1YARO

Structure of archeabacterial 20s proteasome mutant d9s- pa26 complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
228
structure length
218
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGSDHMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.9 A structure of a proteasome-11S activator complex and implications for proteasome-PAN/PA700 interactions.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase/hydrolase activator
molecule keywords Proteasome alpha subunit
total genus 86
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1yarO01
1AVOB 3IPMO 1YAUO 1Z7Qc 3JTLO 1FNTc 3JRMO 1YA7O 3JSEO 1YARO
chains in the Genus database with same CATH superfamily
1TWGA 2C03A 1YA9A 2O9XA 4LLCA 2V26A 2CDQA 1HY5A 2XSEA 1H9TA 2R7TA 2I15A 4MTGA 5DS5A 3GWLA 3AJMA 5KYUB 1JRAA 1RKEA 5HV9A 2AU5A 3X2QC 3G4XA 4K7BA 1UG7A 4FX5A 2QLAA 5D92A 1O5HA 2H7OA 4E0IA 3C18A 2H7VC 4OIRF 1VMAA 2VC9A 3NKDA 1FNTc 3ZVRA 5CIVA 4XEVA 5D91A 2YLGA 1YZAA 2HS5A 2KC3A 3DJUB 4XEKA 2HJ3A 5JSLA 4DBRA 2A1DD 2ICWG 4J30B 3KPHA 4LLEA 1FFHA 4K0DA 1RJ9A 4N6HA 2XXAB 2XXAA 3TOMA 4MNDA 4J7TA 3DE8A 2HJMA 3EHNA 4E7SA 1T6QA 1O3UA 3C7JA 4U9EA 4U9DA 2R7RA 2OOCA 4Q4ZF 4E17A 2EIKC 2XL4A 4YWQA 2HSQA 4PFOA 1BDJB 1V55C 3I5QA 2Y39A 4DRHB 2R05A 1L3PA 1RXQA 1TKNA 2OU6A 4JJGA 4U5CE 1VB5A 2J7PD 1ZVZA 1HW1A 2NUPB 4LDRA 4JURI 4A2NB 3LAYA 4IJJA 3B0VC 5T3TA 2EINC 2XL8A 3WHNA 1M2VB 3W2VA 1LE4A 3KH2A 1Z7Qc 4ANJA 1KTMA 2G3VA 4BJ1A 2HMQA 3PCVA 2WVNA 3RW0A 3U2MA 4ER9A 3EGXA 1CGNA 1YYXA 5FCLA 1FAPB 1RMVA 2KYHA 3WAQA 5KYWB 3RVZA 3FOPA 4W8KA 4BJTA 5F5FA 4P6IC 2Y3DA 1ZHXA 4AL0A 1R5ID 2Q00A 3EQLF 1D0YA 2FFHA 2WVQA 5JP7A 1A0BA 1B68A 3C62A 3ZWIA 5KYNA 4I3MA 1LM3B 2A0UA 3CZ6A 3K33A 2C04A 3VRCA 4EBJA 5T1DB 5JVEA 1NZEA 4DVYP 3BRJA 4PJMA 1IW7F 2P61A 4C7OA 4CX9A 2GFHA 1ORJA 1T01A 2A0BA 2ZXRA 2PNOA 1VK5A 3GM1A 1AVOB 2L6GA 1D1CA 3L34A 3RQFA 5EHHA 2M4EA 1NLXA 3V5XA 4CS9A 1M57C 3B0UX 2EIJC 4JVSA 3WG7C 4XPWA 1TWCA 2JPUA 4AL1A 4CDYA 3M1CB 2EPNA 2KNHA 3LNRA 3EFOB 3NMIA 3QTHA 4PACA 1EI7A 2WL8A 4CSAA 2XLMA 4U5BE 2LFDA 1VYKA 3GODA 4WGZA 2TMVP 4OIOF 1K04A 3CAXA 3HTKC 3WODF 1XWJA 2IXMA 4AK9A 5L0CA 3NRHA 1LE2A 1N1CA 2EPOA 3QZCA 2P6VA 4IAQA 1SYQA 2XLEA 4EBKA 4WABA 3W8IA 3IQ6A 2PFDA 1BZ4A 3EFOA 3JYYA 3ECSA 3TOLA 4D4XA 5BUOA 4JJFA 3G4ZA 2XLOA 1EA8A 2B0HA 2KGOA 2J46A 1FFTC 1OW8A 1OXBA 2PP4A 1XZPA 2F22A 4PR9A 1APCA 2HV6A 1LS1A 1PCXA 2L7AA 