1YARO

Structure of archeabacterial 20s proteasome mutant d9s- pa26 complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
228
structure length
218
Chain Sequence
b'KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGSDHMVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome alpha subunit
publication title The 1.9 A structure of a proteasome-11S activator complex and implications for proteasome-PAN/PA700 interactions.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase/hydrolase activator
total genus 86
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1yarO01
1Z7Qc 3IPMO 1YA7O 1YARO 3JSEO 1FNTc 3JTLO 1AVOB 1YAUO 3JRMO
chains in the Genus database with same CATH superfamily
4MS2A 5D91A 4JEAA 4MTGA 5AGFA 1CGOA 4K7BA 1JOGA 2HSBA 4C3EA 4LDQA 1Q0FA 4OD5A 4CDVA 1QVXA 4D4XA 4XPXA 1QSPA 2WZGA 1VLTA 2Q4FA 3DWWA 2O9XA 3A9CA 2OG2A 1NFNA 4Z9JA 3O10A 3K33A 3SXYA 4CS8A 3GEEA 5E33A 3EH1A 1T6QA 4FX5A 3O6XA 1VK5A 1TR2A 3LNMB 2R7RA 4AK9A 1A7DA 2YRFA 2UUHA 2XLEA 4OIOF 5EHHA 5F5HA 1NSGB 3JTLO 4WGYA 3HNKA 3C8GD 2I8BA 1EI7A 2PF4E 1G4US 3DM5A 3QVZA 3RQEA 2OOCA 1I5NA 2J7PD 2XS8A 3L34A 2EIKC 1CGNA 2NUTB 3LJBA 2QY9A 2FGYA 4HEAJ 3VYWA 1H6GA 4AL1A 4DOZA 3JYHA 1MMAA 3AOUA 3I5PA 1MNDA 4CJGA 1PD1A 3KYIA 3U3FA 1VMAA 2BL2A 2OU6A 4Z9HA 2KK1A 4DRIB 4EUKB 1MMGA 2KC3A 1LIHA 3JRMO 3V5ZA 2W4BA 1BR1A 3KL4A 4OIPF 3U2LA 1OR3A 2L6FA 3FOPA 3L8IA 4HFFB 3RH3A 3T6JA 2X0CA 2OEVA 2PX3A 4C7OA 2R7TA 4C7OB 4IB4A 4CIPA 1UG7A 1WN0A 2A69F 1BDJB 2J9VA 2XSEA 3ABMC 1R4TA 1S7ZA 2IXPA 2YL7A 3H2UA 1U0BB 4JC7A 2ETSA 3C8ZA 2A0BA 1WWPA 1YVIA 1OCZC 1EA8A 1NLXA 3GEIA 2B0HA 5JSLA 1Z5ZA 4MQ9F 1Q0GA 2VH3A 5GPGB 3EZIA 4NCQA 3DKAA 1O3UA 3Q7GA 1MMNA 2DGJA 4PJMA 2FFHA 4EBJA 2J8WA 2H7BA 1CPRA 2AP3A 3C18A 4XLNF 3W2WA 5A6JA 2XLDA 2UUIA 2XM0A 1C03A 3M4CA 4CDAA 2J9BA 1E86A 4J7YA 2ZXPA 2KGOA 2YWAA 2VCAA 2HKVA 3B0VC 1U6HA 3JRTA 4G7ZF 3QTHA 3KKBA 5L0FA 2HJMA 3T6BA 2HUJA 3GWNA 4NTAA 2HJ3A 3M4BA 2WZFA 3V5XA 1HMDA 1APCA 3S9OA 5DQTA 3IPMO 4Q7CA 4ULWA 3VRCA 5K0IA 5B3SC 4YWQA 1KNYA 3L1MA 3S90A 4JW1A 1GS9A 3E9VA 4U5DE 3W8IA 1Q0MA 4JKVA 1WGWA 2W4MA 3NMKA 1Z63A 4U5EE 1YYJA 2NPUA 2GFHA 3ZTMA 2M64A 1TFOB 2EPKX 4YT5A 4EBKA 5JUAA 3MLGA 3KPHA 3EZHA 3G50A 4ONSA 2AWCA 1RCPA 1TWGA 1ZZPA 1WATA 1TQGA 2R7OA 3TD7A 1QPUA 4YT4A 4PACA 4QI0A 2CNWD 2MHRA 3L8JA 3OA1A 4XQ1A 5CIVA 3PDMP 1XZPA 4PJNA 2DI3A 1JRAA 3TQOA 5D92A 3HLZA 2MWQA 1SF8A 2B0JA 