4BJ1A

Crystal structure of saccharomyces cerevisiae rif2
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
306
structure length
261
Chain Sequence
HVFYQKFKSMALQELGTNYLSISYVPSLSKFLSKNLRSMKNCIVFFDKVEHIHQYAGIDRAVSETLSLVDINVVIIEMNDYLMKTSDLMMMVMRKINNDESIDHIVYFKFEQLDKIEPSKLTEFINVLSVLEKSNNIAFKVLIYSNSSLLSTSLKKKLNTKYTVFEMPILTCAQEQEYLKKMIKFTFDSGSKLLQSYNSLVTCQLNNKESNLAIFFEFLKVFPHPFTYLFNAYTEIIVQSRTFDELLDKIRNRLTIKNYPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN RIF2
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 96
structure length 261
sequence length 306
ec nomenclature
pdb deposition date 2013-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1650 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj1A01
3.40.50.12060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bj1A02
4BJ1A 4BJ6A 4BJ5A
chains in the Genus database with same CATH superfamily
3ZY4A 3TD2A 5CIVA 3MFQA 4N49A 4FYVA 2QTFA 3P9RA 4B9AA 4J2HA 3R7AA 2DOKA 5JH7F 1JFFB 1P9RA 2J08A 4WESB 3JD0A 1P2TA 2X9LA 3FBTA 3W6PA 2CVZA 5CURA 4PG8A 4YVFA 1Y8CA 2PL3A 1TIKA 4EW3A 3PFGA 4DVYP 4Q9KA 1BQ4A 2IEAA 3NIBA 1T8UA 2XRFA 5JMOA 2WVAA 4H7FA 2X8WA 1XLUA 3E7FA 3I2JA 1YKFA 1TIBA 4I5FA 3CR8A 5JEDA 3TTUA 1A2BA 3U2LA 2QRHA 1KI9A 4GKVA 3GEIA 4I55F 4ZALA 3L34A 3V42A 1N9KA 1P29A 3NM4A 2ADMA 3DUFA 4G78A 1A3CA 4QYIB 4JI6B 5I9NA 3X2SA 3DJUB 3AB3A 2FEMA 5A4FS 3S55A 1W36C 3PGA1 4HTAA 1W5BA 4HAOA 3A3OA 4J9UE 1JFLA 4Z7NB 3G59A 3JRMO 4C06A 2ZTLA 2R84A 3ZTZA 4UU1A 4Z4EA 3IVAA 4TV8B 1FVXA 2QSUA 3AFMA 5FFFA 4RPIA 4Q7EA 3FVTA 3L01A 3R9XA 1OKKD 4A8HA 4D3YA 4G7ZF 2WUEA 2NYVA 5B36A 4QRIA 2IKQA 3WFZA 5HKAA 3U7QA 2IHKA 3NIFB 1ZO8A 4G0UA 1JT9A 4EAAA 3P1JA 3FI9A 4Y9SA 5FTLA 1UBHS 3H1FA 1RYNA 4RTSA 2FGKA 5JLJA 1AN9A 3BDIA 1XNRB 3ND6A 5A2GA 2XYQA 5GOZA 2XHZA 1T36A 5AKHA 3A1FA 1WBBA 3NS7A 3K31A 4PF1A 4L8WB 1P4JA 4LNUB 2HA7A 3WTCA 2YZKA 5LQSA 5CXXA 5SZHB 2AOUB 4P4SB 4F5YA 3NYJA 2CFCA 5KKAA 1VLZA 1J56A 1TR2A 3MERA 1QTNA 4RELA 4UE3S 2DPXA 2PN1A 1SIOA 3R7NA 4HNQA 4K40A 1ZN7A 1F2UB 5K8IA 3S5UA 4OXQA 4LTNA 3L7YA 4CIVA 5IWAB 3WAKA 2I66A 5J63A 4JJ7A 2J1LA 1GVNB 3DTVD 2POCA 2NO4A 7MDHA 4LQLA 5ADVA 1KQFA 1IE3A 4F7DA 4BKRA 5DYTA 3FY4A 1GJRA 4TKVB 2PZGA 5DDIP 4PWZA 2PWAA 2HJSA 1JAFA 1Z82A 4E5VA 2QLNA 3SJZA 5TB5A 3PTAA 1XAGA 2QY6A 4MR7B 4LJ9A 2PLNA 4E2ZA 5AKEA 3IP7A 5D91A 4MLDA 1X7WA 3MTAA 7REQA 3SWWA 3RK4A 2WF9A 1DIHA 4BX0A 4BG0A 2EZ8A 5ADHA 5AVRA 3O39A 3H1GA 1O5OA 3PICA 2V8BA 2I7XA 2W6JA 3HBAA 4PANA 4JYMA 5IBPA 3B7PA 4TUYF 4CTKA 4BTEA 2PUBA 1VLJA 2Y1KA 1CGNA 4E03A 2XXAA 5CB4A 1Y9DA 4ZQGA 1YDIA 1EEHA 4GNKA 4YAWA 2D8MA 1MJHA 2ZRLA 3ZGXA 3GYBA 1ST3A 5HS4A 4I9GA 4TVBA 1T1IA 2XB6A 4H3KB 5FUBA 1ZVVA 4MPDA 1Z63A 1T3GA 5CFQA 2QRZA 4QUGA 3IERA 4TM7A 4AKSA 4ZT4A 1V8OA 2VZ8A 3I9V6 5HPYB 2BGIA 1E7YA 1QHGA 4NZ9A 2GN9A 5H70A 1SQ0A 1EX1A 4MQBA 5EXTA 3O4IA 4YCDA 1YE3A 2R6GA 3HJUA 4Y2RA 1WPQA 2J31A 3AOGA 2UUOA 1BQ3A 2VQSA 1RI5A 1GPLA 1RD4A 4N40A 2EHDA 4Y6PA 3KFVA 1JDPA 2VG8A 5YASA 3TKAA 2R7XA 3L06A 4L85A 2A2ZA 3VKUA 4EHLA 4RE5A 4BQIA 3SHQA 4AMVA 2HA5A 4AK9A 1TTTA 1CNMA 4A03A 3LTNC 3DLAA 5DQTA 2QTBA 1EMDA 1L7DA 3LZ6A 2VZEA 4UTOA 3ZIDA 4R6XA 2FHPA 1RQGA 2ATXA 3A04A 2LGJA 4W9MC 1N2SA 5TIIA 1IAVA 2AL7A 3V2GA 3X2QC 2RIPA 2DWQA 2P0EA 3K71B 1V45E 4NOLA 1D2MA 3OJOA 5LXTB 4PNHA 1NW4A 4MRMB 4O2BF 4EG8A 5JPDA 3GAFA 1IN5A 4PR9A 2R7NA 1O6GA 2GTPA 4I6EA 3IJRA 2I4MA 4AQDA 2GD6A 3PFIA 5AYVA 4Q7QA 1U0GA 4D45A 4EMBA 1RLMA 3WRVA 1G8JA 1Z0SA 4BU1A 4AZWA 4W5WA 3TOSA 5DASA 3LMKA 3ZWXA 3BGVA 5DM1A 4MICA 3S90A 1PG5A 4A6PA 1S2MA 1LE4A 3QVGB 4HVTA 3ROPA 1WULS 1IJKA 2W8ZA 4Z53A 1J99A 3PEWA 1ODSA 1JDTA 4UHEA 2ZCUA 1FDSA 5LKRA 1XLTA 2Y1WA 2JGIA 4EHHA 4CG2A 3V8EA 3IE2A 2H8KA 3GFFA 1YA9A 3IA2A 4F6LA 1BD4A 2IYUA 4R8SA 4NS1A 2IOFA 5CA0F 2QR2A 2X0CA 3PDIA 2Y27A 1V74B 4ZRMA 3TG8A 1US8A 1GG2A 4EARA 4U2KA 2C04A 2ZE7A 4LXTA 3K0HA 2O23A 1PTJC 1K8YB 3QVWA 4XAQA 4YUWA 1G8SA 1O95D 2GAFA 3W1VA 2MMGA 4PQYA 2YR0A 4W9NC 2Z4RA 4EFDA 4WCFC 2I2XB 3ZLUA 5JARA 1Y7IA 2J9GA 2AG6A 1QQ3A 3QVKA 1CXZA 1FMFA 3ID6C 3EWAA 3DG9A 3TW0A 1TA0A 4TLEA 2UVPB 4W5TA 4J0CA 3I2FA 3NKVA 4TRMA 4XSHA 3LVBA 4RY0A 3DMHA 3VVBA 1SG6A 3U5SA 2C4HA 2PUTA 3C85A 1ZM7A 4FONA 2IHZA 1DDIA 5J5AA 4X62B 4Y3UA 2ZIAA 4DILA 4O1MA 1RACA 3OPYA 1YE5A 1XTRA 3ITDA 3GGSA 3B1ZA 4MV3A 1N1DA 5FOSA 3G50A 4XH9B 1AUEA 3LDFA 1UKCA 1FDTA 2V7WA 1Y0BA 1IY8A 2FW8A 1H85A 1G5ZA 1YOBA 2Z5GA 4XYBA 2H7BA 3SU8A 2WMYA 1RADA 3SSNA 4N01A 5I9IA 2NQ8A 1EFAA 4JJ6A 1P0PA 2WJWA 5BQ5A 3QX8A 3EN0A 3KOMA 2IEYA 2PMKA 3GH3A 1ELOA 2F3TA 3DBIA 1P7WA 5AR1A 3I64A 2M4EA 1M5UA 2AFRA 4KUHA 4C4TA 4OSEA 4B81A 1XA3A 4BXOA 4MPRA 3AKZA 5B1HA 3V9AA 1USUA 4E7PA 5EMNA 4CTJA 1IM8A 3KJQA 5FV7A 3ORRA 1LU9A 4DG5A 4U2DA 4PR0A 4M36A 3NATA 1NNLA 3L9WA 5KYXA 3RO7A 4J3FA 3A10A 2GAQA 4D98A 2H52A 2I7CA 2JI7A 1LQ2A 5FDFA 1L7RA 3B1XA 1IEWA 1EWTA 4Q7LA 4KWHA 3AF2A 3J06A 3LBHA 3LKDA 2O8FA 2JEOA 4V1CI 1O94C 2P5UA 4U0JA 2WTUA 1C8BA 1DJOA 2XUOA 4LVNA 4U7PB 1OD6A 4CR8A 3OA0A 3E2IA 1Q1EA 4IQGA 2WV7A 3CLSD 1ESMA 2UV8A 3ORFA 3OF2A 3MPUA 2BZ1A 5A7HA 1GNVA 3TMYA 3T38A 5E4YA 3NHRA 1P60A 2NYRA 2WZCA 1XTIA 2DWPA 4EZBA 3G2MA 