3EG9B 3EG9A 2LCHA 3A9CA 2J0XA 5B1AC 5F5HA 2Y3HA 4C7OB 3NYLA 1OR3A 2OJED 4PJLA 1J8MF 3R2PA 3UMIA 4E7ZA 1E85A 2MHRA 4G7OF 2KK1A 2Y69C 3RYLA 4JE9A 4ONSA 3UMKA 3EZHA 4EIYA 2YL7A 2VB6A 3B71A 1BR4A 4QI2A 2EPMX 3N2ZB 4O79A 3RQGA 3IPMO 1KNYA 1ZW2A 2OEXA 3AGUA 4M63A 4PFPA 4YL3A 4RD9A 1E83A 2HKVA 4UDVA 1E86A 4W8PA 5DLJA 3F47A 5L0HA 4ULWA 1NSGB 1U89A 4IB4A 3L8IA 4MVZA 2R7SA 1I4ZA 1YLMA 2D5RB 2J45A 4Q7CA 4P9FA 1BR2A 2RSEB 3V5YA 5KYWA 3GEEA 1H6GA 1OW6A 2KJGA 2YLIA 3LLKA 1V4AA 5L0DA 3JRMO 4BJ5A 3ZQYA 4E18A 2MYSA 1YDIA 3W4YA 3U8VA 5EK0A 2PX0A 3M4CA 2DB4A 3LS0A 3PDMP 2KSFA 3EHMA 3TJ6A 3DMDA 1E84A 3S84A 2Y3GA 2YWAA 2ZXPA 5FZTA 3H2UA 3AG2C 3U9MA 4AE4A 3Q7GA 3ZTZA 4KBLA 2UUIA 3K7DA 3RIPA 4C3BA 4PJNA 1Z6AA 1Z3IX 1WATA 2WZLA 4IRUA 4JIOA 1VYIA 2NPUA 3ABMC 2YEVA 1OCOC 2ZD9A 4JW1A 3NMKA 2G3KA 3M79A 4BJ6C 2EILC 1Z23A 4J32B 1VLTA 4X0RA 1ORYA 5B3IA 2B0JA 3DAGA 1LVKA 3TD7A 4E0HA 4ZLCA 4JTAB 3GEIA 3POVA 1MMGA 5IY5C 4NC3A 4Q5SF 4JTDB 2NSFA 4C3DA 2WB7A 3PHF2 2VCAA 3RKOF 3DZAA 4O7GA 2LSEA 3HJCA 4JKVA 4YL1A 2AVKA 1EKYA 1GQAA 1K05A 4XQ1A 1QPUA 5A6AA 5L0FA 2RD9A 3B9QA 3VAYA 5EGYA 3DI5A 2WZGA 3F46A 3S29A 1M56C 2Y3BA 1Q0DA 2XLVA 4YT8A 1MNEA 2EPLX 1A7DA 1AUEA 4G7ZF 1LS4A 1LIHA 2QNLA 3E9VA 2OJQA 4QDLA 2VASA 2Q9CA 4YJWA 4MVUA 1ZW3A 3C8ZA 4U5GA 4F4BA 1A41A 5DS4A 5AC5A 5L0JA 1AEPA 2H8AA 1Q0KA 5A69A 1ST6A 3FHDA 3HKKA 5DS6A 3NYMA 2J7PA 4YK5A 1YVIA 2H7BA 1UFBA 3TULA 4FESA 2YQYA 4YT2A 3H65A 1JOGA 3I5PA 4MVRA 2R25A 1VOMA 5BQGA 2R7UA 2GA0A 3CSKA 1OCZC 1MQVA 1VLSA 1BR1A 2I8BA 3IEEA 1G8XA 3O10A 1ZHWA 4JRZA 2J9UA 3SZRA 3GM3A 4EHPA 5DQTA 3O39A 2XL6A 3EH2A 3U0CA 1TQGA 3EPVA 2R7XA 4DXWA 1CPQA 1ZHTA 2NUPA 4DRJB 2QUPA 3QW1A 1OKKD 5DVWA 1BBHA 3K6BA 4XPYA 3FAPB 1RCPA 3FVYA 1NG1A 3IHUA 3LS1A 4N4WA 3MYFA 4MW8A 2NSGA 1C03A 4BEJA 1V74B 2A6EF 4G0HA 5KYXB 2XRHA 1U0BB 2IYLD 3K1IA 2Q7RA 3L0IA 3L1MA 2M64A 3DM5A 3DM9B 1HE1A 5E33A 5B1BC 3RQEA 4CBEA 4AX2A 5BQIA 4IARA 2AWCA 1LI7A 5A6JA 1Q0GA 3QVYA 3ZIBA 1F1MA 3T9OA 3KMIA 4NCQA 2HSBA 1YZCA 2JD3A 1ZHZA 2YLDA 2HUJA 5AGFA 4YL0A 3VF0A 1QKRA 4DBQA 3AGTA 4L6RA 1H9GA 2IBFA 3Q6MA 1CGME 1RKEB 4I44A 2IXPA 3K1HA 3M4BA 3TK0A 4J7YA 4CS8A 3S0XA 2R7OA 3RF3A 4PJJA 1O87A 4WGYA 3U3FA 4N6CA 1J8YF 2EPKX 2YZSA 1PD1A 4OIPF 1G4WR 2P1AA 5A6BA 3T6JA 5A6KA 5AC4A 2W4BA 1NBBA 3ABLC 4DOZA 3JZ0A 5JUAA 3Q7LA 5HSWA 2W9YA 5JT4A 5CI8A 3FAJA 5K0IA 1OCRC 4JC7A 3JT1A 3NG1A 3RVYA 2AP3A 3T6GB 3S27A 3UGPA 3KKBA 1SZIA 