3GODA 4FAPB 3QW0A 5HV9A 3FDQA 1NU7D 1Y4CA 3OWTA 5HSWA 2Y39A 4BJTA 1LS1A 1YA7O 3LESA 2W9YA 1RJ9B 2L6GA 1T01A 3A11A 3NG1A 5KYUA 5KYUB 3HNJA 3N2ZB 2VC9A 2Y3HA 1VLSA 2P1AA 1ZU4A 2LK4A 1M56C 5KYNA 4G78A 5JS5A 4XEKA 4KI2A 5KYYB 2WVOA 2JPUA 1JAFA 1LI7A 4PK4A 2PX0A 3V7OA 2YEVA 3SEOA 3B0UX 4CSAC 3ASOC 2G3KA 5DVWA 4F4BA 4P9FA 3X2QC 1M6TA 3B71A 3C62A 4LDKA 5EK0A 1YJGA 3U5SA 4EBBA 1U89A 5L3VA 4CBEA 5L0GA 4N6HA 1JR8A 3DM9B 1OQCA 4IJJA 4JJFA 4W8KA 2YHSA 1S05A 3DJNB 1L3PA 1ZHYA 2EPOA 3JZ0A 1N1CA 2XLOA 5CI8A 1VTMP 3SXKA 2LFDA 1MNEA 1QLEC 2WVQA 2H7OA 3POVA 2Y3GA 4JCZA 3S28A 4AE4A 3HTKC 2XRHA 2J9WA 4O6MA 3AG3C 3QW1A 3R7CA 2HS5A 4AE4B 5T3TA 1AUEA 1SMYF 1G8XA 3JYYA 3ZC4A 1OR2A 4YK5A 2PBEA 4MVOA 3ZQYA 3EGXA 2WL8A 5E3AA 1ORJA 3DAGA 2OCCC 5F28E 4EHPA 5JLIA 3S27A 1EKYA 2LSEA 4MVZA 4XWJA 3UNGC 4DBQA 1OCCC 2CCYA 2MYSA 3ASNC 3FXHA 1MQVA 1DOWA 2KNHA 3EG9A 2Q00A 3LEVA 3MYIA 3EG9B 4DVZA 3WG7C 2XL4A 1A7EA 4GQHA 4XEVA 1YDIA 3IQTA 1WOLA 3UGOA 1Q0KA 2Q9CA 3AQBA 3QMKA 4ANJA 1M57C 2EPLX 3T9OA 4P9TA 2EINC 2WB7A 2FAPB 1L7CA 2X51A 3DMDA 3IHUA 2ASRA 2GA0A 4O6YA 3UR3C 3WODF 4DXWA 4EKWA 1ZU5A 3B9QA 5L0IA 5KYWA 3NYLA 3R2PA 2V26A 4C3BA 2I15A 4WGZA 4MVMA 3DJUB 3PMRA 3EFOA 3IQCA 2IYLD 3GM2A 3C8GA 4YT8A 2TMVP 3EFOB 4NTFA 3VAYA 5JT4A 4GEHA 3C8GB 1VYIA 1ZHXA 2Q7RA 2J7PA 3ZWIA 1V4AA 3W4YA 1HE1A 4U5CE 3T4RA 4M63A 2R02A 2XXAA 1LI5A 3EJNA 2ZXWC 2XXAB 3EHNA 1OW7A 5BQGA 3M79A 2EIJC 4YJWA 3SNHA 4C3DA 2YLDA 3GM3A 3ABKC 2NSFA 2L9JA 2R9RB 1TFKB 3N24A 4FWVA 1Z3IX 1QZXA 3GORA 1YZAA 4JEBA 4JZAA 2A68F 4N6CA 4O79A 5A6BA 3CQZA 4JTDB 3C7JA 2GAQA 4O7GA 2LD6A 5JP7A 4EIYA 1T5OA 2A0UA 3HNIA 4LLEA 1M2OA 1RKEA 2EPNA 1JPJA 2IBFA 3RVYA 4MVRA 4BJ1A 3JCUQ 1RKEB 1HW1A 4JE9A 2LIGA 1PV3A 4YL1A 4CSAA 2R7WA 4XPYA 3Q6NA 4BJ6C 5E2QA 1FMVA 1W2WA 4NC3A 4BEMJ 3NKEA 2W45A 1ZW2A 3JSZA 3DE8A 4I3MA 3LEOA 1H7IA 4U5HA 3FVYA 3N0TA 3CAXA 3ZQVA 2NSGA 1FFHA 3UMKA 4ZLDA 3K6BA 5EGYA 1OKKD 2KW3C 1WTYA 4E18A 3U9MA 4Q4ZF 3WHNA 2IM8A 3GANA 3QZCA 4XTKA 5DS5A 4U9EA 1OXBA 4RDAA 1Q0DA 3RW0A 2CYDA 5A6AA 2QLAA 3K1IC 3SP1A 2IXNA 4G7OF 1JPNA 2YL0A 1A41A 4EWCA 1SZIA 3JSEO 4MVQA 5TJ5E 2KYHA 3G4ZA 4J32B 2L7AA 3BEHA 2HZ8A 2HSQA 4JJGA 4DBRA 3U0CA 2ZD9A 1T6IA 4MNDA 3EGDA 2V3CC 1HE9A 3EGDB 1E85A 2C04A 3MBGA 4IRUA 1NG1A 2ICWG 4CS7A 4BPMA 1GGQA 2CDQA 3TOLA 4BJ5C 5BQIA 3PHF2 1A0BA 3E70C 3F46A 3B29A 4LERA 5COGA 4BG0A 2R03A 4IAQA 4OIRF 3MX3A 2D5RB 4AX2A 3LLKA 2R7XA 1FFTC 