4BJ1A

Crystal structure of saccharomyces cerevisiae rif2
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
306
structure length
261
Chain Sequence
HVFYQKFKSMALQELGTNYLSISYVPSLSKFLSKNLRSMKNCIVFFDKVEHIHQYAGIDRAVSETLSLVDINVVIIEMNDYLMKTSDLMMMVMRKINNDESIDHIVYFKFEQLDKIEPSKLTEFINVLSVLEKSNNIAFKVLIYSNSSLLSTSLKKKLNTKYTVFEMPILTCAQEQEYLKKMIKFTFDSGSKLLQSYNSLVTCQLNNKESNLAIFFEFLKVFPHPFTYLFNAYTEIIVQSRTFDELLDKIRNRLTIKNYPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN RIF2
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 96
structure length 261
sequence length 306
ec nomenclature
pdb deposition date 2013-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1650 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj1A01
3.40.50.12060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bj1A02
4BJ1A 4BJ5A 4BJ6A
chains in the Genus database with same CATH superfamily
1DOZA 3OT1B 2AXPA 5AKXA 5CFNA 3O9VA 4OHMA 1QB8A 4WKOA 4M46A 3W5DA 1LPOA 2QN2A 2DEUA 2IYWA 2ZXRA 1A3CA 2ZKIA 3RUPA 5JDCA 3C24A 3O2QB 5JALA 3GLHE 4KQWA 1UINA 2HF8A 4DAOA 1XZ8A 3ADCA 3WWEA 5J2TB 1CNEA 2GK3A 2VIIA 3ESZA 2TYSB 4G7OF 1LCIA 2A58A 5JOQA 5FTWA 3EVCA 1M3SA 2GPAA 4ERXA 4LGCA 1V47A 2ZSIA 3VHLB 1A8SA 3VX3A 4FFRA 1KEUA 2P6UA 1K8ZB 3KEFA 4PR3A 2PKWA 2PGLA 4NCAA 5LUAA 3ISJA 5TQ2A 4CF4A 2NAFA 3D3QA 1Q17A 4C08A 4OKNA 1ZIPA 2Y8EA 3JD0A 1B2LA 4EJSB 3RVPA 2UUPA 3BXGA 3P2JA 1U3CA 2UUCB 3MOGA 4JJIA 3P0FA 2O0HA 3JQGB 2DU8A 5I47A 3BGVA 4CL2A 1L1QA 2QG9A 2ZCJA 3OTIA 1U9ZA 3MFQA 3LDHA 3EGVA 1OYVA 1BMQA 5EE3A 4C05A 4Q9DA 3G50A 3RW0A 3C5HA 4E09A 4CM5A 4WXMA 2Z57A 4A03A 3WGZA 3RWOA 4U7DA 4MVJE 3UXHA 4NH0A 2ZT6A 4HFMA 1G2QA 4DWWA 4P9FA 3UBMA 1QMPA 1DO8A 2A0UA 3IULA 4FYPA 1OE0A 3AY3A 1YRWA 1XZEA 2ZRJA 3HYNA 2GZRA 1BMDA 1PNQA 2WUDA 1NU9C 3ONVA 1XXHB 3OPNA 5CK4A 4Z2YA 3DHYA 4GP7A 5JTTA 3KD3A 1DDGA 3M5WA 3O8QA 4BAUA 2KLBA 2AB0A 4OI1A 3GB9A 3LWDA 3OOHA 2BDEA 3HV2A 3C7DB 5EPUA 1KDVA 3Q5GA 3PYXA 4YPFA 3H1EA 1Q44A 2AFIA 4RVGA 2XMBA 3REQA 1M8PA 3ATPA 5CR9A 2QR2A 1JDZA 2O59A 4MMZB 4DCVA 4BNGA 3CXUA 2PM8A 3TLMA 2TSYB 2EIJC 2O3SA 4FFWA 4YJ2A 2QNLA 2JATA 4MPTA 3PVCA 3H2SA 5IJ9A 1UBSB 1SVOA 3EQ6A 4MVZA 4OX9B 1TR2A 3SQNA 3NETA 8ATCA 2FXVA 5BSGA 4KVZA 3S99A 1KQGA 1YAUO 2Q1YA 2H29A 2BGJA 3M5PA 1R6BX 3HXPA 2P9HA 4PFQA 4TS9A 1RW4A 3V4ZA 4IG4A 4F8JA 1ULZA 3K09A 3H3XA 3ZV6A 1OYOA 2EL7A 2IY8A 3GJXC 4F3RA 1LFDB 3GMDA 3TD2A 4I19A 3GWNA 3LQRA 3GZJA 3AEZA 5KYXB 5IBCA 5DCLA 4A5SA 2OZVA 2JFVA 3S9OA 3KTAB 1XPRA 4PLFA 2WC1A 1N0HA 3EPKA 1BMFD 4S1TA 4ZVLA 3E2IA 1E2HA 2JFZA 4YP9A 2PS1A 1QLEC 5LZ4A 1VECA 2WHRA 5K1ZA 4X1IB 3KVYA 5T1DB 3N28A 2DSTA 2WHXA 2XKKA 1UFVA 2VDWA 3AU9A 1BW9B 4ESEA 4FC7A 4F04A 4DREA 5IUNC 3L34A 5CXQA 3H5LA 1S4QA 3AR8A 2Q3EA 3LS2A 2QNIA 5IC4A 2D7CA 1AX9A 4LJYA 1QIJA 2JRLA 2YY6A 1U3FA 2BM9A 1N3YA 4JC4A 2YZMA 2V96A 2VQFB 3TJRA 1PJZA 4GKBA 3AB7A 4DTIA 4Q03A 5K20A 5NULA 3E05A 1E2PA 3DJFA 4AY3A 3PC3A 2PH7A 2RGCA 2BWJA 4O63O 4CTOA 4YJFB 1A82A 3HUFA 2GF2A 3QKWA 1JBKA 4UTRA 2F4VB 2C5FA 2IHTA 4PZYA 4PU0A 4J43A 5K2OA 3NKEA 2WWGA 3DEZA 4Y6QA 3CC8A 5FFNA 1EUZA 4I3MA 5HF6A 1ZHOA 2WQ6A 2Q3BA 5ESWA 3K5IA 4J0QA 3AVVA 1KL7A 3GGGA 1YHNA 2WZGA 1Y34E 1GUYA 1WA5A 1VIVA 3AETB 2REQB 2JFGA 1OLXA 1KMIY 3VMMA 1J49A 1A7JA 1X7DA 4J6FA 2I71A 3EPHA 1Z0FA 3TFQA 3NCHA 2GN0A 1UJBA 1Y48E 1M5RA 2NACA 3QTLA 3DFMA 3JWJA 3V7UA 3H5TA 3WFJA 1IIBA 3U4HA 3SN6A 5BN5A 2JFOA 4YRIA 3WG9A 1MABB 4RK6A 3QTBA 4OHFA 3QKSB 3SHVA 4EGCB 1L7BA 2PTGA 4PICA 2OCKA 1I7SB 3E35A 1CQPA 3RC2A 2EW8A 2VSQA 1TU4A 4A2PA 2ONZA 1A7VA 4E1AA 2PZMA 4KFCA 4ICIA 3F71A 2H31A 4AKHA 2JCYA 1X1SA 4JL8A 1NJGA 2FSFA 2QM7A 1NDQA 4D4NA 2FJPA 5JYBA 2P7IA 4MA0A 1ODFA 1VLVA 2BBTA 2F1IA 2CN1A 3R8XA 2V6FA 2H5JA 1M66A 4PZ0A 2EGUA 4UAUA 1T15A 3MQ2A 1A9PA 4I4TB 2BLLA 1YDHA 2D06A 1I9GA 2W45A 3O2NA 1H85A 1SBHA 4CIVA 4R6WA 5KOHA 4CKEA 4KPUB 3ZY5A 2GS9A 1II8A 2ATXA 1UXKA 2XSEA 1AUVA 4YUVA 4E5YA 1ZK3A 1HNZB 4UREA 2DPHA 5LXTA 3NBMA 2R751 2OOSA 5K0NA 3ML1A 1KI4A 1V5FA 1RWKA 4GLBA 5G41A 1SIBE 2R87A 2W98A 3N2LA 2J9XB 3Q3GE 3QWAA 4ZVVA 2P9YA 2BEJA 2DWQA 1C0PA 1U7PA 4CX9A 3IEMA 2D54A 4XGKA 1TFOB 1UBJS 4GSYA 4JW1A 2G9UA 2XMQA 3TTSA 3GLFE 2LK4A 2IXNA 1PO7A 5KEIA 3SC2A 5COGA 3NWEA 4NJEA 4M1ZA 2GNAA 2RKOA 1RQLA 2X1MA 2XNJA 3D3EA 4YT4A 3K5HA 2D1TA 4L85A 2ZSAA 1NSYA 4DM7A 5JLAA 4DE5A 3ABZA 3EMBA 3HB0A 3LBHA 1T35A 2HTEA 1KO5A 1M2JA 2NXNA 4HZGA 2O4CA 1IIRA 5H82A 5JS5A 4MULA 1OH8A 1Q6YA 5JXJA 3UMRA 1WJGA 3W6UA 1BFDA 5JNUA 1DC8A 2G5TA 2ECPA 2DSNA 4LE2A 1D0VA 4C78A 1E4YA 4ZK6A 4D9JA 1Y8RB 1KETA 4CHTA 3R2PA 1IULA 3N2IA 2ZXFA 3BDVA 1U2ZA 2G6TA 1R6UA 2FWMX 2C31A 4Q34A 1SULA 5IXJA 1QCCA 2BFMA 1Q84A 3H11A 2B30A 4D4JA 2J9FA 2MDTA 6ABPA 1GU7A 1GGMA 4FEYA 3JATB 2G62A 1TB4A 2WE8A 2NAPA 3RF6A 1VBMA 3NT2A 4R2JA 3U17A 1BA3A 1NMXA 3JQPA 3L0SA 1S2IA 4S1WA 1CYEA 2HIGA 3D4PA 4DMUB 4BB5A 1DIRA 1N6IA 2XDQA 5KX5A 4ZI7B 2C4HA 4AI6A 2JFXA 4G4GA 1KVSA 4OHCA 1O95C 2VHTA 5CLGA 1M1XB 4N5MA 4R2LA 3IQZA 1CG6A 1HMYA 1EWQA 4IARA 2HMAA 3W4IA 4G86A 4TSFA 1QTQA 3G0OA 1CQXA 4C5BA 4M9UA 4BFUA 4EUHA 4MV5A 2HRZA 2J3HA 3MTIA 2JKVA 2PU7A 1QHSA 1WTYA 4X41A 5EZ5A 1NSFA 1K97A 3QVMA 5B36A 2WZQA 3C1TA 4K6FA 3QVGA 5BYBA 5J4VA 4Z7QB 2GBLA 1UDRA 3CF4A 3DYIA 2PT6A 1NMEA 3K2EA 2UUBB 4GOKA 1KZ6A 1QZ3A 2VYVA 4UATA 5J63A 3RS8A 3EZ6A 1X77A 5A5VA 4TV9F 4CBEA 1DC4A 1IATA 2C4VA 2YHAA 1JSLA 1E79D 3IUBA 4FT2A 4AD8A 1EHIA 2F3RA 1KP3A 2X5JO 1T5HX 3S68A 1A5TA 4QUHA 1ZD4A 4NE2A 3W2TA 3O84A 1OH5A 3ZQYA 4OHYA 3BD9A 3NJ4A 2O2HA 4AJIA 1NDUA 3TCKA 1GSOA 3OAAD 4I1UA 2R8RA 4D3YA 2Q1WA 2WVHA 3ZGYA 3DXJF 3GI1A 4K6MA 3R9XB 1SOWA 1H3FA 5E7JA 2GHRA 2H1SA 2V9CA 1K5HA 2EEPA 3RJ5A 3QTHA 5FI0B 3WZLA 4FZJA 2UZ0A 3T61A 5ADHA 3SOPA 1I14A 2GJ8A 2I6FA 4DFDA 3L92A 3GIDA 1JW9B 4HAXA 5TGDA 5ERYA 2DR3A 4RTRA 3DBOB 5BVGA 1PJAA 4RDHA 1JXOA 4IHJB 2PFGA 3GVIA 1NC3A 1DEAA 3DDNA 2HKVA 5JS1A 2JBAA 2H7BA 1DIAA 2OHIA 1RM5A 3RG8A 3QZCA 1X8JA 3ANMA 4BLTA 4OB7A 2ZJ7A 4QEKA 3RV3A 2A0WA 5CFPA 5ILGA 4DZRA 3FTNA 4XD2A 4CF3A 2CLCX 1ZBQA 2QOEA 1JIQA 3I2JA 3WGJA 2JHGA 4RUKA 3IKTA 3EYAA 1BDIA 2A92A 2ODWA 3FOOA 2JGAA 4WX2B 2HW8A 3A6FA 1CUVA 4AP6A 1JFTA 5KNBD 4B84A 3B53X 2PNOA 2QSYA 5CAEA 4JQOA 2XMSA 2C9ZA 1OF1A 2VDNB 1TTHA 2RH5A 1Y4AE 4NS1A 1CB7A 1H0KA 2CW5A 4R9SA 1Z4OA 2O3JA 5JMOA 1E98A 5KTNA 3T38A 1I2DA 4J16C 4CF7A 2FF5A 2ORVA 1UBCA 3AK4A 4DA4A 5CVCA 2QYTA 1JP7A 2EQ5A 3VDXA 1ETHA 2C9BA 2I4IA 3PXUA 1VI6A 3OWTA 1IBSA 1PJ2A 4MDEA 2H0QA 6REQB 1TM3E 1YS2X 1K89A 2NU8B 4O0LA 4ZIRB 1P0FA 5NLLA 4CV2A 5I9TA 2O0MA 1V4VA 3WICA 4MRAA 4YT5A 5HOQA 1SKMA 3NTVA 4LQDA 2PS3A 3IV6A 3LUFA 3QG1A 1E9SA 1W34A 2QZPA 3GM2A 4MRMB 2BHTA 1M5UA 4CM4A 3OSZA 3Q8MA 1JWAB 3AUFA 3T1QA 1KBZA 4XFJA 4CG3A 2JJ2D 3E9ZA 4OKIA 5FNVA 4Q37A 3VDNB 4EGFA 3MX3A 5LA6F 2F3UA 5HRUA 2OJED 1AQLA 3TOCA 3A1VA 1MO3A 1VBKA 3UIEA 2QVBA 4MWSA 3K30A 5KDLA 1XC7A 1IRXA 4CU5A 4PZUA 3UJ8A 5KWIA 2D5IA 2XWPA 2OV4A 2R48A 4MVQA 2HRRA 4FMDB 3NVDA 1KJWA 3GWGA 1ATZA 4MUKA 4F96A 1WDTA 2OCLA 1RP1A 4Q4AA 1JEYA 2YNMC 4G0ZA 4G3XA 5JEDA 3EXFA 1U3GA 3OZSA 2JG3A 4C07A 5GJVC 5I7RA 3TI9A 2IP2A 3CEPB 1GNPA 1ZGCA 4UQLA 3B51X 3HU3A 3QVVA 3WLSA 2H9YA 3LVRE 3SZMA 1FUYB 2VAXA 1XN4A 2W2KB 1WHTB 3NHLA 3HCCA 3K4HA 3VO8A 4F2WA 2ZIVB 3HCFA 1RRGA 1DWPA 2VH1A 3N0WA 2QV0A 2AJTA 1TKBA 1Z6YA 1E77A 3K0EA 1ADFA 3LNCA 1USVA 4NTZA 2VRCD 2JGNA 2A5FA 2PV0A 3R5FA 3FPGA 5KHOC 2QM3A 2WSSA 1Y3AA 3LCVB 4RHUA 3ZCUA 3FKSA 3WL4A 2G80A 3ZQ6A 1L7MA 3OM8A 1WS6A 2QZ9A 4WI1A 4MV1A 1TYBE 1UP6A 1VBNA 1YA8A 3H19A 3C3EA 4QQ8A 3OPYB 2GYUA 1Y89A 1I2MA 2CXQA 4IIEA 2PU5A 3FZGA 5C8XA 1QKKA 4ZT3A 3RF7A 5JJCA 5C4MA 4Q9JA 3L01A 5D5PA 5ALUA 1ZCBA 3A6LA 5JNWA 4F4BA 4AE4B 4BVHA 3D8HA 5BMVA 1O0SA 4MI3A 4UUMA 2YKZA 2YL0A 1LW6E 3GPCA 3H5RA 5CHEA 2FSHA 4BN0A 3V46A 3EFOA 3AINA 3K1JA 3JQAA 1NYRA 1NC1A 4GNKA 2ZROA 2QTZA 1NTOA 3IAEA 5ITVA 1MAAA 2WAXA 2NU6B 2WPDA 5ENDA 1VKRA 3HXKA 2NVWA 1T0IA 4FMBB 4KN8A 5LIPA 3KQSA 4I6JA 1IQRA 5DN6D 4CODB 1N2IA 1PT8A 2I2FA 1XCOA 4XZ3A 4B80A 3WIOA 1A7EA 3EVTA 2WWYA 3WGIA 2OYRA 3ZV7A 3PYLA 3FGNA 4OHUA 3E9RA 4DC0A 1LBEA 3HP4A 1PJQA 4AJ2A 1AKUA 1GQYA 4R9VA 5KVSA 1UC5B 3WGUA 3SIWA 2QX4A 4ENTA 3THSA 1K4YA 3Q3IA 3UVEA 2JA2A 3ROQA 1N6PA 5THKA 4J29A 5T8KC 1E5QA 1E7QA 1UJMA 4IFBA 3GLVA 2BKUA 4JP5A 2EF0A 2I62A 1I4LD 5DQTA 2HY7A 2CSUA 2MU1A 4K7JA 1YOVA 6Q21A 1H4SA 1DXYA 4LDAA 5DS4A 2QLAA 2N46A 4DJEC 5MGBA 1JDTA 3C1UA 3RRMA 1SZDA 3ZDZB 4JUAA 4R8SA 2VHXA 1PR4A 4AKSA 1TZJA 1P5FA 3WK7A 3T4UA 4A0FA 4FFOA 1USIA 4KMOA 3KJXA 1E9CA 1E6KA 2QGZA 4LMBA 4GP9A 3L6UA 2HRBA 2AJLI 5G0SA 4RZSA 2ANCA 4UCXA 1XT6A 4PHHA 2R7RA 1V11A 1VSBA 4UZSA 1GV1A 2ZSDA 5CFRA 4WESB 5CEFA 4B47A 2E87A 2H2FA 2IXOA 3EAFA 2XCTB 5C1IA 2VLBA 1G6HA 4R41A 4LMRA 3GRVA 4XQ9A 2XH8A 1JKJA 1XP5A 3D31A 5ALQA 2HQRA 2PWYA 3HDTA 4D4MA 4W7IA 4Y6GB 1EVLA 1DP4A 4KQEA 3A1NA 4HEA6 4YRZA 5J2UF 3R3XA 3UAOA 4YWJA 3T3IA 4WY8A 2GBCA 1SCAA 1FCJA 3RWMB 1Q0RA 1XU4A 3JXEA 3O47A 2XE7A 1PJ3A 2XDYA 1K3FA 3TQSA 1WLSA 5KYNA 1PJCA 4PZAA 1QGUA 3U8VA 2AQIA 3C0KA 2DQYA 3K70C 4G0OA 4IX1A 4MVUA 4PFKA 7ABPA 2QN3A 2CZCA 2C7PA 3S1LA 1EJBA 4YCAA 3R5XA 2WTUA 5ER6A 3WDKA 4LNAA 2XOXA 3E5MA 2FZ4A 4H7DA 4RSHA 2JFUA 1DEKA 3PQ3A 2C5AA 3F8SA 1WXEA 1JKMA 3IUYA 1FUEA 3Q3VA 3BBPA 1S2NA 4I1IA 5DM4A 1A5ZA 3GFTA 2CNLA 5CUQA 4W5QA 3T34A 5G53C 3WK4A 5H4GA 4DLPA 4JEAA 4FHCA 3GWLA 3MQ4A 1ZMRA 4LSMA 5A4KA 1CR2A 4NCNA 5EQDA 2L18A 4CFZA 3HB7A 2GN6A 1QE5A 3VVLA 5GTDA 2PYIA 2FKNA 2WV7A 3RAPR 5AT1A 4JV5B 1VMEA 4JXZA 1D9ZA 1H42A 3EOBI 4ZOLA 4Z54A 2ZT5A 3MCVA 3GN1A 1FXSA 2C8KA 2FU5C 5AJYA 4F5DA 4M8SA 4B4DA 3CUTA 1VLTA 4P92A 1JHPA 4WLEA 2ERYA 2FV8A 3LLKA 3A1DA 1W48A 3LGSA 3CZ6A 4YP6A 2UDPA 4WJ0A 2ZUVA 4A0GA 3GC6A 3TH5A 1YS9A 4FD3A 3HSYA 3RFUA 3QKIA 4NBWA 1YQQA 1FFXA 4IJQA 4WKCA 4RY0A 3HJBA 2I91A 4KGVA 4QICA 2VI5A 4D42A 3VZPA 4Q39A 3TL2A 5FA6A 3LOUA 1P7ZA 3M1LA 4J07A 5KYVA 2DFPA 1L9KA 2BGKA 4RKYA 3DO5A 4IDPA 4IWXA 1DMSA 4J8PA 4PO1A 3T7EA 2XJ9A 2FMHA 2AVDA 2XQGA 4PVCA 1YQWA 1OYWA 4UULA 3FYUA 2RG7A 1SK8A 2WHEA 2OFPA 1T0BA 1J4AA 1JEJA 2PNFA 2H63A 1T91A 2X6TA 3X1ZA 4B3GA 3V8BA 3WGQA 3EPLA 3NORA 3O4FA 2C5SA 1CCWA 3D8BA 5JDIC 3TBKA 1QF9A 5CFZA 1F4LA 4OQ4A 3RANA 1SCDA 2I8AA 3HU2A 3RJ9A 5DVWA 2ZTUA 3TLEA 1FYVA 2YL1A 1OZHA 3DGEC 1NMYA 2FFJA 2JLQA 2PKXA 5E3AA 3IR5A 3PRYA 2GAAA 4QXQA 1RLJA 3TNJA 1F2TB 3HXQA 2QT1A 4J0FA 2YLDA 3PWZA 2VHWA 3K1IC 4U5QA 3PUWA 3HKCB 4KI2A 2GLUA 4ULVA 2RHGB 1UXGA 3EMVA 3S7ZA 2GEJA 1BXGB 3IBYA 3MGCA 3U6BA 4EB3A 2WFMA 2SICE 4P9TA 3RROA 4D9FA 3FFAA 1V5IA 4JEBA 3FVWA 1M2VA 1O6ZA 5DO9A 1ORSC 1P0CA 1T8SA 2ADFA 2FSGA 4CLOA 1TVCA 1QOQB 3DE8A 3I0MA 2RGRA 3RIPA 4TMKA 3TWOA 1R5BA 4XDHA 2O8VA 1OX5A 3Q5DA 4UNSA 2PX3A 1K6JA 5FQOA 3RLFA 5J5VA 3TK0A 3HZOA 4HG2A 2NSYA 3CEMA 4PZEA 1ZHFA 1ZNQO 5ALSA 1XA3A 3COYA 4I5GA 4DUGD 4OY3A 3I0ZA 3ZWIA 2XYHA 4IY1A 3E5HA 3BKWA 4UTOA 2ZUSA 5KQRA 1PL0A 3HUEA 4W82A 4BMSA 2Y68A 2HMTA 2X8WA 3U81A 3U16A 3GZNA 3GANA 3IJEB 1P29A 3AILA 3G0HA 1ZVQA 1O9GA 3FJYA 1MA0A 4FLFA 3TMYA 3GDGA 3OD5A 4AY2A 5EHGA 3VR3A 1M2OB 2AFRA 4HAZA 3QK7A 2XXAA 3INNA 4GMKA 5AKIA 4BNDB 4CS8C 4PM4A 4D0NA 3IEKA 4LX8A 3HN2A 1MNEA 4HTAA 3AOUA 4P53A 5KSPA 2WM9B 3ORSA 4RVCA 1ZN9A 1TO1E 4D3XA 3WL5A 4EF6A 3F5SA 4BO1A 3PCTA 3HBJA 4I50B 5BXQC 4Z4EA 3O75A 3V7OA 5D6OA 3SD7A 3S28A 3HCDA 4RHYA 3HO8A 3D64A 3LQ2A 3FMPB 2DRIA 2WTNA 3QPDA 2R8OA 1JDPA 3FLMA 2OTCA 1K92A 3MRXA 1YTUA 1EUYA 4O2BB 3I9NA 1J22A 4OXNA 4NR0A 1D0ZA 1XK7A 8GPBA 1RRKA 3UT5B 5ENZA 1OCEA 1PK9A 3BRWD 1TEXA 4LWQA 3HB5X 3T7DA 3U3BA 4ND8A 3K6RA 2RHHA 1QDUA 2C88A 5FLXA 4DBZA 1M74A 3I58A 2ECKA 4YN0B 1LBTA 2J9VA 3QITA 3EGDB 1F20A 5I7EA 3DE6X 4Q3DA 4TT3A 3EXHA 5DK4A 2QRJA 2QSJA 2BL4A 1BA2A 4G41A 2ZI3A 4E11A 2EBUA 4HC4A 4URVR 4HH3C 1H5QA 3C5VA 3D5QA 1GA6A 621PA 2RHMA 1YR9A 1IVYA 1ONPA 5LBIA 3TOXA 1DO0A 3T3MB 1HWYA 3AHEA 3KFVA 3HEMA 5I7VA 3IDFA 2PG3A 2V58A 2JAOA 3IB6A 4P86A 1N2GA 4L15A 1S9DA 1R8YA 2XD9A 3PU6A 2FWRA 1UFOA 3EARA 1L5KA 1RC0A 1J8FA 1AUPA 3RYCB 4C0BA 4PWYA 2ZRCA 1S5PA 3CW8X 4WKBA 1NBME 5D7BA 5IAKA 2XL4A 5TB5A 1P60A 4B83A 2EZ8A 3EXIA 3SKYA 5EWJA 3H1AA 3L6DA 1Z8HA 2MT9A 2JFHA 4W5OA 2YEVA 1L7EA 1R0LA 1RYZA 1H1LA 3U4DA 3X1WA 1NOJA 1VLHA 1XTBA 2Z2IA 2BL2A 2FW1A 5IJAA 1U6JA 4GUDA 3C3AA 2PX5A 2R7SA 1E2MA 3R23A 3I1YA 2CKDA 1UEJA 4Q3KA 4PTZA 2I8BA 4MQFB 4KAXA 2I8CA 5CD1A 5IK2D 3LIPA 4LK3A 3KO8A 4CUKA 1E6WA 4L0QA 2D2EA 4Z0HO 2R02A 2JGDB 1MJGM 2YWHA 2DBZA 2QTFA 1XZBA 4JN6B 4MKFA 2HA0A 2OCDA 1E18A 1Q21A 4XX0A 4OH7A 5BOSA 5IXYA 4DVYP 3WWDA 1IE3A 1V7ZA 3STTA 3GRKA 1XZIA 2JJ8A 2R1VA 1JECA 4P4NA 2GD1O 3PWKA 1LW7A 2HJGA 4JCHA 3HKBB 2GDZA 2ODQA 1FQWA 3LC0A 1MGPA 5DP2A 1XKLA 3PD7A 3BBLA 1DOHA 4WZBA 2Y3HA 2EF1A 1B6RA 2ZQYA 3IMKA 4ASUD 3C39A 4DXDA 4PLVA 4D57A 1PNRA 3IKVA 1HV8A 5AI4A 2IYYA 3PEVA 3WSWA 2YW9A 4R40A 4DJAA 5K03A 2JFYA 3U3FA 3KOYA 1NLFA 1N6LA 4RTSA 1R5NA 4W1PA 2G83A 2ZVQX 1E9BA 1QYVA 1W35A 5AJHA 4OFBA 3OMLA 1OAOC 5EE5B 1OB5A 2ZYWX 5IKOA 3W8IA 2J0SA 1CS0B 1GGNA 1NRXA 3G0CA 2XCSB 4DR6B 1ISMA 1XYVA 4IIJB 4LFCB 3PFIA 4JR2A 3A6HA 5BW5A 4YYZA 5A4FS 1EJ0A 1DKPA 5D5HA 1QAQA 4BO3A 4E5DA 2NTYC 4L02A 1ENPA 3PQ8A 4NG4A 3JSXA 3GLGE 1DWOA 3I53A 4J2TA 3KPYA 3BIXA 2DG2A 2DPYA 2CYAA 2OM2A 3N2KA 3RC3A 3D7NA 3W2VA 1NZJA 4LTNA 3ZBQA 2QR5A 2VJKA 4ZCQA 4KXNA 3ZCPA 3K2QA 4Y2RA 4D3DA 4HX2A 2ZS7A 2XEDA 2BH9A 1BC5A 1K5DA 4YJGA 1KSHA 2JBWA 5I4IA 1F0NA 3EIWA 3M6FA 1ACJA 1K86A 4F4IA 5B4VA 3CVVA 4J9VA 1XDWA 1OAAA 2ZRBA 3JWHA 4ZDKA 4OLAA 2P0AA 4B0OA 2C03A 5DPMA 4S0ZA 5D8DA 1BG6A 3P8ZA 3RRBA 1UDBA 3IX7A 1EK6A 1J1UA 2DI3A 1WPQA 2RH4A 4K03A 4S1VA 1F8GA 3T94A 1P6XA 4G09A 4X63A 3NZEA 3RHSA 2PLNA 1OQAA 3AM3A 4I55A 4RGQA 1JWLA 1P39A 4WK2B 1TYEB 1EWYA 2C7RA 5D3MB 5COAA 2YV5A 3EIOA 3PP8A 4Q1BA 3N2ZB 2EDAA 2NYAA 3CO0S 4TWJA 4E4YA 4X1KB 2ZBGA 1KSGA 1IBKB 4NCXA 4PSCA 1VL1A 2DH6A 5CXUA 1KS9A 2I3DA 3OG9A 5COQA 4M2LA 3BWYA 3SK0A 2H92A 2YQYA 2DKFA 5LQNA 2G5CA 1HQYE 3EEIA 3K0CC 3T1OA 2QD3A 2HFJA 4V0KA 3DNPA 3CKKA 2PGAA 4Z53A 3KUKA 1ST2A 3BFJA 3U7QB 3VHXA 1NPYA 2WNIA 4PQRA 1X19A 1WXIA 2JH9A 1C29B 4OQXA 2WTMA 4MNDA 3AHFA 2FB9A 2FFAA 1L2TA 4B75A 1GYQA 3GOHA 4DRJB 4I08A 2UVQA 4F85A 1IWBB 3LGXA 1WDWB 4IWNA 5DNAA 3B3GA 4AVYA 3DZGA 2PMCA 3WSVA 1CY1A 1SXJD 1DT3A 2WSIA 3T0IA 3AQCA 1E3DA 2OQIA 1R0CA 2GYVA 3F4KA 2J0QA 4K86A 2FR0A 5EZSA 1NW4A 4LEIA 1XCMA 4Z4FA 1T1RA 2QL7A 1P2BA 4HNAB 2QAIA 1ZNWA 5IVKA 2IHZA 1AGRA 1YGYA 5LZ5A 3LKZA 4DUZB 1QANA 2J3IA 5DI9A 2FP4A 3Q2KA 1FYWA 2EJBA 2GPYA 1OLSA 5FUMA 3OQJA 2RGAA 2D4UA 1N5MA 4V38A 2E1RA 2P7VA 4G2NA 2PJZA 1OILA 2BGIA 4Q3OA 1ADGA 3WB0A 3ZU6A 1IOWA 2Z2JA 3H2HA 1GWNA 1XMQB 4GFDA 1KVQA 2QD5A 2CHFA 2ZT8A 4N54A 3R41A 1RAAA 4JLNA 1Z4QA 4H7EA 4JTAB 1DIOB 1B1AA 3VC2A 2WSMA 1U8AA 2FEOA 4JB0A 4QOIA 4ZVSA 3FYDA 4C4SA 5L3VA 2NTVA 4M9ZA 1DGQA 3H8WA 5JIBA 3PWTA 4DLKA 4Z1OA 1EFDN 1NVKA 3FHCB 2ZQZA 3LX8A 3TW8B 4W5JA 5H02A 5BV2P 1O6GA 4QXMA 2C2WA 2Z83A 1BH6A 3FHJA 1AZWA 4DZTA 1QVRA 2AOWA 5A05A 1N5LA 1E9AA 2PVSA 4TS1A 4K1OA 4Z1MA 4X3PA 4XKJA 2RB5A 4OYHA 5TX7A 5K0FA 4G5YA 1YB4A 2PT5A 3HEAA 4C3BA 3M79A 1MQSA 4PJNA 4KFRA 2RIPA 4LWOA 4IOJA 3SYKA 1W73A 3TULA 4M89A 1U1CA 2WJJA 1DT5A 1J0EA 2Q6VA 2CL0X 1GQFA 1LNSA 4CJOA 2DUJA 1I36A 2BISA 3PNQA 1BVRA 3PUYA 3PITA 4M6WA 1NVEA 4UVEA 1JYSA 2JHPA 5CDYA 1GTVA 1VJ5A 3NHYA 4JROA 2HXSA 1O96B 3RJZA 3GVPA 4GYKA 4QYWA 4B40A 1FUIA 3D2BA 3BWCA 5REQB 5CU7A 1E7RA 5F2OA 4ABYA 3QVOA 2A2ZA 4YL1A 4AKEA 2X3YA 1CPYA 1L7OA 3KQYA 3W79A 1RQ7A 1GFWA 2HLDD 4DMMA 1TKCA 5EHNA 5JVDB 1VB3A 4L78A 1H93A 4MRSA 3GM3A 2EPKX 5DT9A 3OQMA 3C62A 4OTZA 1DVRA 3OTGA 3FWNA 2AUNA 4OA5A 1HG1A 1OB2A 4Y9UA 4DQKA 1J70A 1O4WA 5YASA 3ZOKA 4DJTA 2Z5VA 4FOTA 5KYUA 4PLWA 5ALIA 4RNCA 2O9XA 2VK4A 4PGGA 3OPQA 3BCSA 4LCEA 2BHLA 4G63A 3VUEA 5MFZA 1ZJWA 3UJBA 3BIJA 4S04A 4KITB 4RPCA 1NIPA 1GAJA 1O1YA 4L9WA 4DV6B 2UYGA 5JASA 4J3JA 2XOKA 2G3VA 4C1BA 1Z83A 1RM4A 3FCCA 1P2UA 3I1FA 1PT7A 4G0XA 2VDOB 3H2BA 1V1JA 3GY0A 1C8BA 4YAUA 1JEEA 2GILA 4R9NA 3QJ5A 3U0VA 4NMXB 2CUZA 4AUEA 3H6GA 3Q88A 2IDZA 5ALZA 3W5SA 5F7OA 4RFVA 4I14A 1KP9A 1R6TA 2ISSD 3C7TA 3CH6A 3CX6A 2EW1A 2PXHA 1RVDA 2VATA 3T06B 3NTLA 1ZU4A 4H7JA 1OGJA 3DZFA 4KC0A 3F5FA 3M1AA 4RTNA 4GZ6A 1VL0A 1JHXA 2CNWD 4OJYA 1T6BY 4ZT4A 3MVEA 4CUZA 1Y5NA 2ECFA 2CF5A 2RGEA 3FWYA 3KLOA 4EHDA 5CPBA 2PZEA 5L0CA 3VR2A 3ZTWA 4U7PB 1TWCA 1KTMA 1QVZA 5K4HA 1V7CA 4WY5A 3SCZA 1FMLA 3L07A 2WWTA 3ZDLA 1M6EX 2R4TA 4XDYA 1IG0A 4HGQA 2C2ZA 1I1OA 4FDUA 1KK2A 1E2FA 4DYVA 5K3BA 2XHZA 3GMSA 4EY7A 2FFQA 2DYKA 1HFWA 2PUJA 1XX6A 5AOVA 2YJ4A 2AJCA 5AW4A 1DKUA 5I48A 5LCXA 2EOAA 3A7EA 3ZJUA 1PJTA 4CKYA 2DKNA 3D3KA 4YHHB 4Z9IA 3OP1A 1T5SA 1LSUA 1T8TA 4UBLA 3QVJA 1Z5WA 3T4EA 4TQ9A 2QM0A 3KD2A 3GUCA 1L4YA 1R0YA 5E6RA 1J6UA 3RIHA 5EIEA 5LOVB 3EIFA 2IU3A 1FTSA 5H9VA 5DLEA 2VNSA 3B82A 4KBGA 3A3KA 1V3VA 2A9KA 3RSHA 4K9RA 1RMVA 2FX2A 4YQFA 2PDAA 2OAP1 1BE8A 4AN1A 3LX4A 3KOMA 1FYEA 1DX6A 1EGVB 3LHFA 4PYKA 3WL7A 3OM0A 1WW8A 1C1XB 4GL2A 1K6IA 4N7BA 1BWSA 1MG0A 2FFHA 4EECA 3KYDA 2YJ6A 1SUPA 1Z9BA 5JAOA 4RGBA 3QUBA 2NU9B 1DQYA 2GO7A 2AMFA 1Q1GA 2D1SA 2Q50A 3V1NA 3RAGA 1OXKA 4S2UA 3FZQA 1MC4A 4IIUA 4K9QA 2AFIE 2PX6A 3T6KA 2GZ1A 3AERB 4XJTA 2GXQA 2AG8A 3M6MD 4L8FA 4BFSA 1CJTC 1MF7A 5FIUA 2Z04A 4R51A 3RSQA 3L8JA 4YECA 4I9FA 1XQVA 4WBNF 3WKDA 4F1KA 2IBFA 5DV9A 1Z5ZA 3KXLA 1KMCA 3T5MA 1VRWA 2HJ3A 3DNMA 1QX3A 3RQEA 3OO0A 1P77A 2OKCA 4JZAA 2PMKA 2XCQA 3O8OA 4E14A 1CZKA 2DYRC 2W11A 2JARA 3SHTA 4S2EA 3VDMA 3R5KA 5BUOA 4C4YA 1TM1E 2BIFA 2R9VA 4RJKA 3KK0A 3US6A 2ZAIA 3HYRA 1K5PA 1LA2A 4R81A 4O3MA 2FWBA 5FJIA 1SHUX 4LXQA 3H5VA 2VNAA 3ENZA 4LVCA 4JEHA 3T95A 4WMLA 3S8YA 1NW5A 4YRJA 5HKKA 3U44B 4RA6B 1MB2A 1N7JA 3O95A 3M70A 4BGDA 4H0CA 1AN0A 4M1TA 4XIYA 2QJFA 3QYAA 1YI0A 4QDOA 1Q1AA 3Q15C 1U8TA 2AD1A 3UUFA 3W8HA 2QUHA 2Z43A 3DW1X 3EGIA 3C48A 1KZ7B 2CB9A 2ZB8A 1GLNA 2NLOA 1EH5A 2ZIFA 3ABIA 1MAWA 4QVGA 1C8VB 3OCJA 1OREA 5JZBA 2WJZB 4TLLB 1XFDA 6NULA 1YO6A 1Z0IA 4IL5A 1IUKA 2PUWA 5FWDA 5IJXA 4DY6A 4TWBA 1CD5A 3AGPA 4INAA 3V1YA 1OC4A 3WHPA 3LQKA 3G5AA 2J32A 1VE3A 5KSZA 2R8EA 4X85A 2P4UA 1XCLA 3H4TA 4UHJA 1TMYA 1H2RS 2FE4A 1RBYA 4YRQA 4ITVA 1V5GA 2WFLB 4DADA 1LRJA 4EGQA 3KU4A 5CA1F 1KYIA 5EC8A 3ZEAA 1UBLS 5KU7A 3BT7A 5KTTA 3R9WA 5EJ9A 1UODA 4EMUA 1RZRA 1LS4A 2F1HA 2V5VA 2VNHA 4LW8A 2FFRA 2G9VA 2IYOA 2NTJA 1J5XA 4MCAA 1JEDA 2HSWA 4PRZA 1YZGA 3JQ7A 2XTJA 1LLDA 5CFQA 5J47A 2ZTVA 5CRIA 3M0EA 1V71A 2QE7D 2J3KA 4PEVA 3TIIA 1Z88A 2RGBA 5J3JA 2AWNA 2IZOA 3SIPA 4KIGA 2IUTA 4RVUA 3P9QA 9LDTA 1O94A 4GVPA 3N70A 3BE5A 2C58A 4DDVA 3O8RA 1J5EB 1JLRA 4XD7D 2Y0PA 3C8MA 3LX5A 1NKVA 4F5WA 1YMUA 2CV1A 5JFTA 2O05A 2W2QA 1RAGA 1Z12A 5B1AC 3E7PA 3D6FA 5GOZA 2Y1XA 2PQ6A 3NGMA 2FWIA 3CLRC 3IHUA 1XWWA 1A9SA 3ANYB 3L7LA 4YX9A 1DFGA 3ITDA 3RYHB 5IABA 1MW8X 1K9SA 2RB4A 1GQQA 1GXSA 1G0OA 2XE4A 1A98A 2F1KA 4O4JF 1L4NA 1I24A 1YQDA 4UNNA 5C53B 1SZIA 3WBFA 1Z0JA 4K6HA 2C0PA 3T0GA 4LYJA 3G8DA 2HT1A 4LC9A 4IB4A 3ULKA 3C5CA 1H1TA 5E1OA 4KWCA 4X24A 2A9RA 1L6RA 4MJ7A 3UXYA 3TSYA 4CYMA 4H3SA 1ECGA 2XLBA 3ZJVA 4UXJA 2H00A 4MUMA 3V8EA 1TJ3A 5CLQA 5HTOA 4LJ8A 1Q74A 4YV7A 5E0OA 3TQTA 3TXYA 2NUTA 1M0WA 1PWXA 1X7XA 1GZHB 4QECA 3FLBA 3C8GB 2CHVA 5GIPE 3BJIC 1XAHA 4QNMA 3VKUA 5J1TB 2HA7A 3AY0A 2IEGA 2Q5CA 2BC5A 5HJEA 1QP8A 1ONBA 1YAJA 1WDMA 3UMKA 4GMXA 2IYRA 5AMXA 1HYEA 3KOUA 4QT0A 3WP0A 3DPSA 3D3JA 3ICEA 2YHIB 2HDOA 2C57A 3VVMA 2COEA 3AVXA 4DV1B 3I2IA 5GVSA 4OG2A 2QL5A 3LECA 4F3TA 2AHRA 4L5JA 4D97A 4HPJB 4R5HA 3PK0A 5CB4B 5HK9A 1CUEA 3N39C 2OECA 3E82A 4US1R 1E9EA 3WY9A 4EA7A 5AKHA 1PFVA 1E2EA 3CX8A 1YS6A 4XTCS 1J90A 1XVUA 3ZKWA 3K4PA 3NBQA 3X2FA 1Z68A 4ML3A 3OPXA 5CA0A 1H4TA 4Q4JB 3UUWA 5AFSA 1H4QA 4E5SA 1H69A 3RSOA 4ZICA 4CLEA 4TMXA 1HE9A 2J0UB 3PMRA 3NIWA 4BJ3A 3OIDA 3RKUA 1FUKA 2CYCA 5B6PA 3CRW1 2OMKA 4HAYA 4CKCB 2HV6A 2O7NA 1XKXA 1NGSA 4Q15A 5A0VA 5DRTA 4ZMSA 1NNLA 1UKAA 2V6GA 4M1SA 3ID6C 4XXHA 4ZOBA 2Z3VA 1QO0D 3IP9A 4BNJA 1FE8A 2IU6A 3P20A 3B9QA 4GOMD 2YL7A 3DOUA 5L0DA 2W2PA 3AEYA 1OTYA 4YRLA 3IDOA 4PR0A 1P1HA 5KQLA 1RJDA 4CTKA 1RQRA 1J33A 3QXCA 1SC9A 5JXHA 4HQ6A 4DLYA 4ER9A 3HJFA 2V45A 3ZE9A 4TVOA 5AM2A 3NMUF 4BO9A 4WOBA 4KUGA 2WG2A 2ZUWA 3HI4A 4LHYA 2RBEA 3KXPA 4Q4LA 8AT1A 1QP4A 3AZOA 2JD3A 4R2MA 2PZ8A 2P30A 4X9XA 2KX7A 4KQKA 5DISB 4MKIA 3EDQA 3L6CA 1CPRA 4KI7A 2CCYA 1NPTO 3WRVA 4H1VA 1QJCA 2ZG6A 1N1MA 5IW8A 2VDKB 1NXXA 3JX9A 3W05A 3SYLA 3BQMB 4GO1A 3E0XA 3GAAA 3QPCA 4JD5A 4ATNA 1EEXB 5D92A 3MTBA 3UNXA 1UOQA 8LDHA 3E70C 4R69A 1DADA 2RSLA 3T5PA 3PNSA 3QMMA 5EJEA 2CK3D 3EASA 1G20A 2YIMA 3Q3JB 3WLAA 3O8BA 1B8OA 1QS0B 2O0JA 2QNRA 3P94A 3SY8A 5JS6A 1D1AA 1FY2A 4XPIB 3NOVA 5ELMA 2BJWA 2ATEA 3X1YA 5AC5A 2O52A 2CDBA 4LLEA 2RH8A 3DSRA 4H35A 4YUYA 1UAGA 1T0JB 4RF3A 1T2AA 4ZQCB 2IDMA 4I1YA 1VLZA 1RPJA 1Z7GA 4I99A 4DLZA 4I4NA 3EAGA 3FTQA 2CEKA 4MINA 3HSSA 1DQPA 2D7JA 2FSUA 4FYJA 4QDTA 3MJRA 1H2WA 1H8EA 1MW9X 3H13A 3MMZA 2I54A 1SZJG 4JP2A 3N0XA 4CG2A 2FUNB 2MSWA 3ZX5A 3SOZA 1UIRA 2PUGA 4BV9A 3RHFA 3AUYA 2QQ0A 1ZITA 2FHSA 4WVFA 1NE2A 1ZL2A 4EZBA 1U28C 1XTVA 3ZWVA 1LDBA 2R9RB 2EGGA 2HF9A 3KKMA 5IMBA 4AZ0A 3FUCA 3IGFA 1XZFA 3ZCXA 2VTBA 3W5BA 2DJIA 1CGME 1RXEA 4L73A 2NTEA 5L3QA 4AQDA 1AO3A 3H8SA 1XTTA 3V5ZA 1HSZA 3PGKA 3KYJA 3A37A 5F23A 1C02A 1PZMA 1GKYA 1Q0HA 1D1CA 4OXIA 5KVCA 3L8MA 3P2OA 4WOKA 1GFIA 4MV9A 4YRNA 1BHQ1 4QDKA 3O8CA 4GXQA 5JRDS 4UDXX 1W4ZA 2WTEA 3TKLA 4GVLA 3V2IA 4JS0A 3QLTA 2J4CA 1S2LA 2FZCA 1N8KA 2DUMA 4R7GA 1FQOA 4JOBA 3MJSA 3ER6A 1N0VC 1WL8A 2YRXA 4E17A 2AJ8A 1O58A 1J42A 8ADHA 4YXFA 4JI3B 3A58B 2I2CA 3BCUA 3JQQA 1SD5A 1FS5A 4XSGA 4BFCA 3VR6A 1ESEA 4WPGA 4JK3A 3EFBA 4Q4ZF 1ECCA 3O9MA 3C2QA 4GXNA 4A92A 2ZWOA 1A4RA 1NOIA 4GI1A 3ZY3A 3I2YX 2VDJA 4W7SA 2IYUA 4CQMB 3QX7A 2XT9A 3GLHB 5B3LA 4WGYA 1U0RA 1X94A 4CI9A 2NO9A 1PWEA 1Q0UA 2I2DA 4DBLC 1WMBA 3QOWA 3TW0A 4R54A 2E4AA 1QPBA 3I8OA 1H94A 2P78A 4DG5A 1PF7E 1Y4ZA 4M1EA 3V48A 1LLFA 4LA4A 3I6IA 1E2JA 1GNQA 2VP6A 4MVJP 1RAIA 2VP9A 1PV2A 3AF1A 4R2WA 1TCBA 1YULA 1AGNA 3CUSA 256BA 1JU3A 5A9SB 1O77A 3O6XA 1KMHA 4JVLA 4DR7B 1GSIA 1GT6A 3ZCSA 2W4IA 3LDFA 4DB2A 1QHHA 4JJZA 2HSDA 3M6VA 4J30B 2A78A 2JFNA 3PX3A 3PJEA 1Y5LA 4G1BA 1YZHA 4NCKA 5HGJA 5E95A 2BY4A 2DHDA 1G8FA 3A4MA 2YQ4A 3OZAA 1I3KA 1TIKA 4D9MA 2QTVA 4K1LA 4A73A 5ICSA 5T67A 1E8DA 2ADMA 4C7JA 1OI7A 5HF8A 4KR0A 4X97A 3OLYA 4IBOA 1UKVY 4L4RA 4UJ5A 4M7OA 2F3PA 3OEHA 4B09A 1ZJYA 2ZBRA 3WRXA 4W6ZA 4IGFA 4R8LA 3NLLA 2GCOA 5C35A 3KE9A 3PT5A 4JJ8A 5HILA 2J07A 2YWRA 5FV4A 2HA4A 1WY5A 2H2AA 3KNZA 4YMIA 3AXTA 5CHYA 2ZJOA 4Z8YA 4X62B 2ZJFA 3TYXA 1WBDA 1RXSA 2RFLA 2ZKLA 1JPUA 3RBXA 1OZAA 4RENA 5ESDA 3DT6A 2E6KA 3SF8A 3OVMA 3DHVA 4LK2A 1BWQA 4D9CA 2J7PA 4NOKA 3EHMA 2Q5HA 3FSGA 4J1SA 6CHYA 4MGEA 4BFXA 2BEUB 2RGGA 4C9BA 1JDBB 5CITA 4WCDA 3CBQA 1VI5A 1E4EA 1OLOA 3FVYA 4N47A 2NYRA 5C4IA 1UUFA 2C7BA 1G7SA 2XLEA 1JEAA 1V25A 1QGZA 4GYWA 3A9WA 4CIWA 5EUCA 3U4IA 3WOVA 1QC5B 4OQYA 3LCUA 4NBRA 3ZHOA 1RZVA 1QE0A 3L8GA 5AW8A 1YK0A 3B1YA 2B8WA 3TIFA 3WKEA 3D8NA 3C6MA 4ZYLA 1UMCB 3KEQA 3C3YA 4U9IS 1Q7CA 2DPXA 2IHYA 2IQIA 5CFLA 3OCWA 2VJBA 2XPCA 3LTNC 1LLCA 1YZNA 2V5UA 1D0XA 2XKJE 5CDSA 5DYYA 5IT4A 4WEOA 2QM8A 3QEKA 3QV2A 4MVWA 3FSJX 3UM9A 4MO9A 2H85A 1TQ2A 1J8MF 2G0TA 1FJGB 4O4IF 3AP3A 3DBRA 1VYKA 3DUWA 2ZR8A 1UFQA 4UOEA 1GQ2A 2P4QA 3NDIA 1BROA 4R2XA 3H87A 4GQBA 2EAUA 4JU8A 4MR8A 3W06A 3I4LA 3U5ZB 3TQFA 4KHZA 5E8RA 4EUSA 3UGTA 1AZSC 1DEHA 3ZY4A 5KHLB 5CDHA 3NUZA 5C81A 1A2QA 5EGNA 1KH2A 1SB8A 3KPWA 3K9QO 5AVVA 3NR2A 1J2UA 2QAGA 3ZJ4A 1D8TA 4FMCF 5LD2B 2ZRFA 3INRA 3KJHA 1T34A 5DRYA 4ZJYA 4U3JB 2C99A 1TMOA 2GWHA 2X1VA 5A6SA 5BWCA 1Z0KA 3GFFA 3H2YA 5GONB 2YJ5A 3DT8A 1FMFA 4B6FA 3BXPA 3QNMA 2AF4C 2YS6A 3KZOA 1LBQA 4HGZA 2CWWA 4DBQA 3B6EA 3BF8A 4IYRA 2CFOA 3VA7A 1XQ9A 3ZIAA 2YZNA 1SXPA 3HKDA 3QEJA 2YN2A 4QDZA 5ALJA 3T5BA 5HCIA 5IKEA 3GXBA 4B4VA 1WCIB 2NSLA 5BQ5A 3JALB 4QU5A 3M4XA 1VMKA 3UGQA 2DLCX 2FEAA 4B81A 5HM8A 2XZOA 2MSEB 5DHUA 2PFDA 3ZGVA 3NM5A 3VR1A 1CZLA 3RBZA 1SVNA 3DF7A 3EVAA 3BSWA 5C5DA 3CT6A 3H17A 3RRXA 5BVHB 2EBWA 4IEEA 3O4HA 3CPSA 3TL6A 1YVPA 2RSEB 4MLDA 1T8UA 3S27A 2FX3A 3CAXA 4IRXA 4OIPF 4LDJA 4DL9A 3I6MA 5A4AA 2C1ZA 4L16A 1ZJZA 1WX1A 4OLJA 1REQA 2XUKA 4YLYA 2B8NA 1X15A 1W7AA 1FFTC 3RKOF 2D2VA 1Z0SA 3GJ3A 1J1ZA 1EUCA 3D7KA 1WB6A 1H3EA 3CIFA 4DOMA 1HE3A 2VP3A 2WLTA 1RKXA 3SZLA 5IX8A 3OFKA 4GW3A 1LBIA 5DTRA 2AU5A 4OQZA 3GYBA 2Y1DA 1Q14A 2RHWA 3ZHCA 4NV0A 5IFKA 4DCOA 1A9RA 1NE7A 1YQEA 3FJOA 4ND2A 1K8YB 2I99A 3LUBA 4BLPA 1ISSA 1K0UA 3ZBUA 2GUGA 1YQTA 2Q3MA 1DS6A 3TSOA 5AW0A 3T9EA 4L0CA 2Z58A 5KWEA 1HL3A 3DC7A 4R9RA 2CVZA 3BCRA 3X43A 4DGSA 4U5BE 3DOEA 1NUTA 4M0FA 4CL8A 2BGRA 1IHDA 4CMKA 1R1DA 2DLNA 1T4CA 4C7VA 3G2QA 5L9AA 1Q5PA 1MD9A 2C7VA 4RD6A 2Q3DA 1NP3A 3ACBA 1IZ7A 2GZDA 3BL5A 4M9CA 1TUBB 5KVAA 3L04A 4UU0A 3HLZA 3W8NA 5HQ3A 2QTWB 1U3DA 2OC4A 4AN4A 4D7AA 1EDBA 1KH3A 5J23A 1WXXA 4RVSA 1H5NA 4WNCA 3EG9B 1H05A 2EWVA 4GI7A 2WYIA 3GLFB 4Z9HA 1J0DA 2X7JA 3FTPA 1QF6A 1B76A 3JYOA 1UPAA 4AMBA 2R47A 5J4KA 1Z62A 4B48A 2W6NA 2GD2A 1XIVA 4G4SO 5BWOA 4RDXA 4PCAA 4AWAA 4QA9A 2WKSA 4AO8A 4KUEA 4JYCA 2HA3A 1G55A 1ZJ5A 1X80B 1TC2A 1CC1S 3BMOA 1S7CA 1ZN8A 1SQ6A 1P2TA 2IGBA 3L8DA 1F12A 3SZUA 1KXJA 2KW5A 1CIPA 4LDPA 4ZXFA 3AJ8A 5HCNA 3Q7EA 1NSTA 3BIFA 3QFFA 1A0BA 4ENWA 4ZAWA 4II2A 5SY4A 4BP1A 4RE6A 1WG8A 3WQRA 4NXNB 4P34A 3BF7A 2CMFA 4H4DA 4FDAA 2HV7A 4CS9C 3I83A 1PYGA 3HDQA 3M6UA 2W6ID 1XQ6A 1EX1A 4PS1A 3I12A 1HMPA 2HO5A 4TRMA 5KYGA 2MYSA 3ZZMA 2WKRA 4POOA 3U3XA 4TXMA 3FMGA 4FYWA 2IPAB 3SYTA 4XQ1A 3THWA 4WLUA 3L7JA 5CBPB 2C2KA 1VIMA 2R6FA 2GZ2A 5IXSA 4EX7A 4YK7A 3DEHA 5JH7A 3UJNA 3C6QA 4ZCSA 3BM5A 4ZDJA 3A4YA 1HKHA 1KNQA 1GUDA 1R8XA 4TLMB 4MUIA 3MD9A 3S6JA 2ZYSA 3T9BA 1T13A 1Z0AA 4L6AA 4LUCA 3GEDA 5I9IA 5BWBA 2CXPA 1VIAA 1VJ0A 3K16A 5ANRB 3GLUA 4NIMA 1FU7A 1HRKA 1EK1A 1I3LA 1NASA 3R5SA 4EUKA 4C0SA 1SUAA 1MEEA 1VE6A 2FMFA 2WSBA 3RVNA 1ITZA 4PC1A 1N9GB 4D3FA 4BBJA 4GYYA 4X92A 3LT4A 4PE5B 3L4BC 3KE8A 1KIFA 4A82A 3UXEA 1YE8A 2HAEA 2P2ZA 3NWJA 2QZZA 5EXSA 3TK1A 2Y93A 3ZQ4A 4EQ6B 2HD4A 5KJEA 3H0EA 3WK5A 1RWVA 3H83A 1RRPA 5AM3A 3PXBA 2NP7A 1DCTA 4JNKA 4CKWB 3N8GA 3LWZA 1NWCA 2HSJA 3K73O 3FOBA 1OFTA 3ZGNA 5F51A 1V16A 3AY6A 4TSKA 5B1SA 3PTLA 3K70D 2QR3A 2LPMA 4LNUA 1R3UA 5JSQA 3STXA 4YR7A 1GPYA 5AQ1A 4I5IA 4XVUA 3T7RA 2JANA 3K0FA 3G0BA 5FL7D 3O1LA 4AF7A 3BRSA 1K98A 3EWAA 2GJAA 4AG6A 4KN6A 2H0RA 2B9EA 1EHYA 4FWIB 1U5BB 4AUKA 3K7DA 3IEVA 1F0YA 3NMJA 3I9MA 1QH0A 2WG1A 1FNNA 1R4ZA 3HY6A 1Q7GA 2OGSA 3DWIA 3D5TA 1GYPA 2Z5GA 5BR4A 4OXXA 4UDYX 3DMRA 1T6XA 3IVAA 1EIZA 1PQ4A 4KE6A 2KS6A 1C4KA 1IN5A 4IO1A 1VE5A 2JGMA 4RJ2A 1C9MA 4XWOA 1AQUA 3GT0A 5FPYA 1DBQA 4LSZA 5C8YF 4FOPA 1C5KA 3P2KA 1EZZA 3SQMA 3CVUA 1IJKA 3PGJA 1CUZA 4NPCA 1M1YA 2YL2A 3P9NA 4RMGA 3HB9A 4IQFA 2MSCB 4PCVA 4TKZA 5FRDA 4CMHA 4J0HA 1KFEB 4G4JA 4MQLA 4BNYA 3AVYA 1ZH6A 3B2EA 4NZPA 4A6XA 5CURA 3ANXA 4L3VA 4LYEA 1J00A 1KHHA 2XY4A 3F8WA 3A1FA 3IQ6A 2AW3A 1N7IA 1VLJA 1KC3A 4N49A 4BRWA 4RAOA 4FHEA 5E2IA 4WZAA 1EKXA 4ER0A 3GDFA 1I1HA 1VB5A 4P3XA 3Q40A 4JITA 4WHMA 2H1RA 3RFVA 1U2GC 3EVZA 4E07A 3RUFA 2JS7A 4RTKA 2II6A 1UXJA 2M98A 1C0LA 2W9XA 2GM5A 4EJFA 2QKYA 3CX7A 5JAPA 1THGA 4N3NA 2OZLA 1FYDA 4P5DA 1D1QA 5AVTA 3PC8A 5AW7A 4B73A 5DH9A 1A95A 2HU5A 5EVCA 4W9MC 4EI7A 1EWTA 5ITZB 2NVUA 2RONA 4XM1A 3JV7A 5ED0A 1H22A 1NLMA 2X7HA 4I1RA 4XWWA 1TA0A 2ALJA 4XB6B 1G16A 4CZ2A 2NZ2A 4QGSA 3G2MA 3UOAB 4JLOA 2CJXA 4P4TA 3TEJA 3H3FA 3L7AA 1TAGA 3LY9A 2R1TA 4MB2A 3CWZA 5FWYB 1OWPA 3FMFA 9ATCA 3JQ9A 3G02A 2VCEA 3TTYA 4WBXC 1VCNA 4JBNA 2V65A 2HSBA 4ARBA 2L6FA 1Y1KE 1L7AA 3MUOA 5ESRA 4QG3A 5BNIA 3QVKA 1OZFA 1XU9A 4NQRA 3SM9A 4KXYA 4OHRA 1AT1A 1UIMA 3A6ZA 4Y2XA 2J5BA 1AH2A 1RJGA 4XPZA 2WJIA 4UTNA 3VO1A 5L7YA 1HKUA 2Q7RA 1G2IA 4URHA 3KBBA 1L1FA 5IAAA 3DLAA 3TD6A 3AU8A 4QBGB 2X2FA 1WDKA 4U2CA 2BELA 1V4AA 4NY3A 1N2XA 2C4WA 4Z7JA 2BFEA 5TNXA 4D1YA 2GAIA 4P35A 5CCBA 3LPDA 4WK6A 4J1TA 1IHXA 1Z56C 2MR6A 3CT4A 5EHZA 5FX2A 2A68F 3C8DA 1M0EA 3JASA 4LNHA 1T5BA 1FVFA 3I5PA 5LZ2A 3F46A 3RUCA 3IP3A 1RM3A 3RQIA 4CDMA 3B60A 3CUVA 2W6CX 2M9MA 3HG7A 2GWWA 1RXVA 1EVQA 1TM2A 2F17A 3L5OA 4KOEC 1KFJB 1BWPA 5ED4A 4C43A 4ZPXA 1DX9A 4KR2A 3KH2A 3TXXA 4QBKA 2LV8A 1RP7A 1ZM4A 1VCOA 2HJWA 2Z95A 3KWMA 1AHNA 2ZSFA 2E4VA 3GDHA 4WZBE 3AXSA 4FW9A 2CNNA 3GGCA 3UCXA 5SZHB 4O4LA 1L7CA 1NT4A 3IP8A 3R3SA 2XUJA 2CXNA 1VKNA 5G02A 2VZEA 1F3LA 3FVRA 4L8WB 5HZMA 2A30A 3MBIA 3RUEA 3QOFA 3KALA 1A69A 3MYIA 3BMNB 3UF0A 1I51A 3THYA 2G1KA 3DJNB 4B0PA 5LDDC 2OB1A 3ILSA 1FSSA 3KKZA 2DAPA 1ZH8A 3QEBZ 4D4XA 3DGFC 1UPCA 4HSEA 4XWKA 2LKDA 3KVRA 3SIXA 3VRHA 1ZAKA 2Y9MB 3BC1A 1ZZEA 4D8VA 3MWEA 4AECA 2DBYA 1S4MA 4IH1A 4ZAGA 3U9LA 4TV8F 5CM9C 3LUDA 2XLWA 1II0A 4KWHA 4QTZA 2M6LA 4DG9A 4EJMA 3T9DA 3H9JA 3M83A 1BU8A 3B38A 3PEEA 1V1MA 2DJ5A 3BX1A 2P9CA 3CX4A 5KTOA 2GJ9A 3ZHQA 1ZHHA 2VNIA 1FTNA 4U2EA 4R6XA 4FDMA 4ZAXA 3H6KA 1RWBA 1XL0A 4E1BA 2X0JA 5K6AC 3SQDA 4KKXB 4XJVA 4ZANA 3CIOA 4MVXA 2BFDB 5FH9A 1NL3A 4RLFA 4ROSA 2QQEA 3NBFA 2QN8A 3D3WB 5ALMA 4CG1A 3Q7TA 2RHDA 1Y3HA 4UASA 4LZPA 1M7HA 3W9BA 4EHHA 3WLFA 1L0BA 4TZ0A 1U5CA 2J3MA 2P69A 4MQEA 1T8PA 4TUYB 4GYJA 4LVUA 4MGKR 2HC9A 1YZAA 3PQ4A 4F0JA 3OUZA 3AEKB 1KK0A 4UMVA 4EFNA 4R1UA 1E2GA 1S2GA 5F3WB 5EA2A 3KVNA 3IIEA 3HR7A 4NNPA 3QXHA 2VRWA 4DDTA 4IWBA 5IYZA 4B8ZA 1K7CA 5KYWB 4LSGA 4OXRA 3WO1A 4U63A 1YB6A 2CNOA 2P0EA 2JJ1A 3MCAA 4AL0A 3ZTMA 2WIFA 2J09A 1XO1A 2D4HA 1E0JA 3WMWA 2YY5A 5EMJA 2FEXA 1YR1A 2Q6KA 2RC6A 3UB4A 5FTKA 4Y9RA 2HWXA 2SCUA 1RIFA 1PEAA 1H1DA 3NHUA 1RI1A 1C30A 1YJCA 2QV7A 1GCGA 5LQAA 4ESOA 5LB2A 2JJQA 1P2VA 3ZCQA 1P2GA 1CRQA 5GY7A 4DOZA 1IG3A 2G72A 4Q93A 2HSEA 5ICMA 2C4KA 3KSBC 3S2GA 2CDCA 3GU3A 3QKRB 3MWLA 2XB9A 4MO2A 3FUWA 1MAHA 1CUCA 3AY7A 2YLIA 1R5OA 2O5RA 3Q10A 4F1WA 3KYBA 3K20A 4AWBA 2IUFA 3D6MA 4PYMA 3LY5A 2Y0DA 5SYAA 3D0QA 3KZMA 2V6MA 4ZJUA 5FEUA 1Z06A 3VTFA 4QI0A 3P52A 1WZEA 3F6SA 1CFJA 3V8PA 2IXGA 3IIMA 4ZYVA 3B1VA 5A3RA 5DNUA 5KCZA 3NVAA 1LBSA 1E3WB 2Z6VA 4LZAA 3B5IA 1N57A 2CJPA 1E3EA 2AUTA 5IF3A 2OEXA 3ZLTA 1EB9A 1R3DA 1Z7EA 3H2VA 3DPIA 2D1YA 1QQAA 5CBKA 2RE8A 1ZIDA 1Q1EA 1V95A 1R12A 3K0HA 5HS4A 4O79A 4F12A 3DBLB 1Z2EA 2M1ZA 3FB1A 1DAGA 1T36B 3NJRA 1PW5A 5IRCD 3G0IA 1V2HE 2L42A 3P5SA 4PG7A 1LDGA 1WP9A 2ACEA 2E4WA 1X7GA 3HYLA 2AXNA 3GG2A 3FUTA 4V03A 4F86A 4RACA 3D8UA 1KYWA 2OO3A 1P7VA 2GASA 3CM0A 4HQRA 3M4NA 4E7PA 1VE9A 4YYEA 4L6CA 2JI9A 4MDFA 4DARA 3WBKA 1GR0A 4NJOA 4UHDA 3UHPA 4MVMA 1Z6AA 3HC7A 5BSTA 2G9ZA 2QZ4A 5EKSA 2JIBA 3BZUA 1U0SY 2FR8A 4RXUA 1L4BA 4FHFA 3IURA 5C52B 1OXBA 4BYMA 5G3YA 2VCYA 3B0UX 5LQMA 1MJFA 4J3NA 3TZLA 1KDOA 3OZ7A 2V7BA 4A27A 4K9MA 4YPOA 3PXCX 4JJGA 1J25A 2W6OA 4G5GA 4Q66C 2KJQA 3ER8A 1IXZA 3A4LA 4XUCA 1NLZA 1GL6A 5MHTA 1PLLA 4BQQA 2HS5A 1WU8A 1JKIA 3VPAA 5IHPA 2HU7A 1EA7A 3OZWA 2AR9A 1PQPA 3CPJB 4PF1A 2B4TO 4PRLA 1RQXA 1FUUA 2FW9A 3RTGA 3KKLA 4PANA 1KPIA 4R5MA 2O3RA 5AKYA 2H3EA 2IZ6A 5FUQA 1YL6A 1LF0A 4CTMA 5PNTA 1MO6A 1VP9A 3FFWA 1L5OA 1V8DA 3JQFC 4KYUA 2C9MA 2VKQA 4RABA 4DV4B 4WTOA 5DWQA 2UUHA 3NKVA 5KU1A 2ZBFA 4BVGA 4N8DA 4K3UA 3AV3A 3C6BA 3K6KA 4RKQA 4OUKX 1VL2A 4Q82A 5ECDA 1Y9AA 1D2AA 5HRAA 3SAJA 3B8EA 2XLDA 1QZZA 3GCGA 4OJMX 3E9EA 5DEIA 5ELLA 3VJMA 4Q9IA 1C1HA 3JQ8B 3NAQA 4IRMA 4ALLA 2GOYA 1NVTA 1MMDA 4TQAA 2HA5A 4ZHQA 4P58A 2ATIA 5AHKA 5JT4A 5CH8A 3TOMA 1JR6A 4D45A 2LKCA 1WXWA 5FPSA 4PSVA 1VHLA 3IEEA 4YCDA 1TAQA 1ZYRF 3C45A 3VBCA 3LT2A 1IJFA 4LACB 2Q99A 3EF1A 3ZX4A 4FYMA 4LV6A 4PXSA 3U2QA 5EEHA 1KAQA 5B1HA 3W3AD 2ZTSA 3AFIA 1VSQA 2N9UA 3IQEA 3B6ZA 3DFUA 2IS6A 3BTSA 5ALEA 2J0EA 3FDQA 5DM2A 4CI0B 4KOAA 3KOZA 1GQAA 2I0FA 2Q3FA 4CL0A 4JUIA 4UUAA 3Q4GA 4RTLA 3O7WA 1QH1B 3RODA 5JE8A 5ESXA 1RCUA 3AL0C 4OK5A 3S2FA 2WP8J 5F52A 2QB5A 2VT7A 1FSGA 5AJWA 5B1YA 1U63A 1UFRA 4MAAA 4JRZA 3IOEA 3MA0A 2PRJA 1XPOA 3PNPA 3FPEA 2AC2A 5AK4A 1XWIA 4UM5A 3Q85A 3MUFA 3EWSA 1D1PA 3VV2A 4YRSA 3NOQA 1KJ8A 3ZK9A 3GLSA 1IK6A 1N6HA 1GTG1 1Y4UA 1NV8A 3U2LA 2CUTA 2BCEA 1IWPB 1DAEA 1Q0FA 2KQUA 4YUWA 1DPFA 4N18A 3R0IA 3GAMA 1XPJA 2FOXA 4MS4A 5JSYA 4HRVA 4WEQA 1Z17A 4IUCS 3H9CA 1ZR2A 4N6GA 5J4YA 3MWDA 1TVEA 3AKCA 3FCYA 4ZQBA 3EDOA 3W6PA 2FUEA 2YWJA 1KH1A 4V1CI 1YNSA 1L5LA 1GEEA 2J0XA 1RKCA 1Y7IA 1N1DA 1VP3A 1JA1A 3PICA 4U6NA 1BE1A 1K68A 4H59A 4B3IA 3QELA 4IOLA 3STVA 4BFTA 1AD2A 3UUGA 1NVBA 3K9HA 3G4XA 4A8JC 3G9ZA 3WYDA 5AKLA 3PHGA 1R0KA 2JIRA 3OOYA 3SSAA 3RU2A 2VDLB 4HGOA 4EEXA 1B74A 4L1KA 2WSYB 3KXDA 1EPUA 3WGHA 3KHUA 3DAOA 2VC9A 3NONA 4NZYA 4OL9A 3S0XA 3T4PA 3KQHA 4NULA 5UKDA 3DZAA 3ICQB 3RYIB 1JAXA 4N06A 2XODA 4DLLA 4G65A 4BMZA 1AHHA 1X87A 1OY1A 3CLSC 3E7FA 4RLQA 1Y63A 2ZR0A 5AKEA 3FHTA 3ZG6A 2ZE5A 2QE6A 2PGOA 1RRFA 4BKQA 3N8DA 3BWDD 5DCWA 2A1UA 1C14A 3B9PA 4GKAA 5JC8A 5E6SA 1R0WA 5C4GB 1P9NA 4B35A 1AK2A 4PSKA 2W2VA 3LHDA 2YH2A 3V6LA 3PFBA 2PBLA 4H31A 4DV2B 2DF8A 5B53A 2POCA 2ZRMA 1ZVZA 4LJ7A 3P4YA 4W5RA 4DB4A 1MIOA 2X3UA 2AXEA 4QUEA 2VSOA 4A8PA 4BX2A 4CN9A 3KJGA 1SBIA 4FGKA 1Q0DA 4U39A 3KAKA 4NZZA 3S1AB 2AZMA 2FPWA 3SJZA 2DFKB 1M2KA 2WTXA 4OI0A 1OC2A 2ODEA 3H4MA 4QFBA 1BWRA 3LPCA 1XZQA 1QZUA 1TE2A 4FGZA 4MWBA 3V4VB 3ZR4B 3UV3A 3KB6A 3JAKB 3E3NA 1QXSA 3PNMA 3KFLA 3RQFA 4AURA 3BHNA 3B71A 1KKLA 1F8UA 1SBYA 4FNAA 2HSZA 1US8A 2ZYDA 1C8KA 4C21A 1Z5OA 1XA0A 5HIKA 5AO9A 1NBBA 3D4OA 4TKMA 3BVPA 3BL8A 5T41A 4LE1A 1KEPA 2OCIA 4UBJA 5J2TF 1Y82A 4QRIA 1NG9A 3DDHA 3AL2A 4J0DA 1DHTA 1M54A 4AXBA 4LZWA 4REQB 2D13A 2KYHA 3PHBE 3HBFA 4V0SA 4RHCA 2QW0X 3ACCA 2VRBA 2J31A 3LHIA 2PXXA 4M9QA 2NQ2C 2QRZA 3MILA 5TARA 1PBNA 1I7QB 1HTTA 1XROA 4H1UA 2CFTA 1UJ6A 4BXOA 3AF4A 2ZDGA 5DGXA 3IAFA 2FPIA 1RLMA 3K33A 2EQBA 5IM4A 3MF4A 5IDYA 4IRUA 2BFAA 2FWJA 1BJTA 2J85A 3G0DA 1CZHA 4UHHA 5ILOA 3F7NA 3UG6A 4QPPA 2IYXA 1PTJA 3ZVRA 4OP2A 3EZYA 3PNVA 3WMXA 1AZTA 4AL4A 2IGTA 4NE7A 4QSMA 4EJSC 2QXUA 4BC1A 1COWD 1OLUB 4CM9D 3ZTYA 4L51A 3NRCA 3GF4A 3UK6A 4EB0A 4KQ2A 4ZT5A 2XIJA 1FLAA 3MT0A 5KKCA 2QRVA 1IWOA 2AOUB 2ZXEA 4G0VA 3WJ1A 2QZJA 3GLGB 2A9VA 1E5TA 3G2PA 4B2IA 1EFPA 1UBRS 1O0BA 3L4EA 5AVKA 4C6TA 4CIXA 2ZITA 4ZTUB 1FU8A 3A6PC 4YAOA 2HXGA 3WK6A 3VOTA 3UPTA 2EX4A 4HDSA 3STHA 2NSJA 3IPRA 2CD9A 3A32A 4GX2A 1P1BA 4JOSA 1NULA 2ZTMA 1OXUA 4G81A 4UBNA 5J5CA 1ZNZA 3PHJA 5ALHA 2ZPAA 3QNUA 4FCCA 3EEOA 1FDTA 3KJIA 4RM2A 3WXMA 3ELWA 1CW2B 4D0GA 4RX1A 1FP4B 4DMGA 2J08A 1C3VA 5FFMA 4LVNA 3RH3A 4TYWA 3OEYA 3U6KA 4QBHA 9GPBA 5ALDA 2VJDA 2QJRA 4QEDA 3ISVA 1SVKA 2HBYA 3LPMA 5DHQA 5G1OA 2DFLA 2UXBB 3VZQA 4XASA 2VJMA 3WIUA 5IP5A 5KPJA 5IG2A 5ARCA 1C9KA 2BMFA 5AI9A 3DLTA 1KU2A 3CNNA 1Z7BA 2B34A 2BRUC 5C3MA 5TSDA 1VGVA 2HWUA 4NEQA 1F3OA 421PA 3WDMA 5E3IA 2JLSA 3H8VA 4HDCA 2FEPA 4KDCA 3FNFA 1G8PA 1U94A 3AJAA 5AVQA 1N77A 1LTKA 4BKOA 1QIHA 2FPGB 4JC5A 3GT3A 5KQMA 2V55B 3O4VA 2F3QA 2ZWVA 4E7OA 3UKDA 1SC1A 3LP6A 4P6VF 1T4GA 4OFZA 3WQBA 4JQSA 4BIMA 3DDZX 2WZDA 2PUDA 4CDNA 3TB4A 4HVTA 3G5TA 4E18A 4IR7A 1AKVA 2E6UX 3RO7A 4DXAA 3K72B 2H17A 5HCUA 3HVHA 4FR2A 3QE4A 4EJ2A 4MWCA 4U0JA 4ZFNA 5A6BD 2MINB 4TXJA 5JSZA 4IKOA 1HNXB 4V2UA 2ASRA 1O0CA 2GETA 5LLSA 4KH1A 3VYSB 4NFHA 4DBRA 2R3SA 1DHRA 4JLWA 1WW3A 4FU0A 3PUHA 4OMCA 3GNLA 5A02A 3VAAA 4RJTA 2JZCA 1YB1A 3IDSA 3LHKA 4BVEA 3FLEA 5AR1A 5FOVA 3N7UA 3ZZ0A 3H0KA 1ZUNA 4BKMA 4Z9BA 4D3SA 1TK9A 4HS4A 4YASA 2YZGA 3G2HA 3BTUA 1CETA 1O95D 1CQJA 1GRNA 4WAUA 4Y6LA 2R7WA 4ADSG 4BLSA 3U31A 2WA1A 1YKSA 4WCFA 3PL1A 3VBEA 1PKEA 3FMOB 4FOOA 2GK6A 5D3ZA 5M29A 1Z74A 4Y1GA 1ZHZA 5LP6A 5LP1A 4ENSA 1OOEA 1XMIA 221PA 3LUJA 5ADWA 1KDYA 1G5HA 3PE3A 4PFOA 2AFVA 1IBLB 2EX0A 1YRAA 1VRVA 7REQA 4GM0A 4RVOA 3V5NA 1FDUA 3BMQA 4ALIA 3OJWA 1BYUA 3GLTA 4OP3A 1YARO 1XKTA 3U39A 5DS6A 1UMDB 2I67A 2IOYA 3CLRD 4TLAA 1WHSB 2GM9A 1FB5A 3VPXA 3LZCA 3DC2A 3NNNA 4I36A 5HW0A 2BTQA 4Q48A 5KDDA 3TLAA 2XGJA 3EHEA 1D4AA 3OA2A 4A0QA 1G20E 4KIWA 3KQKA 4I4TF 2VWHA 4BLOA 4RJJA 2A0YA 1SKQA 2WR8A 4J7TA 2FUG6 4A1OA 4RH3A 3ZLUA 2FCAA 3KAJA 4RH0A 3OUTA 1W85B 4DBVO 2YZSA 2K7ZA 2YWFA 1MRNA 1GPBA 4FGLA 2FY8A 1IOZA 1QF7A 1GIAA 4R1SA 3ETLA 5HMLA 3K3PA 3UAWA 1UKZA 2JDID 1VI2A 1Z4PX 1KRWA 4CM8B 3SBXA 3CVXA 3KJZA 4CQNA 2FQWA 4HXYA 2CWDA 4IUDS 5KYYA 3WADA 1NJ1A 3PUIA 1EVIA 2JFWA 2XS1A 2ZBPA 1TDJA 3IKJA 3KJNA 5HJ7A 3HVIA 1FZQA 2XUOA 3AR5A 2O23A 3A27A 2BSAA 4MS2A 2RGYA 4OBEA 4QHYA 1NWHA 1F0KA 5BYJA 2VUTA 1PHPA 4KO1S 1IY1A 4B82A 2GEUA 2AQHA 4GU5A 4DIBA 1NQUA 3QXSA 4CMIA 1KOJA 3GGPA 4GZMA 3FOWA 1CPQA 1EQ2A 3CB4A 1YVIA 5MF6A 2OO5C 1UP4A 2J33A 4TLBA 4AZSA 3O82A 1ADBA 4XGRA 1GAWA 1NXSA 1E79A 3A1TA 2OZEA 3PXAA 1SC6A 2AEEA 2YLGA 1EWRA 5TDHA 2WAOA 2Z6QA 5B6JA 2C9OA 3VPHA 3PXEA 1NAIA 2UZ1B 4UHFA 5BNZA 1WCXA 3UYKA 4FX5A 3GJQA 4NCJA 5LU8A 4YAKA 3I09A 2XUFA 1TT7A 3QVLA 2GBGA 3OAAA 3VNAA 1MMAA 4ZDIA 4YRRA 3JVVA 4NENB 4TTRA 1JBQA 2RG1A 4BCBA 1P91A 3I42A 3UW1A 4H4EA 3CQ9A 3QVSA 3HJHA 1AKRA 1A7AA 2FTKE 4MQ9F 1QIIA 1UG7A 1OW3B 2RKBA 2O1XA 2M64A 4OH1A 4CIAA 1H9BA 1GPAA 1UQTA 3PEFA 5DM0A 3V7YA 2KPOA 2PHZA 2F8TA 2XRYA 4DRHB 2COUA 1BS2A 3B9RA 1JNYA 2Z2ZA 5G40A 1JG6A 3AZPA 4HDRB 1OGIA 3ND8A 2FSPA 4L8LA 4Y3UA 1WWPA 3PBKA 4JYMA 3UZUA 1W46A 2WM2A 3X1OA 1M2HA 3OTWA 3LOQA 3SEAA 4BMCA 2BBWA 4ZI7F 3M6WA 2IHVA 4KJZA 1BDJA 5A4IS 3NOXA 3D4IA 2IS1A 3X1MA 4CR6A 5L4LA 1UR5A 4MVJG 3O83A 3PPYA 3KYCA 2JGRA 3GN2A 3U7FB 4ZRNA 3R6TA 3KKKA 2TMDA 3OC6A 2PZFA 2WKPA 1EKYA 3PVZA 4G5FA 3B12A 3S2EA 4O2AA 1PGJA 1TTQB 3RHZA 4IQGA 5TJ5E 1T9ZA 3PGLA 5JAHA 2C7GA 4JLVA 1Z6XA 2VAVA 4NE9A 5KNBA 2CLSA 1A9ZA 2PSJA 1TM7E 3MS4A 2ONKA 2HF2A 2OXFA 1GLVA 1HLDA 2BI7A 1AMUA 2YQZA 2Z4RA 4E03A 3TW6A 2ZUCA 2UYCA 3MZ0A 1S3SA 2CV0A 1O7JA 1LY1A 3BSFA 4I4LA 5DYNA 5FXMA 1TRHA 4TTPA 4R7ZA 2IEAA 4OHPA 3SX0A 4NSNA 4WDQA 1ZN7A 2EYQA 5ALLA 2YNMD 5AW1A 3LC7O 2H8AA 1OH6A 3B0PA 3HXMA 1K6MA 2WG0A 2F8SA 3MTEA 1U2SA 3O90A 3HQ4O 2EFYA 3K9BA 4IDOA 2CB0A 2YJGA 3KZNA 1E3SA 4YO8A 2WLSA 4HBZA 3WB1A 2EFDB 3W7BA 4Y9SA 2Y39A 3LSTA 5JLIA 2WVGA 3MJDA 3KRTA 5KWJA 1PJRA 5E4FA 1BTOA 4ACBA 3O8QB 3GRPA 3M1CB 1I6LA 1E5LA 3CCBA 1IXYA 4CU2A 4WE3A 1YL7A 4OGGA 3KWFA 3OZBA 1NVUQ 1ZP6A 4HEA1 1OUMA 1GL7A 3LUPA 5K8LA 4JI4B 4A0HA 3W90A 2JJ2A 2AFIB 3HJGA 3REQB 5DEOA 1XHLA 2ACWA 3AG6A 2VOJA 3GZ4A 3AM4A 1FMCA 3ZXUB 1RLTA 3D7MA 4YJ2B 5K01A 5K0JA 4FYYA 1IEVA 3WA7A 4IHJF 4LX0A 4ALNA 5IJ9B 1EEHA 2OHJA 3RYFA 3H42B 3DMTA 4A0RA 2BT4A 3OIWA 2GSWA 4A0SA 1BHJA 4NPAA 3G88A 1WPXA 2FMTA 4ZO7A 2A4MA 3NRHA 1VRCA 1UJ2A 1TVMA 1XQWA 1C1DA 3EA5A 3CZRA 1MH1A 2XF8A 4QSHA 4CW7A 2NUBA 2IPLA 3Q3EA 4DQVA 4PS0A 4C2AA 3E9CA 3HA3A 2MWQA 2W2LD 2L0XA 4DEYA 3HCRA 3FNGA 2ECQA 1RS0A 4LRTB 4RDAA 3OETA 3VOSA 1E0AA 2QYOA 2OBYA 4FC6A 4EY4A 5K3CA 4QPZA 4QVKA 2PJDA 4LCJA 5U1PA 4ZCTA 1SZCA 4ZJZA 1NXOA 3PJRA 4HVLA 1QHIA 4OLBA 2WFZA 2HPZA 2ZJZA 3EDRA 1Z15A 3WDLA 2EP7A 4TM7A 4MW5A 2GZ3A 2C4NA 1L8XA 3Q0IA 1YZVA 1GN8A 3R3VA 1KP2A 1NONA 2GNPA 1XBTA 4UAJA 2XTMA 3OU2A 1W25A 3EHDA 4YJHA 1SBTA 3EJ6A 5BUQA 4FS3A 1WMDA 2VDWB 5LQSA 1GTJ1 3USES 2GN1A 4KR9A 1ZX1A 4DCTA 2Q6IA 3PPVA 4KX3A 1DRVA 2WEKA 3ET4A 2XM4A 4EYOA 4NBVA 2QN6A 4XQGA 4BHTA 1RXCA 1CBUA 4Q9AA 1KYYA 2JX0A 2GTIA 3I62A 3LAWA 5DNEA 1SZPA 4I8IA 2ZEJA 3RFXA 1TAHA 121PA 1X7WA 3RAEC 3RVSA 1EP2B 5DE3A 3ZV4A 4R0NA 2OVFA 4KXVA 3TRIA 1TA4A 2OPHA 2UU9B 1TQHA 1U8ZA 4U5XA 1QTIA 1YF3A 1XNHA 2ANBA 3GEGA 4HB4A 1CUBA 4QJ5A 4D9BA 1VLMA 3FXHA 3OLZA 3OCZA 3KOXA 1EFCA 2BM8A 5EIWA 5HIAA 4KLCA 2QTGA 4H6PA 3TIGA 4MCJA 4LQLA 2WOJA 2PMFA 4MITA 2OHGA 2JVIA 3WNDA 3U4QB 4HDKA 2JAXA 4NFSA 3ZUPA 3QYPA 2X5NA 1DELA 1QK4A 2OFXA 4FMDF 1QYCA 3WYGA 1YUBA 2A0KA 2SKCA 1OLXB 1FTQA 1WXGA 3CRQA 3AH8A 5DN6A 3CG0A 3LRXA 1GSHA 4K8RB 1XRMA 3HZZA 4OIRF 1E9FA 2XWQA 2P35A 1L9XA 4ONEA 3R09A 3ZDFA 3P96A 3C8ZA 4INPA 5DGCA 3ASOC 5BN5B 3BD6A 4IINA 1NU7D 3A9UA 1CNMA 3N6RA 4L5YA 3AJRA 3K66A 1X42A 3K1HA 1QGED 4E4RA 2O19A 1ZI6A 2RD2A 3NPMA 3QENA 1SG0A 2DCUA 3W3ZB 4EO7A 5K9ZA 2BBOA 5GZ3A 1WV1A 1MJGA 4BNVA 1KIMA 3FWHA 1NMZA 1ZJ6A 1YR6A 1JILA 3QMPA 3W2EA 1QYWA 1ZONA 2I3ZA 1T29A 2FMIA 1NA5A 2XNDD 1PR1A 1PDOA 1CZNA 4NOLA 3F5DA 3IO5A 3H2ZA 4HYYA 1KWGA 5H9WA 2XNCA 4IMJB 4FQ5A 5K3FA 4DLBA 5KOHB 5JZVA 4BMNA 4CKEB 3V7FA 2J5RA 4GWLA 4CJXA 1A9XA 5CX4A 5I7OA 1II8B 1R4TA 2XLHA 2IYSA 2CBZA 2AJBA 1SR2A 1A9QA 2OGWA 4TZ6A 5BW8A 1YKGA 4MQ4A 4GOOD 1KO1A 1QRUA 1Y37A 2ATCA 3VAYA 2BUAA 2B1JA 4HTFA 1OT3A 5DXJA 4Y6SA 4RVHA 3R7SA 3MINB 4KE8A 2SECE 3AWIA 3T5AA 1WY7A 3N8HA 2VPQA 2ZANA 3DVQX 3T3PB 1BIFA 1AOXA 1QDLB 1JI3A 5JWHA 1GPH1 1USGA 5CD9A 2P2SA 1JT2A 2W8ZA 3PEWA 3DTVA 2QMQA 1SKYE 4GMGA 4MUYA 4XUEA 1I7LA 2YJZA 2QY9A 3DF9A 3L43A 4PIVA 4G0MA 4F9TA 3SC2B 4NJEB 5IWAB 2W6MA 2IELA 4FFVA 1G8AA 3BRJA 3FHOA 3M7IA 1F2DA 5J43A 1FX0A 1HG0A 3UG7A 4QYTA 2HFIA 1Q19A 3OZRA 4KO4S 3OLCX 4EL0A 5EY5B 1V8OA 1J0XO 1ZD5A 4XEHA 3U09A 1OX4A 3QWHA 1KKMA 4X8HA 3G68A 2BMEA 2E85A 3IHLA 4I8DA 1NNEA 3WK8A 4I46A 4NQZA 4TOIA 1PG0A 4JKYA 2WD9A 5HVNA 4JJKA 1XL1A 4O59O 5JXWA 5DTQA 4MYTA 1O6CA 2DBVO 2BCJQ 3KLPX 5B55A 2A1DD 4QU8A 4AY6A 3NYLA 3HPRA 1YDGA 4JFRA 1Y7PA 3A3NA 1R9NA 3WWYA 1ZI8A 2EPNA 3GO4A 4MOWA 3H11B 4D6YA 1OZGA 4TTSA 2J9FB 5EP2A 1F6BA 3UCFA 5B4TA 1QGDA 3TS1A 3ZC4A 4MLPA 1TW3A 1KORA 1Q77A 2C2GA 1RYFA 1QVWA 3S90A 1NQXA 3CGWA 3G13A 3C8HA 1YHZA 4L5BA 4NLLA 4WK4B 2MYPA 3I3SR 2C1XA 3T5DA 4PXYA 2XCLA 2HCRA 5KX5B 3AF5A 1MRZA 3QU2A 5CNIA 1T8RA 3K1AA 4AICA 1V39A 3KUXA 4F5YA 4JBLA 3CSDA 2XGOA 1T2FA 3GRFA 4RQUA 2IWHA 2NT4A 1FSPA 3B48A 5M3BA 2HQBA 3KR1A 4PC6A 5CDUA 3H05A 3G6WA 4GT1A 2JLYA 2D5CA 3HXOA 3MRVA 2F00A 3FI0A 3HGMA 2OBFA 1S8AA 3QVGB 3PHIA 3B70A 4TTVA 1WP4A 2MYNA 1YWGO 2FMXA 3HVKA 4N40A 3W2IA 2DB3A 4RCVA 4EBKA 4BE4A 5FV7A 2W0MA 2AW5A 1SG6A 2QA5A 2ODAA 4F45A 2E48A