2Q9AA 3U9JA 1T6IA 1WTYA 3N0TA 1TR2A 3OA1A 3C8GD 2WZFA 3JYHA 2CNWA 2CW0F 3U5SA 3AG4C 4A4AA 2DYSC 1HMOA 3MX3A 1M6TA 4XPXA 4Z9HA 5JS5A 3DE9A 3B29A 4OIQF 2HMZA 2XLWA 2BC5A 1R4TA 1E2XA 2GDCA 3ZTMA 3JSZA 4I1MA 3B0PA 2R7WA 1LI5A 4OD5A 3TQOA 3NYJA 2CGEA 1M2VA 1QQ3A 2CCYA 4BG0A 3ATPA 3IQ5A 2PF4E 4CS8C 3SXYA 4P9TA 2J9VA 4IWBA 3R7CA 2XM4A 3KYJA 2XS1A 3A11A 3EGXB 5L0GA 4O6NA 2R7VA 2MWQA 1ZHYA 3GANA 4U5HA 1T9KA 2A6HF 3MFNA 4H4KC 4LERA 3SYNA 3AG1C 4WJ0A 3TJ5A 1TFKB 2OQMA 1YJGA 1NFNA 1Z5ZA 1YA7O 4RBNA 4XLNF 1RKCA 1PV3A 4HEAJ 2NG1A 1C17M 1Y6DA 5GPGB 2OCCC 4CJOA 2J0WA 2E87A 1HE9A 1S7ZA 2HFIA 2J9BA 1Y4CA 2YL0A 5B3SC 2BE5F 2XM0A 3DJNB 2FAPB 3SXMA 1DOVA 4EUKB 1OQCA 1OW7A 4CDVA 2OKUA 4MTOA 1MMDA 2DGJA 1HW2A 3MYIA 4U5EE 2L6HA 1A7EA 3O6XA 2L81A 4PK4A 3ZC4A 1MNDA 1T6UA 3ASNC 1HMDA 3V5ZA 3JRTA 1OKKA 2QE9A 1WGWA 2L9JA 3FMSA 2LP4A 3GEHA 1LKXA 3RFYA 2YL1A 5JLIA 3DWWA 1T5OA 3JCUQ 3UMHA 3HNLA 2BL2A 4YT4A 3QVZA 3H2VA 3LUTB 4CDAA 5L3VA 3NDBB 1KU2A 1ZYRF 3MBGA 1S05A 4D4NA 2QTVA 4OD4A 2XLDA 1JPJA 1PD0A 5E2QA 3LJBA 1U6HA 1G5ZA 2IM8A 1NU9C 3NMJA 2L6FA 2X51A 4CIPA 4KI2A 2NUTB 3EJNA 3PMRA 4YN0B 3GWNA 3HLZA 2ZXOA 3CEXA 3DKAA 1OR2A 3L8JA 2J9WA 4GQHA 1JAFA 2QY9A 4MVSA 5COFA 1DOWA 5E3AA 2DYRC 4DVZA 1WOLA 2KW3C 1VTMP 1FMVA 2D4UA 3I4UA 2YVKA 4CSAC 4KNVA 1SMYF 3LEVA 4CS7A 3AOUA 2P0NA 5KYYA 2JX0A 3MLGA 2AWYA 3JTLO 4LDQA 3BEHA 1D0ZA 2KQ9A 2XLHA 1JPNA 3K66A 3T6BA 2Q9BA 1G4US 4ZLDA 3UGOA 5BQHA 5TJ5E 5F28E 3ABKC 3SNHA 4BJ5C 2VH3A 1L7CA 3EH1A 3C63A 4G78A 3LESA 4BPMA 4XWJA 4JEBA 2NUTA 4FWVA 2IOQA 3W8HA 1CGOA 1D1BA 3AQBA 2IXOA 3S9OA 3SP1A 3UNGC 3G50A 1RJ9B 2LQGA 3FDQA 2A68F 3ITFA 2R9RB 5A6BD 2Z15A 2A69F 2HZ8A 1I4YA 3C8GA 4MTFA 1D1AA 3FXHA 5T3WA 2YL3A 2OEVA 3J06A 1OXKA 4RDAA 4NTBA 5E3CA 4Z9IA 4KNWA 4FAPB 1SR2A 2HV7A 4KC9A 4MVMA 4HE8D 5CI9A 1M2OA 4B6IA 4DRIB 3ZG1A 2R02A 1C02A 3RH3A 4H54A 4DJ9A 2LD6A 5L3QA 2GAQA 2Q4FA 4K1OA 3SEOA 3W2WA 3KL4A 5KYUA 3SXZA 3QW0A 3DD7A 1QVXA 4O6MA 3IQTA 1GGQA 4BEMJ 1JMWA 4CIHA 4EBBA 1GS9A 3DAFA 2PBEA 3CQZA 3EGDA 1FTSA 1JR8A 2G62A 5DQZA 2LK4A 1QLEC 4NTAA 2ETSA 2W4MA 3C8GB 5COGA 1MMNA 1XZQA 3GM2A 2FGYA 2XS8A 3ASOC 3N24A 2GWWA 4JEAA 4R32A 4XTKA 3VYWA 3QMKA 4IGGA 4U5DE 4MQ9F 4JCZA 2WVOA 4IAOA 2LFFA 3GORA 3IQCA 2Q3TA 4NTFA 3DXJF 3EGDB 1OCCC 2R7QA 3US6A 4EWCA 4HFFB 3S90A 1TWAA 2ASRA 4N06A 4XEFA 3ZQVA 256BA 1FR0A 4G7HF 1NU7D 2DI3A 4EKWA 1D0XA 1W2WA 4U5FE 3SXKA 4BJ6A 2PX3A 3FOOA 2YKZA 