2XLHA 3EHMA 2AWYA 5B3IA 2KQ9A 3KYJA 3RFYA 3DZAA 1Z23A 1LM3B 2OJQA 2LP4A 2G3VA 2P0NA 4E0HA 4IAOA 2XLVA 2E87A 5A6KA 3W2VA 4OD4A 3M1CB 3S84A 4LACB 4NQFA 3SXZA 1YA9A 2Y3BA 3HJCA 5DS4A 3WAQA 3AG1C 4PR9A 3EQLF 2L6HA 1V74B 4JURI 4L6RA 2C03A 5DS6A 1T9KA 1CGME 5L0CA 1YLMA 3Q7LA 4DRJB 1ORYA 4AL0A 2OJED 3ITFA 1OCRC 4ULVA 1YZCA 3LS0A 3X1OA 3GEHA 3EPVA 4RBNA 1NBBA 3U3BA 3HNLA 3GWLA 2HMZA 4LDRA 2QTVA 3I5QA 4MVSA 4P6IC 3RKOF 3KMIA 4KNVA 2IOQA 1D1BA 3M15A 4HFKB 3FHDA 1SR2A 3LAYA 5B1AC 3RVZA 4XLPF 4J7TA 5JVEA 4Q5SF 1OW8A 2XLMA 1JMWA 3TULA 3UGPA 2WZLA 5BUOA 1ZHWA 3VM6A 4BJ6A 4UDVA 5E3CA 1NFOA 2XM4A 3ECSA 4JCHA 2R25A 1CPQA 1LKXA 4HE8D 3NYJA 3RF3A 3LLIA 1FR0A 3FMSA 2QE9A 1VOMA 2ZXRA 3HKKA 1A7VA 1D1AA 2HFIA 3H2VA 3JT1A 4YT2A 1FMWA 3EGXB 256BA 3AGTA 1VYKA 1BR2A 2CGEA 2A1DD 2OKUA 3EH2A 4I1MA 4CS9C 4DVYP 1BR4A 2JD3A 3AGUA 2JX0A 4YN0B 4JIOA 3UMHA 3LNRA 3K1IA 3Q6MA 5FZTA 1E84A 3K7DA 3G4XA 4IARA 2OEXA 1HY5A 2L81A 2YLIA 3FAPB 2NG1A 5L3QA 2BC5A 1RXQA 3NYMA 5B1BC 1ZHZA 4KNWA 1UFBA 3DXJF 3NKDA 4PFOA 2YVKA 4MW3A 2J9UA 2D4UA 2YLGA 1I4ZA 4JTCB 1J8MF 1BBHA 2GDCA 2HV7A 2LCHA 2Q9BA 2A6HF 3AG4C 2EIMC 3TJ6A 3K1HA 4BJ5A 4D4NA 3ZDLA 2Y69C 1K05A 3IEEA 3PCVA 1I4YA 3ZIBA 1K04A 4G7HF 5T1DB 2QUPA 2HMQA 4MW8A 1EQ1A 1C02A 5L0DA 4GYTA 5FCLA 2J45A 1ST6A 4JVSA 1PCXA 3AQCA 5IY5C 1LPEA 4DJ9A 2LQGA 4G0HA 3TK0A 1ZW3A 1KTMA 4U9DA 3ABLC 4LLCA 5BQHA 1V54C 3ZSUA 4CX9A 2R7UA 2NUTA 1TKNA 2R7VA 5DLJA 1TWHA 3C63A 5A69A 3IQ6A 4OIQF 5DQZA 1R5ID 4RD9A 1D0ZA 4E7SA 4CDYA 5L0JA 3ZVRA 2CW0F 4H54A 1Z6AA 4KBLA 3CEXA 3U8PA 2AU5A 4U5BE 4J30B 3H65A 4YL3A 1D0YA 4JRZA 3T6GB 4H4KC 2R05A 2Q3TA 4KC9A 1IZMA 2IXOA 2XS1A 1TWCA 1KU2A 4A4AA 4YL0A 5A6BD 5KYWB 1F1MA 2VCBA 4CIHA 2HV6A 4NTBA 2NUPA 2EILC 5T3WA 3SZRA 3RQGA 2NUPB 2GWWA 3DE9A 1YAUO 3AG2C 2Y3DA 2Z15A 2DYRC 3CZ6A 4FESA 3UMIA 2YKZA 1LE2A 2RD9A 4K1OA 1WASA 5CI9A 2VASA 5F5FA 2DB4A 4K0DA 2H7VC 4PFPA 5KYXA 3US6A 1XWJA 5KYXB 2G62A 1VB5A 3TOMA 1GM5A 4XPWA 2M4EA 5COFA 3U9JA 1HMOA 2ZXOA 1OXKA 4N4WA 1YARO 1C17M 4U5FE 3LS1A 3SXMA 4QI2A 2VCCA 1M2VA 1Y6DA 2EPMX 1M2VB 2IXMA 2KSFA 4PJLA 4QDLA 2PNOA 2P6VA 4IGGA 3MYFA 4WJ0A 3RIPA 1H9TA 4A2NB 1OKKA 4CS9A 2YZSA 5L0HA 5JRAA 2F22A 1XZQA 1H9GA 3DI5A 3DAFA 5COMA 1NU9C 3SYNA 2OQMA 1RMVA 4CS8C 2XL8A 2J0XA 3FAJA 1AVOB 1D1CA 3CSKA 2BE5F 1AEPA 4ZLCA 1ORSC 2H8AA 3BRJA 4X0RA 3B0PA 4OINF 4U5GA 4I44A 4B6IA 4ER9A 4E7ZA 3RYLA 3LUTB 3NMJA 1NZEA 2LFFA 1D0XA 4MTOA 3RQFA 