4LERA

Crystal structure of a putative outer membrane protein, probably involved in nutrient binding (bvu_1254) from bacteroides vulgatus atcc 8482 at 1.42 a resolution
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
457
structure length
457
Chain Sequence
TNPSLLLTGVAYSAFNQTSSDACHAAKMLILTSGESKYQVYKWTRGDFDYYSNLRDVTKMSEEAGEGSAYQALAHFFRANYFYQLTLDFGSIPYTDALKAETDANYQPAYDSQEVVLAGILKELEEADKMLEGSDEIISGDIIYNGNLVNWRKLINAYRLRILMSLSGKEKVGDIDVKSEFSKIVADGPLMESLSDNGQLIYLDQQDNRYPYFNDSDFGSGRFMDSTYIAELATRQDPRLFAVATQTPNAEKAGKAINDFSSYDGGDPAVPYSLVNDKAVAGNCSKPAPRYYQTPTNEPMVLLGYVEQQLILAEAVVRGWIQGDDKIYYESAVKASFEFYQKYAVSVADYLTQDAAAEYLRNDKVAYSSSLSTDEKIERIIMQKYLPTFLQGSVWLPYYEALRTGYPDFRRAAGVSLPYRWMYPQDEYNNNATHVEAALNEQFGGSDKTSDKPWWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a putative outer membrane protein, probably involved in nutrient binding (BVU_1254) from Bacteroides vulgatus ATCC 8482 at 1.42 A resolution
rcsb
source organism Bacteroides vulgatus
molecule tags Sugar binding protein
molecule keywords Putative outer membrane protein, probably involved in nutrie
total genus 174
structure length 457
sequence length 457
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12771 SusD-like_2 Starch-binding associating with outer membrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4lerA03
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4lerA01
3LEWA 3CKBA 5J90A 5FQ8A 5FQ7A 4F53A 4MRUA 3I4GA 3EHNA 5FQ4A 3JQ1A 4PUCA 3CK8A 3KEZA 3GZSA 3EHMA 3QNKA 3CKCA 3MYVA 3MX3A 5E76A 3CK9A 4Q69A 3HDXA 3EJNA 4L7TA 3SGHA 5E75A 3NQPA 5FQ6A 5LX8A 5T4YA 3L22A 3FDHA 3JYSA 4LERA 5T3RA 4F7AA 3MCXA 3OTNA 3CGHA 3SNXA 3IV0A 3CK7A 3P1UA 3JQ0A