3HCOA 1X8LA 5E9JA 1S7ZA 3ZE2B 4QELA 3N2LA 1QPBA 1C81A 5H1YA 4C3EA 1QS0B 4FM9A 3H99A 1ETHA 2X9NA 2VPQA 3PXXA 1FIUA 3SDBA 2PGLA 5ALIA 5IANA 3RU7A 4WKCA 4QYMA 3H5NA 1TD9A 1DQZA 3IAAA 3IUNA 2WIGA 1FL9A 1C7QA 3MRVA 4WNYA 4NOJA 4MPTA 2QL5A 1B43A 3N24A 4PINA 2H07A 3WIDA 1LPBB 2WICA 3MS4A 4RY2A 1SUCA 1V26A 4RD2A 1VE1A 4CUZA 4AAYA 3IUYA 1GV0A 3CLKA 3RHZA 2AVNA 2VP3A 2A78A 1L9KA 2HKVA 2CCJA 1HNZB 1DG1G 4UBJA 2DB4A 1NURA 1D5CA 3CKLA 1A0BA 5FWYA 3RV3A 5CMLA 3O82A 3A1CA 1RYFA 4P5EA 4UEWA 4FJ2A 2JFUA 1T3HA 4YRZA 3LUPA 3FUUA 1Q0RA 1WW2A 1L4NA 3BRWD 3A4NA 1Z34A 4LY0A 3UXMA 1OAOA 3AUSA 2AD1A 1ORYA 2ODTX 1EBBA 2DBRA 4I3FA 4JI4B 3RREA 4YJ2B 3RHSA 4AVYA 2NXCA 2Q6VA 4Y2SA 3D0OA 3L5KA 3WK6A 4XPXA 2E18A 5F64A 3DDCA 3WRXC 5ERXA 4ZZ1A 1NVWQ 1CUEA 3KWFA 3EIOA 2G6TA 4TZ0A 3C98A 3W6UA 2CCGA 3R4VA 4MQUA 4Y2GA 1UMBA 4ND5A 3MGBA 4KR2A 2JIZA 4WJKB 4BLVA 4HUQA 2FEOA 1RWQA 3NV9A 4HRXA 3IOBA 4ZARA 2QXUA 1BCRA 1LWOA 3UK6A 4KO3S 3WHKA 2I4LA 1UJNA 3PKZA 1NX9A 4PGHA 2Q07A 2OWDA 1OIVA 1G6OA 1HT2E 3IPAA 4I4TB 2IYZA 3MOIA 3CX7A 3JQAD 1CG6A 3L79A 1VG1A 3EUAA 4TXLA 5DNWA 1R4TA 4HGNA 2YXEA 2WK1A 1Z5OA 1UFQA 2YW9A 4EBBA 1E2JA 2BD0A 3O0DA 1XCJA 2RG7A 3BVPA 2AFHB 2JGMA 3H11B 4L5YA 2V9CA 1UADA 3QTTA 2HQBA 5HE9A 3KJHA 1FBNA 4FT2A 4R1UA 4C05A 1RNLA 2Y2UA 5E4TA 1M0SA 4URHA 2P79A 1E96A 3AV3A 3TFWA 1YBHA 3BZUA 1AHIA 4MQ6A 1EVJA 4ZODA 4CLHA 2RD2A 1YZQA 2VNAA 3EIXA 3GFRA 4D6XA 3ZWYA 2C9DA 3CUEF 3SXMA 4E3ZA 3GPIA 4IUDS 1NVDA 1S1MA 4Y6GB 1NATA 2A86A 2ZYSA 2E4VA 1PEDA 2I4NA 2M32A 1UOQA 2B3DA 2VJDA 2ZP1A 4IEIA 1DOZA 3TQHA 5BQXA 3GEMA 1I7QB 3CF0A 1SXQA 1A82A 4CM9A 2O8VA 2YS6A 2DWCA 2I22A 3A7DA 2Q5IA 1PSZA 4L5IA 5AW2A 4G4SO 4J0IA 2P5YA 4R1QA 2OHVA 2R8XA 2KLBA 3BREA 4PRKA 3WV4A 1K6EA 2JKYA 1GS9A 1BU8A 4EABA 4WN9B 1BFUA 2GCOB 3AMVA 1ZC3A 1G0OA 1ZN8A 3WHPA 1HETA 5IT0A 3ADCA 5EKXA 3X43A 4JDPA 1K86A 3L49A 4MSUA 1TM4E 3P2YA 5L3SA 1OT5A 4X54A 2ONZA 1BVUA 3GVCA 4YYEA 3G49A 1P4GA 1W1WA 1CJBA 1TB4A 1YE8A 1NFOA 1PRYA 3KZMA 3CNQS 4NYJR 4MZXA 1ULBA 5MN6A 1ZH8A 3PJRA 1IZ9A 4DR6B 5M7EA 4RETA 2I71A 3FZQA 5K3BA 4JR0A 2LFDA 3BD7A 4MUXA 5B7QA 2R66A 1RXQA 1KI8A 3FPAA 1FYVA 1WLYA 2RAFA 1AZSC 1FFXB 5A7FA 3E22A 3TSYA 1E85A 2FSVC 1RYYA 1P7ZA 1KK3A 1AURA 3ZC4A 2F22A 4G23A 1KDPA 2AE2A 3E1KA 3H86A 1BMFD 1G20A 1RWNA 2OSBA 3U48A 3SYRA 1NX6A 4GNRA 4IVQA 4HN4B 3X3HA 4OUDA 1M1YE 4GDFA 3FTQA 5BQ3A 3EQ8A 4MLZA 4PSVA 1IN8A 1MO2A 4YRPA 1MLDA 2WVGA 3WL7A 5HIAA 2PBZA 4YH1A 3ED1A 4KDEA 3WP0A 1N5MA 4RH3A 5JD4A 2WYHA 1GD1O 4XQ1A 3R0IA 5LB2A 4DVGA 3KSZO 2FV8A 4QUBA 1UZMA 4RTMA 3D8HA 1XTKA 4KZPA 3V4LA 3P0EA 2XCUA 4ZU6X 5K3EA 1QUEA 3PC7A 4F21A 2P65A 3G5LA 4KODA 3Q5DA 4H4KC 3A32A 4N39A 2HA4A 3MTIA 1GQAA 3C8DA 2GWRA 4TMYA 1BZ4A 5DVZA 5HDBB 1DV1A 1HYGA 3KLMX 1C9MA 3O2QB 5K51A 2WU3A 4ARZB 1G2IA 2R86A 5BUQA 5IT4A 1M34A 2F64A 4JOCA 1T6UA 4OAQA 1UBTS 4AL0A 2HWXA 2OBLA 2A59A 2O05A 3D3KA 4A27A 3R40A 1NBBA 1T6NA 4HNTA 5CGQB 1NUUA 3LBNA 4HFJA 2ICWG 3CSDA 1SKBA 2GJ8A 4QHSA 1E8MA 3DZJA 4KN6A 1A7DA 1Q7CA 4G0QA 2P91A 3FZNA 3WQHA 4EBKA 5HFJA 3UR3C 4PNPA 4NBRA 4EY4A 5JE8A 3UJPA 2OECA 2RGWA 5KU1A 2Q0XA 4GAEA 2DKFA 5DVWA 3UOAB 1ODJA 4XSVA 5TR9A 4DRHB 1T4DA 1VXOA 1XX6A 1QVAA 3L4BC 1SVIA 2PD6A 1X0XA 4DJTA 2FOXA 2NU9A 1I5NA 4H27A 4XJVA 4QTXA 1PJQA 1CERA 3IP1A 3R8XA 1Y8AA 1CLEA 4CM8A 4JMPA 2W2OA 3ZYZA 1O4VA 1FNSA 3CT6A 2H92A 1Q21A 4YRCA 2Q5FA 3VYRB 1PNRA 1U31A 3ORHA 8AT1A 3FYUC 1C1XB 5B2ZA 1HE1A 4ANJA 1JXAA 4GBMA 5IK2A 2FE4A 3D2LA 3I4UA 4CDVA 2P6MA 2BLNA 4UM9B 3CPJB 3I04M 4NYIR 3H65A 4IY1A 4DZZA 2QTHA 2AWCA 4ZHQB 1YARO 2XBMA 3IS3A 2WF8A 3AQBA 3OD1A 3F96A 3U4CA 1U3GA 2RKWA 1OW8A 2BUBA 2D0PB 4QUAA 3V34A 3VU9A 4DABA 3I01M 1TWHA 3D3JA 3E15A 4E70A 3D3NA 4DDHA 4DCGA 4J07A 4BFCA 2D3WA 2CF5A 1U9ZA 3FOAA 3OEWA 1YK1A 4PHGA 1D9XA 4BNTA 3A3KA 1H3FA 1XXLA 2ZRAA 1EJBA 1BWPA 1I80A 2BP7A 1MIOA 1UPAA 1PZMA 3RFFA 5EPOA 2BE7A 3PXAA 4CWAA 2YW2A 4US2R 3PXGA 4CUJA 4N9WA 1LRJA 1KGSA 1M83A 1CDEA 2XOKD 2HJMA 5E4JA 2PSEA 4KX3A 4JKOA 2BTEA 4DRXA 1DL5A 3CHYA 2M1ZA 2NO9A 4YJFB 1Y9JA 2NVBA 1BKDR 4BNIA 3KTOA 4OQYA 3KKMA 1P62B 1ES9A 4LRTB 2UUIA 5IM4A 3HDHA 5KDDA 1P7CA 4EG0A 2WWVD 1K7FB 4IIJF 5AK3A 1HMDA 3UK1A 1C3EA 2GPTA 3STXA 1FJ2A 1XQYA 4A6XA 3O5AA 3JZ0A 1GFSA 2J3KA 2KLHA 5DLEA 1CF4A 1QP7A 2NTEA 3IUBA 3RS3A 1KNYA 2XT0A 4ABTA 4JURI 1P9OA 1RAHA 2YZ2A 4UC0A 4K6MA 4QYXA 2HK6A 1XP5A 2VYND 4WOPA 2BTQB 3LDGA 4A2QA 1MX1A 1KHHA 3OURA 3HFSA 1EP9A 3EJNA 1B6TA 3NDJA 1O6BA 5C52B 3EW7A 3Q7LA 4YUZA 3NC4A 3E1GA 4YJGA 3H9GA 1OR2A 1QQAA 2WJGA 5JATA 1RHRA 1UOPA 3D4OA 3L18A 3G1UA 2Z1NA 4Q37A 2WAOA 3WLFA 5D1NA 3BL5A 3FCCA 4NU8X 4TT3A 1EFUA 2WHYA 2JJ2A 1V71A 3PXUA 2GASA 2AXEA 5K0ZA 2OBFA 1NZDA 3Q87B 4IH4A 5E0KB 2Z8YM 2LD6A 3KKOA 2RGGA 2RSLA 2D1YA 3OC6A 5T3TA 4NAUA 3F3MA 5BNFA 4AYWA 3CW2A 3OZFA 4HSEA 4TS4A 3I4FA 3EFOA 3WSVA 4RDAA 1QCZA 4R8MA 5F5XA 5TGDA 3LCCA 2CDQA 4TOIA 2YCBA 4JLKA 3VNUA 1OYYA 1SNYA 4ND8A 2BV3A 3GFQA 3HCBA 3LXMA 4YCCA 3AERB 3D9QX 4XZ3A 1YB2A 2OPBA 1N1GA 3U81A 3B9PA 2YYZA 3OQIB 1YJ8A 5BUCA 1IHDA 2WM9B 2BN4A 5A6AA 2LRHA 4IXDA 1VM6A 3S4YA 1ZI9A 2WOOA 3ASVA 1SVSA 2IE8A 4FYJA 3DXZA 3MOGA 2VNKA 1OROA 4CDGA 1P18A 2Q1UA 3VZQA 1VPEA 