4BEJA 2J46A 2WVNA 5AC5A 4MVUA 2R7SA 3DD7A 3NMIA 3QVYA 4MTFA 1FAPB 4N06A 1FTSA 1LE4A 2YL1A 1J8YF 3V5YA 3IQ5A 3NRHA 4Z9IA 2CNWA 1E2XA 1HW2A 2ZPAA 5AC4A 3NDBB 3J06A 1O87A 3FOOA 2A6EF 3VF0A 1IW7F 2PFDA 2R7QA 3W8HA 4JTAB 2YL3A 3TJ5A 2J0WA 1YYXA 3S0XA 2DYSC 2XLWA 3U2MA 2P61A 4I1OB 1ZYRF 4O6NA 3O39A 1ZVZA 3ZG1A 1ZHTA 1B68A 1OCOC 3ATPA 1OW6A 3K66A 1SYQA 2XL6A 2RSEB 3F47A 3KH2A 1E83A 1FNTc 1O5HA 4IWBA 4WABA 1Z7Qc 1PD0A 3AJMA 1GQAA 1QKRA 4E0IA 4E17A 1RJ9A 1MMDA 3L0IA 1LVKA 4NY3A 4PJJA 2VB6A 1G4WR 3GM1A 1LS4A 3U8VA 3O55A 1V55C 1K40A 2Q9AA 2PP4A 2AVKA 3I4UA 1DOVA 5KYYA 1TWAA 3S29A 1T6UA 4XEFA 3OEOA 1RKCA 3MFNA 4W8PA 2YQYA 1BZ4A 1QQ3A 1G5ZA 3ZTZA 2P7VA 4CJOA 2QNLA 4R32A 4DRHB 2KJGA
chains in the Genus database with same CATH topology
1Z7Qc 3IPMO 1YA7O 1YARO 3JSEO 1FNTc 3JTLO 1AVOB 1YAUO 3JRMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z7Q c;  3IPM O;  1YA7 O;  1YAR O;  3JSE O;  1FNT c;  3JTL O;  1AVO B;  1YAU O;  3JRM O; 
#chains in the Genus database with same CATH topology
 4MS2 A;  5D91 A;  4JEA A;  4MTG A;  5AGF A;  1CGO A;  4K7B A;  1JOG A;  2HSB A;  4C3E A;  4LDQ A;  1Q0F A;  4OD5 A;  4CDV A;  1QVX A;  4D4X A;  4XPX A;  1QSP A;  2WZG A;  1VLT A;  2Q4F A;  3DWW A;  2O9X A;  3A9C A;  2OG2 A;  1NFN A;  4Z9J A;  3O10 A;  3K33 A;  3SXY A;  4CS8 A;  3GEE A;  5E33 A;  3EH1 A;  1T6Q A;  4FX5 A;  3O6X A;  1VK5 A;  1TR2 A;  3LNM B;  2R7R A;  4AK9 A;  1A7D A;  2YRF A;  2UUH A;  2XLE A;  4OIO F;  5EHH A;  5F5H A;  1NSG B;  3JTL O;  4WGY A;  3HNK A;  3C8G D;  2I8B A;  1EI7 A;  2PF4 E;  1G4U S;  3DM5 A;  3QVZ A;  3RQE A;  2OOC A;  1I5N A;  2J7P D;  2XS8 A;  3L34 A;  2EIK C;  1CGN A;  2NUT B;  3LJB A;  2QY9 A;  2FGY A;  4HEA J;  3VYW A;  1H6G A;  4AL1 A;  4DOZ A;  3JYH A;  1MMA A;  3AOU A;  3I5P A;  1MND A;  4CJG A;  1PD1 A;  3KYI A;  3U3F A;  1VMA A;  2BL2 A;  2OU6 A;  4Z9H A;  2KK1 A;  4DRI B;  4EUK B;  1MMG A;  2KC3 A;  1LIH A;  3JRM O;  3V5Z A;  2W4B A;  1BR1 A;  3KL4 A;  4OIP F;  3U2L A;  1OR3 A;  2L6F A;  3FOP A;  3L8I A;  4HFF B;  3RH3 A;  3T6J A;  2X0C A;  2OEV A;  2PX3 A;  4C7O A;  2R7T A;  4C7O B;  4IB4 A;  4CIP A;  1UG7 A;  1WN0 A;  2A69 F;  1BDJ B;  2J9V A;  2XSE A;  3ABM C;  1R4T A;  1S7Z A;  2IXP A;  2YL7 A;  3H2U A;  1U0B B;  4JC7 A;  2ETS A;  3C8Z A;  2A0B A;  1WWP A;  1YVI A;  1OCZ C;  1EA8 A;  1NLX A;  3GEI A;  2B0H A;  5JSL A;  1Z5Z A;  4MQ9 F;  1Q0G