4QI0A 2ZPAA 1ZU5A 5JRAA 1GM5A 4JTCB 1TWHA 2CNWD 1WN0A 1LPEA 1Q0FA 4HFKB 3LLIA 4MVOA 4NQFA 1IZMA 4CJGA 5KYYB 4GEHA 4NY3A 3T4RA 1Q0MA 3ZDLA 4Z9JA 3U2LA 2LIGA 4JZAA 4AE4B 1ZU4A 1NFOA 1ORSC 1YYJA 3NKEA 2YRFA 4LACB 3E70C 3LEOA 1Z63A 5L0IA 2W45A 1QSPA 2V3CC 3HNIA 1K40A 2VCBA 3AG3C 4O6YA 2X0CA 3EZIA 3U8PA 5COMA 4YT5A 1QZXA 1CPRA 3M15A 1WWPA 3K1IC 3VM6A 3V7OA 4C3EA 2UUHA 1V54C 4MS2A 1A7VA 4CS9C 4JCHA 3HNJA 1MMAA 3OWTA 1I5NA 2YHSA 3HNKA 3UR3C 4OINF 3LNMB 3AQCA 2OG2A 4MVQA 3ZSUA 4I1OB 1SF8A 3OEOA 2CYDA 3O55A 2VCCA 4LDKA 4XLPF 2P7VA 1EQ1A 2R03A 5KYXA 1FMWA 2ZXWC 2EIMC 2J8WA 3Q6NA 1YAUO 3S28A 4GYTA 1ZZPA 3U3BA 4ULVA 1H7IA 3X1OA 1TFOB 2IXNA 3JSEO 3KYIA 1YARO 4MW3A 1WASA
chains in the Genus database with same CATH topology
1AVOB 3IPMO 1YAUO 1Z7Qc 3JTLO 1FNTc 3JRMO 1YA7O 3JSEO 1YARO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVO B;  3IPM O;  1YAU O;  1Z7Q c;  3JTL O;  1FNT c;  3JRM O;  1YA7 O;  3JSE O;  1YAR O; 
#chains in the Genus database with same CATH topology
 1TWG A;  2C03 A;  1YA9 A;  2O9X A;  4LLC A;  2V26 A;  2CDQ A;  1HY5 A;  2XSE A;  1H9T A;  2R7T A;  2I15 A;  4MTG A;  5DS5 A;  3GWL A;  3AJM A;  5KYU B;  1JRA A;  1RKE A;  5HV9 A;  2AU5 A;  3X2Q C;  3G4X A;  4K7B A;  1UG7 A;  4FX5 A;  2QLA A;  5D92 A;  1O5H A;  2H7O A;  4E0I A;  3C18 A;  2H7V C;  4OIR F;  1VMA A;  2VC9 A;  3NKD A;  1FNT c;  3ZVR A;  5CIV A;  4XEV A;  5D91 A;  2YLG A;  1YZA A;  2HS5 A;  2KC3 A;  3DJU B;  4XEK A;  2HJ3 A;  5JSL A;  4DBR A;  2A1D D;  2ICW G;  4J30 B;  3KPH A;  4LLE A;  1FFH A;  4K0D A;  1RJ9 A;  4N6H A;  2XXA B;  2XXA A;  3TOM A;  4MND A;  4J7T A;  3DE8 A;  2HJM A;  3EHN A;  4E7S A;  1T6Q A;  1O3U A;  3C7J A;  4U9E A;  4U9D A;  2R7R A;  2OOC A;  4Q4Z F;  4E17 A;  2EIK C;  2XL4 A;  4YWQ A;  2HSQ A;  4PFO A;  1BDJ B;  1V55 C;  3I5Q A;  2Y39 A;  4DRH B;  2R05 A;  1L3P A;  1RXQ A;  1TKN A;  2OU6 A;  4JJG A;  4U5C E;  1VB5 A;  2J7P D;  1ZVZ A;  1HW1 A;  2NUP B;  4LDR A;  4JUR I;  4A2N B;  3LAY A;  4IJJ A;  3B0V C;  5T3T A;  2EIN C;  2XL8 A;  3WHN A;  1M2V B;  3W2V A;  1LE4 A;  3KH2 A;  1Z7Q c;  4ANJ A;  1KTM A;  2G3V A;  4BJ1 A;  2HMQ A;  3PCV A;  2WVN A;  3RW0 A;  3U2M A;  4ER9 A;  3EGX A;  1CGN A;  1YYX A;  5FCL A;  1FAP B;  1RMV A;  2KYH A;  3WAQ A;  5KYW B;  3RVZ A;  3FOP A;  4W8K A;  4BJT A;  5F5F A;  4P6I C;  2Y3D A;  1ZHX A;  4AL0 A;  1R5I D;  2Q00 A;  3EQL F;  1D0Y