1CZKA 1UC9A 2I9KA 2VPWA 4Q6BA 2GYWA 1BZYA 1ZSVA 5JT1A 3JD4A 3ZU2A 5CVUA 1XBTA 2YHIA 2FMFA 1VYIA 2GBLC 1I10A 2QPOA 1MJNA 1E2BA 4MGIR 2DG2A 5A3SA 3W3AA 4C21A 1XZPA 5E2QA 3G5TA 1DDGA 1E79A 3WYNA 1B6SA 9LDBA 3OEHA 4HX5A 3A2LA 4F4IA 3GLHB 3R5HA 2C31A 3GL9A 4NV3A 5E9QA 1CZNA 4A5OA 2TRSB 1J06A 3K33A 5EKTA 4E4RA 1G4UR 4CL2A 1JTVA 3TIVA 1Z15A 2I99A 2XF8A 4OKNA 2W00A 4G1CA 2GZSA 3AR3A 2CKMA 1A8HA 1P5ZB 1DEOA 4JFAA 4MS3B 3IQTA 4YT8A 4R16A 5AK6A 3E9YA 4RE6A 4CCWA 5HX7A 1O7JA 3N05A 2ISSD 1GEEA 4C4XA 4Y9DA 3NH9A 4IEFB 4CJOA 5AI4A 5CYGA 1RR6A 5CVDA 3CRW1 4PN7A 1XDUA 1W0JA 3ZS9A 1R8QA 4WBNA 4QU0A 4ZQFA 1K6MA 3H0KA 5FL7A 2BEUB 2MDTA 1Q7BA 3LQ4A 4BX2A 3NWBA 1DLIA 4JUCA 2NU6A 1VZ3A 1Q0UA 4KVAA 1S4QA 1GTVA 3P9IA 5HV9A 3QFFA 2JC3A 3NCTA 3AL2A 1W5AA 5K4AA 1MOQA 1TQ6A 1ESZA 2X1HA 5A5FA 1I7PA 3MLEA 1KP9A 3B36A 4MVMA 2SICE 4L4RA 5L0FA 1CUUA 5HZKA 3NOVA 5K6AA 4DUYB 4YAUA 4A9AA 2I2DA 1WDWB 3BXFA 4DR1B 4HE8D 3I5MA 3LUGA 1BRTA 3JQCA 5DBIA 1YJ5A 1MEEA 2EP7A 4PW0A 4UCWA 4BN4A 1YCHA 3RCBA 4NZPA 3T35A 421PA 4FYWA 4WT7A 1J23A 3BSFA 5EMMA 3GT3A 2V8OA 3KUCA 4DLPA 3L7JA 2PYZA 2VDKB 1IUPA 1IFXA 2HQRA 3GF4A 3V1LA 3BMOA 4NOMA 4AJPA 1IBCA 3TVDA 1UODA 3MJCA 4MWGA 3LPDA 2JVJA 3E2PA 3IYLW 1WU8A 3ZHCA 3ZQKA 2QX6A 2VHXA 3H2IA 4AX2A 3TULA 5EHNA 2D0IA 4FNGA 4E5KA 4B7UA 1IWPB 2CXUA 3DAHA 3ZJYA 3DAFA 4MVJA 1E9CA 4GLFA 5IH7A 1ZOSA 1LC0A 3FMIA 1NF8A 3BIJA 2O7RA 3QPCA 1NKVA 4DLYA 3EFHA 3GCWA 4R51A 3PSHA 4LW8A 2YLGA 4P83A 1N2CE 3HLYA 1FU8A 1I4ZA 4X65B 2V6BA 3LNTA 2Y1EA 4NXNB 1AC5A 4JNKA 1M54A 3BERA 4AURA 2CVQA 3KXDA 1KE1A 2QPTA 4X7BA 1VJRA 3WNBA 4B82A 1IUNA 3CVYA 1TAGA 4A0HA 4ZDIA 1HMYA 1C9KA 3IEMA 2QMUA 1C8VB 3HB1A 1GL6A 3UA4A 2R60A 3QQ5A 5CG2A 4FDMA 3W7VA 3LC2O 1P6XA 2XVMA 1H8HD 4QBKA 2CB0A 1DDOA 3LPLA 3T9AA 4OP2A 4TLAA 3PITA 4CDNA 1KEVA 3FBWA 3GNTA 5F7JA 1BE8A 5HGXA 1YRLA 2COUA 3ETCA 2XQVA 4JELA 5DX1A 5BSTA 3R3SA 4IRXA 4F4BA 3BORA 2WLSA 3SLKA 4Q4AA 5L3QB 3BSSA 3RYHA 4RFLA 4ES6A 1MAUA 2NT3A 1TQGA 5CLLA 4L76A 2ZJ7A 4UMDA 1P1JA 1DNPA 3S1AA 3IL2A 3H4VA 3IESA 2WJAA 1N7GA 2G4VA 5LZ8A 2PMEA 1YR8A 4I5EA 1A2QA 3FFTA 4B4UA 3M70A 4NCBA 4BKQA 1LKZA 1FTQA 4WFQA 3O8NA 1WCYA 3DZCA 4UPVA 2WSYB 1R4MB 4NYMQ 4WASA 1P6UA 4KVGA 2PGIA 3E70C 1FRQA 2ZWMA 3K09A 3PUZA 5GZ3A 3AUKA 4NNOA 4DB4A 5DGCA 1JN0A 3LW7A 4TSFA 4IBOA 3DL0A 1JJBA 1WHTB 3BCHA 1XQWA 3RJ9A 3FH0A 1MVNA 3R2JA 3B1FA 3JYLA 3GJZA 5B57C 4F93B 3NZEA 2VCCA 3O93A 1B8OA 4JBXA 2O2SA 5A4MS 4R1PA 1E6KA 5ED4A 4WE3A 1MEOA 5A9TA 1ZW3A 3MTQA 4OM7A 4MS1B 4CIHA 1GT91 3FCAA 5DYIA 1JYFA 4I50B 2I3DA 1JQKA 1VYTA 2J7PA 4NU5A 3KLPX 4PHCA 1KBOA 1H8EA 3VNAA 1I3CA 3ZWWA 3F49S 5FPKA 4LQDA 3AEYA 1L1RA 2X0FA 4B4DA 1XZAA 2VDQB 5T3YA 5I9LA 4C7VA 4MUIA 4HLCA 1RRVA 2CNDA 1HNWB 1L7QA 1QM5A 4HDKB 1J8QA 2PLAA 1X15A 1YGYA 4U7TB 4HZGA 4L72A 4X8MA 5JT4A 1MC1A 1S3FA 4B44A 1ZKMA 2EQ5A 3HJTA 4W1QA 5DOZA 4ENWA 4KQJA 1NDHA 1NF9A 2ZYGA 3BKXA 3LKZA 1IRIA 2YHAA 4J0EA 4BFXA 3U9SA 4OLAA 1Z88A 2Q3FA 2Q3DA 2YUIA 4O5OA 4DOMA 2GF2A 2ZBVA 2RGNA 2G04A 2OO5A 4GF5A 5C1PA 2ZITA 2Q4DA 1XCLA 5B4TA 4HZUA 3KPUA 3KOOA 2O48X 1DRVA 4HJRA 3AM1A 3JQFC 1OXBB 4C20A 4DIEA 3POVA 5BVGB 4IWXA 3KO8A 1S5PA 1I3OA 2R5FA 3Q88A 4ATNA 3QTHA 4WJLA 2WNSA 1LE2A 3O4JA 1SCBA 1QAMA 4PO8A 3CPEA 2H31A 4TSRA 5CTJA 4UHBA 1R0KA 1N5JA 1MXFA 2P35A 2W8BA 4X45A 5TJHA 2CCKA 1FP4A 2EWWA 1ZM2A 4D9EA 1KMMA 2VI5A 2DFPA 5GOTA 1EFLA 2ZRQA 5JZBA 3ZS8A 3O8OB 5KC8A 1W52X 2GPBA 2GWWA 1RDFA 1U5BB 1P1RA 1D2AA 1QE5A 5TPWB 1UKZA 5DNUA 4MQ4A 4FB4A 5INTA 4BV3A 4XGQA 3GLIB 2EOAA 2JH8A 3SF8A 3WSWA 4H1UA 3UHJA 4RMGA 3JASB 4K81B 3NT4A 3TNLA 4GZ5A 2GAOA 1I9GA 1Y5IA 5FWNA 4JU9A 3PYLA 3AIKA 5DKFA 3PYMA 2DTEA 5GV7A 1ZFNA 2OV1A 1XZ8A 2XS8A 2YOFA 1KWGA 2HJ3A 1LS6A 1Q74A 3QOFA 4NEQA 2HRZA 1JJFA 3EVCA 4QO8A 4B35A 1YL7A 3IB6A 2NPUA 4UAUA 3PC4A 2EX4A 4LA4A 3RRFA 1X77A 3S28A 4MS4A 4YECA 5EVJA 2HZ8A 2ZQZA 1QLHA 5FPTA 4J49A 3UY4A 1YR7A 5I7FA 4Q3DA 4UTZA 4CG0A 3AY0A 2QJRA 3PIDA 3KX2A 4JKYA 3BXGA 2JFVA 3AGUA 1LLFA 1NPTO 2BW0A 1VKJA 2F1OA 4OK6A 1E77A 3OZTA 3IJEB 1WVMA 2CBZA 4QQRA 1N9GB 2A9QA 1JEQB 3MJ4A 2WVNA 1Y34E 3GAAA 5EKUA 3TO5A 2QZPA 3CRZA 3CF4A 1LW7A 4RNDB 3CURA 1RYBA 2YWDA 1RPZA 4CS8A 4YP1A 3LU1A 5C5CA 4B43A 2G9RA 1OV4A 3FNBA 4X41A 4BUJA 3KVNA 4XJXA 4OQDA 4M0DA 5I7AA 4KW7A 1K0UA 1VJCA 3NVKI 2R85A 3LLVA 4BPRA 2BF4A 5ABPA 4G09A 1SF8A 1JVNA 4RVDA 2XMDA 3MVEA 3KKZA 2QTAA 4XIIA 4GSYA 3ROFA 3ZX4A 3ZQUA 3AJ8A 4CMGA 4M6WB 1ZIXA 3SXJA 1N75A 4O1IA 5T8KC 1CE8A 4KDRA 4K1OA 4M8SA 2JATA 1DIAA 2VJOA 1I7DA 1EUDA 4WIAA 1V1JA 3N6VA 1RWVA 4NFLA 3F9RA 2DBQA 1XWIA 3MWYW 2IV2X 1N6NA 2PX8A 4Q1CA 5DWVA 2IYFA 3CB2A 2P2YA 1T0BA 3WHIA 3M4CA 3HXQA 4PPNA 2XL6A 1W5EA 4Q9LA 4JDUA 1W1IA 4E11A 4Y2XA 1NYLA 1OLXA 3MILA 4J6FA 3K5PA 5U9CA 1KZGB 3DT9A 2QX7A 3OOHA 2YL3A 1VRVA 3O7WA 5E33A 2QTLA 4TYNA 3F47A 3MSCA 1A7VA 4HV4A 2Z8XA 3HSSA 2BFBB 1W2WA 2FN8A 4YAFA 1A8UA 1E94E 1YR6A 4NCKA 3TLCA 4O6YA 1YBVA 1T8WA 4BB9A 5CR9A 1ONPA 5AJVB 4HRAA 2BUCA 3SSMA 1ACMA 5DS4A 3WJ1A 4D81A 3GDGA 2Z30A 2QLMA 3WLEA 2ZB4A 4F5WA 1J0BA 1IG0A 3MK31 2GR9A 2OLEA 2ZAOA 5C1IA 5AVQA 3T7SA 3T3NA 1CB7A 2XKAA 3VU1A 1RM4A 1XZGA 4WCFB 4RY9A 3N3BC 1ZGJA 3NHBA 5CEEA 1PNQA 