A;  2VH3 A;  5GPG B;  3EZI A;  4NCQ A;  3DKA A;  1O3U A;  3Q7G A;  1MMN A;  2DGJ A;  4PJM A;  2FFH A;  4EBJ A;  2J8W A;  2H7B A;  1CPR A;  2AP3 A;  3C18 A;  4XLN F;  3W2W A;  5A6J A;  2XLD A;  2UUI A;  2XM0 A;  1C03 A;  3M4C A;  4CDA A;  2J9B A;  1E86 A;  4J7Y A;  2ZXP A;  2KGO A;  2YWA A;  2VCA A;  2HKV A;  3B0V C;  1U6H A;  3JRT A;  4G7Z F;  3QTH A;  3KKB A;  5L0F A;  2HJM A;  3T6B A;  2HUJ A;  3GWN A;  4NTA A;  2HJ3 A;  3M4B A;  2WZF A;  3V5X A;  1HMD A;  1APC A;  3S9O A;  5DQT A;  3IPM O;  4Q7C A;  4ULW A;  3VRC A;  5K0I A;  5B3S C;  4YWQ A;  1KNY A;  3L1M A;  3S90 A;  4JW1 A;  1GS9 A;  3E9V A;  4U5D E;  3W8I A;  1Q0M A;  4JKV A;  1WGW A;  2W4M A;  3NMK A;  1Z63 A;  4U5E E;  1YYJ A;  2NPU A;  2GFH A;  3ZTM A;  2M64 A;  1TFO B;  2EPK X;  4YT5 A;  4EBK A;  5JUA A;  3MLG A;  3KPH A;  3EZH A;  3G50 A;  4ONS A;  2AWC A;  1RCP A;  1TWG A;  1ZZP A;  1WAT A;  1TQG A;  2R7O A;  3TD7 A;  1QPU A;  4YT4 A;  4PAC A;  4QI0 A;  2CNW D;  2MHR A;  3L8J A;  3OA1 A;  4XQ1 A;  5CIV A;  3PDM P;  1XZP A;  4PJN A;  2DI3 A;  1JRA A;  3TQO A;  5D92 A;  3HLZ A;  2MWQ A;  1SF8 A;  2B0J A;  3GOD A;  4FAP B;  3QW0 A;  5HV9 A;  3FDQ A;  1NU7 D;  1Y4C A;  3OWT A;  5HSW A;  2Y39 A;  4BJT A;  1LS1 A;  1YA7 O;  3LES A;  2W9Y A;  1RJ9 B;  2L6G A;  1T01 A;  3A11 A;  3NG1 A;  5KYU A;  5KYU B;  3HNJ A;  3N2Z B;  2VC9 A;  2Y3H A;  1VLS A;  2P1A A;  1ZU4 A;  2LK4 A;  1M56 C;  5KYN A;  4G78 A;  5JS5 A;  4XEK A;  4KI2 A;  5KYY B;  2WVO A;  2JPU A;  1JAF A;  1LI7 A;  4PK4 A;  2PX0 A;  3V7O A;  2YEV A;  3SEO A;  3B0U X;  4CSA C;  3ASO C;  2G3K A;  5DVW A;  4F4B A;  4P9F A;  3X2Q C;  1M6T A;  3B71 A;  3C62 A;  4LDK A;  5EK0 A;  1YJG A;  3U5S A;  4EBB A;  1U89 A;  5L3V A;  4CBE A;  5L0G A;  4N6H A;  1JR8 A;  3DM9 B;  1OQC A;  4IJJ A;  4JJF A;  4W8K A;  2YHS A;  1S05 A;  3DJN B;  1L3P A;  1ZHY A;  2EPO A;  3JZ0 A;  1N1C A;  2XLO A;  5CI8 A;  1VTM P;  3SXK A;  2LFD A;  1MNE A;  1QLE C;  2WVQ A;  2H7O A;  3POV A;  2Y3G A;  4JCZ A;  3S28 A;  4AE4 A;  3HTK C;  2XRH A;  2J9W A;  4O6M A;  3AG3 C;  3QW1 A;  3R7C A;  2HS5 A;  4AE4 B;  5T3T A;  1AUE A;  1SMY F;  1G8X A;  3JYY A;  3ZC4 A;  1OR2 A;  4YK5 A;  2PBE A;  4MVO A;  3ZQY A;  3EGX A;  2WL8 A;  5E3A A;  1ORJ A;  3DAG A;  2OCC C;  5F28 E;  4EHP A;  5JLI A;  3S27 A;  1EKY A;  2LSE A;  4MVZ A;  4XWJ A;  3UNG C;  4DBQ A;  1OCC C;  2CCY A;  2MYS A;  3ASN C;  3FXH A;  1MQV A;  1DOW A;  2KNH A;  3EG9 A;  2Q00 A;  3LEV A;  3MYI A;  3EG9 B;  4DVZ A;  3WG7 C;  2XL4 A;  1A7E A;  4GQH A;  4XEV A;  1YDI A;  3IQT A;  1WOL A;  3UGO A;  1Q0K A;  2Q9C A;  3AQB A;  3QMK A;  4ANJ A;  1M57 C;  2EPL X;  3T9O A;  4P9T A;  2EIN C;  2WB7 A;  2FAP B;  1L7C A;  2X51 A;  3DMD A;  3IHU A;  2ASR A;  2GA0 A;  4O6Y A;  3UR3 C;  3WOD F;  4DXW A;  4EKW A;  1ZU5 A;  3B9Q A;  5L0I A;  5KYW A;  3NYL A;  3R2P A;  2V26 A;  4C3B A;  2I15 A;  4WGZ A;  4MVM A;  3DJU B;  3PMR A;  3EFO A;  3IQC A;  2IYL D;  3GM2 A;  3C8G A;  4YT8 A;  2TMV P;  3EFO B;  4NTF A;  3VAY A;  5JT4 A;  4GEH A;  3C8G B;  1VYI A;  1ZHX A;  2Q7R A;  2J7P A;  3ZWI A;  1V4A A;  3W4Y A;  1HE1 A;  4U5C E;  3T4R A;  4M63 A;  2R02 A;  2XXA A;  1LI5 A;  3EJN A;  2ZXW C;  2XXA B;  3EHN A;  1OW7 A;  5BQG A;  3M79 A;  2EIJ C;  4YJW A;  3SNH A;  4C3D A;  2YLD A;  3GM3 A;  3ABK C;  2NSF A;  2L9J A;  2R9R B;  1TFK B;  3N24 A;  4FWV A;  1Z3I X;  1QZX A;  3GOR A;  1YZA A;  4JEB A;  4JZA A;  2A68 F;  4N6C A;  4O79 A;  5A6B A;  3CQZ A;  4JTD B;  3C7J A;  2GAQ A;  4O7G A;  2LD6 A;  5JP7 A;  4EIY A;  1T5O A;  2A0U A;  3HNI A;  4LLE A;  1M2O A;  1RKE A;  2EPN A;  1JPJ A;  2IBF A;  3RVY A;  4MVR A;  4BJ1 A;  3JCU Q;  1RKE B;  1HW1 A;  4JE9 A;  2LIG A;  1PV3 A;  4YL1 A;  4CSA A;  2R7W A;  4XPY A;  3Q6N A;  4BJ6 C;  5E2Q A;  1FMV A;  1W2W A;  4NC3 A;  4BEM J;  3NKE A;  2W45 A;  1ZW2 A;  3JSZ A;  3DE8 A;  4I3M A;  3LEO A;  1H7I A;  4U5H A;  3FVY A;  3N0T A;  3CAX A;  3ZQV A;  2NSG A;  1FFH A;  3UMK A;  4ZLD A;  3K6B A;  5EGY A;  1OKK D;  2KW3 C;  1WTY A;  4E18 A;  3U9M A;  4Q4Z F;  3WHN A;  2IM8 A;  3GAN A;  3QZC A;  4XTK A;  5DS5 A;  4U9E A;  1OXB A;  4RDA A;  1Q0D A;  3RW0 A;  2CYD A;  5A6A A;  2QLA A;  3K1I C;  3SP1 A;  2IXN A;  4G7O F;  1JPN A;  2YL0 A;  1A41 A;  4EWC A;  1SZI A;  3JSE O;  4MVQ A;  5TJ5 E;  2KYH A;  3G4Z A;  4J32 B;  2L7A A;  3BEH A;  2HZ8 A;  2HSQ A;  4JJG A;  4DBR A;  3U0C A;  2ZD9 A;  1T6I A;  4MND A;  3EGD A;  2V3C C;  1HE9 A;  3EGD B;  1E85 A;  2C04 A;  3MBG A;  4IRU A;  1NG1 A;  2ICW G;  4CS7 A;  4BPM A;  1GGQ A;  2CDQ A;  3TOL A;  4BJ5 C;  5BQI A;  3PHF 2;  1A0B A;  3E70 C;  3F46 A;  3B29 A;  4LER A;  5COG A;  4BG0 A;  2R03 A;  4IAQ A;  4OIR F;  3MX3 A;  2D5R B;  4AX2 A;  3LLK A;  2R7X A;  1FFT C;  2XLH A;  3EHM A;  2AWY A;  5B3I A;  2KQ9 A;  3KYJ A;  3RFY A;  3DZA