chains in the Genus database with same CATH superfamily
3UXGA 4G2VA 2LFFA 4WNEA 1BZ4A 2YLIA 4LRZA 4I1MA 1WG0A 3AOUA 2WM9A 4CEMA 4YDYA 3C8GA 3FH8A 3FUFA 4KC9A 2HUJA 2OEVA 4U5BE 4N2QA 4ANXA 4JCHA 3NAWA 2XRHA 1A7VA 3TL5A 1YAUO 1S63A 3OXGA 3TXMA 2A1DD 1YA0A 3RKVA 3BQOA 1H9GA 4XPXA 3HNLA 3CKCA 3S9OA 2NUPB 5A6KA 2OOEA 4G25A 3M4BA 3CQZA 3NOGD 1WATA 3FMSA 1TFKB 4D10C 5T4YA 4ACLA 3ABMC 3MCXA 3UT4A 5CEAA 2HSBA 3JQ0A 1ZHWA 2DZOA 2LQGA 3UMIA 5FQ4A 4WNDA 5CHEE 1N4PA 1NSGB 4YNDA 3HXFA 4WGYA 4I2ZA 3MBGA 3F46A 3ZEFA 2YHCA 4F4BA 2XPIA 4HFFB 1V74B 2X6IA 3AG4E 2WXOA 5FIOA 4TUMA 3JYSA 3HTKC 3FY4A 3TOMA 3GWLA 2CG2A 1RXQA 3D9OA 1V55C 2IYLD 4U9EA 2L0TB 3X1OA 2WMNA 3RO3A 4PFPA 3FUEA 1OWOA 1A7DA 4CDRA 1RMVA 3US6A 1OY3D 4GZDA 2I9CA 3ASNE 4C3DA 3LS1A 5KYXB 5ENRD 1Q0DA 4Y6CA 4JC8A 4PK4A 2IJGX 3ULEG 3ABKC 3DEPA 3ZIBA 3U0CA 4O1OA 2ZU6B 3AG1E 5DBKA 2XHEA 2F8YA 1ZZPA 2WMOA 3CVQA 2P1AA 3ZXPA 4KBLA 1BU9A 4GA0A 4NRHB 5C2YA 4JZAA 3I4RB 3RYLA 3VLDA 1SZ9A 1YLMA 3DRAA 1NBBA 3MYIA 4UQZA 3FTYA 3ONKA 3RF3A 4HLLA 2V8SE 2WXKA 3WAQA 1D0ZA 2GFHA 5JS5A 1HG5A 1O3UA 4W9RA 2R7SA 3HXDA 2XEEA 2CCYA 2GAQA 4CX9A 2E2EA 2H6IA 4LEUA 1UN8A 3SFXA 1A41A 5H7PA 3KSQA 5AC4A 1H2UA 2G3VA 1Z6AA 3BEEA 4JEAA 2B0HA 4RBNA 2NYJA 3DSVA 2X51A 1QBQA 2D5RB 2JABA 4J8EA 5LOZA 1VOMA 2H7OA 2J45A 3EH1A 5EIDA 4K5CA 4JEHA 2PNNA 5COFA 1XZQA 3S29A 4EIYA 3N71A 4DX2A 3SZRA 2XENA 5A7DB 3JSEO 4NC3A 3L13A 1YYXA 4AP2A 1O87A 4JA7A 5ARFA 1PV3A 4O6MA 3TWWA 2OOCA 2WVOA 1QSPA 3DSUA 1H6GA 3G4XA 4URKA 2OV8A 2W45A 3KEAA 3HVEA 4L7TA 3LY8A 1FFHA 1YMPA 3DXKG 4E17A 4N5QA 1TNUA 1OCOC 3Q75A 3DSXA 2QY9A 4MVSA 2XZTG 2XGSA 1TN6A 3PRZA 5CMYA 1IQRA 2EILC 3PDNA 3UT7A 2OQMA 2WXRA 4YDWA 3DE9A 5FT9A 1Z7Qc 2R03A 4N3CA 1HFAA 1EKYA 3JQ1A 1D9SA 2WXLA 4CZ2D 2BUGA 