A;  2FFH A;  2WVQ A;  5JP7 A;  1A0B A;  1B68 A;  3C62 A;  3ZWI A;  5KYN A;  4I3M A;  1LM3 B;  2A0U A;  3CZ6 A;  3K33 A;  2C04 A;  3VRC A;  4EBJ A;  5T1D B;  5JVE A;  1NZE A;  4DVY P;  3BRJ A;  4PJM A;  1IW7 F;  2P61 A;  4C7O A;  4CX9 A;  2GFH A;  1ORJ A;  1T01 A;  2A0B A;  2ZXR A;  2PNO A;  1VK5 A;  3GM1 A;  1AVO B;  2L6G A;  1D1C A;  3L34 A;  3RQF A;  5EHH A;  2M4E A;  1NLX A;  3V5X A;  4CS9 A;  1M57 C;  3B0U X;  2EIJ C;  4JVS A;  3WG7 C;  4XPW A;  1TWC A;  2JPU A;  4AL1 A;  4CDY A;  3M1C B;  2EPN A;  2KNH A;  3LNR A;  3EFO B;  3NMI A;  3QTH A;  4PAC A;  1EI7 A;  2WL8 A;  4CSA A;  2XLM A;  4U5B E;  2LFD A;  1VYK A;  3GOD A;  4WGZ A;  2TMV P;  4OIO F;  1K04 A;  3CAX A;  3HTK C;  3WOD F;  1XWJ A;  2IXM A;  4AK9 A;  5L0C A;  3NRH A;  1LE2 A;  1N1C A;  2EPO A;  3QZC A;  2P6V A;  4IAQ A;  1SYQ A;  2XLE A;  4EBK A;  4WAB A;  3W8I A;  3IQ6 A;  2PFD A;  1BZ4 A;  3EFO A;  3JYY A;  3ECS A;  3TOL A;  4D4X A;  5BUO A;  4JJF A;  3G4Z A;  2XLO A;  1EA8 A;  2B0H A;  2KGO A;  2J46 A;  1FFT C;  1OW8 A;  1OXB A;  2PP4 A;  1XZP A;  2F22 A;  4PR9 A;  1APC A;  2HV6 A;  1LS1 A;  1PCX A;  2L7A A;  3EG9 B;  3EG9 A;  2LCH A;  3A9C A;  2J0X A;  5B1A C;  5F5H A;  2Y3H A;  4C7O B;  3NYL A;  1OR3 A;  2OJE D;  4PJL A;  1J8M F;  3R2P A;  3UMI A;  4E7Z A;  1E85 A;  2MHR A;  4G7O F;  2KK1 A;  2Y69 C;  3RYL A;  4JE9 A;  4ONS A;  3UMK A;  3EZH A;  4EIY A;  2YL7 A;  2VB6 A;  3B71 A;  1BR4 A;  4QI2 A;  2EPM X;  3N2Z B;  4O79 A;  3RQG A;  3IPM O;  1KNY A;  1ZW2 A;  2OEX A;  3AGU A;  4M63 A;  4PFP A;  4YL3 A;  4RD9 A;  1E83 A;  2HKV A;  4UDV A;  1E86 A;  4W8P A;  5DLJ A;  3F47 A;  5L0H A;  4ULW A;  1NSG B;  1U89 A;  4IB4 A;  3L8I A;  4MVZ A;  2R7S A;  1I4Z A;  1YLM A;  2D5R B;  2J45 A;  4Q7C A;  4P9F A;  1BR2 A;  2RSE B;  3V5Y A;  5KYW A;  3GEE A;  1H6G A;  1OW6 A;  2KJG A;  2YLI A;  3LLK A;  1V4A A;  5L0D A;  3JRM O;  4BJ5 A;  3ZQY A;  4E18 A;  2MYS A;  1YDI A;  3W4Y A;  3U8V A;  5EK0 A;  2PX0 A;  3M4C A;  2DB4 A;  3LS0 A;  3PDM P;  2KSF A;  3EHM A;  3TJ6 A;  3DMD A;  1E84 A;  3S84 A;  2Y3G A;  2YWA A;  2ZXP A;  5FZT A;  3H2U A;  3AG2 C;  3U9M A;  4AE4 A;  3Q7G A;  3ZTZ A;  4KBL A;  2UUI A;  3K7D A;  3RIP A;  4C3B A;  4PJN A;  1Z6A A;  1Z3I X;  1WAT A;  2WZL A;  4IRU A;  4JIO A;  1VYI A;  2NPU A;  3ABM C;  2YEV A;  1OCO C;  2ZD9 A;  4JW1 A;  3NMK A;  2G3K A;  3M79 A;  4BJ6 C;  2EIL C;  1Z23 