A;  1Z23 A;  1LM3 B;  2OJQ A;  2LP4 A;  2G3V A;  2P0N A;  4E0H A;  4IAO A;  2XLV A;  2E87 A;  5A6K A;  3W2V A;  4OD4 A;  3M1C B;  3S84 A;  4LAC B;  4NQF A;  3SXZ A;  1YA9 A;  2Y3B A;  3HJC A;  5DS4 A;  3WAQ A;  3AG1 C;  4PR9 A;  3EQL F;  2L6H A;  1V74 B;  4JUR I;  4L6R A;  2C03 A;  5DS6 A;  1T9K A;  1CGM E;  5L0C A;  1YLM A;  3Q7L A;  4DRJ B;  1ORY A;  4AL0 A;  2OJE D;  3ITF A;  1OCR C;  4ULV A;  1YZC A;  3LS0 A;  3X1O A;  3GEH A;  3EPV A;  4RBN A;  1NBB A;  3U3B A;  3HNL A;  3GWL A;  2HMZ A;  4LDR A;  2QTV A;  3I5Q A;  4MVS A;  4P6I C;  3RKO F;  3KMI A;  4KNV A;  2IOQ A;  1D1B A;  3M15 A;  4HFK B;  3FHD A;  1SR2 A;  3LAY A;  5B1A C;  3RVZ A;  4XLP F;  4J7T A;  5JVE A;  4Q5S F;  1OW8 A;  2XLM A;  1JMW A;  3TUL A;  3UGP A;  2WZL A;  5BUO A;  1ZHW A;  3VM6 A;  4BJ6 A;  4UDV A;  5E3C A;  1NFO A;  2XM4 A;  3ECS A;  4JCH A;  2R25 A;  1CPQ A;  1LKX A;  4HE8 D;  3NYJ A;  3RF3 A;  3LLI A;  1FR0 A;  3FMS A;  2QE9 A;  1VOM A;  2ZXR A;  3HKK A;  1A7V A;  1D1A A;  2HFI A;  3H2V A;  3JT1 A;  4YT2 A;  1FMW A;  3EGX B;  256B A;  3AGT A;  1VYK A;  1BR2 A;  2CGE A;  2A1D D;  2OKU A;  3EH2 A;  4I1M A;  4CS9 C;  4DVY P;  1BR4 A;  2JD3 A;  3AGU A;  2JX0 A;  4YN0 B;  4JIO A;  3UMH A;  3LNR A;  3K1I A;  3Q6M A;  5FZT A;  1E84 A;  3K7D A;  3G4X A;  4IAR A;  2OEX A;  1HY5 A;  2L81 A;  2YLI A;  3FAP B;  2NG1 A;  5L3Q A;  2BC5 A;  1RXQ A;  3NYM A;  5B1B C;  1ZHZ A;  4KNW A;  1UFB A;  3DXJ F;  3NKD A;  4PFO A;  2YVK A;  4MW3 A;  2J9U A;  2D4U A;  2YLG A;  1I4Z A;  4JTC B;  1J8M F;  1BBH A;  2GDC A;  2HV7 A;  2LCH A;  2Q9B A;  2A6H F;  3AG4 C;  2EIM C;  3TJ6 A;  3K1H A;  4BJ5 A;  4D4N A;  3ZDL A;  2Y69 C;  1K05 A;  3IEE A;  3PCV A;  1I4Y A;  3ZIB A;  1K04 A;  4G7H F;  5T1D B;  2QUP A;  2HMQ A;  4MW8 A;  1EQ1 A;  1C02 A;  5L0D A;  4GYT A;  5FCL A;  2J45 A;  1ST6 A;  4JVS A;  1PCX A;  3AQC A;  5IY5 C;  1LPE A;  4DJ9 A;  2LQG A;  4G0H A;  3TK0 A;  1ZW3 A;  1KTM A;  4U9D A;  3ABL C;  4LLC A;  5BQH A;  1V54 C;  3ZSU A;  4CX9 A;  2R7U A;  2NUT A;  1TKN A;  2R7V A;  5DLJ A;  1TWH A;  3C63 A;  5A69 A;  3IQ6 A;  4OIQ F;  5DQZ A;  1R5I D;  4RD9 A;  1D0Z A;  4E7S A;  4CDY A;  5L0J A;  3ZVR A;  2CW0 F;  4H54 A;  1Z6A A;  4KBL A;  3CEX A;  3U8P A;  2AU5 A;  4U5B E;  4J30 B;  3H65 A;  4YL3 A;  1D0Y A;  4JRZ A;  3T6G B;  4H4K C;  2R05 A;  2Q3T A;  4KC9 A;  1IZM A;  2IXO A;  2XS1 A;  1TWC A;  1KU2 