1NVVQ 4EUHA 3UWSA 1UJCA 2PJRA 4YJ3F 3VPAA 4AJEA 3BIWA 1YCGA 4DARA 3H6GA 3QLVA 3KYJB 2YY5A 1EGQA 1HDEA 1ZAKA 4HFRA 1IMOA 1PJBA 5FI1B 3S29A 1IONA 1QZXA 4TYMA 1V9CA 1HDGO 1ECGA 3KAJA 2QE9A 1M10A 4WY5A 2KI5A 3OWTA 1EHCA 3JYHA 2WJIA 3GCXA 3L0DA 4E4YA 1JQBA 4QTTB 2C57A 5EHXA 2ECQA 2C4KA 1S4MA 1M0WA 1F1BA 4PSDA 3U8PA 2GEDA 2EJWA 3B3FA 5LNK1 4PR3A 3HC7A 1UKYA 2BCJQ 4W6ZA 1FYFA 2OEPA 1WQ4A 2Y3GA 5DV9A 5E3IA 3RROA 1Z29A 2WT8A 3VHLB 4YUXA 3L8MA 1KXJA 4N54A 1T2VA 2IEDA 4OXNA 3T94A 2I55A 3AR6A 5A04A 3ED5A 4EUKA 1MNAA 3QJ5A 3AJ9A 1PE0A 3DB1A 1VI5A 5BRNA 5B7NA 2XWPA 4I4NA 4IEEA 3JTEA 4M46A 2PUEA 4AIRA 2GAIA 2VTDA 4RA6A 4JVSA 1HEYA 1UQUA 1AQIA 3MJVA 1W581 2QN1A 3JCZA 1G4US 1PJAA 2P4SA 2Q1YA 3MFYA 4LWOA 1B8NA 1WL8A 2KSFA 5IYZB 2P90A 2WKSA 1AUPA 3SJBA 3PHHA 2QQGA 1T29A 4QVIA 1KU2A 4CMJA 3N75A 4AN4A 2W98A 1CRWG 4ZIRB 2LBPA 1KY2A 1EQ2A 2RFLA 1BGWA 1KZYC 4XEKA 3GT7A 4ALJA 1WD5A 2CW0F 5DCYA 2LUOA 3V5NA 2BHSA 1SBYA 1I33A 3HR4A 2DXIA 4S35A 4YP0A 5EPUA 2C20A 2NQTA 4L3OA 2XE8A 1SQSA 3C45A 1YQWA 4DJJA 1G8FA 1ZD1A 4QHYA 3KQPA 4TL7A 4DB2A 1R4NA 2P11A 5BV2P 1NG1A 2DY1A 2BCGY 1KOJA 1QC5B 3ZOKA 5F33A 2JLRA 1U1EA 1PR9A 2IBTA 3OX1A 5CEFA 5HTKA 5IJ0A 4YV2A 1ZXXA 1RYHA 5ITWA 1BHO1 4DLVA 4A0QA 1K27A 4POAA 2FPIB 2FF7A 3VPBA 4ZJYA 2PZ8A 4R7TA 2OCLA 2ENUA 2XR1A 1L5WA 2RSEB 2WINI 5K0GA 4PAMA 2OQMA 1PTKA 4ZYXA 3FOPA 4IOMA 2PL9A 1RBQA 1WBJB 4Y2UA 3M8KA 1NAHA 4JBNA 1U1CA 4ZEVA 2CT8A 1P3JA 1SXJA 4MVWA 1G64A 3UV6A 3HI6A 1IIRA 1BJKA 3OMLA 1XV5A 2CNWD 3HO8A 1C0LA 4PCLA 3V5ZA 4JYCA 3ORSA 2AC7A 2I8BA 3VU3A 1IEVA 3GJXC 3CLVA 4W8PA 3P9ZA 4MMYB 5BSHA 4AJ4A 5ENVA 1J0DA 3PI7A 2NSDA 4AX4A 4J16C 2NMVA 4OK5A 1L5ZA 1Y4UA 2WVQA 2IU0A 2FRXA 3DZIA 2OD7A 1RCFA 3UA3A 2IYTA 3RVLA 1C41A 4RHFA 1VCIA 1LSJA 1AXRA 4PV7A 3VO9A 5IVDA 3QTBA 4FHCA 5EE1A 2I2WA 4TYPA 2EIKC 1X2EA 1YRAA 2H7VA 1FX1A 4S04A 3ITNA 1K4YA 1KI2A 4X1OA 3F1LA 3G17A 1XTPA 1LJLA 4GL4A 1M3SA 1XZJA 3Q3EA 1UMDB 1RJFA 4OA5A 2JBAA 1H5UA 1XRNA 3O8LA 3I1YA 3ZR4B 3T7JA 3VQTA 2LCIA 3ZHXA 4HVLA 3DWEX 2HF9A 4UM7A 1U0HC 1E1MA 2R6HA 2QI9F 3GBVA 2QW1A 2OL4A 3R1IA 1ZCFA 2QWXA 1EHYA 2GA9A 4XIJA 1G291 4BO0A 5BW6B 2HT1A 1TJPB 2JB9A 4H7HA 1K8QA 2CL0X 2DE0X 2JJ1D 3DNMA 2D8AA 5A4DA 2IV3A 4CKEB 1BVHA 1AB5A 4EAQA 5CT6A 3AOUA 4HKTA 5AK5A 4KTVE 1ZUHA 2HIMA 1P73A 1M8FA 3IQZA 2PGDA 3CY6A 1MJGA 4Y1FA 1F8FA 4NBUA 2J3HA 4UEOA 4ZOCA 2VATA 2WG1A 3TUIC 2XLHA 1E20A 1UXIA 3FKSD 1QHSA 2YVAA 3GQBA 3OF5A 2PMCA 4Z9YA 1M2VB 3IHTA 1MN6A 3MWDA 4YJWA 2ZR9A 3G6WA 2BHNA 3P0HA 4JOBA 4IF6A 4IRUA 5JI2E 4BQPA 1SG0A 4A2WA 1SEPA 3CE9A 2BFEA 1ZHHA 3S2ZA 4FFBA 1H6DA 2H29A 4HH0A 3HKEB 5BSKA 4PQEA 2IYNA 2VTBB 2BGTA 2ZUCA 3GNQA 4H1TA 2C54A 4U5GA 1L5KA 4AY5A 2R7QA 3GY0A 3ZHRA 3E3OA 4IYRA 4MV6A 3GFOA 2H54A 5IMBA 3ICCA 2HDNB 1IJFA 2C7PA 1JIJA 1OBOA 3OQJA 1T9HA 3CSSA 3ZCUA 5EY5B 3HVJA 5DHPA 3KV3O 1BA3A 1K6JA 4ZO4A 4JT8A 2RHHA 3I5XA 2RGEA 2RHMA 1C5KA 2NPIA 5A4JA 2WJVA 5F4ZA 4DCJA 1C3JA 5AKJA 1KYYA 4Q9NA 1CC1S 3V7WA 5CXSA 4N0PA 2PNFA 4EKIA 4PZAA 3BCSA 1ZOPA 2WFLA 4ACAA 1UPUA 4OQZA 4XLLA 3UFXB 2ZW9A 1HDOA 2QB5A 1KARA 2F3QA 5I7VA 5D5HA 5DP2A 1RFGE 3BUSA 4JLBA 4F2PA 3BAFA 1E8NA 2PMBA 5I4KA 3ASZA 3EFEA 3AUTA 3MGAA 3CLRC 1L5FA 2C0PA 5L53A 2O0LA 3H2VA 2IS1A 1XXHA 5TMEA 4A73A 1OVMA 3SFZA 1GILA 4BEMJ 3WXMA 5DHSA 2E4AA 2MJLA 4M1EA 1VYUA 1NVEA 2N3ZA 5JC8A 3IEUA 5EWJB 4CM6A 1SK8A 3LLMA 3U9MA 2GBIA 5CU7A 2F3PA 4IIGA 3ETEA 1NTRA 4A0GA 2V7XA 4X64B 4KFTA 5BRAA 4JR2A 1DAIA 1OWNA 1R0LA 3LO5A 4CF6A 3QQPA 4D74A 4FSHA 1EA7A 4HGRA 4L5AA 5FORA 3HXMA 3QBDA 3EX7C 2UZ4A 3NKLA 3SR4A 1KMCA 3SHTA 3C39A 5K6TA 4P7JA 1VB3A 4O2LA 3CEPB 3QG1A 3RD5A 4DJ9A 3OKPA 3IE0A 5EJMA 1AOXA 4B6FA 4DJFC 2D74A 3ESRA 3NORA 2BTOA 5ALGA 1ZIYA 1K40A 4XQ9A 5C7OO 3ELWA 4DCPA 1DEHA 3CN9A 4BQSA 3EXIA 4KFCA 1UDXA 2NSGA 2JCYA 4K2AA 4QOFA 4QXMA 4CXMA 2O5EA 1IXYA 4Q24A 1PK7A 4HBZA 3INRA 1XCBA 5LP6C 4FFSA 5CXQA 4S24A 5KNDA 2JEYA 4LHWA 2QMHA 4ZOAA 4TTQA 1YA6A 2EJBA 2C3UA 1V47A 3UKOA 1KZ1A 3EPVA 4H6VA 5MHTA 1JHXA 3DE0X 1GKKA 3QUBA 2PVCA 1U8CB 1QIMA 1PWEA 1CY7A 4J76A 1QIHA 5G0SA 2X2EA 2AK3A 2NAPA 4LGYA 3EASA 4DGQA 5L0HA 4RACA 621PA 2ZBRA 2JLUA 2HCTA 1IHYA 2GF9A 3L7MA 4P82A 4V0MA 2OT3B 5JAQA 1HW1A 1RHMA 3OZXA 4HMQA 3OE5A 2WR8A 1KYXA 1EDBA 1XZNA 4HLUC 4ZP1A 1ZJJA 1C2TA 2RCYA 2XWSA 1YWGO 4UE6A 2BMEA 4R2IA 3FYUB 4GSKA 2QSJA 2FWNA 1D0YA 3GLFA 3E0QA 3VJKA 3AQCA 3ULKA 5TQ2A 4BMNA 5H83A 3WBJA 3I76A 3KB6A 4TWAA 3KR1A 2CXXA 2UUAB 4WZBB 1UXJA 4OJKA 1GO2A 4YWHA 3EIHA 3EEIA 3WGQA 2Y68A 1VJ1A 2FPSA 5FB3A 1XE3A 4JQCA 4D3SA 3G2KA 3KLOA 1QLEC 3KHKA 2F43B 3SBEA 1HSOA 4LC0A 1RXCA 4X0RA 3NBAA 5HK9A 3UXYA 3F4BA 5JDIC 5D92A 4CHGA 1OZGA 3E3AA 5D7BA 1NRJB 2PNOA 3HFRA 3QSYA 4CKWB 2IQIA 5B37A 4YPOA 4GL2A 5F52A 3KB2A 3WJ7A 4MVQA 2WU8A 3EC2A 2GM3A 4E7ZA 2YV2A 1QNFA 1HDRA 5E6UA 1C8KA 1U2SA 1OZFA 4YQFA 3ZVNA 5E6SA 4EG1A 4EY5A 1H22A 4FSXA 4S0XA 1RE0A 3KKNA 2HZBA 3PR2B 1YJAA 2GEKA 2HDHA 2J41A 2JF0A 3W3AH 4NZNA 1ZJYA 2AKYA 3U2QA 4UCQA 3RYLA 3DZKA 2X14A 4LLEA 1KFCB 4QUHA 2VDUE 1JZQA 5EJIA 4WN3A 4BQFA 3NHLA 5AKZA 5F2KA 4X85A 3L6DA 1WMBA 5JJ5A 1ECLA 1J22A 1UOOA 1ZBQA 1CVLA 1K8ZB 4I9NA 2XDWA 5T4HA 2O1EA 1WXDA 3KUKA 2PIDA 