A;  4J32 B;  1VLT A;  4X0R A;  1ORY A;  5B3I A;  2B0J A;  3DAG A;  1LVK A;  3TD7 A;  4E0H A;  4ZLC A;  4JTA B;  3GEI A;  3POV A;  1MMG A;  5IY5 C;  4NC3 A;  4Q5S F;  4JTD B;  2NSF A;  4C3D A;  2WB7 A;  3PHF 2;  2VCA A;  3RKO F;  3DZA A;  4O7G A;  2LSE A;  3HJC A;  4JKV A;  4YL1 A;  2AVK A;  1EKY A;  1GQA A;  1K05 A;  4XQ1 A;  1QPU A;  5A6A A;  5L0F A;  2RD9 A;  3B9Q A;  3VAY A;  5EGY A;  3DI5 A;  2WZG A;  3F46 A;  3S29 A;  1M56 C;  2Y3B A;  1Q0D A;  2XLV A;  4YT8 A;  1MNE A;  2EPL X;  1A7D A;  1AUE A;  4G7Z F;  1LS4 A;  1LIH A;  2QNL A;  3E9V A;  2OJQ A;  4QDL A;  2VAS A;  2Q9C A;  4YJW A;  4MVU A;  1ZW3 A;  3C8Z A;  4U5G A;  4F4B A;  1A41 A;  5DS4 A;  5AC5 A;  5L0J A;  1AEP A;  2H8A A;  1Q0K A;  5A69 A;  1ST6 A;  3FHD A;  3HKK A;  5DS6 A;  3NYM A;  2J7P A;  4YK5 A;  1YVI A;  2H7B A;  1UFB A;  3TUL A;  4FES A;  2YQY A;  4YT2 A;  3H65 A;  1JOG A;  3I5P A;  4MVR A;  2R25 A;  1VOM A;  5BQG A;  2R7U A;  2GA0 A;  3CSK A;  1OCZ C;  1MQV A;  1VLS A;  1BR1 A;  2I8B A;  3IEE A;  1G8X A;  3O10 A;  1ZHW A;  4JRZ A;  2J9U A;  3SZR A;  3GM3 A;  4EHP A;  5DQT A;  3O39 A;  2XL6 A;  3EH2 A;  3U0C A;  1TQG A;  3EPV A;  2R7X A;  4DXW A;  1CPQ A;  1ZHT A;  2NUP A;  4DRJ B;  2QUP A;  3QW1 A;  1OKK D;  5DVW A;  1BBH A;  3K6B A;  4XPY A;  3FAP B;  1RCP A;  3FVY A;  1NG1 A;  3IHU A;  3LS1 A;  4N4W A;  3MYF A;  4MW8 A;  2NSG A;  1C03 A;  4BEJ A;  1V74 B;  2A6E F;  4G0H A;  5KYX B;  2XRH A;  1U0B B;  2IYL D;  3K1I A;  2Q7R A;  3L0I A;  3L1M A;  2M64 A;  3DM5 A;  3DM9 B;  1HE1 A;  5E33 A;  5B1B C;  3RQE A;  4CBE A;  4AX2 A;  5BQI A;  4IAR A;  2AWC A;  1LI7 A;  5A6J A;  1Q0G A;  3QVY A;  3ZIB A;  1F1M A;  3T9O A;  3KMI A;  4NCQ A;  2HSB A;  1YZC A;  2JD3 A;  1ZHZ A;  2YLD A;  2HUJ A;  5AGF A;  4YL0 A;  3VF0 A;  1QKR A;  4DBQ A;  3AGT A;  4L6R A;  1H9G A;  2IBF A;  3Q6M A;  1CGM E;  1RKE B;  4I44 A;  2IXP A;  3K1H A;  3M4B A;  3TK0 A;  4J7Y A;  4CS8 A;  3S0X A;  2R7O A;  3RF3 A;  4PJJ A;  1O87 A;  4WGY A;  3U3F A;  4N6C A;  1J8Y F;  2EPK X;  2YZS A;  1PD1 A;  4OIP F;  1G4W R;  2P1A A;  5A6B A;  3T6J A;  5A6K A;  5AC4 A;  2W4B A;  1NBB A;  3ABL C;  4DOZ A;  3JZ0 A;  5JUA A;  3Q7L A;  5HSW A;  2W9Y A;  5JT4 A;  5CI8 A;  3FAJ A;  5K0I A;  1OCR C;  4JC7 A;  3JT1 A;  3NG1 A;  3RVY A;  2AP3 A;  3T6G B;  3S27 A;  3UGP A;  3KKB A;  1SZI A;  2Q9A A;  3U9J A;  1T6I A;  1WTY A;  3N0T A;  1TR2 