5AN8A 4YVOA 4B8AA 1H6PA 4F1SA 4AXHA 1NFIE 4BG0A 1OCZC 5KYWA 3S90A 4L2LA 5FZRA 3WHNA 2CNWA 1Y4CA 4GPKA 1KPSB 4OIQF 3CLJA 4GYYA 5ANRA 4W8PA 3ML9A 2WVIA 3ASDA 5ENPD 1LM3B 1V54E 4N06A 4DUIA 4ZFHA 3LJBA 2J4DA 1N1CA 3FTVA 2JX0A 3FH5A 4OIPF 2Q9AA 3CK8A 4J8DA 3D9MA 4XEKA 1E86A 3DAGA 2EILE 3BEHA 4CIPA 3S84A 1D1BA 3N24A 2GDCA 4JJGA 1HZ4A 4XEIG 3EGXA 3SBTB 4CT0A 3SP1A 1Z23A 5JSLA 3SY2A 1SQMA 2XS8A 4JTCB 2FULA 5BXOA 3QW0A 1TEZA 4CIHA 3RKOF 4BPMA 2XPYA 2NSZA 2QC9A 3Q47B 3NYMA 4DLOA 1HW1A 5KNGA 5DIZA 1HMOA 3E9VA 3LYAA 2YHSA 3RVZA 4JPSA 3OWTA 3EIJA 4G23A 3ABME 4N39A 3TWSA 2MHKA 4NIKA 5ARGA 2VASA 3MV3B 2VJ8A 2R7OA 3ENEA 5G2NA 4DJAA 1E7UA 4D4XA 2P58C 3CR3A 1HY5A 2XL8A 1JWFA 3ZTZA 1YARO 2AXVA 2GRLA 3GZSA 1IKND 5IY5C 4R7LA 3U3BA 2FF4A 2P9PG 4ONSA 3HDXA 2EIJE 3VTXA 2IO3C 3MKRA 5G55A 2ZXRA 4FLBA 3FU6A 4BSXA 1OWLA 4TXQA 2KK1A 3AU4A 2B6CA 2WXMA 3D3MA 2H6HA 1U0BB 4GZ5A 2VGEA 5AQAA 2BTDA 3TG5A 4L9PA 3LDZA 1BD8A 4HFKB 3GORA 3URZA 3U8VA 2Q00A 2AJAA 2EPMX 3QARA 4I17A 1OR3A 3TG4A 3OEOA 3DSWA 3IHYA 3HG0D 1APCA 4FULA 4N4WA 3FFLA 1ZU4A 2CHWA 5BUOA 2PM6A 4AE4B 4J0UA 1KT0A 3WXXA 1OW6A 4J32B 4I6JA 3ZN3A 3I5QA 3SFYA 4C3BA 2XL6A 2CNWD 1LE2A 2AWIA 4PS7A 2GRRB 3POVA 2KXPC 4JD2G 2QE9A 2EIME 5DS4A 2JEKA 4A63B 2CYDA 1M57C 4ER9A 3ZVVA 4W8KA 4HRMB 2H6GA 1VDYA 1RW2A 1Z5SC 4CCAA 4LLCA 5HQ8A 3OXFA 1OR2A 2QNLA 4IB4A 4A55A 4EBKA 2PX0A 2XQ0A 2C0MA 2A4ZA 3X2QC 1JCRA 2OU6A 4MQ9F 4BSZB 3U9WA 4HEAJ 4FADA 4U5EE 2DYRE 2IONA 3FUDA 3SD5A 3UTMA 3T5VA 256BA 1YA7O 2NPUA 1TNYA 4JTAB 4C9BB 1WGWA 3F47A 4OAUC 4MVOA 2R7RA 2YL0A 2VSXE 2YQ8A 4JIOA 1LE4A 4DRIB 2V26A 4FC8A 4BJ5A 4EZKA 5E3CA 3W8IA 3BU8A 1X5BA 4GCNA 2HSQA 3CKBA 3HLZA 4OINF 2IM8A 4NTAA 4U0ZA 3DSTA 4A4AA 4BJ1A 4KVMA 3MYVA 3RRNB 1JAFA 