4F9EA 4DSOA 2JFOA 3HXPA 5BSUA 1GU1A 3A70A 3VR3D 3SXKA 2RK3A 5IY5C 1V7CA 1SY7A 2DJIA 3U6BA 3N7AA 3D43A 3OLXA 1LCIA 1GKYA 2Y2VA 5EE3A 4J29A 3SZRA 1N77A 3PCVA 3N39C 3PS9A 5GONB 3MCAA 3TBFA 2VQ3A 3AKCA 5HQ3A 3IOMA 4D26A 5JIBA 5CFMA 1PHRA 5AW4A 2ASVA 5KHOC 3OPQA 1U0NA 1RI4A 3A9CA 3Q7PA 3OT1B 4YQEA 1M57C 3NHAA 3VR4D 1UJ4A 2W71A 4MK4A 1EK2A 5CW1A 3TI7A 1YVDA 3BHMA 1X8KA 3A26A 3JQ8B 4FHEA 3IAXA 5BT8A 3CLUD 4C07A 2ZT7A 3V1YA 4L57A 1PDOA 4JGIA 1I6KA 4TV9A 1E3JA 3FOZA 5BRJA 1CY2A 1Z26A 3VC3A 3ADDA 4FK8A 2IELA 4MWSA 2BJWA 2W6ZA 5IKMA 1QZ3A 5JNTA 2I15A 3G8BA 1CUFA 5DTEA 1JG7A 3S1SA 2GN0A 1NKSA 1OU4A 2CCYA 4QPDA 4B7ZA 4ZDKA 3UXHA 1YCDA 1KERA 1FMCA 2Y0CA 2B8EA 5ERGB 5MFZA 4ZMRA 3ESDA 2BBOA 3BILA 1KDYA 3V6MA 1QE3A 3V8NA 5EWMB 2ZANA 1GPUA 5JCJA 2PSFA 2XSZA 2WD8A 4MVJH 4RHEA 4JP3A 2ZXPA 3SZOA 5K8UA 5K1ZA 3TLMA 4TQUS 4HMOA 1EIWA 2VNIA 1NBMA 3OLCX 2GCNA 5J1TB 5JU6A 2JIOA 1X1AA 4Z3DA 4DT1A 4M9SA 4N06A 1O2DA 1E9EA 5DP1A 1RKVA 1KI6A 3FLEA 3EGXA 4BHTA 4G26A 4B3DA 4LVUA 1XMQB 5FNVF 2VAVA 2J9BA 1X7YB 4MYDA 1QQ5A 2ZRFA 1Z56C 5J2UF 2Q0HA 2QTNA 3TI9A 5JJKA 2F1JA 2I7VA 2P75A 1I7LA 4F3KA 2C5LA 4FBMA 4H9GA 3GWNA 3SXZA 3HU3A 1M5RA 3ND8A 4OBWA 3THXA 1ULTA 2B6NA 2GMWA 2YV4A 3FWPA 2R8YA 4JEUA 3Q0EA 2EC5A 2XL8A 3RTDA 1VJ0A 1UBFA 1XVIA 5BPFA 1CV2A 4IJUA 1LEHA 2QRKA 4ICIA 1J09A 1RKUA 4HDSA 3AEUB 3ABMC 3HTXA 4CF3A 4D43A 1WJGA 2I0FA 2AJDA 3LGAA 1YK0A 3GMTA 4O4HB 3QXJA 1J21A 4ZT3A 4DCTA 4QUEA 2XVAA 2MWMA 4DDUA 4Q1BA 1E7MA 3OUZA 3FPKA 3WYGA 4Q0MA 2JLYA 1U1IA 2IEZA 1MENA 4CEJB 2RHBA 3PDWA 1N2IA 4OHFA 5LUAA 1Y6RA 5IXSA 3C1UA 5EZYA 3OQBA 4BGDA 3P4UA 3VI4B 1JG1A 4AMUA 2F8LA 3AUUA 1Q0ZA 2GSWA 1JIVA 3AG6A 3UT5A 3AUJB 1DO8A 3GPBA 4I0WB 5JDCA 5HJ7A 1SCNE 1Z6QA 3EVTA 1YQTA 3EAQA 2E1RA 5REQB 3T4XA 3P9XA 2BWJA 3FJOA 2FHSA 4L16A 1T8PA 2XTAA 4NPHA 3O1IC 3E61A 2P0YA 1XHEA 2C58A 5TRTA 4M1WA 3R7DA 4E14A 4L27A 1EFPB 2JG3A 4QUIA 3PDCA 1GU7A 3AVXA 5F28E 1Y3DE 3SN6A 4LXUA 3GP8A 1IZ0A 3LS2A 3UUGA 4J32B 1T5TA 5DBOA 1QRAA 3Q9SA 3X1OA 3PQ7A 3G13A 2Z4TA 2X2OA 4LXHA 3DWWA 1C03A 1Q0DA 2QV7A 3KKLA 1JMYA 4YT2A 2F9MA 3BM5A 3R7WA 3OEYA 4Z7QB 1I9CA 3OUTA 3J80A 2A6HF 3W1EA 2WEKA 4NENA 1H05A 1PGNA 3CUUA 4GDMA 4XTRA 3O2SB 2QKYA 4RWZA 4QD3A 2RHDA 3WGLA 2W2LA 4HDMA 1ZR4A 1FDRA 3V1MA 2J5QA 4NFSA 1GAJA 1EA5A 1XVLA 1ZZEA 4XEVA 2HTEA 2XYRA 1R4AA 3AH8A 4BVBA 2IP4A 1KSHA 1VIYA 1QQ7A 1Z6TA 3FVYA 3E3LA 1OSNA 2WVJA 2B7BA 1AS2A 1IC6A 1CUZA 2NG1A 1AKNA 1A71A 3VZRA 1Z8NA 4QGHA 3GGCA 3BK7A 4II7A 2A94A 1PN3A 4TTVA 3I6YA 2EIMC 2BR3A 4KVFA 5F9HA 3RK0A 2C2HA 3SX2A 4TMZA 1I1NA 1EHIA 1HMPA 2EJCA 4AUEA 4C6TA 2A9RA 1P7VA 1HGXA 2EBFX 1R5NA 4HLDA 4RD9A 3VSDA 3ABKC 4PX2A 3KQSA 1IN1A 1XZDA 2B94A 1CF2O 3MWJA 4LYDA 1ZZGA 4TMXA 4B6RA 2YS7A 1SHUX 5ECDA 2A1UB 4R2KA 4QOHA 3H2ZA 1ZM4A 3AEQB 3RT7A 3QPDA 4PXSA 1FRVA 1G8XA 3WLJA 4Q4CA 1F3LA 1OH6A 4LKOA 1YQEA 3UWKA 1R9MA 4GPZA 5TGTA 5FUQA 4NARA 1GT6A 2ZATA 1JWLA 4KE8A 5LNK6 3DE6X 4KO1S 3DMFA 1ST6A 2D0OB 2RC5A 1HDYA 4PZZA 3T5TA 1XVVA 1MOZA 1FU4A 2IUTA 3KD3A 5ALMA 1TOAA 2AV6A 2R62A 4OMDA 4G9EA 1P77A 4EYGA 4XFKA 1MTZA 4K9MA 2QMZA 2DU8A 2Q9CA 1JB1A 3LY5A 3P19A 3L4EA 2Q6OA 1L5HA 2AP3A 3A1TA 3DS8A 3EVGA 2B8NA 2IHUA 1H2HA 5JXIA 5HOQA 2X8JB 1YA4A 5DXFA 5F5NA 4L4SA 4NAHA 1TYAE 2C0QA 1JWBB 5G4KA 3VA7A 2NSYA 4JBYA 5G3YA 5CJPA 2W90A 2R6R1 3V2UA 1BROA 5B58T 3HO1A 1VKNA 1IOVA 4YB8A 2FXIA 5DEOA 3RS0A 4RD6A 2LDBA 4WZAB 3SAJA 2RJNA 3A05A 3JU3A 4A0RA 3KYIA 1XRSB 3T9EA 1NSTA 3LDAA 4N7JA 1HYEA 3MPOA 1GZ3A 2UUPA 4L9AA 5F98A 1UR5A 4TRNA 4TZTA 3SIWA 1FSGA 2AD5A 4FMCB 1CR4A 3HYTA 4OYLA 2HUNA 4NDZA 2UUBB 4POOA 3B5IA 4Q1VA 1F0PA 2BFNA 3C8MA 1CUYA 1T25A 3QKUA 1KQNA 4DBZA 4HNUA 4F96A 3ICQB 4EIYA 2PSDA 3EA0A 2QNRA 4YX9A 4WW0A 3FSRA 3OCXA 4WNIA 4N0DA 2FW1A 4GP6A 2LKCA 1X7ZB 1J2YA 4U9IS 1Z47A 4G4JA 1CULC 3F2VA 4WGZA 5LOVA 2AGVA 2R1TA 2XNDA 3KSAC 4QWMA 1M8JA 5T67A 4D82A 3QUAA 5E7JA 4CGZA 3N9IA 2DFNA 5DK4A 3WLKX 5I4CA 1AF4A 1D0IA 3ZHBA 3HG7A 1TF7A 4JIMA 4RMNA 4A15A 3L8CA 4E31A 5GZ6A 1KJJA 3W5SA 2VBCA 4FWVA 4C29A 1F4LA 5AW6A 3F46A 1YLMA 4ILKA 1KVTA 4RJTA 3K0BA 1RRCA 5FEMA 3W5CA 1SUFA 1IEQA 2H4FA 4D8XA 1G41A 2NSJA 5JS1A 2MSLA 3CNLA 3H1BA 1U28A 1UZAA 2CLEB 2HLNA 1VLLA 2WT9A 5JUAA 2ZSJA 4IIUA 1EJ0A 2IOFK 4Q9HA 2AJCA 4C5BA 3UJ8A 3ND5A 4KJZA 3AFOA 3RFTA 3DVQX 5EHZA 4G0PA 1ECBA 2XADA 4E18A 3LJKA 4UOZA 1C7ZA 5EJ8A 4ITRC 1C3OB 4HWSA 4I6GA 1HLGA 3KWMA 2OENG 1ZVMA 1MPXA 3R5KA 1PQUA 4QJ5A 4I1OA 2AKEA 4N1AA 4KMSA 1BE0A 3TSZA 2Z43A 4DXDA 5J2TB 5EC8A 1DWQA 1NFQA 3WFIA 2DGDA 1ONBA 5G40A 4I2VA 3LSYA 4INOA 1NBHA 2QAIA 4PZLA 1LVUA 1QIDA 1MIHA 3N28A 3A1EA 4ZMBA 5K0SA 4JBLA 3QEOA 4GU5A 2DFVA 1JJIA 3FKJA 2AS0A 3THWA 5LPNA 1Q57A 3GJTA 2LV8A 1ZCZA 1ENOA 3VR1A 2PHZA 2AJ8A 1GRNA 2KMLA 3PC6A 3K32A 3B7GA 3SYTA 2GK3A 4JP8A 4GXTA 4QBIA 2JD3A 1EFHA 2YJTD 2B4YA 5BYKA 4RK5A 1DAHA 4FHGA 3NYWA 2ZEJA 3IHUA 2XUZA 1C3LA 4FOLA 3AF4A 1A9ZA 5TE9A 4D44A 3B9QA 5I8PA 3E2MA 4DVZA 2GKOA 3QOXA 4GSLA 2CLMB 1VGQA 5H16A 5ICCA 1DUIA 4CPDA 3OQHA 4JENA 3EDMA 2GTIA 3I2IA 4RF2A 2A5DA 3MEQA 1OZAA 3QM1A 4ZJZA 1V8ZA 4Z1MD 3ZKWA 3Q8MA 4NR0A 2R5WA 2NZ2A 4CZ2A 3H9EO 2OORA 5JS5A 4P54A 5KWIA 3UAZA 4IUCS 4ZAZA 4FYMA 4KQKA 