A;  3OA1 A;  3C8G D;  2WZF A;  3JYH A;  2CNW A;  2CW0 F;  3U5S A;  3AG4 C;  4A4A A;  2DYS C;  1HMO A;  3MX3 A;  1M6T A;  4XPX A;  4Z9H A;  5JS5 A;  3DE9 A;  3B29 A;  4OIQ F;  2HMZ A;  2XLW A;  2BC5 A;  1R4T A;  1E2X A;  2GDC A;  3ZTM A;  3JSZ A;  4I1M A;  3B0P A;  2R7W A;  1LI5 A;  4OD5 A;  3TQO A;  3NYJ A;  2CGE A;  1M2V A;  1QQ3 A;  2CCY A;  4BG0 A;  3ATP A;  3IQ5 A;  2PF4 E;  4CS8 C;  3SXY A;  4P9T A;  2J9V A;  4IWB A;  3R7C A;  2XM4 A;  3KYJ A;  2XS1 A;  3A11 A;  3EGX B;  5L0G A;  4O6N A;  2R7V A;  2MWQ A;  1ZHY A;  3GAN A;  4U5H A;  1T9K A;  2A6H F;  3MFN A;  4H4K C;  4LER A;  3SYN A;  3AG1 C;  4WJ0 A;  3TJ5 A;  1TFK B;  2OQM A;  1YJG A;  1NFN A;  1Z5Z A;  1YA7 O;  4RBN A;  4XLN F;  1RKC A;  1PV3 A;  4HEA J;  2NG1 A;  1C17 M;  1Y6D A;  5GPG B;  2OCC C;  4CJO A;  2J0W A;  2E87 A;  1HE9 A;  1S7Z A;  2HFI A;  2J9B A;  1Y4C A;  2YL0 A;  5B3S C;  2BE5 F;  2XM0 A;  3DJN B;  2FAP B;  3SXM A;  1DOV A;  4EUK B;  1OQC A;  1OW7 A;  4CDV A;  2OKU A;  4MTO A;  1MMD A;  2DGJ A;  1HW2 A;  3MYI A;  4U5E E;  2L6H A;  1A7E A;  3O6X A;  2L81 A;  4PK4 A;  3ZC4 A;  1MND A;  1T6U A;  3ASN C;  1HMD A;  3V5Z A;  3JRT A;  1OKK A;  2QE9 A;  1WGW A;  2L9J A;  3FMS A;  2LP4 A;  3GEH A;  1LKX A;  3RFY A;  2YL1 A;  5JLI A;  3DWW A;  1T5O A;  3JCU Q;  3UMH A;  3HNL A;  2BL2 A;  4YT4 A;  3QVZ A;  3H2V A;  3LUT B;  4CDA A;  5L3V A;  3NDB B;  1KU2 A;  1ZYR F;  3MBG A;  1S05 A;  4D4N A;  2QTV A;  4OD4 A;  2XLD A;  1JPJ A;  1PD0 A;  5E2Q A;  3LJB A;  1U6H A;  1G5Z A;  2IM8 A;  1NU9 C;  3NMJ A;  2L6F A;  2X51 A;  4CIP A;  4KI2 A;  2NUT B;  3EJN A;  3PMR A;  4YN0 B;  3GWN A;  3HLZ A;  2ZXO A;  3CEX A;  3DKA A;  1OR2 A;  3L8J A;  2J9W A;  4GQH A;  1JAF A;  2QY9 A;  4MVS A;  5COF A;  1DOW A;  5E3A A;  2DYR C;  4DVZ A;  1WOL A;  2KW3 C;  1VTM P;  1FMV A;  2D4U A;  3I4U A;  2YVK A;  4CSA C;  4KNV A;  1SMY F;  3LEV A;  4CS7 A;  3AOU A;  2P0N A;  5KYY A;  2JX0 A;  3MLG A;  2AWY A;  3JTL O;  4LDQ A;  3BEH A;  1D0Z A;  2KQ9 A;  2XLH A;  1JPN A;  3K66 A;  3T6B A;  2Q9B A;  1G4U S;  4ZLD A;  3UGO A;  5BQH A;  5TJ5 E;  5F28 E;  3ABK C;  3SNH A;  4BJ5 C;  2VH3 A;  1L7C A;  3EH1 A;  3C63 A;  4G78 A;  3LES A;  4BPM A;  4XWJ A;  4JEB A;  2NUT A;  4FWV A;  2IOQ A;  3W8H A;  1CGO A;  1D1B A;  3AQB A;  2IXO A;  3S9O A;  3SP1 A;  3UNG C;  3G50 A;  1RJ9 B;  2LQG A;  3FDQ A;  2A68 F;  3ITF A;  2R9R B;  