;  2M4E A;  2YRF A;  4QI2 A;  4N06 A;  3C8Z A;  3DI5 A;  5B1B C;  3VRC A;  1T6Q A;  1GGQ A;  1IZM A;  1NG1 A;  5IY5 C;  1OKK D;  2WZF A;  3BRJ A;  3C7J A;  2YL3 A;  2EIN C;  3O39 A;  3DAF A;  4IAO A;  3UMK A;  2OJE D;  4OD4 A;  4I44 A;  5AGF A;  2R9R B;  2R7Q A;  3S28 A;  4A4A A;  4YL0 A;  3W8I A;  1SZI A;  3DE9 A;  1LI5 A;  5K0I A;  1I4Z A;  2HUJ A;  3RW0 A;  3TK0 A;  1TWC A;  2VAS A;  2H7B A;  2HSQ A;  3AQC A;  3QW0 A;  4G7Z F;  1A7D A;  2PBE A;  3LLK A;  1JRA A;  1NFN A;  4JE9 A;  3POV A;  4FAP B;  2R7X A;  4NTF A;  2NUP B;  1WN0 A;  4EKW A;  2YLD A;  3RVY A;  3T6G B;  2NUT B;  3NYM A;  5L0I A;  3U5S A;  1WOL A;  1YYX A;  1Z6A A;  4J32 B;  3CZ6 A;  3BEH A;  4FWV A;  5AC4 A;  3JZ0 A;  1M57 C;  2I8B A;  1U6H A;  4JJF A;  4LDR A;  4ULV A;  4YT8 A;  5L0F A;  4HEA J;  3HTK C;  2OOC A;  3L1M A;  5FCL A;  1E85 A;  2E87 A;  1RXQ A;  4G7O F;  5HSW A;  1H6G A;  3L8I A;  4DXW A;  4IRU A;  2XLV A;  3QW1 A;  3IQ5 A;  3K1I A;  3CAX A;  4LAC B;  3T6B A;  2CNW D;  2LP4 A;  4O6N A;  1YLM A;  2R7O A;  5CIV A;  5KYX A;  3AOU A;  1KU2 A;  1MND A;  2R25 A;  5KYW B;  3G4Z A;  5DQT A;  4YJW A;  1QQ3 A;  1VLS A;  3W8H A;  1WWP A;  2VB6 A;  2Y39 A;  2G3K A;  3LEO A;  4U5F E;  3B0V C;  2VCA A;  2YEV A;  3JRT A;  2XLD A;  2Q7R A;  3ZQY A;  1NSG B;  3V5X A;  4EUK B;  1RJ9 A;  1OXB A;  1YJG A;  1LS4 A;  5DS5 A;  2AP3 A;  1V74 B;  3EH1 A;  3S84 A;  1YA7 O;  2R7S A;  1NFO A;  2HV6 A;  1I5N A;  5L3Q A;  1RKE A;  3K7D A;  3LNR A;  3S29 A;  3I4U A;  4YL1 A;  2OEV A;  4MS2 A;  1F1M A;  1G4U S;  3M15 A;  3W2W A;  3FAJ A;  3Q7G A;  2PF4 E;  2R02 A;  2XSE A;  3RVZ A;  1K04 A;  3V5Y A;  1D0Z A;  2C04 A;  1G8X A;  2L6G A;  4QDL A;  3B71 A;  4ANJ A;  3KMI A;  2JD3 A;  3FVY A;  4E0I A;  3B0U X;  2YWA A;  2HSB A;  5E3A A;  1OKK A;  2NPU A;  2UUH A;  2A0B A;  2XLW A;  5KYX B;  2AWY A;  2ETS A;  2R05 A;  3LS0 A;  3K66 A;  1OR3 A;  1T9K A;  2OQM A;  3QZC A;  4MVO A;  4QI0 A;  4C3B A;  2ZXR A;  5BUO A;  2ZXO A;  5KYU A;  4AK9 A;  2NG1 