1OR3A 3R7CA 4QPNA 1MH9A 3DOIA 3IAHA 1V5GA 4IOKA 2RC6A 5TPZA 1ZRHA 5AKKA 3S70A 2VF8A 1YVUA 2RHWA 3T4EA 3HVUA 2BBSA 3GCGA 2NO5A 4LYJA 4CV1A 3ES9A 2VQ6A 1D2RA 4R3WA 4OJMX 4OD0A 3TJ6A 2ADOA 3AVQA 1ILWA 4RIGA 2CFOA 4G9BA 5IT5A 4NATA 1AXGA 4Q15A 4DN6A 5LLTA 5LQUA 2CYCA 1E3WA 2SKCA 4ENRA 1KOFA 1MMGA 3M7IA 2Y05A 2HHJA 3WVNA 4W5NA 4RORA 3CNNA 2ZETA 4GGPA 4EJ6A 1C1YA 5JV5A 4E6EA 3CKYA 3ASNC 3QU9A 4RL4A 1KZ9A 4QI2A 1Z83A 2NNWB 4TV8A 2XZLA 3CJRA 1C4XA 5F5HA 5FTKA 2YVQA 3D5QA 1MPTA 3CQ9A 4DJDC 5L4LA 2C3YA 1E61A 3G85A 3B70A 3HZHA 1GAWA 5TMBA 1Y1SA 2N9UA 3N2NA 3S5JA 4WXPA 3KRTA 2P9QA 3A6DA 3HL0A 3ZLTA 1QYWA 5H3HA 2NTJA 5J5CA 3B53X 2I3GA 3SPXA 3MINA 1BVRA 4J7CA 3GROA 1J33A 1JU9A 4ARIA 5FHRA 2I6TA 4QATA 3K0AA 3DEJA 1RAAA 3PUHA 4DJAA 3QBVA 2C98A 1AJEA 1KMHB 5EHQA 3TUJC 3HS3A 3LX4A 3TW8B 2DRIA 4RNCA 4PZEA 2CDRA 5CFZA 4LNUA 2MYNA 3NXKA 3R7FA 5AKYA 5G41A 4M76B 3WNZA 2BGGA 5T6BA 3AL0C 3TDNA 4P4SA 2V7UA 3CWZA 1M8GA 2UU9B 3U4AA 4D6YA 1E3EA 1XTJA 1DAEA 3DTTA 1IJBA 4JJ4A 6AT1A 2AMLA 2E2WA 3OIUA 2VRCD 3A8TA 5FPHA 1VPTA 3VTKA 3W6NA 3LCUA 2G76A 4D4HA 3DH0A 4BL5A 1L1EA 1ZLXA 3QXXA 2JAPA 1Z2NX 4YMWA 1T35A 3I6ZA 2QRPA 1EP3B 3GJ4A 1E59A 1XU7A 4YMUA 3CUKA 3IXMA 3FRHA 4W63A 4LF9B 4RTOA 1X9HA 3EXHA 2P9FA 4ZU1X 3CLTC 3DOEA 1XZQA 1SZJG 2WF6A 2IZ5A 3FG9A 4JGBA 3BEDA 5ITSA 4MVYA 3ROZA 5HUJA 5AVXA 2P1DA 2CUTA 1ADJA 4OGFA 1D4OA 2J30A 1XZFA 1OIXA 1U81A 5FI0B 4KN8A 4EJFA 3HP7A 5HRUA 4WKOA 2I8CA 3M5PA 1R27A 2BF7A 2EKQA 5DN6A 5KOYA 5BWMA 1ZIOA 2VLIA 1PFKA 2WP0A 3AOEC 1INLA 1L8AA 4HAXA 4EEKA 1VTMP 2JLQA 1PL6A 4WLVA 2BYTA 4L0DA 4A82A 3E82A 5DHQA 3HNIA 1XFAA 1YC5A 2YNMC 4FZVA 1XCPA 3KP1A 4NRDA 3LL7A 2X2PA 1PUIA 2D1RA 4MVOA 1FCJA 1IW7F 5E2AA 4UOQA 4WUVA 3U9JA 4AKHA 2FDCA 2EEZA 1DFGA 3LK7A 1EX9A 4QREA 3ON5A 5A6SA 1Z23A 1C4KA 3CGGA 1SQ5A 4G4GA 1GNQA 2AN9A 1JOGA 3MCWA 4PSUA 2GZDA 3S8EA 5BWLA 2QORA 1XU4A 2BLLA 1V3UA 1MQ9A 2HEIA 1BS2A 3AQ4A 2NX2A 3MQ4A 2QBYA 3KNZA 3W5JA 5BVHB 2B9VA 4M0LA 4EK9A 5T4FA 5HTOA 3PNPA 4RIEA 3COVA 2GAJA 4O33A 1S2NA 1AHNA 3A31A 3U3ZA 2IZ1A 1OAAA 3V5YA 1XTSA 3H8JA 1HZZA 4HATA 1NVUQ 4M83A 5DM70 4ZPJA 1OXKB 1M5TA 4F56A 5KX5B 1E2DA 5IVPA 3K4QA 4HTFA 2QD1A 1P0FA 2WQ7A 3U4QB 3RLIA 4DV3B 3U13A 1AK2A 4ZC1A 3RRZA 3MLBA 3GXBA 4QPCA 3DDWA 1NONA 3HCWA 4KXLA 1GRRA 3EXEA 2NXWA 1ITZA 3DL4A 2XRMA 1FDVA 2ZDQA 2OCCC 2FG7C 2VDMB 3FHLA 3FSJX 5G4LA 2PD3A 1JDVA 1MX9A 3DTNA 4LACB 3L1KA 4EHJA 3IEIA 2E85A 1XAHA 2QLJA 1C7IA 3IPLA 2EEPA 4BMPB 1E83A 4LJSA 2O5VA 3USCS 1RE1A 1FVOA 5SYMA 1W9HA 2JVIA 4K1XA 1YBAA 4UDNA 4EW6A 1C30B 1E2NA 4MWEA 2Q3HA 1JFTA 2OFOA 2P40A 2ZSBA 2KJGA 5JFTA 2ZWVA 5GTDA 3G1WA 2ZYDA 3D59A 2JGFA 2GK7A 3GGJA 3G9TA 1Y1PA 3UGPA 1R6BX 4CE6A 3DBLB 2BL4A 3RYIA 1L7MA 3GPDG 3UYLA 3QLTA 2RGXA 4R2JA 3R3JA 4O4LA 2ZUVA 4G1BA 1RKBA 1FAPB 5HK8A 4CQMD 1IVYA 2HU5A 1Q20A 3RFYA 1E2XA 3L1MA 1PJRA 1H42A 1NLXA 1DV2A 5AVUA 1UIMA 5PGMA 1RZRD 2F6RA 2XB9A 3FPSA 1P2GA 2ZBGA 4AN1A 1JR4A 5EJEA 1A7JA 1IZ7A 1KE2A 1T9GR 3OBBA 1L7XA 3UK0A 4QBHA 3B3QA 4UTPA 5JNRA 5CA1B 2FQXA 5EERA 4BKPA 1QH1B 4AE4A 1X38A 4F71A 3D6HA 4P2BA 2AWOA 4LHVA 4BV8A 2Q9BA 1L8LA 2UVPA 1KVUA 4NJEB 2MINB 3HCNA 3DTYA 3FAZA 5AOAA 3LF2A 1H0SA 5L4SA 4B1FA 4H3SA 3SJ7A 4MLPA 3RSSA 4CSAA 2KHZA 4DNQA 3NBYC 3EHNA 1A4XA 1A5BB 4KXNA 4B31A 2VDNB 3IKMB 1Q0GA 2J3JA 1KKUA 7YASA 3VDMA 3AHDA 3AF1A 4PX3A 3U3RA 1YU6A 4IH1A 2XX3A 4GEKA 4G2NA 1RIFA 4HB3A 2UVDA 2JX0A 1KQ3A 1RHUA 4XIGS 5FOQA 1G42A 4IIXA 4UBOA 2DECA 1VIMA 3QMWA 3LEVA 5AW7A 3AFNA 5HFNA 1PVVA 2R8ZA 3E4CA 4EQ6A 2XHEA 2W2XA 1WMSA 4ESEA 5FCDA 4N4WA 1ADCA 2DHRA 1WXQA 1M2GA 3N6XA 3JATA 3H3JA 3D3EA 2GJKA 4BMCA 4P22A 3ZXIA 1QGOA 2ZTMA 4MHOA 1MFPA 3SVLA 4JCHA 3UJ9A 1LBIA 4V2IA 4CL8A 1G7TA 1NQOA 4XX1A 5JD6A 3QPBA 4PG4A 4YHBA 3VPXA 1G8YA 5FTMA 3A6PC 1ISMA 1PLLA 2WY2D 1QR6A 3BRQA 4LZNA 4DV5B 4FS3A 1YR1A 3M49A 4BLRA 2DB3A 2Q4FA 3ZD7A 1EM8B 5P21A 2XIJA 3MRXA 4GT1A 2B1GA 3ETNA 3QMMA 4W9RA 1TZKA 4JBWA 4Z0HO 1P61B 4YK7A 4H16A 1TM1E 3DZBA 2JARA 3ZJTA 3HHEA 4PZYA 1SCDA 4QDOA 2E5FA 5CHYA 5KNDH 2R7OA 1TU4A 4YRMA 4Q3BA 4IJ5A 2JHFA 3NTXA 3FI0A 4RKEA 1D2HA 4HS4A 1KR2A 4MQLA 3TM5A 3H9QA 1OWPA 3EIFA 5CD1A 2IDKA 5FOUA 5IM5A 2BKEA 1RCPA 2VUSA 2Q3BA 2KBFA 2V7EA 4C4YA 1T2NA 1E5LA 4ZAWA 1J97A 1H2XA 5AJTA 2G71A 3LP6A 1BGXT 2FOLA 4KYUA 1CR2A 2CMDA 4DCOA 5F3RA 2BBTA 3G88A 2RONA 2L17A 5HQTA 1RT9A 2F1HA 3K4HA 4J7XA 3AGTA 1A9SA 3V1KA 3WGKA 1OUMA 3INNA 3SGLA 2H4XA 4TYWA 2RAPA 4QECA 5J58A 3BTVA 1Q6YA 2QDKA 4P3YA 3LLSA 3GWZA 2J0XA 2OZLB 2G9NA 4CN9A 2QM0A 1EK6A 3T61A 5BUSA 1YIAA 1V48A 1P2UA 3NNSA 5IDQA 4H7IA 2R6FA 4HX2A 1EE9A 2P0AA 1Y8QB 3BFXA 3H5AA 2HKIA 1EGHA 3PD0A 4IIDA 2I29A 4EEXA 1CHDA 3SM3A 3K6BA 2IU4A 4Z3OA 3RAFC 1XPJA 3U3OA 3BXXA 1XT6A 4E32A 3M1LA 1BCSB 1WEKA 1R3DA 1R5OA 4ANFA 4HQNA 1KEZA 4WLFA 2H1WA 1FYEA 5C8VA 3HB9A 3DHEA 4OA8A 3CEHA 2FWBA 5L9AA 2Q2WA 5D3MB 2F62A 3UMJA 1QX3A 3LT0A 2N0SA 3G9UA 3N2KB 1CQXA 5KSYA 1LNSA 1HQCA 1IJEA 1RU3A 3DZAA 2G0NA 3UJCA 1ZGGA 1QPZA 1ZITA 1MW9X 4UVDA 4CTMA 3USZA 1TQ8A 1LJUA 2BMAA 1AKWA 3OHMA 1IPHA 3D6VA 5WRFA 1OOEA 4H7DA 3RT1A 2C8KA 1QMPA 5T3WA 1ZL0A 4YN0B 1NN0A 4DBLC 1F0KA 2BMJA 3T12A 1ZNWA 5BN5A 1KXZA 1OVGA 1SBHA 1GPKA 