3ZYKA 4UWFA 4GA1A 3KKBA 5EX3A 3C3RA 3LY7A 3NMKA 3NMIA 3QWPA 4J7WA 4X0RA 1HG2A 1OCCC 4Z9JA 4CS9A 3OTNA 2Y3DA 3L8IA 5DS5A 4PACA 3C18A 3ABLE 4XZ4A 1DC2A 3RRUA 5CI8A 1SW6A 4PS3A 3HJCA 4JC7A 4U7EB 1MQSA 1WTYA 4P9TA 1E85A 1SVXA 4PUCA 1IW7F 3KEZA 2KYHA 3TD7A 3ZHEA 2X6FA 4C3EA 3TJ5A 4FJZA 3AAAC 4MTFA 4EBBA 1Y6DA 1E8ZA 4FU3A 3ZKJA 2WVQA 3ZUVB 1DVPA 5E33A 3DEOA 2NSFA 3GZ1A 4BFRA 5L0JA 3ASFA 3W4YA 5T8IA 5L0FA 2C0LA 1TJCA 3GEHA 3W9FA 4I9CA 4WJ0A 2RG8A 2OEXA 4J6IA 1VYIA 1A17A 1N4SA 4XKCA 3R9MA 3FOPA 4PR9A 3Q7FA 5L3VA 3QDNA 3GZ2A 1JCSA 5FWQA 4GZ3A 2P9SG 3UMHA 3KYJA 5E76A 4MS6A 3Q9UC 4U5GA 1MMGA 2G62A 3SZ7A 4P29A 5EIBE 2IXPA 4CSAA 2PZIA 2BEDA 4KMOA 4NQFA 1FVHA 3PEVB 4DI3A 3RJVA 5J90A 3RVYA 1SA4A 4ABNA 2A5EA 4DPRA 1LTXA 4N3BA 3W8HA 3U5SA 4U95D 1YJGA 2XEVA 1DOVA 3MKQB 4UWHA 2IOQA 5AAOA 1EI7A 1J8YF 3Q5MA 3EIQC 4QFVA 2AU5A 2KJGA 3T4RA 1EYHA 3CHMA 3V31A 3HNIA 3JUIA 2AVKA 2ZGDA 2OEWA 3JUEA 1Q0FA 2ICWG 3V2XA 2NG1A 2F0YA 3VLFA 2R59A 4DX1A 1INZA 1AUEA 3CVNA 4LCTA 4BEJA 2VB6A 1K04A 1MX6A 2Q9BA 5G05J 4ATZD 3C72A 2R17C 3O39A 3ZU7B 1A0BA 4GEHA 4DJ9A 3VAYA 4ZLCA 4PFOA 3ZW3A 4B8CB 1LD7A 3FULA 3ULYA 1UG7A 2YZSA 3GANA 4YN0B 5DQTA 4HB5A 1HE8A 3UIOC 1D0XA 4IN3B 1UOHA 1FT2A 4CRWA 4RDAA 3D9NA 3FHEA 4ANWA 2XLEA 1HH8A 3R2PA 2CGEA 2JD3A 4MLPA 1N94A 4BX9A 4BETA 3ASOE 2XGOA 3VM6A 4ZLDA 4JHJA 1MNDA 4TRQA 4M7CA 3UM2A 1NL4A 2UY1A 3S7DA 3T9OA 3L34A 1U3CA 4GTMA 3EHQA 4WWPA 5EKQD 4F7AA 5AIJA 3NOCD 3UT8A 4CS9C 2NUPA 4GYWA 4AL1A 1N95A 2DCPA 4UWKA 4JHRA 4GZCA 4U63A 1RKCA 4BT8A 3UR3C 2H8AA 2F8XK 3CVVA 2L9JA 4XE0A 3AG3E 3G4ZA 2LXLA 3CEQA 1Z3XA 3JXIA 2DYSE 1TQGA 3X2QE 4JZYA 1KZOA 5FQ6A 3L9TA 2EPLX 3UKRG 5CMWA 2OCCC 3CVXA 3NF1A 3PZ4A 5KWDA 5BUZA 3D9KA 4L6RA 4CJOA 4BJ5C 3CAXA 2P2CP 