A;  4A4A A;  4YL0 A;  5A6B D;  5KYW B;  1F1M A;  2VCB A;  4CIH A;  2HV6 A;  4NTB A;  2NUP A;  2EIL C;  5T3W A;  3SZR A;  3RQG A;  2NUP B;  2GWW A;  3DE9 A;  1YAU O;  3AG2 C;  2Y3D A;  2Z15 A;  2DYR C;  3CZ6 A;  4FES A;  3UMI A;  2YKZ A;  1LE2 A;  2RD9 A;  4K1O A;  1WAS A;  5CI9 A;  2VAS A;  5F5F A;  2DB4 A;  4K0D A;  2H7V C;  4PFP A;  5KYX A;  3US6 A;  1XWJ A;  5KYX B;  2G62 A;  1VB5 A;  3TOM A;  1GM5 A;  4XPW A;  2M4E A;  5COF A;  3U9J A;  1HMO A;  2ZXO A;  1OXK A;  4N4W A;  1YAR O;  1C17 M;  4U5F E;  3LS1 A;  3SXM A;  4QI2 A;  2VCC A;  1M2V A;  1Y6D A;  2EPM X;  1M2V B;  2IXM A;  2KSF A;  4PJL A;  4QDL A;  2PNO A;  2P6V A;  4IGG A;  3MYF A;  4WJ0 A;  3RIP A;  1H9T A;  4A2N B;  1OKK A;  4CS9 A;  2YZS A;  5L0H A;  5JRA A;  2F22 A;  1XZQ A;  1H9G A;  3DI5 A;  3DAF A;  5COM A;  1NU9 C;  3SYN A;  2OQM A;  1RMV A;  4CS8 C;  2XL8 A;  2J0X A;  3FAJ A;  1AVO B;  1D1C A;  3CSK A;  2BE5 F;  1AEP A;  4ZLC A;  1ORS C;  2H8A A;  3BRJ A;  4X0R A;  3B0P A;  4OIN F;  4U5G A;  4I44 A;  4B6I A;  4ER9 A;  4E7Z A;  3RYL A;  3LUT B;  3NMJ A;  1NZE A;  2LFF A;  1D0X A;  4MTO A;  3RQF A;  4BEJ A;  2J46 A;  2WVN A;  5AC5 A;  4MVU A;  2R7S A;  3DD7 A;  3NMI A;  3QVY A;  4MTF A;  1FAP B;  4N06 A;  1FTS A;  1LE4 A;  2YL1 A;  1J8Y F;  3V5Y A;  3IQ5 A;  3NRH A;  4Z9I A;  2CNW A;  1E2X A;  1HW2 A;  2ZPA A;  5AC4 A;  3NDB B;  3J06 A;  1O87 A;  3FOO A;  2A6E F;  3VF0 A;  1IW7 F;  2PFD A;  2R7Q A;  3W8H A;  4JTA B;  2YL3 A;  3TJ5 A;  2J0W A;  1YYX A;  3S0X A;  2DYS C;  2XLW A;  3U2M A;  2P61 A;  4I1O B;  1ZYR F;  4O6N A;  3O39 A;  1ZVZ A;  3ZG1 A;  1ZHT A;  1B68 A;  1OCO C;  3ATP A;  1OW6 A;  3K66 A;  1SYQ A;  2XL6 A;  2RSE B;  3F47 A;  3KH2 A;  1E83 A;  1FNT c;  1O5H A;  4IWB A;  4WAB A;  1Z7Q c;  1PD0 A;  3AJM A;  1GQA A;  1QKR A;  4E0I A;  4E17 A;  1RJ9 A;  1MMD A;  3L0I A;  1LVK A;  4NY3 A;  4PJJ A;  2VB6 A;  1G4W R;  3GM1 A;  1LS4 A;  3U8V A;  3O55 A;  1V55 C;  1K40 A;  2Q9A A;  2PP4 A;  2AVK A;  3I4U A;  1DOV A;  5KYY A;  1TWA A;  3S29 A;  1T6U A;  4XEF A;  3OEO A;  1RKC A;  3MFN A;  4W8P A;  2YQY A;  1BZ4 A;  1QQ3 A;  1G5Z A;  3ZTZ A;  2P7V A;  4CJO A;  2QNL A;  4R32 A;  4DRH B;  2KJG A; 
#chains in the Genus database with same CATH homology
 1Z7Q c;  3IPM O;  1YA7 O;  1YAR O;  3JSE O;  1FNT c;  3JTL O;  1AVO B;  1YAU O;  3JRM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...