2XUQA 3I5PA 1MB0A 4HL6A 1D07A 4YPVA 4BX3A 3PVSA 1JFRA 4RVHA 1YSCA 4BO7A 2EIXA 4W5OA 3THOA 5KTMA 4DQVA 1NJ6A 3VMMA 4K9SA 3A1WA 4RKRA 1OFVA 1PO7A 2VDPB 2VQDA 5IRCD 2LIVA 5JC1A 1KMNA 1QHHB 2JIDA 2BGLA 3UMKA 4U7GA 1BFKA 2ZJ6A 2XS1A 2ECPA 4IIEA 4O2AA 5LP6B 1LPSA 3TQIA 4BZPA 3LS0A 2NZWA 5C2JB 4OREX 5A06A 3KQLA 5E95A 4YFVA 4DV1B 5HM6A 4DCMA 3JVEA 1A9TA 1AY0A 3ONEA 5HIJA 5ECWA 2G8LA 2L6FA 4AYXA 2Y0PA 3ZE7A 3NLLA 2D62A 2G5PA 3H0CA 4YGYA 1X9IA 4KR0A 4RZ2A 1QAOA 4C0AC 4I5GA 1PQYA 2ASRA 2AOVA 4RC9A 1R4ZA 1RJEA 3LV8A 3IDOA 1WSWA 2O0KA 1UBUS 1I4TD 3FHJA 5KVCA 2PXXA 3RC3A 2OGTA 2D5RB 5CFNA 2JZNA 3PDUA 4D0LB 5MN4A 3JX9A 1EVYA 3S6JA 3G9ZA 3UV3A 2ZBFA 2RHGB 2CWWA 3NETA 3HPRA 3M82A 4TKMA 3BTOA 1WMDA 4ARSA 4D9NA 3SX0A 3MMNA 2YICA 1X1RA 2BGUA 1BC5A 3RM3A 2NO1A 3QE4A 2QZZA 3G5MA 4MWDA 1YR2A 4J6EA 1XRMA 5EJ2A 4DA8A 4URFA 1JVSA 5B4VA 4PYJA 1J07A 2I1LA 1R18A 2GCOA 3PQ2A 3SICE 3WYAA 3X2FA 5K20A 1E9DA 3ORQA 1CPQA 2REBA 2J87A 3M2TA 1L4YA 4BIIA 3E5NA 4ZZ0A 1U2TA 2XKBA 2K2QB 1V2GA 2V0NA 3JQGB 4QOSA 2QRVA 4MCAA 1NN5A 2MTBA 2GYYA 3EZLA 4QBFA 2G9QA 3LM8A 4EKDA 1K5GA 3DV9A 2JD1A 3KVYA 4DREA 4OEHA 2Q1WA 4KO8A 4O59O 4S05A 4X9XA 1VCHA 4DE5A 1XA0A 3TRFA 3UKDA 4A8PA 3A3NA 4PHFA 2WTNA 2V74B 5FWXA 4ZTUB 5JANA 2C9CA 1GSHA 4LECA 4PYOA 5JXWA 3LPCA 2UZ1A 3U7FB 5CXUA 3UBMA 3UB4A 3AWDA 1ZR2A 5DLQC 2BEVA 2JIPA 2Q3EA 4ZAGA 2DERA 3B78A 1E5VA 3KQNA 1EWQA 3GM3A 1GHTA 4FMDB 3HZZA 2Q21A 3WZ2A 4HAVA 2VASA 3WIBA 1EUYA 1GCGA 1W48A 1MD9A 5A03A 1P39A 1VYVA 1L7EA 2UYYA 3HEBA 5AHXA 2QJOA 4BN0A 2P3OA 5TC4A 1DT3A 5ETJA 4DMLA 3SDZA 4OHRA 2VWQA 3LY7A 4HXGA 3NG1A 4O4JF 1Y6ZA 3K8ZA 2D2IA 1M34E 1FFAA 4X1KB 4R9UC 3WMFA 3X0DA 3BJMA 2PO5A 3DR5A 5FL3A 1EKXA 2VNSA 4FD2A 2KW5A 4EI7A 3AI1A 4JASB 2WT4A 1EDZA 4M99A 5AJWA 2WWXA 1PV3A 3NC1C 4GRIA 2B7LA 3QOWA 1B16A 3U44B 2CHFA 1TM5E 4BFWA 4BBZA 2AFIA 2DTDA 3TNJA 3MGGA 1ZD3A 2OEXA 3C8UA 2ONJA 3RS8A 2WF7A 3G2JA 5KI6A 2WRZA 2O7VA 3DFMA 1ESCA 4KFRA 3PZBA 1QIIA 3LBYA 3UKJA 3TLZA 3H97A 1EVZA 1KPGA 3NKFA 4OXKA 5LP1A 1ESDA 3REQB 1MRNA 3T9OA 5FUXA 3CMMA 3BMCA 1X1EA 3HU2A 4ML3A 4EKEA 4EY6A 2QQ5A 1CUXA 3PLNA 2Y66A 4MAFA 4DC0A 4LZLA 4O6VA 1P45A 1RIIA 2P9TA 2AVKA 1PR4A 2BFCB 4DIUA 2OHHA 4FCWA 4LBZA 2NTYC 1EYZA 1TYEB 3MQFA 2AR7A 3JYOA 4XE5A 1XG5A 3DMGA 3B3AA 3G68A 2GJSA 1HYQA 2FGYA 3L0BA 1KVRA 4JB2A 5A5EA 1UMCB 4EKNB 1PVDA 2QDXA 3FDFA 2NO6A 1J8YF 4Q4DA 1JQ5A 1VBNA 1K6IA 3OPMA 1Y3BE 4AUKA 2Y4NA 3DF7A 2YWHA 2PCJA 4Z4FA 3K2IA 4L9RA 3S2GA 2BGNA 4DZRA 4PE5B 2O3RA 4C7OB 1IY1A 3D0QA 4B5KA 4C4AA 1G8AA 1V4VA 1TCBA 4GUAA 4HG2A 3IDZA 4C22A 1OW6A 4ZJUA 4Q9AA 1QCYA 2DT8A 2XUJA 4X97A 4J94A 3AJDA 4DKXA 2KSQA 3ZDFA 1VJGA 4ZHQA 3BDVA 5THQA 5EINA 3A9TA 2XQGA 1MABA 1K3UB 3Q7SA 821PA 1KAMA 3N8NA 1TTPB 1D09A 3ICOA 2JH3A 1LH0A 1EG7A 3OKFA 4G5YA 4JL6A 4M0MA 2XYPA 4TKUB 4ZOLA 4ZCTA 4K9QA 5JYDA 2CW5A 1CUIA 4DEVA 3URKA 2LFFA 3L0PA 5TY0A 2R44A 4JKIA 1PEKE 2FEWB 4MI3A 2ZRHA 4M1YA 4O6MA 3TQCA 1JECA 3RGGA 1PGJA 5BSFA 5A3RA 3NO4A 1X3LA 5LBIA 5DLPA 3KPJA 4AF8A 2OM2A 3M83A 3EG5A 3BWCA 1PV4A 1WKVA 3IXQA 4DNOA 4Q5IA 2PU7A 1OHHA 1BKSB 5KHLB 2F3RA 4OHUA 1O89A 2VPTA 2O1XA 2QN8A 4EMTA 1LTHR 1RW4A 1VRWA 2ZWOA 1WVIA 1P2SA 2QVGA 3OFNA 4V2UA 4FFNA 1QDUA 2BE5F 4GZMA 3RU9A 1HKHA 1ID8A 4IX9A 3FW1A 1NR7A 1EQUA 1YF3A 1T9GS 4XVCA 4FR2A 4Y9UA 3B6JA 1COWA 2YMMA 1GU0A 3LWZA 3I9OA 2OAQ1 3OD5A 3FVRA 1CQJA 3IIIA 4S1PA 3HDGA 3PNBA 3SQDA 1NF3A 2JKZA 3R44A 1CS0A 1QOPB 4K05A 5EK0A 4I36A 2GVZC 2NSLA 1QHEA 4RQBA 3G0OA 4KRXA 1TT5A 2RCNA 2EGUA 4DMKA 1Z39A 2HGZA 4REQB 4D5EA 2VFAA 1ZJWA 1VJTA 3ZWQA 5D8DA 2IXMA 4FOTA 3G4XA 1P1CA 3PRHA 4KUEA 3RGWS 4BB6A 2HMTA 1TYCA 4J3NA 4UDOA 4F12A 2ISCA 4C3DA 2O3QA 2YMLA 3TLBA 5D6OA 5BN3B 3QTLA 1O97D 1P2VA 4RQAA 3WNVA 1RM5A 1OTHA 2OVBA 4KIGA 2WLTA 2A9KA 1T4CB 3BD8A 2XQJA 2NW6A 4NEGA 5E38A 3JAWA 3WYFA 4FWTA 3KQWA 4B83A 4DCVA 1CR1A 4ZI7F 3H5IA 1QGED 4PQFA 1VB5A 4M86A 3H8VA 3C8GB 3LT2A 1O4WA 1YBMA 2QTGA 4C43A 1PI3A 1X6VA 3UJNA 5F1OA 4NICA 3KEOA 1YQGA 3EWNA 4DL9A 3DUWA 2XBUA 3CRMA 3KKEA 3RLFA 3E1SA 4BC1A 2AW3A 2Q3MA 1JR8A 1XZIA 1T15A 3R77A 1EFVB 3M4YA 5FBKA 3NBKA 4NDNE 2FY8A 4X24A 3WISA 3RODA 2PPVA 1X1BA 3KOZA 2WFAA 4DF3A 3NTRA 1NMXA 1SD1A 4XD7D 2GLUA 5HKKD 2FMKA 4WK2B 2OD2A 4ROTA 4WNAA 3ZVRA 3ZWIA 4C2BA 4NYIQ 5AJXA 3FNFA 4G1VA 2EFGA 1LW6E 3IQHX 4RENA 1PLJA 3G5AA 3DMTC 2IH5A 1AV6A 5H3CA 3OT4A 4JQYA 1FDWA 2OC9A 3MMZA 2DPLA 1LC3A 2WUWE 3B6EA 1ZMOA 4IHAA 4Z54A 2O8DA 4E7SA 4JCOA 1YDHA 1RC1A 1GTZA 2HY7A 1Y7TA 1OX4B 1ABEA 1N6OA 1SKYE 1UXOA 3ZVMA 2J3IA 2BJVA 1TUEA 2FB9A 2LXNA 2VSXA 1W87A 5FOVA 5LBTA 4X8OA 3RW0A 4OB8A 4DA6A 3QVJA 3TRDA 5EXXA 4FZJA 1D2CA 3GLHA 4HXFB 2FP4A 4B75A 3ACBA 1U04A 4X20A 5CDTA 1X14A 3L8ZA 1GRQA 1KEPA 3AR4A 3HVHA 2NUTB 2X0KA 1FLVA 4GKBA 4BVFA 4EATA 3WLHA 3BA6A 3CKMA 1H65A 2OJED 2OXRA 1EBUA 4FTWA 4EG3A 1C7EA 3VHXA 1KF0A 1W76A 2C7VA 5AJUA 2I65A 1PIWA 5H4GA 1E6UA 3K9HA 3CBGA 2KBEA 2VR1A 2R7SA 1CY1A 2H06A 1OZ0A 2NVUA 4H77A 3FDZA 4KB5A 4RX1A 3ZHSA 4NONA 3QPAA 3W5DA 5LYJA 2VC9A 1E32A 1L9XA 3WY9A 1TE2A 4NCXA 4J8PA 1YZNA 1PJCA 1W49A 1Y6FA 1UAAA 1DX4A 3HCDA 3I73A 1K92A 3T3PB 2QQFA 3GOQA 3CO0S 3Q10A 2EIJC 1ZK3A 1AGNA 2JNWA 3HDQA 4XA8A 