1K3ZD 5J08A 3EU9A 5D92A 3EGXB 3B71A 2J0XA 2WXGA 3D9HA 1EQ1A 4LDRA 4DX7D 1JRAA 4R32A 2IBFA 3PVLA 4AY6A 2O9XA 4BY6A 3RQEA 3APFA 3B7BA 2HR2A 4KT6B 5CECB 1ZVZA 4J30B 3QAQA 2Q3TA 4FAPB 5FZQA 4G7ZF 4JW1A 3QWWA 5G05C 2KC7A 4OYSA 4CS7A 4IARA 3O55A 2M63A 5HRYA 3NBNB 2XL4A 1N4QA 4GAAA 3MJWA 2LK4A 3H2VA 2ZXWC 3DE8A 4NCQA 1QLEC 3SQVA 4XLNF 4FLHA 5AENA 1ZB1A 2CHXA 4MTGA 2GROB 4XWJA 2ZXPA 4J8FA 5G04C 2GA0A 4LERA 3JSZA 4CBEA 3WODF 2WXPA 2E87A 3TWUA 5BV0A 5AARA 1OXBA 2MOWA 5BPPA 5AYWD 3S27A 1MX4A 2LAHA 3ZDLA 2UUIA 2Y69C 4AV7A 4DX5D 1N11A 4MVQA 1LI5A 2LCHA 4U96D 4DRJB 2PP4A 2YL1A 2C04A 3C8ZA 3BG0B 1LI7A 2OVBA 4AIFA 3H2UA 3O10A 2XLOA 2OCCE 3G2WA 1M2VA 4XPYA 2XLWA 5CRVA 1KT1A 4IGGA 4UI9J 4YDEA 1EA8A 3RIPA 3U2LA 1MMAA 4YT2A 2XRYA 4NQ0A 3C8GB 4NTFA 3IQCA 3K9IA 1K40A 4P6IC 1FFTC 2HE0A 1P5QA 4QQIA 1QKRA 1XNFA 1PC2A 1W2WA 4KZCA 1EPUA 1T6UA 4WUYA 5L3QA 2MRIA 4K5AB 3W2WA 1YYHA 3HIZA 4O7GA 3NQPA 4HE8D 4XLPF 1NFOA 2RSEB 2CDQA 5B1AC 4GMJA 2J0WA 3UI2A 1ZHTA 2H7VC 3EUVA 4F53A 5BV1A 4UWLA 1WOLA 4XTKA 2MWQA 2Y3BA 1NU9C 3JYYA 2J4BA 1JWGA 3U4TA 2VGYA 1G4US 3AG2E 2NUTB 3VF0A 1TJFA 1F1MA 2AXUA 4J7YA 4I6EA 3ZYMA 1NA0A 4TV3A 1VMAA 2X6KA 1BPOA 4E0IA 5JHAA 4PJJA 4JKVA 4C7OB 1FTSA 3CQCB 3SNXA 3MKQA 3CZ6A 2FFHA 4AY5A 5ITZF 2DIWA 3ABLC 2M4EA 4CJGA 2X6HA 4U07A 4UQYA 2OVFA 2TMVP 2OG2A 5JVEA 4I6GA 5D2MC 4I9EA 1YCSB 1JPJA 2V4LA 2R9RB 4AOFA 4H54A 3UIPC 1FCHA 4ZHBA 3GEEA 3FAPB 4BJ6C 2FI7A 4G0HA 3MFNA 3KD7A 2I6HA 1OKKA 4GTVA 3LNRA 4EPZA 1OT8A 1YZAA 5JA4D 3S7JA 2A0UA 3ITFA 3JT1A 2KSFA 5BQHA 3AGUA 3FDQA 2I1KA 1G3NB 1MMNA 1JR8A 1H7IA 4OD4A 3JCUQ 3P2BA 1FVFA 2Y4UA 4OVVA 1OXJA 1LD8A 1O1TA 3CSKA 5JMND 2ZISA 1QQ3A 2I1JA 1LS4A 2GRPB 1XGWA 4U8HA 1R5ID 5KJKA 4U5CE 5C1DA 2IQCA 3TULA 4O6FA 