5A6B D;  2Z15 A;  2A69 F;  2HZ8 A;  1I4Y A;  3C8G A;  4MTF A;  1D1A A;  3FXH A;  5T3W A;  2YL3 A;  2OEV A;  3J06 A;  1OXK A;  4RDA A;  4NTB A;  5E3C A;  4Z9I A;  4KNW A;  4FAP B;  1SR2 A;  2HV7 A;  4KC9 A;  4MVM A;  4HE8 D;  5CI9 A;  1M2O A;  4B6I A;  4DRI B;  3ZG1 A;  2R02 A;  1C02 A;  3RH3 A;  4H54 A;  4DJ9 A;  2LD6 A;  5L3Q A;  2GAQ A;  2Q4F A;  4K1O A;  3SEO A;  3W2W A;  3KL4 A;  5KYU A;  3SXZ A;  3QW0 A;  3DD7 A;  1QVX A;  4O6M A;  3IQT A;  1GGQ A;  4BEM J;  1JMW A;  4CIH A;  4EBB A;  1GS9 A;  3DAF A;  2PBE A;  3CQZ A;  3EGD A;  1FTS A;  1JR8 A;  2G62 A;  5DQZ A;  2LK4 A;  1QLE C;  4NTA A;  2ETS A;  2W4M A;  3C8G B;  5COG A;  1MMN A;  1XZQ A;  3GM2 A;  2FGY A;  2XS8 A;  3ASO C;  3N24 A;  2GWW A;  4JEA A;  4R32 A;  4XTK A;  3VYW A;  3QMK A;  4IGG A;  4U5D E;  4MQ9 F;  4JCZ A;  2WVO A;  4IAO A;  2LFF A;  3GOR A;  3IQC A;  2Q3T A;  4NTF A;  3DXJ F;  3EGD B;  1OCC C;  2R7Q A;  3US6 A;  4EWC A;  4HFF B;  3S90 A;  1TWA A;  2ASR A;  4N06 A;  4XEF A;  3ZQV A;  256B A;  1FR0 A;  4G7H F;  1NU7 D;  2DI3 A;  4EKW A;  1D0X A;  1W2W A;  4U5F E;  3SXK A;  4BJ6 A;  2PX3 A;  3FOO A;  2YKZ A;  4QI0 A;  2ZPA A;  1ZU5 A;  5JRA A;  1GM5 A;  4JTC B;  1TWH A;  2CNW D;  1WN0 A;  1LPE A;  1Q0F A;  4HFK B;  3LLI A;  4MVO A;  4NQF A;  1IZM A;  4CJG A;  5KYY B;  4GEH A;  4NY3 A;  3T4R A;  1Q0M A;  3ZDL A;  4Z9J A;  3U2L A;  2LIG A;  4JZA A;  4AE4 B;  1ZU4 A;  1NFO A;  1ORS C;  1YYJ A;  3NKE A;  2YRF A;  4LAC B;  3E70 C;  3LEO A;  1Z63 A;  5L0I A;  2W45 A;  1QSP A;  2V3C C;  3HNI A;  1K40 A;  2VCB A;  3AG3 C;  4O6Y A;  2X0C A;  3EZI A;  3U8P A;  5COM A;  4YT5 A;  1QZX A;  1CPR A;  3M15 A;  1WWP A;  3K1I C;  3VM6 A;  3V7O A;  4C3E A;  2UUH A;  1V54 C;  4MS2 A;  1A7V A;  4CS9 C;  4JCH A;  3HNJ A;  1MMA A;  3OWT A;  1I5N A;  2YHS A;  3HNK A;  3UR3 C;  4OIN F;  3LNM B;  3AQC A;  2OG2 A;  4MVQ A;  3ZSU A;  4I1O B;  1SF8 A;  3OEO A;  2CYD A;  3O55 A;  2VCC A;  4LDK A;  4XLP F;  2P7V A;  1EQ1 A;  2R03 A;  5KYX A;  1FMW A;  2ZXW C;  2EIM C;  2J8W A;  3Q6N A;  1YAU O;  3S28 A;  4GYT A;  1ZZP A;  3U3B A;  4ULV A;  1H7I A;  3X1O A;  1TFO B;  2IXN A;  3JSE O;  3KYI A;  1YAR O;  4MW3 A;  1WAS A; 
#chains in the Genus database with same CATH homology
 1AVO B;  3IPM O;  1YAU O;  1Z7Q c;  3JTL O;  1FNT c;  3JRM O;  1YA7 O;  3JSE O;  1YAR O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...