4OBBA 5HZGA 3BE6A 3JS5A 5K3FB 4NFHA 3FBGA 5E8RA 5BQGA 1MRSA 4ILEA 3T3GA 1U7OA 1UL1X 4TVKA 3TLKA 1G60A 2GA8A 4CCYA 2FSPA 5GM1A 1A1SA 2ZBUA 1YI0A 4U5BE 3OX4A 3PKJA 1ANKA 1I24A 4MVJE 4QUJA 4JJFA 3U4MA 1MO4A 4ZEOA 1GTG1 1H1DA 4S0ZA 1K9SA 1OGYA 4NQZA 5DI3B 4TL8A 2FH5B 4KXMA 1KVQA 3NMIA 3I6MA 2X22A 3QITA 3JYQA 1HO3A 1GPWB 4ISBA 5K8TA 2PZBA 1SOMA 4AZVA 3W9BA 4W5QA 4CYMA 3V8BA 1IM5A 1P7PA 2XZDA 1OGJA 4WDQA 5F77A 1DGQA 1HTBA 4TMKA 3AYXB 3PB3A 1F2VA 2QAGA 4IHJB 3FVWA 4G0XA 1BOOA 3EZ6A 2ET6A 1ZRMA 4JGGA 3WKEA 1RQNA 3JARB 4W5JA 4B3RB 3CNOA 3CM0A 3C4JA 3OPNA 2N75A 4YK5A 4Q02A 4R9RA 2H8AA 3CZ6A 2R7WA 2G1AA 5HNKA 3QVMA 1KKLA 4AMBA 4WKPA 1JDJA 4KWIA 1PYDA 3K96A 2YLIA 1V37A 2JGDB 1FSZA 3RYFA 2FZLA 1U4NA 1DAFA 1W88B 1CEEA 2DHQA 2NUPB 1PAUA 4BNLA 2XLWA 2JZCA 3RFVA 1UK7A 3FCOA 3OZIA 1E66A 4N41A 3ZLJA 1EVLA 3V33A 4JX9A 4Q3EA 2ZJ8A 2RAVA 2ZULA 3ROTA 2C3OA 2WHEA 4KO2S 3RUIA 2YL0A 3SHFA 3Q7IA 3R3HA 1UUFA 3HWX1 3OQ1A 1GKIA 2Q3CA 5EVCA 5G53C 3EXFA 4MA4A 4O02B 2I78A 1TUBB 2Y67A 2SCUB 1GAEO 2I87A 5J1SB 3S1LA 3Q85A 4B3FX 5EQDA 4CMEC 2PS1A 2DBVO 4MUEA 1ZU4A 3ODGA 1JDNA 2F9LA 2RGRA 1R4MA 5IEBA 4XKJA 2WNHA 4FYXA 1SFRA 1SHJA 3H42B 2B4TO 3VR0A 4I5IA 1RXWA 2EW8A 2BZGA 5IZCC 3TX6A 5C53B 3VYWA 1WZ2A 2VYVA 2OFXA 3K70D 4YMVA 4R1OA 1RPTA 5C3UA 4HR7A 2JGLA 5HBGA 2J8WA 1WHTA 4ZAVA 4EOGA 2OK7A 3CMCO 2O2JA 1CUWA 5JTUA 1O0BA 2YQZA 2XD4A 3QVVA 5BW4A 2E89A 1O96A 5J59A 4MI9A 3MZ0A 3BXEA 2FKAA 2QE7A 1IHUA 1N5DA 1EWVA 2HADA 3TOXA 1DRWA 3N0RA 5KNCA 3AZQA 4Z9FA 2ZI6A 3NWOA 4D4KA 3L8IA 3JAKA 4HF7A 4OOEA 3DB2A 5JYCA 3EA5A 1G1MA 4BB0A 1FS6A 4C4RA 1A9QA 1ODFA 1O58A 2ZXOA 4GZLA 5IUKC 3SBDA 2XQKA 1U8YA 5IBQA 5JJCA 1DEXA 1E5DA 1G21B 1B73A 4EX7A 1BR2A 2Q2OA 3M6IA 3EVBA 4BO3A 2QRMA 4A92A 1BFDA 3BIFA 4DUZB 1Y81A 1T9BA 2XF2A 3LUKA 4N0QA 3W2TA 1S3IA 2BGMA 6REQA 1Z5GA 3PGLA 3KTDA 1Y8ZA 3EAGA 3AJRA 4P4UA 4R1MA 2V4UA 4MUNA 2XJ9A 2P6UA 4YO8A 4WXHA 4EHNA 4PPYA 1G4AE 5DWQA 1E4OA 1I0IA 3SJUA 1CDOA 4ZVSA 2VKQA 1KMQA 1RMTA 4C4SA 3C3YA 16PKA 4LSZA 3ABRB 1EK5A 2H1IA 3FIUA 4EVSA 2H2AA 2C5EA 1OTYA 4JEMA 4OM8A 2NVOA 4MA0A 4D9MA 2H2DA 4JIGA 4C76A 3LQ2A 3ZD9A 2DH6A 4KSYA 3WWCA 4PLCA 5JVDF 2J9FA 1B2RA 2E1PA 4JJKA 1BXKA 4URZR 3A9VA 2P7IA 3BWBA 4QGBA 1B3BA 1ZI8A 4UULA 3ER6A 4AUMA 3ZUGA 1J8FA 2G36A 4LBWA 5BSMA 2VF4X 3NBXX 3RSLA 1PS0A 3HUTA 2EYUA 3PGXA 3OOJA 1USGA 1T13A 2C7OA 4Z4IA 4MEAA 3B8EA 1U1DA 3CPHA 4B34A 3CS3A 4HGYA 3RTBA 2PAAA 4CODB 1D5WA 3E4DA 1YS7A 2DLDA 3ZIAD 4JYBA 4C4PA 2XUKA 4G1EB 3MIIA 2YVKA 1DRKA 4E17A 2D3TA 4PLZA 2Z2XA 5CX4A 3NIGB 3RV4A 2TECE 4I9UA 4P3NA 1QLWA 3DCNA 2A5FA 2X0IA 3TOMA 1JIXA 4HFNA 4C3ZA 1T0UA 3PNKA 4LNAA 3KTAA 1I2ZA 2CZGA 3IT3A 1EXVA 3LBFA 2PCLA 3QFSA 3I2KA 3QIVA 4UU8A 1RLTA 1K75A 3A7EA 4E5NA 4JTCB 1S7GA 2LZ0A 1Z6GA 1C4WA 1H1LA 4TMVA 3BGOS 4BO5A 3B9BA 1N34B 3TF5A 3UJDA 4PPFA 4UUPA 1ML3A 3ZWNA 4ALNA 1JEQA 4OO3A 2WSSD 13PKA 5AM2A 4GZ3A 3QYAA 1WVGA 1JBEA 4G8CA 4Q21A 1MO6A 3CZ4A 5JQGB 3ELUA 3K9FC 2ZWAA 1JXMA 3LOQA 2XRHA 3HGQA 1UDCA 2RHLA 6NULA 4MUBA 2J0UB 3RTEA 4D3DA 3RG8A 4AJLA 2ARKA 5G1OA 4PLHA 1JFFA 2DQ4A 4WESA 1WDMA 3ITKA 1LPNA 5C80A 3GT4A 4A1FA 3SJAA 4P38A 3B2EA 3A37A 3KZOA 2A4MA 2IDMA 3AG5A 2OCAA 4B8YA 2R6AA 4XB6B 4F72A 3EG9B 4RWEA 2OKGA 1WATA 3B12A 5BW5A 2IW3A 2VS1A 3BF8A 4LF6B 3G8YA 2QPLA 2IITA 2WKRA 4HI0E 5CRIA 1MFZA 3QZUA 1F6BA 3DL7A 2X3YA 3QU5A 4ZCRA 5GMOA 4OQXA 2XQIA 3HTKC 4UVGA 3TQOA 3K9GA 5CJ2A 4Q00A 2HPZA 4QYIA 2OQIA 3PL1A 2P9GA 1GA4A 4BVKA 3BG5A 3VHQA 4ZTZB 3F3YA 1EB9A 2X9GA 1DHRA 3DBHB 2NP7A 1XKTA 4XVQA 4LFBB 1QRUA 3N58A 2ISQA 1MW8X 2OZPA 1IBRA 3PC8C 3G0GA 3GODA 5IFKA 5CNIA 3EQ6A 4ETMA 2EERA 4KFSA 3FWNA 3U7EB 3KQMA 4OQQA 3IVGA 4ULWA 4DPMA 1MX3A 3WKCA 1F6DA 2C07A 1PDVA 4YR7A 1IPEA 5BSWA 4DRIB 4UMVA 2ZBDA 1LDMA 2BR4A 5TS3A 4Q12A 1YMVA 4F60A 5C8YB 1P4SA 1XVUA 3WAGA 3GR6A 3C3EA 1E2IA 1W5SA 3GRPA 5KYNA 1GM5A 1ESNA 4YJKA 3INTA 1Y9AA 1TAHA 3M9LA 1P3DA 4P0QB 1DP4A 4IQFA 2AOUA 4D8YA 4Y2JA 1N1CA 5B1EA 5E1DA 2VCYA 5IULC 3I9NA 2XE7A 1DQRA 4J1TC 4W9NA 3QFCA 3Q5EA 1MH1A 4UCXA 1YUBA 1FLDA 1T3SA 4YHHB 3DEZA 1XD8A 1AD2A 1OWOA 3ZK8A 4AJOA 1UWCA 5EXEA 2X0RA 1EA8A 1WE2A 2VXCA 1F2UA 4CVNA 5H59A 4U2GA 1B1CA 2IIPA 3ZJVA 4MHSA 4EYEA 1PVOA 1ZAYA 1GUDA 3WDSA 2JLAA 4GQBA 5KTTA 3A2KA 2CZQA 1K05A 1PL7A 1XC7A 4L6AA 3SFTA 2D5BA 5C4GB 2NZ8A 4TKVA 5HF6A 3KHSA 4JB3A 1A8IA 2P5TB 1SO8A 4JLJA 3M3HA 1U8TA 4F06A 4OL9A 2Q6IA 4M9QA 1TVKB 3GVPA 4MR7A 1XRPA 3EZ7A 4EWLA 5HFAA 1OFGA 5DLYA 4F4FA 2QYTA 2FJUA 1L6RA 2CYBA 3RIHA 2JK1A 3FMOB 3WLOA 5COAA 2GHIA 4LDRA 2R4TA 4UVIA 4HD8A 1KOLA 3ISTA 4FU0A 2ZJ2A 3NBFA 2FR8C 2DLCX 3N07A 2RB5A 4NBKA 2Q0SA 5LD2C 1VLQA 2B36A 4IIYA 1PV1A 3RANA 4RK1A 5I45A 1WOLA 1LZKA 4IDNA 4LPKA 3B0PA 3EPRA 2IU3A 1TJ4A 3DO6A 5IYZA 4I1YA 1R5ID 3FMGA 5FBZA 3RJMA 2PRYA 2FFJA 4RFVA 1PJLA 3RBAA 2IPMA 2XM0A 1NJ8A 3KKQA 1S8FA 5I9TA 3RQEA 4G2TA 3ZYCA 3Q6MA 5IJ9B 4IAQA 1MZPA 1KR5A 4C14A 2W6JD 4BY9E 1KAOA 2Y9MB 3K9CA 1CX9B 4EO4A 5H7XA 4JP1A 3V5XA 2VEDA 2YVLA 1P80A 2AMFA 4ASUA 1QG4A 1QOZA 4ZI2A 3QW0A 2ODAA 3EXG2 2FTKE 3WK9A 1FNMA 1HA3A 4G24A 1G3RA 3IPCA 3O8QB 1N0IA 2QUJA 3D0KA 3OG9A 1HY5A 3HJFA 1H93A 4P4TA 4HJXA 3RJTA 3H3FA 1EEXB 3HLKA 3ZHUA