2IXNA 3LCAA 3LEOA 3DMDA 5B1AE 3FUNA 5CBNA 4K1OA 5KJNA 1ZU5A 3B0VC 2J9WA 1E90A 4RG6A 1RKEB 4F6RD 3RRMB 4EBAA 4I1OB 5BT1A 2KZTB 4L23A 3JCKC 1K1BA 2ASRA 3ESLA 3SHFA 3KYIA 4EHPA 3SF4A 1C17M 3UMKA 1WM5A 4DVYP 2RFMA 4EQFA 4C48B 5CRUA 4IRUA 4GTQA 1KTMA 2ETSA 4U8VD 1ORYA 2ETBA 3AJMA 4JVSA 4U5FE 4IYPA 4JHKA 3I5PA 3M1CB 3T6JA 3AG1C 3ASGA 1BBHA 1T01A 4N5CA 4XEVA 4B6IA 4V3IA 4MS2A 3SYNA 3EFOB 3IHUA 5E75A 3EQLF 2HZ8A 3W2VA 2EIKC 2BC5A 4AVXA 5JRAA 1VB5A 1IQUA 1NA3A 3UINC 3FAJA 2QY7A 1IHBA 4I2WA 4WAFA 2DYSC 1E96B 1TN8A 1OCRE 4LSZE 3DSSA 3UM3A 4AL0A 4DBQA 2X6JA 2WQ7A 4CDMA 1IYGA 2HFIA 3SXYA 4O60A 2LIGA 2ETAA 1V54C 3RQGA 2IXOA 5L0HA 4DRHB 2YEVA 4LNGA 3V2OA 3FHDA 2AVPA 5D91A 5K0IA 4IAQA 2V0PA 2XXAA 2YL3A 3V7OA 5ENQD 3B7SA 1K1AA 4QI2A 2WQHA 1PAQA 3S28A 3V5YA 3RFYA 4X8QA 2XM0A 3DPDA 5BXUA 1I5NA 1Z6TA 4Z9HA 4WWNA 2KCLA 3CHSA 5AGFA 2I8BA 3EJNA 3K1HA 2XM4A 4GU5A 1VTMP 4RLYA 3AGTA 2WXHA 1RKEA 4EECA 4GB9A 1KZPA 4AK9A 3C8GD 3ZYQA 1E7VA 1IHGA 4F3VA 4G8KA 1FR0A 1KLXA 5A6BA 3QW1A 3C7JA 2UY1B 3LPZA 2YINA 5B3SC 5KJMA 4UUCA 2OJED 5F5HA 4Q96A 1LVKA 2WXFA 3AG4C 3SO8A 2WB2A 4D4NA 4B94A 1OWNA 2P9UG 3V5ZA 3R7CA 5ENNA 3HXBA 2DGJA 3NRHA 1MJ0A 3JYHA 3QC1A 2GRMA 1QPUA 4HNAD 3DJNB 3PREA 3Q7GA 2EINE 2D4UA 4HVBA 4YVQC 3TQOA 4Q94A 1L3PA 4G7OF 1GGQA 2HV7A 5KYXA 2L0IA 3V79K 1JPNA 2WXNA 5L0CA 5LP0A 4UQXA 4G11A 3DAFA 3ZNGA 2P61A 4FESA 4WNGA 5AQ9A 4K5BA 3T8KA 3DKAA 3IQTA 1LF8A 1HE9A 3ZVRA 4CT4A 5KBAA 1S70B 1CGME 4B89A 1DCQA 4YK5A 4XPWA 3JXJA 4ME2A 4B0ZA 3ZHEB 1K8KG 1YZCA 3JZ0A 4RQIA 1H19A 2IU1A 3BRJA 2HJ3A 3QJZA 2CHZA 4JXTA 1H0AA 2NSGA 5AJLA 2Y3GA 2HYZA 4JJFA 2UUHA 2J46A 5HS0A 3CVLA 3TWVA 1XZPA 2J49A 4UWGA 3TWTA 2J09A 4BERA 2QUPA 1U89A 1TR2A 3UNGC 3SXZA 1A5EA 3CHRA 1HMDA 4G1TA 