A;  5A6A A;  3G50 A;  2PP4 A;  3DM5 A;  4Z9I A;  1HE1 A;  3ZWI A;  1E83 A;  4MQ9 F;  3RQG A;  2EPN A;  5FZT A;  1ZHW A;  4CSA A;  1ORY A;  2XLM A;  2LQG A;  5JUA A;  2PX0 A;  1U0B B;  3N0T A;  2HMQ A;  3PHF 2;  3IQC A;  3U0C A;  3ZDL A;  2J9U A;  1HW2 A;  3NRH A;  4CS9 C;  4O6Y A;  3SYN A;  3FXH A;  4R32 A;  2MWQ A;  5B1A C;  5F5F A;  5JLI A;  2EIM C;  4FX5 A;  3Q7L A;  4I1M A;  2FGY A;  4NC3 A;  2CNW A;  1R5I D;  3GEH A;  5L0H A;  4XLP F;  5JSL A;  1V54 C;  2WL8 A;  3ZTM A;  3HKK A;  3O10 A;  1G5Z A;  2CDQ A;  4YL3 A;  5A6B D;  5KYU B;  1JR8 A;  2HJM A;  1M6T A;  1DOW A;  2XS8 A;  3NDB B;  3DE8 A;  1BBH A;  2ASR A;  2B0J A;  3GM3 A;  1GM5 A;  4XLN F;  3KH2 A;  1EKY A;  3M1C B;  3CEX A;  2R7U A;  4BEJ A;  1SF8 A;  3E70 C;  4A2N B;  4OIN F;  4Q5S F;  4GQH A;  3VF0 A;  2NUP A;  1FMW A;  3DXJ F;  3RKO F;  5A69 A;  3ECS A;  1QSP A;  1RCP A;  1TKN A;  3QMK A;  3I5P A;  4XQ1 A;  3W4Y A;  4KNW A;  2EPM X;  1D1B A;  2IBF A;  1ZHY A;  3B0P A;  2Q3T A;  4MW3 A;  1FNT c;  3KYI A;  3SP1 A;  3L8J A;  1V4A A;  3EH2 A;  2WVO A;  4WGY A;  5DS4 A;  4DBQ A;  2KW3 C;  1ZHT A;  2H7V C;  2OJQ A;  5HV9 A;  4LDK A;  3RF3 A;  3RQE A;  3ZSU A;  5CI8 A;  4RDA A;  4YK5 A;  1FR0 A;  3U8V A;  3SNH A;  2W4B A;  3WOD F;  1O5H A;  1QLE C;  2P61 A;  2J9V A;  5COF A;  4EBK A;  1YZA A;  1GQA A;  1Z5Z A;  2X0C A;  1N1C A;  3HNI A;  2HKV A;  2IOQ A;  1HE9 A;  5KYW A;  1K40 A;  1OCR C;  2IXN A;  4JC7 A;  1J8M F;  1LVK A;  3SXZ A;  4MW8 A;  1LIH A;  3HJC A;  3M4B A;  4IAR A;  4OIR F;  3KYJ A;  4PJN A;  4WAB A;  1MNE A;  3MFN A;  3E9V A;  4GEH A;  1I4Y A;  2YQY A;  3Q6M A;  3CSK A;  3T9O A;  3B29 A;  2HJ3 A;  5DLJ A;  2KNH A;  3UR3 C;  3GM2 A;  2YHS A;  4EBB A;  4OIQ F;  3A9C A;  3LNM B;  2D5R B;  4J7Y A;  4WGZ A;  2NSF A;  2JPU A;  2Q00 A; 
#chains in the Genus database with same CATH homology
 1FNT c;  1Z7Q c;  3JSE O;  1AVO B;  3JRM O;  1YAU O;  3IPM O;  1YAR O;  3JTL O;  1YA7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...