The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
96
|
sequence length |
306
|
structure length |
261
|
Chain Sequence |
b'HVFYQKFKSMALQELGTNYLSISYVPSLSKFLSKNLRSMKNCIVFFDKVEHIHQYAGIDRAVSETLSLVDINVVIIEMNDYLMKTSDLMMMVMRKINNDESIDHIVYFKFEQLDKIEPSKLTEFINVLSVLEKSNNIAFKVLIYSNSSLLSTSLKKKLNTKYTVFEMPILTCAQEQEYLKKMIKFTFDSGSKLLQSYNSLVTCQLNNKESNLAIFFEFLKVFPHPFTYLFNAYTEIIVQSRTFDELLDKIRNRLTIKNYPH'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb |
molecule keywords |
PROTEIN RIF2
|
source organism |
Saccharomyces cerevisiae
|
molecule tags |
Dna binding protein
|
total genus |
96
|
structure length |
261
|
sequence length |
306
|
ec nomenclature | |
pdb deposition date | 2013-04-15 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Four Helix Bundle (Hemerythrin (Met), subunit A) | Four Helix Bundle (Hemerythrin (Met), subunit A) | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |