4LERA

Crystal structure of a putative outer membrane protein, probably involved in nutrient binding (bvu_1254) from bacteroides vulgatus atcc 8482 at 1.42 a resolution
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
457
structure length
457
Chain Sequence
TNPSLLLTGVAYSAFNQTSSDACHAAKMLILTSGESKYQVYKWTRGDFDYYSNLRDVTKMSEEAGEGSAYQALAHFFRANYFYQLTLDFGSIPYTDALKAETDANYQPAYDSQEVVLAGILKELEEADKMLEGSDEIISGDIIYNGNLVNWRKLINAYRLRILMSLSGKEKVGDIDVKSEFSKIVADGPLMESLSDNGQLIYLDQQDNRYPYFNDSDFGSGRFMDSTYIAELATRQDPRLFAVATQTPNAEKAGKAINDFSSYDGGDPAVPYSLVNDKAVAGNCSKPAPRYYQTPTNEPMVLLGYVEQQLILAEAVVRGWIQGDDKIYYESAVKASFEFYQKYAVSVADYLTQDAAAEYLRNDKVAYSSSLSTDEKIERIIMQKYLPTFLQGSVWLPYYEALRTGYPDFRRAAGVSLPYRWMYPQDEYNNNATHVEAALNEQFGGSDKTSDKPWWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative outer membrane protein, probably involved in nutrie
publication title Crystal structure of a putative outer membrane protein, probably involved in nutrient binding (BVU_1254) from Bacteroides vulgatus ATCC 8482 at 1.42 A resolution
rcsb
source organism Bacteroides vulgatus
molecule tags Sugar binding protein
total genus 174
structure length 457
sequence length 457
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12771 SusD-like_2 Starch-binding associating with outer membrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4lerA03
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4lerA01
5LX8A 3HDXA 4F53A 4MRUA 3CK9A 5T3RA 5E75A 3SNXA 3I4GA 4PUCA 5FQ8A 3SGHA 3MYVA 5FQ4A 3IV0A 3EHMA 3KEZA 5FQ6A 3JQ0A 3JQ1A 3OTNA 5J90A 3CK8A 4LERA 4F7AA 3JYSA 5T4YA 3EJNA 3CGHA 3EHNA 4Q69A 3P1UA 3CK7A 3GZSA 5E76A 3L22A 3MX3A 3NQPA 3LEWA 5FQ7A 3CKCA 3CKBA 3MCXA 3FDHA 4L7TA 3QNKA
chains in the Genus database with same CATH superfamily
2P9LG 5B1AE 4YN0B 5DQZA 3ASHA 1VMAA 3SBSA 2BC5A 1SZAA 1ZBPA 3FULA 4K7BA 4A3TA 2NUTB 2V4LA 3EFOB 3ZG1A 4WABA 1D8EA 1UN9A 2L0TB 1PD1A 3NF1A 3Q7AA 3ZGQA 5BUZA 2Z15A 2NXPA 2C2LA 1PD0A 2W4MA 2R7XA 3ZFWA 2YHSA 4N6HA 4H54A 2G62A 3JXIA 4ANUA 4DLOA 1WASA 4B94A 4FJZA 4F3VA 3T5VA 4Y6CA 3CSTA 1RJ9B 3U4TA 4GTVA 3FHEA 2EILE 2VGYA 1IHBA 1VLTA 2W9YA 2KZTA 3FUMA 4JZYA 3NKDA 2AWIA 1YLMA 1MMNA 1SA4A 4DVYP 1I4YA 3NQPA 3ZU7B 3JRTA 1V4AA 3ABMC 3R7QA 2VB6A 4PFOA 4CJOA 2F0YA 2XPYA 4D4XA 3ZW3A 256BA 2WB2A 2QYJA 4A4AA 3SGHA 2EINC 4U9EA 4OIOF 3PZ3A 3WHNA 3MEKA 2DGJA 1H6GA 5KYYB 1KPSB 3J5PA 3X2QC 3EDTB 4N6CA 3EHNA 2CGEA 4JJGA 5ENRD 3TOMA 1NZEA 1BLXB 3DSVA 5KYXA 3ABKE 2DYSC 1BPOA 1WDYA 2EIJC 3V79K 4GA2A 2V3CC 3ASDA 3T4RA 2EQXA 1OR2A 5A7DB 2CW0F 2D5RB 2KNHA 3KS2A 4G11A 3HG0D 3CHMA 3FDQA 3GEIA 2WXRA 2J0XA 3KSQA 1OXJA 1DC2A 2OVBA 5BT1A 5ENNA 4KI2A 3AQBA 1SR2A 2Y0BG 3FUNA 2J9QA 5TJ5E 4YT2A 1LE4A 3RW0A 4EUKB 3T8MA 2DB4A 1BI7B 1H6PA 2LSVA 3R9AB 1RXQA 1CPQA 4JCZA 4FA6A 1CGME 3AJMA 1U2VG 3RQGA 3ZYKA 4G8KA 4DJAA 3TXNA 2ZXPA 1GGQA 5D2MC 2VQ2A 2OJQA 4N5QA 1ZU5A 3FY4A 1OCCE 1WATA 3ESKA 3VF0A 3V5YA 3QWPA 3PH0C 3PZ1A 2M4EA 3LEVA 1N11A 3HXEA 3DXMG 1MHQA 2L9JA 3SNXA 4U63A 1S63A 3DE8A 2WXOA 2OVFA 3TWWA 4O6NA 3MV2B 3ZIMA 3AAAC 4HFFB 3ECSA 4P9FA 3AG4C 3KAEA 4YL1A 3HVEA 1ORSC 3LEWA 1WWPA 3GM1A 4IB4A 1D1CA 4F1PA 4G2VA 4GMJA 4MVSA 2HV7A 1FT2A 1TN6A 3UKRG 2V8SE 5D0QD 2X6FA 2Y3GA 1IKND 3MKQA 3H65A 4NTFA 2FI7A 1RZ4A 3T8KA 3RSEG 1R4TA 2DYRC 2CCYA 5JJ7A 4GZ3A 4DRXE 2DZOA 3SEOA 3B71A 5T8IA 3US6A 4BY6A 5EX0A 2Q3TA 1O5HA 1GQAA 1Q2ZA 3CAXA 4Z9HA 2P2CP 2P9KG 3LUTB 5F5HA 1RW2A 3FUJA 4F1SA 3AG1E 1M57C 3E4BA 1LS1A 5A69A 4IJJA 3VLDA 3CK9A 3ZVVA 5E75A 4EZLA 2F8XK 5BV0A 1Q0DA 2F37A 2WVNA 2HV6A 2H6HA 3BUAA 4JA7A 4FLBA 3EPVA 3HXCA 4LRZA 3NBNB 3T9OA 2OEWA 4FWVA 5KWDA 3RIPA 4BJ1A 3OXGA 4U5GA 5E76A 2L0IA 4N06A 3L6AA 2P0NA 2Q00A 2ETAA 2PQNA 3CKBA 3EGXB 2KXPC 2ILRA 3ULYA 3ASOC 4I3MA 3D9MA 3SFYA 4JD2G 3CHPA 2HKVA 4YVOA 3I4UA 4NRHB 3C63A 1BR4A 4YT5A 4M3OA 3DSUA 2C04A 2ICWG 3HHMA 1S64A 3RIBA 1PAQA 4F6RD 1B89A 4N2SA 2EPOA 3EIQC 3LS0A 1NU9C 5T3WA 3JTLO 3S9OA 2BE5F 2DBAA 3QK0A 1M56C 4K0DA 2XLWA 1EDUA 3RRMB 3HYMB 5DLJA 4WGYA 4DJ9A 3CVNA 4TUMA 5BUOA 3UUXA 2XLOA 4CJGA 1KZOA 2BUGA 4JZAA 1T01A 2L9BA 1UJKA 3B95A 4C7OB 3SYNA 2YLDA 2ZXOA 1TFKB 3UT7A 1UOHA 4GTQA 4HVBA 2X6JA 3GM3A 4M7CA 4RBNA 1D0ZA 1S7ZA 5L0JA 2ZXWC 4JXTA 3UIOC 4C3EA 3ZEFA 4DX2A 4EECA 1HMDA 4PACA 1JPLA 5AC4A 3LJNA 3E9VA 4DI4A 4X0RA 4BX9A 4FC8A 4DRJB 4IN3B 4I44A 2VSXE 3PRZA 2QTVA 2MYOA 3ASFA 1PV3A 2IOQA 1W3BA 1N4PA 1OY3D 3ULQA 2MRIA 4J7WA 2MWQA 4C0EA 5KYWA 2MHRA 4FHJA 4BJ6A 1SQMA 2WMNA 1Y6DA 3APDA 5HRYA 3DSWA 3EGXA 2NYJA 1TFOB 3S27A 3W4YA 4G7OF 2FF4A 4GTOA 4JIOA 1A7EA 3PHF2 3ZRHA 2DVWA 5D91A 4GMLA 4O60A 4OAUC 4GMRA 3RQFA 2H6GA 3KH2A 3DJNB 2LUHA 3B7SA 5ENSD 2AXZA 2J46A 5JRAA 1TNBA 3QAQA 4I17A 1OCRE 2IONA 3P1UA 1IZMA 3MX3A 1O87A 3F46A 3NDBB 2AXUA 4YDYA 4XWJA 2DI3A 2GRLA 4G25A 4NTBA 1LM3B 3RYLA 4R7LA 2YEVA 3VTYA 5L0HA 4HFGA 4HOUA 2XL6A 3SF4A 1XNFA 4UI9K 4ANJA 4GEHA 4PR9A 5EGYA 3C8GB 1RKEA 4BSZB 3M15A 4O79A 1O1TA 1A17A 4Q7CA 2PM7A 1YA7O 4UQXA 4YDWA 3LNRA 2ETSA 1NI1A 3NMJA 5FZQA 3RKVA 4BJ5C 3SXYA 4AK9A 2XLDA 4KMOA 1SZIA 5AGFA 2Y39A 1H6KA 3JSZA 4IWBA 4KYOB 3NMKA 2FFHA 3O6XA 5D92A 2JEKA 3HTKC 2WXHA 3IQ6A 3V5ZA 3K9IA 2R9RB 4QDLA 4HRNA 4MTOA 3C8GD 2EIMC 2R05A 2KK1A 2XL8A 1K1BA 4BWRA 3O10A 3IHYA 4A63B 4ANXA 5JSLA 5LOZA 4HRMB 1Z63A 3HNKA 2BL2A 5AN8A 1TNOA 2B0JA 1A5EA 4PS8A 3U3WA 1MX2A 5CCMA 3N24A 1KZPA 4ER9A 1DNPA 4K5BA 3PS6A 4CDAA 2J8WA 1P5QA 2AP3A 4CCAA 3IXEA 4C48B 5KBAA 4YJWA 1M2VB 1G5ZA 1XZPA 4JKVA 2CDQA 2YLGA 3DSSA 2ZD9A 3JYYA 4CS9C 1JRAA 4F7AA 3JYSA 2WXKA 3UM1A 1ZW2A 2OV8A 3EJNA 1EF1C 3DZAA 3MYIA 1WAO1 3RVZA 5CMYA 3T6BA 3APCA 1OCOE 4APFA 3M1CB 1TEZA 4K1OA 4PFPA 4XLNF 3WODF 5E3AA 3LJBA 4LLEA 3IKOB 3KEAA 1H2VC 3CEXA 3MYFA 4MTGA 4MW8A 3SP1A 4MKTA 2J07A 3IPMO 2ZPAA 4LERA 2WXLA 4ATGA 4A55A 1OUVA 1L7CA 3L22A 3TAXA 2IJGX 4W8KA 4GCOA 4N4WA 1OT8A 3CSFA 1XGWA 1E84A 3HNJA 3FAJA 3TWVA 4CDNA 2J08A 1PC2A 3SXMA 2FO7A 4OVVA 1KT0A 4Z68A 1TWCA 1YZCA 1VTMP 3NG1A 1JCRA 3RO2A 4KZ0A 4BEJA 3JQ1A 2D4UA 3IQ5A 3AG2E 3ZHEA 2OCCE 1MMAA 3NYMA 2QY9A 2IXMA 2M64A 3IBEA 4ATZD 4CT0A 4MVQA 4KBQA 3C62A 4HEAJ 3U2LA 3POVA 4Q5SF 5HQ8A 4WJ0A 1M2VA 3LY8A 2GRMA 4UWGA 4J32B 3TWUA 1FMVA 2IEJA 5CEAA 2A69F 1BI8B 1N0RA 4CYMD 4YT4A 4ABNA 5FCLA 4CX9A 1YYJA 4KBLA 3WG7C 2KM4A 2DWZA 3R9MA 3Q78A 4G23A 2JPUA 1ZHTA 4HLEA 3PCVA 4PJLA 1FFHA 4N39A 3A9CA 4WNFA 3SQVA 3RFYA 5CCLA 1YZAA 3MYVA 3W9FA 2XCCA 1V55C 2YZSA 3TWSA 4PJJA 2V4HC 2CFZA 2BTDA 4BTBA 2LAIA 5KJMA 1TYQG 5BPPA 1ZU4A 2XS8A 3OXFA 2PX0A 2ASRA 1K8KG 4ILHB 2IFUA 3HIZA 4HRLA 1TWHA 3B0VC 4RG9A 3U0CA 1Z5ZA 4FESA 4U9DA 2AVPA 2AU5A 5B3SC 1S05A 1D1AA 5JUAA 2L6FA 3D9LA 2QC9A 3RJVA 3QWWA 4I2ZA 5BXUA 2X6KA 3WXXA 2EPKX 3OTNA 3S2AA 2IO3C 3C5RA 2KZTB 5EKQD 1NG1A 3FOPA 5HSWA 3LVRE 1N4RA 2CHWA 3LESA 3AU4A 1G4WR 2J7PD 1IW7F 5ITZF 3D9KA 3V5XA 4CS9A 3Q7GA 4XI0A 4EBAA 1CGOA 3W2VA 3TULA 1H6OA 5ENQD 3DXKG 4D4NA 3ML8A 1E7UA 4BEMJ 3KMIA 2XHEA 4O1PA 3ZYQA 4BT8A 1YVIA 2PBEA 3FUKA 4GCNA 5EDSA 2PP4A 2A4ZA 1M2OA 3UM0A 1Q0FA 4PS3A 4EHPA 1LD7A 5AAOA 4MQ9F 4GQHA 5L0CA 3PDMP 5KJKA 3CVXA 3CK7A 3R7RA 4U0ZA 5CRUA 3HXBA 1VOMA 2LSEA 4YDOA 3UMHA 2F22A 5KYXB 3N0TA 2L6JA 4IYPA 3FH5A 4E7SA 4PJNA 4EZJA 4EBAG 3SD5A 3NOGD 5L3QA 5T3RA 3TL5A 5B1BC 3CLJA 3FXHA 4GYOA 1QSPA 4N5CA 1C03A 3K1IC 4Y6WA 3Q4AB 2H7VC 3URZA 4Q4ZF 3TQOA 3SI5A 1NSGB 2VCBA 3PZ4A 3JYHA 1SZ9A 5IY5E 4FAPB 4CS7A 2KJGA 1UG7A 4RLYA 1HF8A 3VM6A 5AQ9A 3JRMO 4A3VA 4U0UA 2Q9BA 3ABLC 3B0PA 3RK6A 3G2VA 2R7UA 4GTTA 4XPYA 3ENEA 4KNWA 4HE8D 2FGYA 3PUKA 4I1MA 3D9NA 3VTXA 1APCA 1SMYF 3U66A 4IGGA 4MNDA 2EIKC 5LCWC 3LS1A 4XTKA 3CHSA 3MA5A 5AQ7A 3UMVA 1JPJA 3BRJA 4JJFA 4L7TA 4EZKA 4AM9A 5A6KA 3UKUG 4ZLCA 3M79A 4AX2A 3PUJA 4L1BA 3NZSA 4EHMA 2NSGA 3JUIA 2XEEA 1YCSB 2XRZA 2WVOA 3G4XA 4XX5A 4MVOA 1Z6TA 5CBNA 3Q15A 3E33A 3FU0A 1TJFA 4IARA 3LLKA 2I1KA 5CECB 5FQ7A 1HE9A 4I9EA 3HVEB 5ENOD 3EU9A 3QB2A 3AG3C 4LNBA 5L0FA 5KNGA 4AL0A 5EHHA 1YAUO 2JABA 1OCOC 4GB9A 3PZ2A 4UI9C 3T5XA 2AVKA 4UDVA 3L82A 3MKQB 4DX7D 3TJ6A 1NZNA 1Y4CA 4C0MA 1LIHA 4E0IA 1HW2A 2WVIA 3V31A 2W45A 3TOLA 3DEPA 5AJDA 4G78A 4MVMA 3QARA 4F4BA 3L8JA 3ZXPA 2GROB 1QQEA 5BW8C 4PDXA 2KATA 3W2WA 3DWLG 3HNIA 4TXQA 4NQ0A 1O1SA 2AWCA 5FQ8A 1TJCA 3L17A 2DIWA 1T9KA 3ESLA 5HKPA 2R5SA 1J8YF 1XZQA 3J5QB 2Y3BA 4U0SA 4RDAA 1OW6A 2C03A 1DOWA 2XENA 4LCTA 2B6CA 2IQCA 5HI7A 3L9TA 2CYDA 1N94A 3RU0A 4AJWA 4ACKA 3HLZA 3HRAA 1MQSA 4J7TA 3ZYLA 2KBXA 5G05J 4GTPA 4FX5A 1OWLA 2HFIA 3LY9A 1Q0KA 3F6QA 4HS2A 4BJ6C 4XLPF 2LQGA 3D9OA 3IV0A 2YNQA 2RFMA 2IU1A 4HQDA 2VGEA 5KJNA 2PX3A 2XM0A 2ETCA 1H19A 4WAFA 4AL1A 1TR4A 1OQCA 5FZSA 2Q9AA 3K1IA 3Q47B 3J06A 4WWNA 4NCQA 2YL3A 1LF8A 3FOOA 4WUYA 1FMWA 3L1MA 1NP7A 4U8VD 2WQ6A 1L5JA 3S29A 3GODA 1ZVZA 3ZN3A 2WXIA 5AENA 1OWOA 1BR2A 1V74B 2VASA 4EPZA 1BD8A 4EKWA 5E2QA 4ZHBA 1LS4A 4M63A 4K5CA 2R7OA 4U96D 4JB8P 4A2NB 3NYJA 3HNLA 1MZCA 1B68A 3FH8A 4XI9A 4GPKA 2V5FA 1E8XA 5CMWA 2LCHA 2R7SA 4JTCB 3DM5A 1TNZA 3D9HA 1QYMA 1D1BA 3V2OA 5J08A 1Q0GA 1YA0A 3HXFA 3UPVA 1OW7A 3CR3A 5A6BA 4P29A 4DRHB 1E86A 1BR1A 3JZ0A 3PMRA 5G2NA 1UJJA 3TXMA 2XGMA 1D9SA 2LSUA 5KYWB 4MS2A 2PF4E 3FAPB 3UGOA 3AS5A 1HU3A 2HE0A 3CIAA 1HXIA 4QFVA 2Y1LE 4ILGA 4HBDA 4UWKA 3OA1A 4OVUA 2X0CA 2RSEB 3KKBA 4J8SA 3EG9A 2VC9A 4XQ1A 2Y4TA 4CEMA 3FUEA 2XZTG 3MKRA 1TKNA 3SO8A 1XWJA 3NB2A 4YK5A 2A6HF 4FJYA 2OKUA 4L2YA 3UQ3A 1T6IA 4CIPA 2R7QA 4J30B 5CRVA 1HS6A 4BJTA 3SNHA 1E96B 2XEVA 1E85A 3DM9B 3WAQA 3GW4A 2IXPA 2IY0C 3GZ2A 2YHCA 4PK4A 1C02A 2NG1A 4E18A 3ZTZA 5EK0A 1HZ4A 4BT9A 3LPZA 3Q9UC 4JE9A 5B1AC 2ZGGA 1CPRA 3NRHA 1RKEB 2Q7RA 3LJ3A 1WTYA 2IXNA 1AWCB 4O7GA 4J8FA 4CS8C 4NY3A 5A6AA 3E30A 3UXGA 3RRUA 4I43A 2G3KA 2WB7A 1EPUA 1YARO 2GAQA 4EQFA 4EWCA 5AC5A 2X6HA 1QPUA 2VGXB 4N3BA 1CGNA 2NSFA 4N3CA 3UINC 3L0IA 3FTWA 1JWFA 3L8IA 2EILC 3FVYA 4QI0A 4AE4A 1H0AA 2P1AA 2YLIA 1FCHA 5JHAA 4D10C 4RVBA 2LO6A 4Q96A 2YKZA 4DVZA 3W8HA 2ZIRA 3FTVA 1YMPA 3LYAA 1UN8A 4CZ2D 3DI5A 5ANRA 1V54E 1ZHYA 2EPNA 2Q7FA 5JLIA 3G2WA 4LNUD 3BEEA 3NYLA 1BU9A 3UX4A 1NLXA 4OD4A 2XS1A 3IEEA 4LEUA 4MS6A 1OW8A 1JCSA 1YA9A 3AJIA 2XLHA 5HV9A 3I5QA 4L6RA 2J8SD 4J8EA 4MVZA 2XXAA 4K03A 3CKCA 3UT4A 5JT4A 2VSOE 5L0GA 4CDRA 3QNKA 3ONLA 4F53A 1EYHA 4DX1A 4PJMA 5CHEE 3TK0A 5B3IA 3ABKC 3K7DA 4AV7A 4JCHA 4KC9A 4U04A 4XZ4A 1E7VA 4IRUA 2P9SG 4H4KC 5EILA 1Z6AA 2KQ9A 4H7YA 4WNGA 1NFOA 3FTYA 4U8YD 2HJ3A 5AARA 4IAOA 3SY2A 1ZYRF 2BKKB 5AYWD 5DS4A 3UI2A 3V2XA 4NTAA 1J8MF 4OIQF 1E90A 2FULA 3KD7A 4DK5A 2YL7A 2AWYA 5DS5A 2KCKA 2XGOA 3G2TA 3UIPC 2VGXA 4AIFA 3TWTA 3RH3A 3KL4A 2WXNA 3FEXA 3Q6NA 3FU6A 4AY6A 1OR3A 5GPGB 1EA8A 2UY1A 2HS5A 3QW1A 3C3OA 3PDNA 1TN7A 1D0XA 1LVKA 4CDMA 3ZHEB 5EYPF 2I8BA 5L3VA 5A23A 4YNDA 3MCXA 2XM4A 4OIRF 3CQZA 4LNGA 3Q7LA 5EIDA 2IO2C 3K66A 2UUHA 1OCCC 1DCEA 2AXVA 3HXDA 3QC1A 3O55A 5FT9A 4V3IA 5M72A 4LACB 3ABME 3DRAA 4MBGA 4OYSA 2VSNA 4CBEA 3A11A 2R17C 3CGHA 5JS5A 2LXLA 3EU5A 5DS6A 1JMWA 3VAYA 3B7TA 1KT1A 4HFKB 2O9XA 4CDVA 1IXVA 1H9TA 4AVXA 4CS8A 3TWRA 3X2QE 4E7ZA 4I1AA 2QZAA 3BQOA 1T5OA 3JCKC 5BNWA 2DZNA 4YL3A 2XLVA 4EIYA 3S84A 5G04C 4U5HA 3FEYA 4UQZA 3PEUB 2WMOA 2IOSA 2ZU6B 3LCAA 4G1TA 4BX8A 4HOQA 4KT6B 2LD6A 3ZWIA 3GZ1A 3DSTA 4BETA 3U2MA 1ZZPA 2J9VA 5CIVA 3HDXA 2YWAA 1ELWA 2J9WA 1NU7D 2OU6A 4W8PA 2VTBA 3DPYA 2P9UG 1TN8A 1WM5A 3UGPA 2R03A 3AG1C 5F5FA 2OOEA 2XSEA 4LSZE 3QVZA 2VCCA 2YQYA 1A7DA 2KC3A 2KC7A 4R32A 1OCZE 2X6IA 4DX5D 1U89A 1LI7A 3FHDA 3UT8A 2UUIA 4IAQA 3CVYA 1WGWA 5JA4D 3VYWA 3TGOA 2GRPB 4E85A 3DWWA 1PCXA 5FWQA 5LX8A 4CGWA 2CHXA 3RO3A 1MJ0A 5FINA 2Y3HA 4OD5A 3IQCA 2XRHA 4BFRA 3V30A 1WN0A 5AQBA 1ORJA 4G26A 5CI8A 1N4QA 3BU8A 3U9MA 2CG3A 3C8ZA 3KYIA 3I3NA 3TG5A 5DBKA 2WZGA 2WL8A 1X5BA 4TXPA 4NURA 3QOUA 3NOCD 5ARFA 3B7RL 3G4ZA 4ILIA 4N2QA 1TWGA 4G0HA 1SYQA 1NBBA 1H7IA 1QKRA 3EHQA 3NMIA 2ZGDA 1KU2A 5CI9A 4XEIG 3KYJA 3MBGA 3UM3A 4DXWA 3R2PA 3B13A 1HW1A 4J8YA 3ONKA 2R2LA 3R7CA 2CNWD 5KYUA 1MYOA 3G2SA 2GRQB 1D8DA 3Q75A 3N71A 2FAPB 3G2UA 5ENTD 2W4BA 2DYRE 1E8YA 4U5CE 3FFLA 2HJMA 2GGFA 4O6FA 3D3MA 3ISMC 5T3TA 3I4GA 4PUCA 2VJ8A 1U6HA 3HKKA 2WZLA 3ASNE 5AQAA 1K3ZD 3JQ0A 1O1RA 3E32A 4X8QA 2X3MA 3RQEA 3Q9NC 3QDNA 3MFNA 1U3CA 2LNIA 5BQGA 1D0YA 4JEAA 3FTUA 2YL1A 4O6MA 1K05A 4ME2A 2Q4FA 4HB5A 1GS9A 3UMIA 1LI5A 3QTHA 1TQGA 4XEKA 2VH3A 3H2VA 2WXPA 2A6EF 5E3CA 2XQ0A 3CHOA 3AGTA 4JPSA 3FTXA 2OJED 4DBRA 4HNAD 4A1GA 2CG2A 3IQTA 1Z23A 1INZA 3U9JA 3JT1A 4BESA 1QQ3A 4JC7A 3ASOE 3ZNGA 1E8WA 2HM8A 2PL2A 4IULA 1AEPA 3N2ZB 5C2YA 1OCRC 3RKOF 4J0UA 1JCQA 4KXKB 1FVFA 1DCQA 4P6IC 4RQIA 4GYWA 2I15A 5DIZA 4HLLA 3O39A 2CFUA 3RF3A 1NL4A 3L16A 2IXOA 3UMKA 2Y3AA 3JSEO 2EPLX 3ZKJA 1FNTc 1G4US 1LE2A 4DUIA 2MYSA 1Z5SC 2WQHA 2ZISA 4DRIB 4G7HF 1N4SA 4E0HA 1R5ID 5EYLA 2C0LA 3SXKA 5JHBA 3FU3A 2L6GA 3CVWA 2ETBA 2GFHA 2H7OA 1OKKA 3DE9A 2ZXWE 2VSYA 2J7PA 5G55A 1VLSA 3SZ7A 1JPNA 4LDKA 2ZXRA 1GW6A 3L08A 4GPMA 4UUCA 2H8AA 1A0BA 1N54A 4FP7A 3RRNB 5D0OD 3T6GB 3DEOA 2J9BA 3CVQA 3LDZA 1MNDA 2IBFA 2BKGA 2V26A 2RD0A 2GRRB 3ZYMA 1C17M 3DPDA 2L6HA 3ULEG 5LFAA 4FU3A 4CSAA 1Z7Qc 3QVYA 3AU5A 4I9CA 4QI2A 2AW6A 2A0UA 5EN5D 4U95D 4W9RA 4JRZA 1JAFA 4J8DA 3NAWA 1OWMA 3U8PA 2MOWA 3S28A 3FTSA 3C72A 1TWAA 3Q5MA 2PFDA 4TRQA 2HMQA 3ZPJA 1LTXA 4JEHA 1AUEA 4BG0A 1ELKA 2F8YA 2XPZA 5CBOA 4GZ6A 2QLAA 2NPUA 4JW1A 3E34A 2DCPA 4NQFA 3QW0A 1Y8MA 2B0OE 3FUDA 4RSYA 4U8HA 2YL0A 3B29A 1OWPA 4FHKA 1DVPA 4YVQC 4HORA 2P6VA 3OAWA 1QZXA 1HE1A 3EZHA 1HG5A 3PE3A 3B0UX 2Y4UA 4LUNU 1KNYA 2NUTA 1PY1A 3EFOA 1EI7A 4U5BE 4GTRA 3W8IA 1HFAA 3U5SA 2NUPB 4YDEA 2QYUA 3QWVA 2FEZA 2WPVA 2IYLD 2J4DA 5ENPD 3ZUVB 1VYKA 4H7XA 4AY5A 3LNMB 2G3VA 2YQ8A 2XPIA 1KTMA 4AOFA 3AG2C 1OCZC 2LFFA 2OCCC 3OEOA 1RJ9A 2OOCA 2EIME 4B8CB 3U8VA 3QJZA 3EG9B 5FTPA 3QKYA 1IHGA 1N1CA 4GAAA 3GM2A 1H2UA 3AS8A 4KNVA 5A6BD 1UG3A 3CQGB 2JLBA 2LAHA 3CHRA 3CHQA 4K0RA 3IHVA 4JHRA 4JL0A 1UFBA 2WXGA 1MMDA 1QVXA 2I9CA 3GANA 4CRWA 3PE4A 3TWXA 4NACA 4CT4A 3BEHA 1FT1A 3PREA 1YJGA 1HH8A 3TJ5A 4YL0A 1S70B 4L2LA 1RKCA 4GZCA 5COFA 5F28E 2KCVA 1VK5A 4GA1A 3Q7FA 5KYYA 1SVXA 5JVEA 4JEBA 4XEVA 3CK8A 4BSXA 2VYIA 4Q69A 4L23A 2QNLA 1TNUA 3HJCA 4LLCA 3JXJA 4XE0A 4HOSA 4KZCA 3CV0A 3FWVA 2E2EA 3V7OA 2B0HA 4LDQA 3ZQYA 5L0DA 3MZLB 3K33A 2EPMX 4BERA 3EH1A 3M4CA 2KYHA 2NUPA 3KEZA 1F1MA 4P9TA 3S0XA 5BQIA 2MHKA 4LG6A 5G04J 2OG2A 4PH4B 5EIBE 1KLXA 2J49A 4XPWA 1YYHA 3NKEA 2NSZA 3ASNC 4AE4B 4U07A 2IM8A 3CVLA 4J6IA 3Q6MA 2HUJA 4WNEA 2HSBA 3CSKA 2XRYA 1N52A 4LDRA 5JJTA 2XZDG 2L81A 1IQUA 4JTAB 2HYZA 4L9PA 5BV1A 1OXBA 3LAYA 5AJLA 4APOA 3CVUA 1SF8A 2IOLA 4Q94A 3DJUB 4EBKA 1ZB1A 2FBNA 2ONDA 2R7TA 3L13A 1BBHA 2HZ8A 4O1OA 2RD9A 2XXAB 1G3NB 2OEVA 1FTSA 4ONSA 2Y3DA 5A6JA 3ZC4A 3EIJA 2FO1E 1ELRA 2WXJA 3WG7E 3DXJF 3ZQVA 5K0IA 1LKXA 2Y69E 5JJ6A 2RFAA 5T4YA 5LP0A 1DOVA 4U5EE 1EKYA 2HR2A 2J09A 2PNNA 3LVQE 1WOLA 5C1DA 2GW1A 3K1HA 4I6JA 3O4ZA 3KPHA 1V55E 5JP7A 1ST6A 1HX8A 4DLQA 4TV3A 5FIOA 5IY5C 3DKAA 5AIJA 3BG1B 3EH2A 3PVLA 4I6GA 3KSLA 3SHFA 4JHKA 1TR2A 2WXMA 3DSXA 2YVKA 2BF0X 3U64A 2R7RA 3LEOA 4E17A 1NA0A 2UY1B 3GZSA 5B3SE 1ZW3A 1AVOB 2YHEA 3AS4A 3TG4A 2J45A 3X1OA 4DI3A 4GTSA 4C9BB 3EHRA 1AP7A 4XPXA 2V0PA 3Q73A 2WXQA 4B89A 3ZXSA 3D9PA 2OQMA 1OWNA 4NIKA 1MX4A 1HG2A 2P58C 2WXFA 3ZVRA 4KVMA 4JTDB 1HE8A 1QNFA 1N95A 5H7PA 2P7VA 5FZRA 4A1SA 4JVSA 4DPRA 3B7BA 3GEEA 1O3UA 3LLIA 3FP3A 4GTMA 3QZCA 1WY6A 4MRUA 4XKBA 4B93B 2UWJG 4GU5A 3T6JA 2WM9A 3ATPA 4ANWA 3VLFA 2PQRA 3ITFA 4KVOA 2R59A 3EGDB 5D66A 2J0WA 3GWNA 2XGSA 2A5EA 1I4ZA 3PNLB 1RCPA 4JURI 1IQRA 4Z9JA 2GRNB 5B1BE 3CQCB 3CZ6A 4MTFA 4AP2A 3GYZA 3K6BA 4HOTA 4G8LA 4B0ZA 4MLPA 2H7BA 2HO1A 1A41A 3UR3C 4HI8A 4WWOA 5KCMA 4C7OA 2QY7A 3W9GA 5COGA 2X38A 2V5QC 3PEVB 4OINF 4ZLDA 4XIFA 2VTBB 3I4RB 1VB5A 4J7YA 2R7WA 1FAPB 2PNOA 5COMA 3D9JA 2LK4A 2QE9A 2Q9CA 3L54A 2TMVP 1YDIA 4JC8A 3G50A 3TWQA 2R02A 2KSFA 5BXOA 4QQIA 3FUHA 2I1JA 5T1DB 1MMGA 3ABLE 4PS7A 3H2UA 1N9AA 1A7VA 1NA3A 1Q0MA 1I5NA 3S7FA 3LXUX 5G05C 5KYNA 5A6CA 3DMDA 1SA5A 4ANVA 4EBJA 4OIPF 2KGOA 4O6YA 4U7EB 1LPEA 3AGUA 1JUQA 2EIKE 3PZDA 4XKCA 3GEHA 1HO8A 3Q79A 5CERB 2X51A 3ASGA 3LKUA 3Q49B 3UM2A 3SBTB 4NC3A 4ULVA 4K5AB 4HXIA 3AOUA 5LCWJ 3ZSUA 3CVVA 3VLEA 3L34A 2EINE 3FDHA 1L3PA 4U5DE 4ACLA 1BDJB 5L0IA 2LFDA 3RVYA 3UNGC 2C0MA 3TD7A 4U5FE 1QZ2A 4MVRA 3C3RA 4I2WA 3EUVA 1BZ4A 1U0BB 3MV3B 3EGDA 3ZTMA 3I5PA 2QUPA 3AG3E 2DYSE 4Z9IA 4WGZA 3S90A 3C3QA 1ZHXA 2EIJE 3C98A 3ZIBA 1HY5A 3SZRA 2HMZA 3E70C 2RKKA 2XL4A 3DBSA 5KYUB 2PM6A 4UWHA 4WNDA 3GORA 1RMVA 4CGVA 2JD3A 4DOZA 2L7AA 3C8GA 3TJPA 4UI9J 3VRCA 2NC9A 1HMOA 4XEFA 4BTAA 2OEXA 3ZDLA 5FQ6A 3SXZA 1WG0A 3DAGA 2LXMA 4DX6D 2LP4A 2XCBA 1E8ZA 4EBBA 2J4BA 3ML9A 1MX6A 4BEPA 2GWWA 3CVPA 3B7UX 5KJLA 3BG0B 4B8AA 1JR8A 3FH7A 1ZHZA 3O48A 1H2TC 5JMND 2WVQA 4UWFA 3APFA 1EQ1A 2YRFA 4HI9A 4GYTA 3B9QA 2L6BA 1VDYA 1O5MA 5KNHD 1Y6IA 4URKA 2YINA 5FZTA 2WZFA 3EQLF 3EZIA 4RG6A 3DAFA 2P9PG 3S7DA 1SW6A 4ZFHA 1FVHA 2A68F 1T6QA 2GDCA 4I1OB 3CEQA 1E83A 1S0PA 3RAUA 1FFTC 4DBQA 3E37A 2QFCA 2KCLA 3C18A 2HSQA 2I6HA 3D9IA 4CSAC 1MQVA 5EX3A 1NFNA 5HS0A 4GZ5A 2A0BA 3AG4E 1OXKA 3EHMA 5J90A 1G8XA 3SFXA 3LY7A 3M4BA 2A5UA 4JA9A 1W2WA 2I2OA 4WWPA 2P9NG 4CIHA 4TXRA 4MVUA 2J9UA 3QMKA 1U3DA 4FLHA 4CDYA 1FPPA 2Y69C 1ZU2A 2H6IA 4JHJA 2E0IA 2JX0A 5CEDB 3AQCA 3JUEA 3F47A 3GWLA 4I6EA 1JWGA 1K1AA 4BJ5A 1QLEC 4YT8A 3FUIA 5ARGA 2GA0A 2KW3C 4C3DA 2P9IG 1GM5A 1K40A 3PNTB 2H6FA 5DVWA 4YWQA 3SFZA 1H9GA 3T9KA 1QBQA 1M6TA 2IF4A 4N3AA 1TNYA 2XLMA 1YYXA 4G7ZF 1VYIA 4GZDA 3C7JA 1UW4B 1Z3IX 2BEDA 2PZIA 4GA0A 1N0QA 4AXHA 3NZUA 5BQHA 1NFIE 3FTZA 2XEHA 1V54C 3U3BA 1ZHWA 3UTMA 2R25A 2RG8A 2P61A 5DQTA 3FUFA 2CHZA 3S7JA 1OKKD 3DD7A 1E2XA 4FADA 5E33A 3LS8A 1FR0A 1Z3YA 2M63A 4MW3A 1ORYA 4UQYA 2E87A 3S7BA 3FMSA 1IYGA 3OXLA 1MNEA 3U9WA 4G24A 3MLGA 1JOGA 3MGBA 4JEUA 4C3BA 4B6IA 4TUUA 4GYYA 1X81A 5ANLA 3IHUA 5FJYA 5FQ4A 1T6UA 4BPMA 2AJAA 2CNWA 1LD8A 2R7VA 1Z3XA 1K04A 2LIGA 3P2BA 3OWTA 4FULA 3JCUQ 3MJWA 3IEGA 3FU5A 2A1DD 4OAVB 4ULWA 4AEZC 2XLEA 4UWLA 4E6HA 3U3FA 2VCAA 2WQ7A 4RD9A
chains in the Genus database with same CATH topology
4YN0B 5DQZA 3ASHA 1VMAA 3SBSA 1SZAA 1ZBPA 3FULA 4K7BA 4A3TA 2NUTB 2V4LA 3EFOB 3ZG1A 1UN9A 2L0TB 1PD1A 3NF1A 5BUZA 3ZGQA 2Z15A 2NXPA 2C2LA 1PD0A 2W4MA 2R7XA 3ZFWA 2YHSA 2G62A 4ANUA 4DLOA 4B94A 4FJZA 4F3VA 3T5VA 4Y6CA 3CSTA 1RJ9B 3U4TA 3FHEA 2VGYA 2W9YA 2KZTA 3FUMA 4JZYA 3NKDA 2AWIA 1MMNA 4DVYP 3NQPA 3JRTA 3ABMC 3R7QA 2VB6A 4PFOA 2XPYA 3ZW3A 2WB2A 3SGHA 2EINC 4OIOF 3MEKA 2DGJA 5KYYB 3X2QC 3EDTB 3EHNA 2CGEA 4JJGA 1NZEA 5KYXA 2DYSC 1BPOA 2EIJC 4GA2A 2V3CC 3ASDA 3T4RA 2EQXA 5A7DB 2CW0F 2D5RB 2KNHA 3KS2A 4G11A 3CHMA 3FDQA 2WXRA 2J0XA 2OVBA 5BT1A 5ENNA 4KI2A 3AQBA 3FUNA 2J9QA 4YT2A 3T8MA 2LSVA 3R9AB 4FA6A 3ZYKA 4DJAA 3TXNA 2ZXPA 2VQ2A 1ZU5A 3FY4A 3ESKA 3QWPA 3PH0C 2M4EA 3LEVA 1MHQA 2L9JA 3SNXA 4U63A 2WXOA 2OVFA 4O6NA 3MV2B 3ZIMA 4HFFB 3ECSA 3AG4C 3KAEA 3HVEA 3LEWA 1D1CA 4G2VA 4GMJA 2HV7A 2V8SE 5D0QD 2X6FA 2Y3GA 3MKQA 3H65A 2FI7A 2DYRC 5JJ7A 4GZ3A 3SEOA 5T8IA 4BY6A 5EX0A 2Q3TA 1O5HA 5F5HA 3FUJA 4F1SA 1M57C 3E4BA 1LS1A 4IJJA 3VLDA 3CK9A 3ZVVA 5E75A 4EZLA 5BV0A 2WVNA 2HV6A 4JA7A 4FLBA 3EPVA 4LRZA 4FWVA 3RIPA 4BJ1A 3OXGA 4U5GA 5E76A 2L0IA 4N06A 3L6AA 2PQNA 3CKBA 3EGXB 2ILRA 3ASOC 4I3MA 3D9MA 3CHPA 4YVOA 3I4UA 4NRHB 4YT5A 1BR4A 4M3OA 2C04A 3HHMA 4N2SA 3RIBA 1PAQA 1B89A 3EIQC 3LS0A 1NU9C 5T3WA 2BE5F 2DBAA 3QK0A 1M56C 4K0DA 1EDUA 3RRMB 3HYMB 5DLJA 3CVNA 5BUOA 3UUXA 2BUGA 4JZAA 2L9BA 1UJKA 4C7OB 3SYNA 2ZXOA 3UT7A 4HVBA 2X6JA 4RBNA 1D0ZA 1S7ZA 2ZXWC 4JXTA 4C3EA 3ZEFA 4EECA 1JPLA 3E9VA 4DI4A 4X0RA 4BX9A 4FC8A 4IN3B 4I44A 2VSXE 3PRZA 2QTVA 3ASFA 2IOQA 1W3BA 3ULQA 2MRIA 2MWQA 4C0EA 5KYWA 4FHJA 4BJ6A 1SQMA 2WMNA 3APDA 3EGXA 3S27A 2FF4A 4G7OF 3PHF2 3ZRHA 5D91A 4GMLA 3KH2A 3B7SA 3DJNB 2AXZA 2J46A 3QAQA 4I17A 2IONA 3P1UA 1IZMA 3MX3A 1O87A 3F46A 3NDBB 2AXUA 4XWJA 2GRLA 4G25A 3VTYA 3RYLA 4R7LA 2YEVA 4HFGA 4HOUA 3SF4A 1XNFA 4UI9K 4ANJA 4GEHA 5EGYA 4O79A 1A17A 4Q7CA 2PM7A 4UQXA 3LNRA 5FZQA 3RKVA 4BJ5C 4AK9A 4KMOA 1SZIA 2Y39A 1H6KA 3JSZA 4IWBA 4KYOB 2FFHA 3O6XA 5D92A 2JEKA 3HTKC 2WXHA 3K9IA 4QDLA 2EIMC 4BWRA 3IHYA 4ANXA 5LOZA 1Z63A 2B0JA 4PS8A 3U3WA 5CCMA 3N24A 1DNPA 3PS6A 1P5QA 4CCAA 4YJWA 1M2VB 2CDQA 4CS9C 4F7AA 3JYSA 2WXKA 2OV8A 3EJNA 1EF1C 3DZAA 1WAO1 5CMYA 3T6BA 3APCA 4APFA 3M1CB 1TEZA 4PFPA 4XLNF 3WODF 5E3AA 3LJBA 4LLEA 3IKOB 1H2VC 3SP1A 4MKTA 2J07A 2ZPAA 4LERA 2WXLA 4ATGA 4A55A 1OUVA 3L22A 3TAXA 2IJGX 4W8KA 4GCOA 3CSFA 1XGWA 3FAJA 4CDNA 2J08A 1PC2A 2FO7A 4OVVA 1KT0A 1TWCA 3NG1A 3RO2A 4KZ0A 4BEJA 3JQ1A 3ZHEA 1MMAA 3NYMA 2QY9A 2IXMA 3IBEA 4CT0A 4KBQA 4HEAJ 3POVA 4Q5SF 5HQ8A 4WJ0A 1M2VA 3LY8A 2GRMA 4UWGA 4J32B 1FMVA 2A69F 4YT4A 4ABNA 5FCLA 4KBLA 3WG7C 2KM4A 4G23A 1ZHTA 4HLEA 4PJLA 1FFHA 4N39A 4WNFA 3RFYA 5CCLA 3MYVA 2XCCA 1V55C 2YZSA 4PJJA 2CFZA 2BTDA 4BTBA 2LAIA 5KJMA 5BPPA 1ZU4A 3OXFA 2PX0A 4ILHB 2IFUA 3HIZA 1TWHA 3B0VC 4RG9A 1Z5ZA 4FESA 2AVPA 5B3SC 1D1AA 3D9LA 3RJVA 3QWWA 4I2ZA 2X6KA 3WXXA 3OTNA 3S2AA 2KZTB 5EKQD 1NG1A 5HSWA 3LVRE 2CHWA 3LESA 3AU4A 2J7PD 1IW7F 3D9KA 4CS9A 3Q7GA 4XI0A 4EBAA 3W2VA 3ML8A 1E7UA 3KMIA 2XHEA 3ZYQA 4BT8A 4GCNA 3FUKA 5EDSA 2PP4A 2A4ZA 1M2OA 4PS3A 4MQ9F 5KJKA 3CVXA 3CK7A 3R7RA 4U0ZA 1VOMA 2LSEA 3UMHA 5KYXB 3N0TA 2L6JA 4IYPA 3FH5A 4E7SA 4PJNA 4EZJA 4EBAG 3SD5A 5T3RA 5L3QA 3TL5A 5B1BC 3CLJA 4GYOA 4N5CA 3K1IC 4Y6WA 3Q4AB 2H7VC 3URZA 4Q4ZF 3SI5A 3JYHA 1SZ9A 4CS7A 2KJGA 1HF8A 4A3VA 4U0UA 2Q9BA 3ABLC 3B0PA 3RK6A 3G2VA 2R7UA 3ENEA 4KNWA 4HE8D 2FGYA 3PUKA 4I1MA 3D9NA 3VTXA 1SMYF 3U66A 4MNDA 2EIKC 5LCWC 3LS1A 4XTKA 3CHSA 3MA5A 3UMVA 1JPJA 4JJFA 4L7TA 4EZKA 4AM9A 4ZLCA 4AX2A 3PUJA 4L1BA 3NZSA 3JUIA 2XRZA 2WVOA 4XX5A 1Z6TA 3Q15A 3FU0A 1TJFA 2I1KA 3LLKA 5FQ7A 4I9EA 3HVEB 3QB2A 3AG3C 5EHHA 1OCOC 4GB9A 4UI9C 3T5XA 3MKQB 1NZNA 4C0MA 2WVIA 2W45A 5AJDA 3QARA 4F4BA 1QQEA 5BW8C 4PDXA 2KATA 3W2WA 4NQ0A 5FQ8A 1TJCA 3L17A 2DIWA 3ESLA 2R5SA 1J8YF 2Y3BA 4U0SA 4RDAA 2C03A 4LCTA 2IQCA 5HI7A 3RU0A 4AJWA 4ACKA 3HLZA 1MQSA 3ZYLA 5G05J 4FX5A 1OWLA 3LY9A 4HS2A 4BJ6C 4XLPF 3D9OA 3IV0A 2YNQA 2IU1A 5KJNA 2PX3A 1H19A 4WAFA 5FZSA 2Q9AA 3Q47B 4WWNA 1LF8A 4WUYA 1FMWA 1NP7A 2WQ6A 1L5JA 3S29A 3GODA 3ZN3A 2WXIA 5AENA 1OWOA 1BR2A 2VASA 4EPZA 5E2QA 4M63A 2R7OA 4A2NB 3NYJA 3FH8A 4XI9A 4GPKA 2V5FA 1E8XA 5CMWA 2R7SA 3DM5A 1D1BA 5J08A 1YA0A 3UPVA 3CR3A 4P29A 1BR1A 3PMRA 5G2NA 1UJJA 3TXMA 2XGMA 2LSUA 5KYWB 2PF4E 3UGOA 3AS5A 1HU3A 3CIAA 1HXIA 4QFVA 4ILGA 4UWKA 3OA1A 4OVUA 3KKBA 4J8SA 3EG9A 4CEMA 2Y4TA 3FUEA 3MKRA 1TKNA 2A6HF 4FJYA 4L2YA 3UQ3A 2R7QA 4J30B 1HS6A 4BJTA 3SNHA 1E96B 2XEVA 3DM9B 3GW4A 2IXPA 3GZ2A 2YHCA 4PK4A 2NG1A 1HZ4A 4BT9A 3LPZA 5B1AC 3NRHA 3LJ3A 2IXNA 4O7GA 4J8FA 4CS8C 4NY3A 3RRUA 4I43A 2G3KA 2WB7A 1EPUA 4EQFA 4EWCA 2X6HA 2VGXB 4N3BA 4N3CA 3L0IA 3FTWA 1JWFA 2EILC 3FVYA 4QI0A 4AE4A 1H0AA 5JHAA 1FCHA 4D10C 4RVBA 2LO6A 4Q96A 4DVZA 3W8HA 3FTVA 3LYAA 1UN8A 5ANRA 1ZHYA 2Q7FA 3G2WA 3BEEA 3NYLA 3UX4A 4OD4A 3IEEA 4LEUA 4MS6A 3I5QA 4J8EA 2XXAA 4K03A 3CKCA 3UT4A 2VSOE 4CDRA 3QNKA 3ONLA 4F53A 1EYHA 4PJMA 5CHEE 3ABKC 3K7DA 4AV7A 4JCHA 4KC9A 4U04A 4XZ4A 1E7VA 4IRUA 4H4KC 1Z6AA 2KQ9A 4H7YA 4WNGA 3FTYA 4IAOA 1ZYRF 5AYWD 5DS4A 1J8MF 4OIQF 1E90A 2FULA 3KD7A 4DK5A 5DS5A 2KCKA 2XGOA 3G2TA 2VGXA 4AIFA 3RH3A 3KL4A 2WXNA 3FEXA 3Q6NA 3FU6A 4AY6A 2UY1A 3PDNA 1D0XA 1LVKA 4CDMA 3ZHEB 2I8BA 5L3VA 5A23A 4YNDA 3MCXA 4OIRF 3CQZA 3Q7LA 3K66A 1OCCC 2AXVA 3QC1A 5FT9A 4V3IA 5M72A 4LACB 4OYSA 2VSNA 4CBEA 2R17C 3CGHA 5DS6A 3VAYA 3B7TA 1KT1A 4HFKB 2O9XA 4AVXA 4CS8A 4E7ZA 4I1AA 3JCKC 5BNWA 5G04C 4U5HA 3FEYA 4UQZA 3PEUB 2WMOA 2IOSA 2ZU6B 3LCAA 4G1TA 4BX8A 4HOQA 4KT6B 3GZ1A 2J9VA 3HDXA 1ELWA 2J9WA 1NU7D 2VTBA 1WM5A 3UGPA 3AG1C 5F5FA 2OOEA 2XSEA 2KC7A 2X6IA 3FHDA 3UT8A 3CVYA 1WGWA 3VYWA 3TGOA 4E85A 1PCXA 5FWQA 5LX8A 4CGWA 2CHXA 3RO3A 2Y3HA 4OD5A 2XRHA 4BFRA 4G26A 5CI8A 2CG3A 3I3NA 3TG5A 5DBKA 2WZGA 2WL8A 1X5BA 4NURA 3QOUA 5ARFA 3B7RL 4ILIA 4N2QA 1TWGA 4G0HA 1KU2A 5CI9A 3B13A 3ONKA 2CNWD 5KYUA 3G2SA 3N71A 3G2UA 2W4BA 1E8YA 4U5CE 3FFLA 2GGFA 4O6FA 3D3MA 5T3TA 3I4GA 4PUCA 2VJ8A 2WZLA 3JQ0A 2X3MA 3QDNA 1U3CA 2LNIA 3FTUA 1D0YA 4O6MA 4ME2A 3UMIA 2VH3A 2WXPA 2A6EF 5E3CA 2XQ0A 3CHOA 4JPSA 3FTXA 4DBRA 4A1GA 2CG2A 1Z23A 1INZA 3JT1A 1E8WA 2HM8A 2PL2A 4IULA 3N2ZB 5C2YA 1OCRC 3RKOF 4J0UA 4KXKB 1FVFA 4P6IC 4GYWA 5DIZA 3O39A 2CFUA 3L16A 2IXOA 3UMKA 2Y3AA 2MYSA 2WQHA 4G7HF 2C0LA 5JHBA 3FU3A 3CVWA 2GFHA 2H7OA 1OKKA 2VSYA 2J7PA 5G55A 3SZ7A 1JPNA 2ZXRA 1GW6A 3L08A 1N54A 4FP7A 3RRNB 5D0OD 3CVQA 3LDZA 1MNDA 2V26A 2RD0A 3ZYMA 3DPDA 5LFAA 4FU3A 4CSAA 3AU5A 4I9CA 4QI2A 2AW6A 4W9RA 4J8DA 1OWMA 2MOWA 3S28A 3FTSA 1TWAA 3Q5MA 2PFDA 4TRQA 3ZPJA 4JEHA 4BG0A 1ELKA 2XPZA 4GZ6A 4JW1A 2DCPA 1Y8MA 3FUDA 4RSYA 4U8HA 1OWPA 4FHKA 1DVPA 4YVQC 4HORA 2P6VA 3OAWA 1QZXA 3EZHA 1HG5A 3PE3A 3B0UX 2Y4UA 4LUNU 1PY1A 2NUTA 3EFOA 4U5BE 3W8IA 1HFAA 2NUPB 3QWVA 2FEZA 2WPVA 2IYLD 2J4DA 1VYKA 4H7XA 4AY5A 2G3VA 2YQ8A 2XPIA 4AOFA 3AG2C 1OCZC 2OCCC 3OEOA 1RJ9A 4B8CB 3QJZA 3EG9B 5FTPA 3QKYA 1IHGA 1N1CA 4GAAA 1H2UA 3AS8A 4KNVA 1UG3A 3CQGB 2JLBA 3CHRA 2LAHA 4K0RA 3CHQA 3IHVA 4JHRA 4JL0A 2WXGA 1MMDA 2I9CA 3GANA 4CRWA 3PE4A 4NACA 4CT4A 3PREA 1HH8A 4L2LA 4GZCA 2KCVA 1VK5A 4GA1A 5KYYA 3CK8A 4BSXA 2VYIA 4Q69A 4L23A 3HJCA 4LLCA 4HOSA 4XE0A 4KZCA 3CV0A 3FWVA 2E2EA 3V7OA 3MZLB 3K33A 3EH1A 2NUPA 3KEZA 3S0XA 2MHKA 5G04J 2OG2A 4PH4B 1KLXA 2J49A 3NKEA 2NSZA 3ASNC 4AE4B 4U07A 3CVLA 4J6IA 3Q6MA 4WNEA 3CSKA 2XRYA 1N52A 5JJTA 2L81A 1IQUA 2HYZA 5BV1A 3LAYA 5AJLA 4APOA 3CVUA 1SF8A 2IOLA 4Q94A 3DJUB 2FBNA 2ONDA 2R7TA 3L13A 2XXAB 1FTSA 2Y3DA 3ZC4A 3EIJA 1ELRA 2WXJA 3DXJF 1LKXA 5JJ6A 5LP0A 5T4YA 4U5EE 2HR2A 2J09A 3LVQE 5C1DA 2GW1A 3K1HA 4I6JA 3O4ZA 1ST6A 1HX8A 4DLQA 4TV3A 5IY5C 5AIJA 3BG1B 3EH2A 3PVLA 4I6GA 3SHFA 4JHKA 1TR2A 2WXMA 2BF0X 3U64A 2R7RA 1NA0A 2UY1B 3GZSA 2YHEA 3AS4A 3TG4A 2J45A 3X1OA 4DI3A 4C9BB 2V0PA 2WXQA 4B89A 3ZXSA 3D9PA 1OWNA 1HG2A 2P58C 2WXFA 3ZVRA 4KVMA 1HE8A 1QNFA 2P7VA 5FZRA 4A1SA 4JVSA 4DPRA 3FP3A 3LLIA 3QZCA 1WY6A 4MRUA 4XKBA 2UWJG 4GU5A 3T6JA 2WM9A 4ANWA 3VLFA 2PQRA 3ITFA 4KVOA 2R59A 3EGDB 2J0WA 2XGSA 3PNLB 4JURI 1IQRA 3CQCB 3CZ6A 4AP2A 3GYZA 3K6BA 4HOTA 4B0ZA 4MLPA 2H7BA 2HO1A 3UR3C 4WWOA 5KCMA 4C7OA 2QY7A 2X38A 3PEVB 4OINF 4ZLDA 4XIFA 2VTBB 3I4RB 2R7WA 3D9JA 2Q9CA 3L54A 4JC8A 3FUHA 2I1JA 5T1DB 1MMGA 4PS7A 1NA3A 3S7FA 3LXUX 5G05C 5KYNA 5A6CA 3DMDA 4ANVA 4OIPF 2KGOA 4O6YA 1JUQA 3PZDA 4XKCA 1HO8A 2X51A 3ASGA 3LKUA 3Q49B 3SBTB 4HXIA 5LCWJ 3ZSUA 3CVVA 3VLEA 3L34A 3FDHA 4U5DE 4ACLA 3UNGC 2C0MA 3TD7A 4U5FE 1QZ2A 4I2WA 3MV3B 3EGDA 3I5PA 1ZHXA 3C98A 3ZIBA 3SZRA 3E70C 2XL4A 3DBSA 5KYUB 2PM6A 4UWHA 4WNDA 4CGVA 2JD3A 4DOZA 3TJPA 4UI9J 2NC9A 4BTAA 5FQ6A 3DAGA 2XCBA 1E8ZA 4EBBA 2J4BA 3ML9A 3CVPA 3B7UX 5KJLA 3BG0B 4B8AA 3FH7A 1ZHZA 3O48A 1H2TC 2WVQA 4UWFA 3APFA 4GYTA 3B9QA 1VDYA 1Y6IA 4URKA 2YINA 2WZFA 3EQLF 3EZIA 4RG6A 3DAFA 3S7DA 1FVHA 2A68F 4I1OB 3CEQA 1S0PA 1FFTC 4DBQA 2QFCA 2KCLA 2I6HA 3D9IA 4CSAC 5EX3A 4GZ5A 3EHMA 5J90A 1G8XA 3LY7A 4JA9A 2A5UA 4WWPA 1W2WA 2I2OA 4CIHA 2J9UA 3QMKA 1U3DA 4FLHA 2Y69C 1ZU2A 4JHJA 2E0IA 3AQCA 3F47A 4I6EA 1JWGA 4BJ5A 1QLEC 4YT8A 3FUIA 5ARGA 2KW3C 4C3DA 3PNTB 5DVWA 4YWQA 3SFZA 2IF4A 4N3AA 4G7ZF 1VYIA 4GZDA 1UW4B 1Z3IX 2PZIA 4GA0A 4AXHA 3NZUA 3FTZA 1V54C 1ZHWA 2RG8A 5DQTA 3FUFA 2CHZA 3S7JA 1OKKD 3DD7A 4FADA 5E33A 3LS8A 1Z3YA 2M63A 4UQYA 2E87A 3S7BA 1IYGA 3OXLA 1MNEA 3U9WA 4G24A 3MLGA 4TUUA 3MGBA 4JEUA 4C3BA 4B6IA 4GYYA 5ANLA 5FJYA 5FQ4A 2CNWA 2R7VA 1Z3XA 3P2BA 4FULA 3OWTA 3JCUQ 3MJWA 3IEGA 3FU5A 2A1DD 4ULWA 4AEZC 4UWLA 4E6HA 2WQ7A 4RD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LX8 A;  3HDX A;  4F53 A;  4MRU A;  3CK9 A;  5T3R A;  5E75 A;  3SNX A;  3I4G A;  4PUC A;  5FQ8 A;  3SGH A;  3MYV A;  5FQ4 A;  3IV0 A;  3EHM A;  3KEZ A;  5FQ6 A;  3JQ0 A;  3JQ1 A;  3OTN A;  5J90 A;  3CK8 A;  4LER A;  4F7A A;  3JYS A;  5T4Y A;  3EJN A;  3CGH A;  3EHN A;  4Q69 A;  3P1U A;  3CK7 A;  3GZS A;  5E76 A;  3L22 A;  3MX3 A;  3NQP A;  3LEW A;  5FQ7 A;  3CKC A;  3CKB A;  3MCX A;  3FDH A;  4L7T A;  3QNK A; 
#chains in the Genus database with same CATH topology
 2P9L G;  5B1A E;  4YN0 B;  5DQZ A;  3ASH A;  1VMA A;  3SBS A;  2BC5 A;  1SZA A;  1ZBP A;  3FUL A;  4K7B A;  4A3T A;  2NUT B;  2V4L A;  3EFO B;  3ZG1 A;  4WAB A;  1D8E A;  1UN9 A;  2L0T B;  1PD1 A;  3NF1 A;  3Q7A A;  3ZGQ A;  5BUZ A;  2Z15 A;  2NXP A;  2C2L A;  1PD0 A;  2W4M A;  2R7X A;  3ZFW A;  2YHS A;  4N6H A;  4H54 A;  2G62 A;  3JXI A;  4ANU A;  4DLO A;  1WAS A;  4B94 A;  4FJZ A;  4F3V A;  3T5V A;  4Y6C A;  3CST A;  1RJ9 B;  3U4T A;  4GTV A;  3FHE A;  2EIL E;  2VGY A;  1IHB A;  1VLT A;  2W9Y A;  2KZT A;  3FUM A;  4JZY A;  3NKD A;  2AWI A;  1YLM A;  1MMN A;  1SA4 A;  4DVY P;  1I4Y A;  3NQP A;  3ZU7 B;  3JRT A;  1V4A A;  3ABM C;  3R7Q A;  2VB6 A;  4PFO A;  4CJO A;  2F0Y A;  2XPY A;  4D4X A;  3ZW3 A;  256B A;  2WB2 A;  2QYJ A;  4A4A A;  3SGH A;  2EIN C;  4U9E A;  4OIO F;  3PZ3 A;  3WHN A;  3MEK A;  2DGJ A;  1H6G A;  5KYY B;  1KPS B;  3J5P A;  3X2Q C;  3EDT B;  4N6C A;  3EHN A;  2CGE A;  4JJG A;  5ENR D;  3TOM A;  1NZE A;  1BLX B;  3DSV A;  5KYX A;  3ABK E;  2DYS C;  1BPO A;  1WDY A;  2EIJ C;  3V79 K;  4GA2 A;  2V3C C;  3ASD A;  3T4R A;  2EQX A;  1OR2 A;  5A7D B;  2CW0 F;  2D5R B;  2KNH A;  3KS2 A;  4G11 A;  3HG0 D;  3CHM A;  3FDQ A;  3GEI A;  2WXR A;  2J0X A;  3KSQ A;  1OXJ A;  1DC2 A;  2OVB A;  5BT1 A;  5ENN A;  4KI2 A;  3AQB A;  1SR2 A;  2Y0B G;  3FUN A;  2J9Q A;  5TJ5 E;  4YT2 A;  1LE4 A;  3RW0 A;  4EUK B;  3T8M A;  2DB4 A;  1BI7 B;  1H6P A;  2LSV A;  3R9A B;  1RXQ A;  1CPQ A;  4JCZ A;  4FA6 A;  1CGM E;  3AJM A;  1U2V G;  3RQG A;  3ZYK A;  4G8K A;  4DJA A;  3TXN A;  2ZXP A;  1GGQ A;  5D2M C;  2VQ2 A;  2OJQ A;  4N5Q A;  1ZU5 A;  3FY4 A;  1OCC E;  1WAT A;  3ESK A;  3VF0 A;  3V5Y A;  3QWP A;  3PH0 C;  3PZ1 A;  2M4E A;  3LEV A;  1N11 A;  3HXE A;  3DXM G;  1MHQ A;  2L9J A;  3SNX A;  4U63 A;  1S63 A;  3DE8 A;  2WXO A;  2OVF A;  3TWW A;  4O6N A;  3MV2 B;  3ZIM A;  3AAA C;  4HFF B;  3ECS A;  4P9F A;  3AG4 C;  3KAE A;  4YL1 A;  3HVE A;  1ORS C;  3LEW A;  1WWP A;  3GM1 A;  4IB4 A;  1D1C A;  4F1P A;  4G2V A;  4GMJ A;  4MVS A;  2HV7 A;  1FT2 A;  1TN6 A;  3UKR G;  2V8S E;  5D0Q D;  2X6F A;  2Y3G A;  1IKN D;  3MKQ A;  3H65 A;  4NTF A;  2FI7 A;  1RZ4 A;  3T8K A;  3RSE G;  1R4T A;  2DYR C;  2CCY A;  5JJ7 A;  4GZ3 A;  4DRX E;  2DZO A;  3SEO A;  3B71 A;  5T8I A;  3US6 A;  4BY6 A;  5EX0 A;  2Q3T A;  1O5H A;  1GQA A;  1Q2Z A;  3CAX A;  4Z9H A;  2P2C P;  2P9K G;  3LUT B;  5F5H A;  1RW2 A;  3FUJ A;  4F1S A;  3AG1 E;  1M57 C;  3E4B A;  1LS1 A;  5A69 A;  4IJJ A;  3VLD A;  3CK9 A;  3ZVV A;  5E75 A;  4EZL A;  2F8X K;  5BV0 A;  1Q0D A;  2F37 A;  2WVN A;  2HV6 A;  2H6H A;  3BUA A;  4JA7 A;  4FLB A;  3EPV A;  3HXC A;  4LRZ A;  3NBN B;  3T9O A;  2OEW A;  4FWV A;  5KWD A;  3RIP A;  4BJ1 A;  3OXG A;  4U5G A;  5E76 A;  2L0I A;  4N06 A;  3L6A A;  2P0N A;  2Q00 A;  2ETA A;  2PQN A;  3CKB A;  3EGX B;  2KXP C;  2ILR A;  3ULY A;  3ASO C;  4I3M A;  3D9M A;  3SFY A;  4JD2 G;  3CHP A;  2HKV A;  4YVO A;  3I4U A;  4NRH B;  3C63 A;  1BR4 A;  4YT5 A;  4M3O A;  3DSU A;  2C04 A;  2ICW G;  3HHM A;  1S64 A;  3RIB A;  1PAQ A;  4F6R D;  1B89 A;  4N2S A;  2EPO A;  3EIQ C;  3LS0 A;  1NU9 C;  5T3W A;  3JTL O;  3S9O A;  2BE5 F;  2DBA A;  3QK0 A;  1M56 C;  4K0D A;  2XLW A;  1EDU A;  3RRM B;  3HYM B;  5DLJ A;  4WGY A;  4DJ9 A;  3CVN A;  4TUM A;  5BUO A;  3UUX A;  2XLO A;  4CJG A;  1KZO A;  2BUG A;  4JZA A;  1T01 A;  2L9B A;  1UJK A;  3B95 A;  4C7O B;  3SYN A;  2YLD A;  2ZXO A;  1TFK B;  3UT7 A;  1UOH A;  4GTQ A;  4HVB A;  2X6J A;  3GM3 A;  4M7C A;  4RBN A;  1D0Z A;  1S7Z A;  5L0J A;  2ZXW C;  4JXT A;  3UIO C;  4C3E A;  3ZEF A;  4DX2 A;  4EEC A;  1HMD A;  4PAC A;  1JPL A;  5AC4 A;  3LJN A;  3E9V A;  4DI4 A;  4X0R A;  4BX9 A;  4FC8 A;  4DRJ B;  4IN3 B;  4I44 A;  2VSX E;  3PRZ A;  2QTV A;  2MYO A;  3ASF A;  1PV3 A;  2IOQ A;  1W3B A;  1N4P A;  1OY3 D;  3ULQ A;  2MRI A;  4J7W A;  2MWQ A;  4C0E A;  5KYW A;  2MHR A;  4FHJ A;  4BJ6 A;  1SQM A;  2WMN A;  1Y6D A;  3APD A;  5HRY A;  3DSW A;  3EGX A;  2NYJ A;  1TFO B;  3S27 A;  3W4Y A;  4G7O F;  2FF4 A;  4GTO A;  4JIO A;  1A7E A;  3PHF 2;  3ZRH A;  2DVW A;  5D91 A;  4GML A;  4O60 A;  4OAU C;  4GMR A;  3RQF A;  2H6G A;  3KH2 A;  3DJN B;  2LUH A;  3B7S A;  5ENS D;  2AXZ A;  2J46 A;  5JRA A;  1TNB A;  3QAQ A;  4I17 A;  1OCR E;  2ION A;  3P1U A;  1IZM A;  3MX3 A;  1O87 A;  3F46 A;  3NDB B;  2AXU A;  4YDY A;  4XWJ A;  2DI3 A;  2GRL A;  4G25 A;  4NTB A;  1LM3 B;  3RYL A;  4R7L A;  2YEV A;  3VTY A;  5L0H A;  4HFG A;  4HOU A;  2XL6 A;  3SF4 A;  1XNF A;  4UI9 K;  4ANJ A;  4GEH A;  4PR9 A;  5EGY A;  3C8G B;  1RKE A;  4BSZ B;  3M15 A;  4O79 A;  1O1T A;  1A17 A;  4Q7C A;  2PM7 A;  1YA7 O;  4UQX A;  4YDW A;  3LNR A;  2ETS A;  1NI1 A;  3NMJ A;  5FZQ A;  3RKV A;  4BJ5 C;  3SXY A;  4AK9 A;  2XLD A;  4KMO A;  1SZI A;  5AGF A;  2Y39 A;  1H6K A;  3JSZ A;  4IWB A;  4KYO B;  3NMK A;  2FFH A;  3O6X A;  5D92 A;  2JEK A;  3HTK C;  2WXH A;  3IQ6 A;  3V5Z A;  3K9I A;  2R9R B;  4QDL A;  4HRN A;  4MTO A;  3C8G D;  2EIM C;  2R05 A;  2KK1 A;  2XL8 A;  1K1B A;  4BWR A;  3O10 A;  3IHY A;  4A63 B;  4ANX A;  5JSL A;  5LOZ A;  4HRM B;  1Z63 A;  3HNK A;  2BL2 A;  5AN8 A;  1TNO A;  2B0J A;  1A5E A;  4PS8 A;  3U3W A;  1MX2 A;  5CCM A;  3N24 A;  1KZP A;  4ER9 A;  1DNP A;  4K5B A;  3PS6 A;  4CDA A;  2J8W A;  1P5Q A;  2AP3 A;  4CCA A;  3IXE A;  4C48 B;  5KBA A;  4YJW A;  1M2V B;  1G5Z A;  1XZP A;  4JKV A;  2CDQ A;  2YLG A;  3DSS A;  2ZD9 A;  3JYY A;  4CS9 C;  1JRA A;  4F7A A;  3JYS A;  2WXK A;  3UM1 A;  1ZW2 A;  2OV8 A;  3EJN A;  1EF1 C;  3DZA A;  3MYI A;  1WAO 1;  3RVZ A;  5CMY A;  3T6B A;  3APC A;  1OCO E;  4APF A;  3M1C B;  1TEZ A;  4K1O A;  4PFP A;  4XLN F;  3WOD F;  5E3A A;  3LJB A;  4LLE A;  3IKO B;  3KEA A;  1H2V C;  3CEX A;  3MYF A;  4MTG A;  4MW8 A;  3SP1 A;  4MKT A;  2J07 A;  3IPM O;  2ZPA A;  4LER A;  2WXL A;  4ATG A;  4A55 A;  1OUV A;  1L7C A;  3L22 A;  3TAX A;  2IJG X;  4W8K A;  4GCO A;  4N4W A;  1OT8 A;  3CSF A;  1XGW A;  1E84 A;  3HNJ A;  3FAJ A;  3TWV A;  4CDN A;  2J08 A;  1PC2 A;  3SXM A;  2FO7 A;  4OVV A;  1KT0 A;  4Z68 A;  1TWC A;  1YZC A;  1VTM P;  3NG1 A;  1JCR A;  3RO2 A;  4KZ0 A;  4BEJ A;  3JQ1 A;  2D4U A;  3IQ5 A;  3AG2 E;  3ZHE A;  2OCC E;  1MMA A;  3NYM A;  2QY9 A;  2IXM A;  2M64 A;  3IBE A;  4ATZ D;  4CT0 A;  4MVQ A;  4KBQ A;  3C62 A;  4HEA J;  3U2L A;  3POV A;  4Q5S F;  5HQ8 A;  4WJ0 A;  1M2V A;  3LY8 A;  2GRM A;  4UWG A;  4J32 B;  3TWU A;  1FMV A;  2IEJ A;  5CEA A;  2A69 F;  1BI8 B;  1N0R A;  4CYM D;  4YT4 A;  4ABN A;  5FCL A;  4CX9 A;  1YYJ A;  4KBL A;  3WG7 C;  2KM4 A;  2DWZ A;  3R9M A;  3Q78 A;  4G23 A;  2JPU A;  1ZHT A;  4HLE A;  3PCV A;  4PJL A;  1FFH A;  4N39 A;  3A9C A;  4WNF A;  3SQV A;  3RFY A;  5CCL A;  1YZA A;  3MYV A;  3W9F A;  2XCC A;  1V55 C;  2YZS A;  3TWS A;  4PJJ A;  2V4H C;  2CFZ A;  2BTD A;  4BTB A;  2LAI A;  5KJM A;  1TYQ G;  5BPP A;  1ZU4 A;  2XS8 A;  3OXF A;  2PX0 A;  2ASR A;  1K8K G;  4ILH B;  2IFU A;  3HIZ A;  4HRL A;  1TWH A;  3B0V C;  4RG9 A;  3U0C A;  1Z5Z A;  4FES A;  4U9D A;  2AVP A;  2AU5 A;  5B3S C;  1S05 A;  1D1A A;  5JUA A;  2L6F A;  3D9L A;  2QC9 A;  3RJV A;  3QWW A;  4I2Z A;  5BXU A;  2X6K A;  3WXX A;  2EPK X;  3OTN A;  3S2A A;  2IO3 C;  3C5R A;  2KZT B;  5EKQ D;  1NG1 A;  3FOP A;  5HSW A;  3LVR E;  1N4R A;  2CHW A;  3LES A;  3AU4 A;  1G4W R;  2J7P D;  1IW7 F;  5ITZ F;  3D9K A;  3V5X A;  4CS9 A;  3Q7G A;  4XI0 A;  4EBA A;  1CGO A;  3W2V A;  3TUL A;  1H6O A;  5ENQ D;  3DXK G;  4D4N A;  3ML8 A;  1E7U A;  4BEM J;  3KMI A;  2XHE A;  4O1P A;  3ZYQ A;  4BT8 A;  1YVI A;  2PBE A;  3FUK A;  4GCN A;  5EDS A;  2PP4 A;  2A4Z A;  1M2O A;  3UM0 A;  1Q0F A;  4PS3 A;  4EHP A;  1LD7 A;  5AAO A;  4MQ9 F;  4GQH A;  5L0C A;  3PDM P;  5KJK A;  3CVX A;  3CK7 A;  3R7R A;  4U0Z A;  5CRU A;  3HXB A;  1VOM A;  2LSE A;  4YDO A;  3UMH A;  2F22 A;  5KYX B;  3N0T A;  2L6J A;  4IYP A;  3FH5 A;  4E7S A;  4PJN A;  4EZJ A;  4EBA G;  3SD5 A;  3NOG D;  5L3Q A;  5T3R A;  3TL5 A;  5B1B C;  3CLJ A;  3FXH A;  4GYO A;  1QSP A;  4N5C A;  1C03 A;  3K1I C;  4Y6W A;  3Q4A B;  2H7V C;  3URZ A;  4Q4Z F;  3TQO A;  3SI5 A;  1NSG B;  2VCB A;  3PZ4 A;  3JYH A;  1SZ9 A;  5IY5 E;  4FAP B;  4CS7 A;  2KJG A;  1UG7 A;  4RLY A;  1HF8 A;  3VM6 A;  5AQ9 A;  3JRM O;  4A3V A;  4U0U A;  2Q9B A;  3ABL C;  3B0P A;  3RK6 A;  3G2V A;  2R7U A;  4GTT A;  4XPY A;  3ENE A;  4KNW A;  4HE8 D;  2FGY A;  3PUK A;  4I1M A;  3D9N A;  3VTX A;  1APC A;  1SMY F;  3U66 A;  4IGG A;  4MND A;  2EIK C;  5LCW C;  3LS1 A;  4XTK A;  3CHS A;  3MA5 A;  5AQ7 A;  3UMV A;  1JPJ A;  3BRJ A;  4JJF A;  4L7T A;  4EZK A;  4AM9 A;  5A6K A;  3UKU G;  4ZLC A;  3M79 A;  4AX2 A;  3PUJ A;  4L1B A;  3NZS A;  4EHM A;  2NSG A;  3JUI A;  2XEE A;  1YCS B;  2XRZ A;  2WVO A;  3G4X A;  4XX5 A;  4MVO A;  1Z6T A;  5CBN A;  3Q15 A;  3E33 A;  3FU0 A;  1TJF A;  4IAR A;  3LLK A;  2I1K A;  5CEC B;  5FQ7 A;  1HE9 A;  4I9E A;  3HVE B;  5ENO D;  3EU9 A;  3QB2 A;  3AG3 C;  4LNB A;  5L0F A;  5KNG A;  4AL0 A;  5EHH A;  1YAU O;  2JAB A;  1OCO C;  4GB9 A;  3PZ2 A;  4UI9 C;  3T5X A;  2AVK A;  4UDV A;  3L82 A;  3MKQ B;  4DX7 D;  3TJ6 A;  1NZN A;  1Y4C A;  4C0M A;  1LIH A;  4E0I A;  1HW2 A;  2WVI A;  3V31 A;  2W45 A;  3TOL A;  3DEP A;  5AJD A;  4G78 A;  4MVM A;  3QAR A;  4F4B A;  3L8J A;  3ZXP A;  2GRO B;  1QQE A;  5BW8 C;  4PDX A;  2KAT A;  3W2W A;  3DWL G;  3HNI A;  4TXQ A;  4NQ0 A;  1O1S A;  2AWC A;  5FQ8 A;  1TJC A;  3L17 A;  2DIW A;  1T9K A;  3ESL A;  5HKP A;  2R5S A;  1J8Y F;  1XZQ A;  3J5Q B;  2Y3B A;  4U0S A;  4RDA A;  1OW6 A;  2C03 A;  1DOW A;  2XEN A;  4LCT A;  2B6C A;  2IQC A;  5HI7 A;  3L9T A;  2CYD A;  1N94 A;  3RU0 A;  4AJW A;  4ACK A;  3HLZ A;  3HRA A;  1MQS A;  4J7T A;  3ZYL A;  2KBX A;  5G05 J;  4GTP A;  4FX5 A;  1OWL A;  2HFI A;  3LY9 A;  1Q0K A;  3F6Q A;  4HS2 A;  4BJ6 C;  4XLP F;  2LQG A;  3D9O A;  3IV0 A;  2YNQ A;  2RFM A;  2IU1 A;  4HQD A;  2VGE A;  5KJN A;  2PX3 A;  2XM0 A;  2ETC A;  1H19 A;  4WAF A;  4AL1 A;  1TR4 A;  1OQC A;  5FZS A;  2Q9A A;  3K1I A;  3Q47 B;  3J06 A;  4WWN A;  4NCQ A;  2YL3 A;  1LF8 A;  3FOO A;  4WUY A;  1FMW A;  3L1M A;  1NP7 A;  4U8V D;  2WQ6 A;  1L5J A;  3S29 A;  3GOD A;  1ZVZ A;  3ZN3 A;  2WXI A;  5AEN A;  1OWO A;  1BR2 A;  1V74 B;  2VAS A;  4EPZ A;  1BD8 A;  4EKW A;  5E2Q A;  4ZHB A;  1LS4 A;  4M63 A;  4K5C A;  2R7O A;  4U96 D;  4JB8 P;  4A2N B;  3NYJ A;  3HNL A;  1MZC A;  1B68 A;  3FH8 A;  4XI9 A;  4GPK A;  2V5F A;  1E8X A;  5CMW A;  2LCH A;  2R7S A;  4JTC B;  3DM5 A;  1TNZ A;  3D9H A;  1QYM A;  1D1B A;  3V2O A;  5J08 A;  1Q0G A;  1YA0 A;  3HXF A;  3UPV A;  1OW7 A;  3CR3 A;  5A6B A;  4P29 A;  4DRH B;  1E86 A;  1BR1 A;  3JZ0 A;  3PMR A;  5G2N A;  1UJJ A;  3TXM A;  2XGM A;  1D9S A;  2LSU A;  5KYW B;  4MS2 A;  2PF4 E;  3FAP B;  3UGO A;  3AS5 A;  1HU3 A;  2HE0 A;  3CIA A;  1HXI A;  4QFV A;  2Y1L E;  4ILG A;  4HBD A;  4UWK A;  3OA1 A;  4OVU A;  2X0C A;  2RSE B;  3KKB A;  4J8S A;  3EG9 A;  2VC9 A;  4XQ1 A;  2Y4T A;  4CEM A;  3FUE A;  2XZT G;  3MKR A;  1TKN A;  3SO8 A;  1XWJ A;  3NB2 A;  4YK5 A;  2A6H F;  4FJY A;  2OKU A;  4L2Y A;  3UQ3 A;  1T6I A;  4CIP A;  2R7Q A;  4J30 B;  5CRV A;  1HS6 A;  4BJT A;  3SNH A;  1E96 B;  2XEV A;  1E85 A;  3DM9 B;  3WAQ A;  3GW4 A;  2IXP A;  2IY0 C;  3GZ2 A;  2YHC A;  4PK4 A;  1C02 A;  2NG1 A;  4E18 A;  3ZTZ A;  5EK0 A;  1HZ4 A;  4BT9 A;  3LPZ A;  3Q9U C;  4JE9 A;  5B1A C;  2ZGG A;  1CPR A;  3NRH A;  1RKE B;  2Q7R A;  3LJ3 A;  1WTY A;  2IXN A;  1AWC B;  4O7G A;  4J8F A;  4CS8 C;  4NY3 A;  5A6A A;  3E30 A;  3UXG A;  3RRU A;  4I43 A;  2G3K A;  2WB7 A;  1EPU A;  1YAR O;  2GAQ A;  4EQF A;  4EWC A;  5AC5 A;  2X6H A;  1QPU A;  2VGX B;  4N3B A;  1CGN A;  2NSF A;  4N3C A;  3UIN C;  3L0I A;  3FTW A;  1JWF A;  3L8I A;  2EIL C;  3FVY A;  4QI0 A;  4AE4 A;  1H0A A;  2P1A A;  2YLI A;  1FCH A;  5JHA A;  4D10 C;  4RVB A;  2LO6 A;  4Q96 A;  2YKZ A;  4DVZ A;  3W8H A;  2ZIR A;  3FTV A;  1YMP A;  3LYA A;  1UN8 A;  4CZ2 D;  3DI5 A;  5ANR A;  1V54 E;  1ZHY A;  2EPN A;  2Q7F A;  5JLI A;  3G2W A;  4LNU D;  3BEE A;  3NYL A;  1BU9 A;  3UX4 A;  1NLX A;  4OD4 A;  2XS1 A;  3IEE A;  4LEU A;  4MS6 A;  1OW8 A;  1JCS A;  1YA9 A;  3AJI A;  2XLH A;  5HV9 A;  3I5Q A;  4L6R A;  2J8S D;  4J8E A;  4MVZ A;  2XXA A;  4K03 A;  3CKC A;  3UT4 A;  5JT4 A;  2VSO E;  5L0G A;  4CDR A;  3QNK A;  3ONL A;  4F53 A;  1EYH A;  4DX1 A;  4PJM A;  5CHE E;  3TK0 A;  5B3I A;  3ABK C;  3K7D A;  4AV7 A;  4JCH A;  4KC9 A;  4U04 A;  4XZ4 A;  1E7V A;  4IRU A;  2P9S G;  4H4K C;  5EIL A;  1Z6A A;  2KQ9 A;  4H7Y A;  4WNG A;  1NFO A;  3FTY A;  4U8Y D;  2HJ3 A;  5AAR A;  4IAO A;  3SY2 A;  1ZYR F;  2BKK B;  5AYW D;  5DS4 A;  3UI2 A;  3V2X A;  4NTA A;  1J8M F;  4OIQ F;  1E90 A;  2FUL A;  3KD7 A;  4DK5 A;  2YL7 A;  2AWY A;  5DS5 A;  2KCK A;  2XGO A;  3G2T A;  3UIP C;  2VGX A;  4AIF A;  3TWT A;  3RH3 A;  3KL4 A;  2WXN A;  3FEX A;  3Q6N A;  3FU6 A;  4AY6 A;  1OR3 A;  5GPG B;  1EA8 A;  2UY1 A;  2HS5 A;  3QW1 A;  3C3O A;  3PDN A;  1TN7 A;  1D0X A;  1LVK A;  4CDM A;  3ZHE B;  5EYP F;  2I8B A;  5L3V A;  5A23 A;  4YND A;  3MCX A;  2XM4 A;  4OIR F;  3CQZ A;  4LNG A;  3Q7L A;  5EID A;  2IO2 C;  3K66 A;  2UUH A;  1OCC C;  1DCE A;  2AXV A;  3HXD A;  3QC1 A;  3O55 A;  5FT9 A;  4V3I A;  5M72 A;  4LAC B;  3ABM E;  3DRA A;  4MBG A;  4OYS A;  2VSN A;  4CBE A;  3A11 A;  2R17 C;  3CGH A;  5JS5 A;  2LXL A;  3EU5 A;  5DS6 A;  1JMW A;  3VAY A;  3B7T A;  1KT1 A;  4HFK B;  2O9X A;  4CDV A;  1IXV A;  1H9T A;  4AVX A;  4CS8 A;  3TWR A;  3X2Q E;  4E7Z A;  4I1A A;  2QZA A;  3BQO A;  1T5O A;  3JCK C;  5BNW A;  2DZN A;  4YL3 A;  2XLV A;  4EIY A;  3S84 A;  5G04 C;  4U5H A;  3FEY A;  4UQZ A;  3PEU B;  2WMO A;  2IOS A;  2ZU6 B;  3LCA A;  4G1T A;  4BX8 A;  4HOQ A;  4KT6 B;  2LD6 A;  3ZWI A;  3GZ1 A;  3DST A;  4BET A;  3U2M A;  1ZZP A;  2J9V A;  5CIV A;  3HDX A;  2YWA A;  1ELW A;  2J9W A;  1NU7 D;  2OU6 A;  4W8P A;  2VTB A;  3DPY A;  2P9U G;  1TN8 A;  1WM5 A;  3UGP A;  2R03 A;  3AG1 C;  5F5F A;  2OOE A;  2XSE A;  4LSZ E;  3QVZ A;  2VCC A;  2YQY A;  1A7D A;  2KC3 A;  2KC7 A;  4R32 A;  1OCZ E;  2X6I A;  4DX5 D;  1U89 A;  1LI7 A;  3FHD A;  3UT8 A;  2UUI A;  4IAQ A;  3CVY A;  1WGW A;  5JA4 D;  3VYW A;  3TGO A;  2GRP B;  4E85 A;  3DWW A;  1PCX A;  5FWQ A;  5LX8 A;  4CGW A;  2CHX A;  3RO3 A;  1MJ0 A;  5FIN A;  2Y3H A;  4OD5 A;  3IQC A;  2XRH A;  4BFR A;  3V30 A;  1WN0 A;  5AQB A;  1ORJ A;  4G26 A;  5CI8 A;  1N4Q A;  3BU8 A;  3U9M A;  2CG3 A;  3C8Z A;  3KYI A;  3I3N A;  3TG5 A;  5DBK A;  2WZG A;  2WL8 A;  1X5B A;  4TXP A;  4NUR A;  3QOU A;  3NOC D;  5ARF A;  3B7R L;  3G4Z A;  4ILI A;  4N2Q A;  1TWG A;  4G0H A;  1SYQ A;  1NBB A;  1H7I A;  1QKR A;  3EHQ A;  3NMI A;  2ZGD A;  1KU2 A;  5CI9 A;  4XEI G;  3KYJ A;  3MBG A;  3UM3 A;  4DXW A;  3R2P A;  3B13 A;  1HW1 A;  4J8Y A;  3ONK A;  2R2L A;  3R7C A;  2CNW D;  5KYU A;  1MYO A;  3G2S A;  2GRQ B;  1D8D A;  3Q75 A;  3N71 A;  2FAP B;  3G2U A;  5ENT D;  2W4B A;  2DYR E;  1E8Y A;  4U5C E;  3FFL A;  2HJM A;  2GGF A;  4O6F A;  3D3M A;  3ISM C;  5T3T A;  3I4G A;  4PUC A;  2VJ8 A;  1U6H A;  3HKK A;  2WZL A;  3ASN E;  5AQA A;  1K3Z D;  3JQ0 A;  1O1R A;  3E32 A;  4X8Q A;  2X3M A;  3RQE A;  3Q9N C;  3QDN A;  3MFN A;  1U3C A;  2LNI A;  5BQG A;  1D0Y A;  4JEA A;  3FTU A;  2YL1 A;  4O6M A;  1K05 A;  4ME2 A;  2Q4F A;  4HB5 A;  1GS9 A;  3UMI A;  1LI5 A;  3QTH A;  1TQG A;  4XEK A;  2VH3 A;  3H2V A;  2WXP A;  2A6E F;  5E3C A;  2XQ0 A;  3CHO A;  3AGT A;  4JPS A;  3FTX A;  2OJE D;  4DBR A;  4HNA D;  4A1G A;  2CG2 A;  3IQT A;  1Z23 A;  1INZ A;  3U9J A;  3JT1 A;  4BES A;  1QQ3 A;  4JC7 A;  3ASO E;  3ZNG A;  1E8W A;  2HM8 A;  2PL2 A;  4IUL A;  1AEP A;  3N2Z B;  5C2Y A;  1OCR C;  3RKO F;  4J0U A;  1JCQ A;  4KXK B;  1FVF A;  1DCQ A;  4P6I C;  4RQI A;  4GYW A;  2I15 A;  5DIZ A;  4HLL A;  3O39 A;  2CFU A;  3RF3 A;  1NL4 A;  3L16 A;  2IXO A;  3UMK A;  2Y3A A;  3JSE O;  2EPL X;  3ZKJ A;  1FNT c;  1G4U S;  1LE2 A;  4DUI A;  2MYS A;  1Z5S C;  2WQH A;  2ZIS A;  4DRI B;  4G7H F;  1N4S A;  4E0H A;  1R5I D;  5EYL A;  2C0L A;  3SXK A;  5JHB A;  3FU3 A;  2L6G A;  3CVW A;  2ETB A;  2GFH A;  2H7O A;  1OKK A;  3DE9 A;  2ZXW E;  2VSY A;  2J7P A;  5G55 A;  1VLS A;  3SZ7 A;  1JPN A;  4LDK A;  2ZXR A;  1GW6 A;  3L08 A;  4GPM A;  4UUC A;  2H8A A;  1A0B A;  1N54 A;  4FP7 A;  3RRN B;  5D0O D;  3T6G B;  3DEO A;  2J9B A;  3CVQ A;  3LDZ A;  1MND A;  2IBF A;  2BKG A;  2V26 A;  2RD0 A;  2GRR B;  3ZYM A;  1C17 M;  3DPD A;  2L6H A;  3ULE G;  5LFA A;  4FU3 A;  4CSA A;  1Z7Q c;  3QVY A;  3AU5 A;  4I9C A;  4QI2 A;  2AW6 A;  2A0U A;  5EN5 D;  4U95 D;  4W9R A;  4JRZ A;  1JAF A;  4J8D A;  3NAW A;  1OWM A;  3U8P A;  2MOW A;  3S28 A;  3FTS A;  3C72 A;  1TWA A;  3Q5M A;  2PFD A;  4TRQ A;  2HMQ A;  3ZPJ A;  1LTX A;  4JEH A;  1AUE A;  4BG0 A;  1ELK A;  2F8Y A;  2XPZ A;  5CBO A;  4GZ6 A;  2QLA A;  2NPU A;  4JW1 A;  3E34 A;  2DCP A;  4NQF A;  3QW0 A;  1Y8M A;  2B0O E;  3FUD A;  4RSY A;  4U8H A;  2YL0 A;  3B29 A;  1OWP A;  4FHK A;  1DVP A;  4YVQ C;  4HOR A;  2P6V A;  3OAW A;  1QZX A;  1HE1 A;  3EZH A;  1HG5 A;  3PE3 A;  3B0U X;  2Y4U A;  4LUN U;  1KNY A;  2NUT A;  1PY1 A;  3EFO A;  1EI7 A;  4U5B E;  4GTR A;  3W8I A;  1HFA A;  3U5S A;  2NUP B;  4YDE A;  2QYU A;  3QWV A;  2FEZ A;  2WPV A;  2IYL D;  2J4D A;  5ENP D;  3ZUV B;  1VYK A;  4H7X A;  4AY5 A;  3LNM B;  2G3V A;  2YQ8 A;  2XPI A;  1KTM A;  4AOF A;  3AG2 C;  1OCZ C;  2LFF A;  2OCC C;  3OEO A;  1RJ9 A;  2OOC A;  2EIM E;  4B8C B;  3U8V A;  3QJZ A;  3EG9 B;  5FTP A;  3QKY A;  1IHG A;  1N1C A;  4GAA A;  3GM2 A;  1H2U A;  3AS8 A;  4KNV A;  5A6B D;  1UG3 A;  3CQG B;  2JLB A;  2LAH A;  3CHR A;  3CHQ A;  4K0R A;  3IHV A;  4JHR A;  4JL0 A;  1UFB A;  2WXG A;  1MMD A;  1QVX A;  2I9C A;  3GAN A;  4CRW A;  3PE4 A;  3TWX A;  4NAC A;  4CT4 A;  3BEH A;  1FT1 A;  3PRE A;  1YJG A;  1HH8 A;  3TJ5 A;  4YL0 A;  1S70 B;  4L2L A;  1RKC A;  4GZC A;  5COF A;  5F28 E;  2KCV A;  1VK5 A;  4GA1 A;  3Q7F A;  5KYY A;  1SVX A;  5JVE A;  4JEB A;  4XEV A;  3CK8 A;  4BSX A;  2VYI A;  4Q69 A;  4L23 A;  2QNL A;  1TNU A;  3HJC A;  4LLC A;  3JXJ A;  4XE0 A;  4HOS A;  4KZC A;  3CV0 A;  3FWV A;  2E2E A;  3V7O A;  2B0H A;  4LDQ A;  3ZQY A;  5L0D A;  3MZL B;  3K33 A;  2EPM X;  4BER A;  3EH1 A;  3M4C A;  2KYH A;  2NUP A;  3KEZ A;  1F1M A;  4P9T A;  3S0X A;  5BQI A;  2MHK A;  4LG6 A;  5G04 J;  2OG2 A;  4PH4 B;  5EIB E;  1KLX A;  2J49 A;  4XPW A;  1YYH A;  3NKE A;  2NSZ A;  3ASN C;  4AE4 B;  4U07 A;  2IM8 A;  3CVL A;  4J6I A;  3Q6M A;  2HUJ A;  4WNE A;  2HSB A;  3CSK A;  2XRY A;  1N52 A;  4LDR A;  5JJT A;  2XZD G;  2L81 A;  1IQU A;  4JTA B;  2HYZ A;  4L9P A;  5BV1 A;  1OXB A;  3LAY A;  5AJL A;  4APO A;  3CVU A;  1SF8 A;  2IOL A;  4Q94 A;  3DJU B;  4EBK A;  1ZB1 A;  2FBN A;  2OND A;  2R7T A;  3L13 A;  1BBH A;  2HZ8 A;  4O1O A;  2RD9 A;  2XXA B;  1G3N B;  2OEV A;  1FTS A;  4ONS A;  2Y3D A;  5A6J A;  3ZC4 A;  3EIJ A;  2FO1 E;  1ELR A;  2WXJ A;  3WG7 E;  3DXJ F;  3ZQV A;  5K0I A;  1LKX A;  2Y69 E;  5JJ6 A;  2RFA A;  5T4Y A;  5LP0 A;  1DOV A;  4U5E E;  1EKY A;  2HR2 A;  2J09 A;  2PNN A;  3LVQ E;  1WOL A;  5C1D A;  2GW1 A;  3K1H A;  4I6J A;  3O4Z A;  3KPH A;  1V55 E;  5JP7 A;  1ST6 A;  1HX8 A;  4DLQ A;  4TV3 A;  5FIO A;  5IY5 C;  3DKA A;  5AIJ A;  3BG1 B;  3EH2 A;  3PVL A;  4I6G A;  3KSL A;  3SHF A;  4JHK A;  1TR2 A;  2WXM A;  3DSX A;  2YVK A;  2BF0 X;  3U64 A;  2R7R A;  3LEO A;  4E17 A;  1NA0 A;  2UY1 B;  3GZS A;  5B3S E;  1ZW3 A;  1AVO B;  2YHE A;  3AS4 A;  3TG4 A;  2J45 A;  3X1O A;  4DI3 A;  4GTS A;  4C9B B;  3EHR A;  1AP7 A;  4XPX A;  2V0P A;  3Q73 A;  2WXQ A;  4B89 A;  3ZXS A;  3D9P A;  2OQM A;  1OWN A;  4NIK A;  1MX4 A;  1HG2 A;  2P58 C;  2WXF A;  3ZVR A;  4KVM A;  4JTD B;  1HE8 A;  1QNF A;  1N95 A;  5H7P A;  2P7V A;  5FZR A;  4A1S A;  4JVS A;  4DPR A;  3B7B A;  3GEE A;  1O3U A;  3LLI A;  3FP3 A;  4GTM A;  3QZC A;  1WY6 A;  4MRU A;  4XKB A;  4B93 B;  2UWJ G;  4GU5 A;  3T6J A;  2WM9 A;  3ATP A;  4ANW A;  3VLF A;  2PQR A;  3ITF A;  4KVO A;  2R59 A;  3EGD B;  5D66 A;  2J0W A;  3GWN A;  2XGS A;  2A5E A;  1I4Z A;  3PNL B;  1RCP A;  4JUR I;  1IQR A;  4Z9J A;  2GRN B;  5B1B E;  3CQC B;  3CZ6 A;  4MTF A;  4AP2 A;  3GYZ A;  3K6B A;  4HOT A;  4G8L A;  4B0Z A;  4MLP A;  2H7B A;  2HO1 A;  1A41 A;  3UR3 C;  4HI8 A;  4WWO A;  5KCM A;  4C7O A;  2QY7 A;  3W9G A;  5COG A;  2X38 A;  2V5Q C;  3PEV B;  4OIN F;  4ZLD A;  4XIF A;  2VTB B;  3I4R B;  1VB5 A;  4J7Y A;  2R7W A;  1FAP B;  2PNO A;  5COM A;  3D9J A;  2LK4 A;  2QE9 A;  2Q9C A;  3L54 A;  2TMV P;  1YDI A;  4JC8 A;  3G50 A;  3TWQ A;  2R02 A;  2KSF A;  5BXO A;  4QQI A;  3FUH A;  2I1J A;  5T1D B;  1MMG A;  3ABL E;  4PS7 A;  3H2U A;  1N9A A;  1A7V A;  1NA3 A;  1Q0M A;  1I5N A;  3S7F A;  3LXU X;  5G05 C;  5KYN A;  5A6C A;  3DMD A;  1SA5 A;  4ANV A;  4EBJ A;  4OIP F;  2KGO A;  4O6Y A;  4U7E B;  1LPE A;  3AGU A;  1JUQ A;  2EIK E;  3PZD A;  4XKC A;  3GEH A;  1HO8 A;  3Q79 A;  5CER B;  2X51 A;  3ASG A;  3LKU A;  3Q49 B;  3UM2 A;  3SBT B;  4NC3 A;  4ULV A;  4K5A B;  4HXI A;  3AOU A;  5LCW J;  3ZSU A;  3CVV A;  3VLE A;  3L34 A;  2EIN E;  3FDH A;  1L3P A;  4U5D E;  4ACL A;  1BDJ B;  5L0I A;  2LFD A;  3RVY A;  3UNG C;  2C0M A;  3TD7 A;  4U5F E;  1QZ2 A;  4MVR A;  3C3R A;  4I2W A;  3EUV A;  1BZ4 A;  1U0B B;  3MV3 B;  3EGD A;  3ZTM A;  3I5P A;  2QUP A;  3AG3 E;  2DYS E;  4Z9I A;  4WGZ A;  3S90 A;  3C3Q A;  1ZHX A;  2EIJ E;  3C98 A;  3ZIB A;  1HY5 A;  3SZR A;  2HMZ A;  3E70 C;  2RKK A;  2XL4 A;  3DBS A;  5KYU B;  2PM6 A;  4UWH A;  4WND A;  3GOR A;  1RMV A;  4CGV A;  2JD3 A;  4DOZ A;  2L7A A;  3C8G A;  3TJP A;  4UI9 J;  3VRC A;  2NC9 A;  1HMO A;  4XEF A;  4BTA A;  2OEX A;  3ZDL A;  5FQ6 A;  3SXZ A;  1WG0 A;  3DAG A;  2LXM A;  4DX6 D;  2LP4 A;  2XCB A;  1E8Z A;  4EBB A;  2J4B A;  3ML9 A;  1MX6 A;  4BEP A;  2GWW A;  3CVP A;  3B7U X;  5KJL A;  3BG0 B;  4B8A A;  1JR8 A;  3FH7 A;  1ZHZ A;  3O48 A;  1H2T C;  5JMN D;  2WVQ A;  4UWF A;  3APF A;  1EQ1 A;  2YRF A;  4HI9 A;  4GYT A;  3B9Q A;  2L6B A;  1VDY A;  1O5M A;  5KNH D;  1Y6I A;  4URK A;  2YIN A;  5FZT A;  2WZF A;  3EQL F;  3EZI A;  4RG6 A;  3DAF A;  2P9P G;  3S7D A;  1SW6 A;  4ZFH A;  1FVH A;  2A68 F;  1T6Q A;  2GDC A;  4I1O B;  3CEQ A;  1E83 A;  1S0P A;  3RAU A;  1FFT C;  4DBQ A;  3E37 A;  2QFC A;  2KCL A;  3C18 A;  2HSQ A;  2I6H A;  3D9I A;  4CSA C;  1MQV A;  5EX3 A;  1NFN A;  5HS0 A;  4GZ5 A;  2A0B A;  3AG4 E;  1OXK A;  3EHM A;  5J90 A;  1G8X A;  3SFX A;  3LY7 A;  3M4B A;  2A5U A;  4JA9 A;  1W2W A;  2I2O A;  4WWP A;  2P9N G;  4CIH A;  4TXR A;  4MVU A;  2J9U A;  3QMK A;  1U3D A;  4FLH A;  4CDY A;  1FPP A;  2Y69 C;  1ZU2 A;  2H6I A;  4JHJ A;  2E0I A;  2JX0 A;  5CED B;  3AQC A;  3JUE A;  3F47 A;  3GWL A;  4I6E A;  1JWG A;  1K1A A;  4BJ5 A;  1QLE C;  4YT8 A;  3FUI A;  5ARG A;  2GA0 A;  2KW3 C;  4C3D A;  2P9I G;  1GM5 A;  1K40 A;  3PNT B;  2H6F A;  5DVW A;  4YWQ A;  3SFZ A;  1H9G A;  3T9K A;  1QBQ A;  1M6T A;  2IF4 A;  4N3A A;  1TNY A;  2XLM A;  1YYX A;  4G7Z F;  1VYI A;  4GZD A;  3C7J A;  1UW4 B;  1Z3I X;  2BED A;  2PZI A;  4GA0 A;  1N0Q A;  4AXH A;  3NZU A;  5BQH A;  1NFI E;  3FTZ A;  2XEH A;  1V54 C;  3U3B A;  1ZHW A;  3UTM A;  2R25 A;  2RG8 A;  2P61 A;  5DQT A;  3FUF A;  2CHZ A;  3S7J A;  1OKK D;  3DD7 A;  1E2X A;  4FAD A;  5E33 A;  3LS8 A;  1FR0 A;  1Z3Y A;  2M63 A;  4MW3 A;  1ORY A;  4UQY A;  2E87 A;  3S7B A;  3FMS A;  1IYG A;  3OXL A;  1MNE A;  3U9W A;  4G24 A;  3MLG A;  1JOG A;  3MGB A;  4JEU A;  4C3B A;  4B6I A;  4TUU A;  4GYY A;  1X81 A;  5ANL A;  3IHU A;  5FJY A;  5FQ4 A;  1T6U A;  4BPM A;  2AJA A;  2CNW A;  1LD8 A;  2R7V A;  1Z3X A;  1K04 A;  2LIG A;  3P2B A;  3OWT A;  4FUL A;  3JCU Q;  3MJW A;  3IEG A;  3FU5 A;  2A1D D;  4OAV B;  4ULW A;  4AEZ C;  2XLE A;  4UWL A;  4E6H A;  3U3F A;  2VCA A;  2WQ7 A;  4RD9 A; 
#chains in the Genus database with same CATH homology
 4YN0 B;  5DQZ A;  3ASH A;  1VMA A;  3SBS A;  1SZA A;  1ZBP A;  3FUL A;  4K7B A;  4A3T A;  2NUT B;  2V4L A;  3EFO B;  3ZG1 A;  1UN9 A;  2L0T B;  1PD1 A;  3NF1 A;  5BUZ A;  3ZGQ A;  2Z15 A;  2NXP A;  2C2L A;  1PD0 A;  2W4M A;  2R7X A;  3ZFW A;  2YHS A;  2G62 A;  4ANU A;  4DLO A;  4B94 A;  4FJZ A;  4F3V A;  3T5V A;  4Y6C A;  3CST A;  1RJ9 B;  3U4T A;  3FHE A;  2VGY A;  2W9Y A;  2KZT A;  3FUM A;  4JZY A;  3NKD A;  2AWI A;  1MMN A;  4DVY P;  3NQP A;  3JRT A;  3ABM C;  3R7Q A;  2VB6 A;  4PFO A;  2XPY A;  3ZW3 A;  2WB2 A;  3SGH A;  2EIN C;  4OIO F;  3MEK A;  2DGJ A;  5KYY B;  3X2Q C;  3EDT B;  3EHN A;  2CGE A;  4JJG A;  1NZE A;  5KYX A;  2DYS C;  1BPO A;  2EIJ C;  4GA2 A;  2V3C C;  3ASD A;  3T4R A;  2EQX A;  5A7D B;  2CW0 F;  2D5R B;  2KNH A;  3KS2 A;  4G11 A;  3CHM A;  3FDQ A;  2WXR A;  2J0X A;  2OVB A;  5BT1 A;  5ENN A;  4KI2 A;  3AQB A;  3FUN A;  2J9Q A;  4YT2 A;  3T8M A;  2LSV A;  3R9A B;  4FA6 A;  3ZYK A;  4DJA A;  3TXN A;  2ZXP A;  2VQ2 A;  1ZU5 A;  3FY4 A;  3ESK A;  3QWP A;  3PH0 C;  2M4E A;  3LEV A;  1MHQ A;  2L9J A;  3SNX A;  4U63 A;  2WXO A;  2OVF A;  4O6N A;  3MV2 B;  3ZIM A;  4HFF B;  3ECS A;  3AG4 C;  3KAE A;  3HVE A;  3LEW A;  1D1C A;  4G2V A;  4GMJ A;  2HV7 A;  2V8S E;  5D0Q D;  2X6F A;  2Y3G A;  3MKQ A;  3H65 A;  2FI7 A;  2DYR C;  5JJ7 A;  4GZ3 A;  3SEO A;  5T8I A;  4BY6 A;  5EX0 A;  2Q3T A;  1O5H A;  5F5H A;  3FUJ A;  4F1S A;  1M57 C;  3E4B A;  1LS1 A;  4IJJ A;  3VLD A;  3CK9 A;  3ZVV A;  5E75 A;  4EZL A;  5BV0 A;  2WVN A;  2HV6 A;  4JA7 A;  4FLB A;  3EPV A;  4LRZ A;  4FWV A;  3RIP A;  4BJ1 A;  3OXG A;  4U5G A;  5E76 A;  2L0I A;  4N06 A;  3L6A A;  2PQN A;  3CKB A;  3EGX B;  2ILR A;  3ASO C;  4I3M A;  3D9M A;  3CHP A;  4YVO A;  3I4U A;  4NRH B;  4YT5 A;  1BR4 A;  4M3O A;  2C04 A;  3HHM A;  4N2S A;  3RIB A;  1PAQ A;  1B89 A;  3EIQ C;  3LS0 A;  1NU9 C;  5T3W A;  2BE5 F;  2DBA A;  3QK0 A;  1M56 C;  4K0D A;  1EDU A;  3RRM B;  3HYM B;  5DLJ A;  3CVN A;  5BUO A;  3UUX A;  2BUG A;  4JZA A;  2L9B A;  1UJK A;  4C7O B;  3SYN A;  2ZXO A;  3UT7 A;  4HVB A;  2X6J A;  4RBN A;  1D0Z A;  1S7Z A;  2ZXW C;  4JXT A;  4C3E A;  3ZEF A;  4EEC A;  1JPL A;  3E9V A;  4DI4 A;  4X0R A;  4BX9 A;  4FC8 A;  4IN3 B;  4I44 A;  2VSX E;  3PRZ A;  2QTV A;  3ASF A;  2IOQ A;  1W3B A;  3ULQ A;  2MRI A;  2MWQ A;  4C0E A;  5KYW A;  4FHJ A;  4BJ6 A;  1SQM A;  2WMN A;  3APD A;  3EGX A;  3S27 A;  2FF4 A;  4G7O F;  3PHF 2;  3ZRH A;  5D91 A;  4GML A;  3KH2 A;  3B7S A;  3DJN B;  2AXZ A;  2J46 A;  3QAQ A;  4I17 A;  2ION A;  3P1U A;  1IZM A;  3MX3 A;  1O87 A;  3F46 A;  3NDB B;  2AXU A;  4XWJ A;  2GRL A;  4G25 A;  3VTY A;  3RYL A;  4R7L A;  2YEV A;  4HFG A;  4HOU A;  3SF4 A;  1XNF A;  4UI9 K;  4ANJ A;  4GEH A;  5EGY A;  4O79 A;  1A17 A;  4Q7C A;  2PM7 A;  4UQX A;  3LNR A;  5FZQ A;  3RKV A;  4BJ5 C;  4AK9 A;  4KMO A;  1SZI A;  2Y39 A;  1H6K A;  3JSZ A;  4IWB A;  4KYO B;  2FFH A;  3O6X A;  5D92 A;  2JEK A;  3HTK C;  2WXH A;  3K9I A;  4QDL A;  2EIM C;  4BWR A;  3IHY A;  4ANX A;  5LOZ A;  1Z63 A;  2B0J A;  4PS8 A;  3U3W A;  5CCM A;  3N24 A;  1DNP A;  3PS6 A;  1P5Q A;  4CCA A;  4YJW A;  1M2V B;  2CDQ A;  4CS9 C;  4F7A A;  3JYS A;  2WXK A;  2OV8 A;  3EJN A;  1EF1 C;  3DZA A;  1WAO 1;  5CMY A;  3T6B A;  3APC A;  4APF A;  3M1C B;  1TEZ A;  4PFP A;  4XLN F;  3WOD F;  5E3A A;  3LJB A;  4LLE A;  3IKO B;  1H2V C;  3SP1 A;  4MKT A;  2J07 A;  2ZPA A;  4LER A;  2WXL A;  4ATG A;  4A55 A;  1OUV A;  3L22 A;  3TAX A;  2IJG X;  4W8K A;  4GCO A;  3CSF A;  1XGW A;  3FAJ A;  4CDN A;  2J08 A;  1PC2 A;  2FO7 A;  4OVV A;  1KT0 A;  1TWC A;  3NG1 A;  3RO2 A;  4KZ0 A;  4BEJ A;  3JQ1 A;  3ZHE A;  1MMA A;  3NYM A;  2QY9 A;  2IXM A;  3IBE A;  4CT0 A;  4KBQ A;  4HEA J;  3POV A;  4Q5S F;  5HQ8 A;  4WJ0 A;  1M2V A;  3LY8 A;  2GRM A;  4UWG A;  4J32 B;  1FMV A;  2A69 F;  4YT4 A;  4ABN A;  5FCL A;  4KBL A;  3WG7 C;  2KM4 A;  4G23 A;  1ZHT A;  4HLE A;  4PJL A;  1FFH A;  4N39 A;  4WNF A;  3RFY A;  5CCL A;  3MYV A;  2XCC A;  1V55 C;  2YZS A;  4PJJ A;  2CFZ A;  2BTD A;  4BTB A;  2LAI A;  5KJM A;  5BPP A;  1ZU4 A;  3OXF A;  2PX0 A;  4ILH B;  2IFU A;  3HIZ A;  1TWH A;  3B0V C;  4RG9 A;  1Z5Z A;  4FES A;  2AVP A;  5B3S C;  1D1A A;  3D9L A;  3RJV A;  3QWW A;  4I2Z A;  2X6K A;  3WXX A;  3OTN A;  3S2A A;  2KZT B;  5EKQ D;  1NG1 A;  5HSW A;  3LVR E;  2CHW A;  3LES A;  3AU4 A;  2J7P D;  1IW7 F;  3D9K A;  4CS9 A;  3Q7G A;  4XI0 A;  4EBA A;  3W2V A;  3ML8 A;  1E7U A;  3KMI A;  2XHE A;  3ZYQ A;  4BT8 A;  4GCN A;  3FUK A;  5EDS A;  2PP4 A;  2A4Z A;  1M2O A;  4PS3 A;  4MQ9 F;  5KJK A;  3CVX A;  3CK7 A;  3R7R A;  4U0Z A;  1VOM A;  2LSE A;  3UMH A;  5KYX B;  3N0T A;  2L6J A;  4IYP A;  3FH5 A;  4E7S A;  4PJN A;  4EZJ A;  4EBA G;  3SD5 A;  5T3R A;  5L3Q A;  3TL5 A;  5B1B C;  3CLJ A;  4GYO A;  4N5C A;  3K1I C;  4Y6W A;  3Q4A B;  2H7V C;  3URZ A;  4Q4Z F;  3SI5 A;  3JYH A;  1SZ9 A;  4CS7 A;  2KJG A;  1HF8 A;  4A3V A;  4U0U A;  2Q9B A;  3ABL C;  3B0P A;  3RK6 A;  3G2V A;  2R7U A;  3ENE A;  4KNW A;  4HE8 D;  2FGY A;  3PUK A;  4I1M A;  3D9N A;  3VTX A;  1SMY F;  3U66 A;  4MND A;  2EIK C;  5LCW C;  3LS1 A;  4XTK A;  3CHS A;  3MA5 A;  3UMV A;  1JPJ A;  4JJF A;  4L7T A;  4EZK A;  4AM9 A;  4ZLC A;  4AX2 A;  3PUJ A;  4L1B A;  3NZS A;  3JUI A;  2XRZ A;  2WVO A;  4XX5 A;  1Z6T A;  3Q15 A;  3FU0 A;  1TJF A;  2I1K A;  3LLK A;  5FQ7 A;  4I9E A;  3HVE B;  3QB2 A;  3AG3 C;  5EHH A;  1OCO C;  4GB9 A;  4UI9 C;  3T5X A;  3MKQ B;  1NZN A;  4C0M A;  2WVI A;  2W45 A;  5AJD A;  3QAR A;  4F4B A;  1QQE A;  5BW8 C;  4PDX A;  2KAT A;  3W2W A;  4NQ0 A;  5FQ8 A;  1TJC A;  3L17 A;  2DIW A;  3ESL A;  2R5S A;  1J8Y F;  2Y3B A;  4U0S A;  4RDA A;  2C03 A;  4LCT A;  2IQC A;  5HI7 A;  3RU0 A;  4AJW A;  4ACK A;  3HLZ A;  1MQS A;  3ZYL A;  5G05 J;  4FX5 A;  1OWL A;  3LY9 A;  4HS2 A;  4BJ6 C;  4XLP F;  3D9O A;  3IV0 A;  2YNQ A;  2IU1 A;  5KJN A;  2PX3 A;  1H19 A;  4WAF A;  5FZS A;  2Q9A A;  3Q47 B;  4WWN A;  1LF8 A;  4WUY A;  1FMW A;  1NP7 A;  2WQ6 A;  1L5J A;  3S29 A;  3GOD A;  3ZN3 A;  2WXI A;  5AEN A;  1OWO A;  1BR2 A;  2VAS A;  4EPZ A;  5E2Q A;  4M63 A;  2R7O A;  4A2N B;  3NYJ A;  3FH8 A;  4XI9 A;  4GPK A;  2V5F A;  1E8X A;  5CMW A;  2R7S A;  3DM5 A;  1D1B A;  5J08 A;  1YA0 A;  3UPV A;  3CR3 A;  4P29 A;  1BR1 A;  3PMR A;  5G2N A;  1UJJ A;  3TXM A;  2XGM A;  2LSU A;  5KYW B;  2PF4 E;  3UGO A;  3AS5 A;  1HU3 A;  3CIA A;  1HXI A;  4QFV A;  4ILG A;  4UWK A;  3OA1 A;  4OVU A;  3KKB A;  4J8S A;  3EG9 A;  4CEM A;  2Y4T A;  3FUE A;  3MKR A;  1TKN A;  2A6H F;  4FJY A;  4L2Y A;  3UQ3 A;  2R7Q A;  4J30 B;  1HS6 A;  4BJT A;  3SNH A;  1E96 B;  2XEV A;  3DM9 B;  3GW4 A;  2IXP A;  3GZ2 A;  2YHC A;  4PK4 A;  2NG1 A;  1HZ4 A;  4BT9 A;  3LPZ A;  5B1A C;  3NRH A;  3LJ3 A;  2IXN A;  4O7G A;  4J8F A;  4CS8 C;  4NY3 A;  3RRU A;  4I43 A;  2G3K A;  2WB7 A;  1EPU A;  4EQF A;  4EWC A;  2X6H A;  2VGX B;  4N3B A;  4N3C A;  3L0I A;  3FTW A;  1JWF A;  2EIL C;  3FVY A;  4QI0 A;  4AE4 A;  1H0A A;  5JHA A;  1FCH A;  4D10 C;  4RVB A;  2LO6 A;  4Q96 A;  4DVZ A;  3W8H A;  3FTV A;  3LYA A;  1UN8 A;  5ANR A;  1ZHY A;  2Q7F A;  3G2W A;  3BEE A;  3NYL A;  3UX4 A;  4OD4 A;  3IEE A;  4LEU A;  4MS6 A;  3I5Q A;  4J8E A;  2XXA A;  4K03 A;  3CKC A;  3UT4 A;  2VSO E;  4CDR A;  3QNK A;  3ONL A;  4F53 A;  1EYH A;  4PJM A;  5CHE E;  3ABK C;  3K7D A;  4AV7 A;  4JCH A;  4KC9 A;  4U04 A;  4XZ4 A;  1E7V A;  4IRU A;  4H4K C;  1Z6A A;  2KQ9 A;  4H7Y A;  4WNG A;  3FTY A;  4IAO A;  1ZYR F;  5AYW D;  5DS4 A;  1J8M F;  4OIQ F;  1E90 A;  2FUL A;  3KD7 A;  4DK5 A;  5DS5 A;  2KCK A;  2XGO A;  3G2T A;  2VGX A;  4AIF A;  3RH3 A;  3KL4 A;  2WXN A;  3FEX A;  3Q6N A;  3FU6 A;  4AY6 A;  2UY1 A;  3PDN A;  1D0X A;  1LVK A;  4CDM A;  3ZHE B;  2I8B A;  5L3V A;  5A23 A;  4YND A;  3MCX A;  4OIR F;  3CQZ A;  3Q7L A;  3K66 A;  1OCC C;  2AXV A;  3QC1 A;  5FT9 A;  4V3I A;  5M72 A;  4LAC B;  4OYS A;  2VSN A;  4CBE A;  2R17 C;  3CGH A;  5DS6 A;  3VAY A;  3B7T A;  1KT1 A;  4HFK B;  2O9X A;  4AVX A;  4CS8 A;  4E7Z A;  4I1A A;  3JCK C;  5BNW A;  5G04 C;  4U5H A;  3FEY A;  4UQZ A;  3PEU B;  2WMO A;  2IOS A;  2ZU6 B;  3LCA A;  4G1T A;  4BX8 A;  4HOQ A;  4KT6 B;  3GZ1 A;  2J9V A;  3HDX A;  1ELW A;  2J9W A;  1NU7 D;  2VTB A;  1WM5 A;  3UGP A;  3AG1 C;  5F5F A;  2OOE A;  2XSE A;  2KC7 A;  2X6I A;  3FHD A;  3UT8 A;  3CVY A;  1WGW A;  3VYW A;  3TGO A;  4E85 A;  1PCX A;  5FWQ A;  5LX8 A;  4CGW A;  2CHX A;  3RO3 A;  2Y3H A;  4OD5 A;  2XRH A;  4BFR A;  4G26 A;  5CI8 A;  2CG3 A;  3I3N A;  3TG5 A;  5DBK A;  2WZG A;  2WL8 A;  1X5B A;  4NUR A;  3QOU A;  5ARF A;  3B7R L;  4ILI A;  4N2Q A;  1TWG A;  4G0H A;  1KU2 A;  5CI9 A;  3B13 A;  3ONK A;  2CNW D;  5KYU A;  3G2S A;  3N71 A;  3G2U A;  2W4B A;  1E8Y A;  4U5C E;  3FFL A;  2GGF A;  4O6F A;  3D3M A;  5T3T A;  3I4G A;  4PUC A;  2VJ8 A;  2WZL A;  3JQ0 A;  2X3M A;  3QDN A;  1U3C A;  2LNI A;  3FTU A;  1D0Y A;  4O6M A;  4ME2 A;  3UMI A;  2VH3 A;  2WXP A;  2A6E F;  5E3C A;  2XQ0 A;  3CHO A;  4JPS A;  3FTX A;  4DBR A;  4A1G A;  2CG2 A;  1Z23 A;  1INZ A;  3JT1 A;  1E8W A;  2HM8 A;  2PL2 A;  4IUL A;  3N2Z B;  5C2Y A;  1OCR C;  3RKO F;  4J0U A;  4KXK B;  1FVF A;  4P6I C;  4GYW A;  5DIZ A;  3O39 A;  2CFU A;  3L16 A;  2IXO A;  3UMK A;  2Y3A A;  2MYS A;  2WQH A;  4G7H F;  2C0L A;  5JHB A;  3FU3 A;  3CVW A;  2GFH A;  2H7O A;  1OKK A;  2VSY A;  2J7P A;  5G55 A;  3SZ7 A;  1JPN A;  2ZXR A;  1GW6 A;  3L08 A;  1N54 A;  4FP7 A;  3RRN B;  5D0O D;  3CVQ A;  3LDZ A;  1MND A;  2V26 A;  2RD0 A;  3ZYM A;  3DPD A;  5LFA A;  4FU3 A;  4CSA A;  3AU5 A;  4I9C A;  4QI2 A;  2AW6 A;  4W9R A;  4J8D A;  1OWM A;  2MOW A;  3S28 A;  3FTS A;  1TWA A;  3Q5M A;  2PFD A;  4TRQ A;  3ZPJ A;  4JEH A;  4BG0 A;  1ELK A;  2XPZ A;  4GZ6 A;  4JW1 A;  2DCP A;  1Y8M A;  3FUD A;  4RSY A;  4U8H A;  1OWP A;  4FHK A;  1DVP A;  4YVQ C;  4HOR A;  2P6V A;  3OAW A;  1QZX A;  3EZH A;  1HG5 A;  3PE3 A;  3B0U X;  2Y4U A;  4LUN U;  1PY1 A;  2NUT A;  3EFO A;  4U5B E;  3W8I A;  1HFA A;  2NUP B;  3QWV A;  2FEZ A;  2WPV A;  2IYL D;  2J4D A;  1VYK A;  4H7X A;  4AY5 A;  2G3V A;  2YQ8 A;  2XPI A;  4AOF A;  3AG2 C;  1OCZ C;  2OCC C;  3OEO A;  1RJ9 A;  4B8C B;  3QJZ A;  3EG9 B;  5FTP A;  3QKY A;  1IHG A;  1N1C A;  4GAA A;  1H2U A;  3AS8 A;  4KNV A;  1UG3 A;  3CQG B;  2JLB A;  3CHR A;  2LAH A;  4K0R A;  3CHQ A;  3IHV A;  4JHR A;  4JL0 A;  2WXG A;  1MMD A;  2I9C A;  3GAN A;  4CRW A;  3PE4 A;  4NAC A;  4CT4 A;  3PRE A;  1HH8 A;  4L2L A;  4GZC A;  2KCV A;  1VK5 A;  4GA1 A;  5KYY A;  3CK8 A;  4BSX A;  2VYI A;  4Q69 A;  4L23 A;  3HJC A;  4LLC A;  4HOS A;  4XE0 A;  4KZC A;  3CV0 A;  3FWV A;  2E2E A;  3V7O A;  3MZL B;  3K33 A;  3EH1 A;  2NUP A;  3KEZ A;  3S0X A;  2MHK A;  5G04 J;  2OG2 A;  4PH4 B;  1KLX A;  2J49 A;  3NKE A;  2NSZ A;  3ASN C;  4AE4 B;  4U07 A;  3CVL A;  4J6I A;  3Q6M A;  4WNE A;  3CSK A;  2XRY A;  1N52 A;  5JJT A;  2L81 A;  1IQU A;  2HYZ A;  5BV1 A;  3LAY A;  5AJL A;  4APO A;  3CVU A;  1SF8 A;  2IOL A;  4Q94 A;  3DJU B;  2FBN A;  2OND A;  2R7T A;  3L13 A;  2XXA B;  1FTS A;  2Y3D A;  3ZC4 A;  3EIJ A;  1ELR A;  2WXJ A;  3DXJ F;  1LKX A;  5JJ6 A;  5LP0 A;  5T4Y A;  4U5E E;  2HR2 A;  2J09 A;  3LVQ E;  5C1D A;  2GW1 A;  3K1H A;  4I6J A;  3O4Z A;  1ST6 A;  1HX8 A;  4DLQ A;  4TV3 A;  5IY5 C;  5AIJ A;  3BG1 B;  3EH2 A;  3PVL A;  4I6G A;  3SHF A;  4JHK A;  1TR2 A;  2WXM A;  2BF0 X;  3U64 A;  2R7R A;  1NA0 A;  2UY1 B;  3GZS A;  2YHE A;  3AS4 A;  3TG4 A;  2J45 A;  3X1O A;  4DI3 A;  4C9B B;  2V0P A;  2WXQ A;  4B89 A;  3ZXS A;  3D9P A;  1OWN A;  1HG2 A;  2P58 C;  2WXF A;  3ZVR A;  4KVM A;  1HE8 A;  1QNF A;  2P7V A;  5FZR A;  4A1S A;  4JVS A;  4DPR A;  3FP3 A;  3LLI A;  3QZC A;  1WY6 A;  4MRU A;  4XKB A;  2UWJ G;  4GU5 A;  3T6J A;  2WM9 A;  4ANW A;  3VLF A;  2PQR A;  3ITF A;  4KVO A;  2R59 A;  3EGD B;  2J0W A;  2XGS A;  3PNL B;  4JUR I;  1IQR A;  3CQC B;  3CZ6 A;  4AP2 A;  3GYZ A;  3K6B A;  4HOT A;  4B0Z A;  4MLP A;  2H7B A;  2HO1 A;  3UR3 C;  4WWO A;  5KCM A;  4C7O A;  2QY7 A;  2X38 A;  3PEV B;  4OIN F;  4ZLD A;  4XIF A;  2VTB B;  3I4R B;  2R7W A;  3D9J A;  2Q9C A;  3L54 A;  4JC8 A;  3FUH A;  2I1J A;  5T1D B;  1MMG A;  4PS7 A;  1NA3 A;  3S7F A;  3LXU X;  5G05 C;  5KYN A;  5A6C A;  3DMD A;  4ANV A;  4OIP F;  2KGO A;  4O6Y A;  1JUQ A;  3PZD A;  4XKC A;  1HO8 A;  2X51 A;  3ASG A;  3LKU A;  3Q49 B;  3SBT B;  4HXI A;  5LCW J;  3ZSU A;  3CVV A;  3VLE A;  3L34 A;  3FDH A;  4U5D E;  4ACL A;  3UNG C;  2C0M A;  3TD7 A;  4U5F E;  1QZ2 A;  4I2W A;  3MV3 B;  3EGD A;  3I5P A;  1ZHX A;  3C98 A;  3ZIB A;  3SZR A;  3E70 C;  2XL4 A;  3DBS A;  5KYU B;  2PM6 A;  4UWH A;  4WND A;  4CGV A;  2JD3 A;  4DOZ A;  3TJP A;  4UI9 J;  2NC9 A;  4BTA A;  5FQ6 A;  3DAG A;  2XCB A;  1E8Z A;  4EBB A;  2J4B A;  3ML9 A;  3CVP A;  3B7U X;  5KJL A;  3BG0 B;  4B8A A;  3FH7 A;  1ZHZ A;  3O48 A;  1H2T C;  2WVQ A;  4UWF A;  3APF A;  4GYT A;  3B9Q A;  1VDY A;  1Y6I A;  4URK A;  2YIN A;  2WZF A;  3EQL F;  3EZI A;  4RG6 A;  3DAF A;  3S7D A;  1FVH A;  2A68 F;  4I1O B;  3CEQ A;  1S0P A;  1FFT C;  4DBQ A;  2QFC A;  2KCL A;  2I6H A;  3D9I A;  4CSA C;  5EX3 A;  4GZ5 A;  3EHM A;  5J90 A;  1G8X A;  3LY7 A;  4JA9 A;  2A5U A;  4WWP A;  1W2W A;  2I2O A;  4CIH A;  2J9U A;  3QMK A;  1U3D A;  4FLH A;  2Y69 C;  1ZU2 A;  4JHJ A;  2E0I A;  3AQC A;  3F47 A;  4I6E A;  1JWG A;  4BJ5 A;  1QLE C;  4YT8 A;  3FUI A;  5ARG A;  2KW3 C;  4C3D A;  3PNT B;  5DVW A;  4YWQ A;  3SFZ A;  2IF4 A;  4N3A A;  4G7Z F;  1VYI A;  4GZD A;  1UW4 B;  1Z3I X;  2PZI A;  4GA0 A;  4AXH A;  3NZU A;  3FTZ A;  1V54 C;  1ZHW A;  2RG8 A;  5DQT A;  3FUF A;  2CHZ A;  3S7J A;  1OKK D;  3DD7 A;  4FAD A;  5E33 A;  3LS8 A;  1Z3Y A;  2M63 A;  4UQY A;  2E87 A;  3S7B A;  1IYG A;  3OXL A;  1MNE A;  3U9W A;  4G24 A;  3MLG A;  4TUU A;  3MGB A;  4JEU A;  4C3B A;  4B6I A;  4GYY A;  5ANL A;  5FJY A;  5FQ4 A;  2CNW A;  2R7V A;  1Z3X A;  3P2B A;  4FUL A;  3OWT A;  3JCU Q;  3MJW A;  3IEG A;  3FU5 A;  2A1D D;  4ULW A;  4AEZ C;  4UWL A;  4E6H A;  2WQ7 A;  4RD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...