4ATGA 4OIRF 3R7QA 1O1RA 2WL8A 4KNVA 2QYUA 3LVQE 5CCMA 5EDSA 3B9QA 1D1CA 4BT9A 5EN5D 2IOSA 3E32A 2XLHA 3K1IA 1AP7A 3ZFWA 3ZXSA 2ILRA 2R05A 5HSWA 2L6JA 3T6GB 2J08A 2HKVA 1Y8MA 3C3QA 1Q2ZA 4EZJA 1C03A 2VTBA 4GA2A 1KNYA 3L08A 1V55E 5L0IA 3TXNA 4DLQA 3C62A 3SI5A 4HLEA 3KH2A 3UUXA 1MQVA 3V5XA 2YNQA 3UKUG 1D8EA 3EGDA 5BQIA 2KQ9A 3LNMB 3IV0A 3DM5A 1Z3IX 2DVWA 1HXIA 3PDMP 5AC5A 1N0RA 3Q4AB 1DOWA 3ML8A 4L1BA 4OAVB 3RAUA 3GM3A 1T6QA 4N6HA 4KI2A 1H6OA 4BTAA 2WQ6A 4RSYA 4MBGA 4GTOA 2V5QC 1A7EA 2LFDA 2A6HF 3LS0A 3FU3A 4U9DA 2P6VA 2W4BA 4OD5A 3VLEA 1NFNA 4APFA 4CDAA 1U3DA 3BG1B 1HX8A 1E8YA 4UI9K 5TJ5E 1NLXA 4LNUD 3PZ1A 1BR1A 1V4AA 3ZIMA 2Q4FA 3A11A 2F22A 1CGOA 5KYNA 1LPEA 4U04A 4XEFA 1WN0A 3GODA 4A3VA 4H7XA 4M63A 5DVWA 1W3BA 2Z15A 3DXJF 5JHBA 3PZ2A 4MVZA 2Y3AA 3FDHA 4FJYA 3M4CA 3K7DA 3UX4A 1BR2A 2QYJA 1OCOE 3G2SA 1N54A 1OCRC 5KYUB 3J5QB 3LXUX 2P9NG 4ULWA 3L8JA 3GYZA 4C7OA 4F1PA 1C02A 1VK5A 4TXPA 4YT4A 2WZGA 1SYQA 3ESKA 3FTSA 2Y4TA 3L22A 4K7BA 3D9IA 5EILA 1ZBPA 3CK7A 1OKKD 2V5FA 4RVBA 3B0PA 3ECSA 4I3MA 1O5HA 3U2MA 3H65A 1AEPA 4U5HA 2AWCA 3EGDB 5FJYA 1GS9A 4DRXE 3LY9A 2W9YA 3PZ3A 5JJ6A 4GQHA 2VSNA 3CVWA 3TWQA 4BTBA 2ZXWE 3AS4A 4P9FA 1HU3A 2XCCA 5T3RA 1Q0KA 3Q7AA 3VRCA 3U3WA 2J8SD 4JA9A 3F6QA 5FTPA 2DYRC 3LVRE 1S0PA 4DBRA 4PH4B 1MZCA 5CERB 2Y3HA 3ZPJA 2LSEA 4NACA 2KW3C 4FWVA 4EKWA 3L16A 4WGZA 1HF8A 4DI4A 3G2TA 3SFZA 5JLIA 1ZHYA 2LXMA 5L0DA 1PCXA 3B29A 5COGA 3PH0C 4HRNA 4ULVA 4CDVA 2EPNA 3IKOB 3HVEB 2Y69E 4MNDA 4EWCA 3M79A 3G2VA 3HRAA 3KAEA 2XSEA 5KYWB 2HMZA 3ASNC 1G5ZA 3HNKA 3DPYA 3ASHA 3PUKA 2KCVA 2VC9A 1X81A 4GPMA 5KYUA 3IPMO 4AM9A 2IXMA 3SGHA 2FO1E 3RH3A 4DXWA 3AS8A 1QYMA 1WY6A 2WB7A 3MZLB 2PQNA 2VTBB 4JRZA 4JEBA 3CQGB 4J8SA 3P1UA 1PD1A 3CV0A 4I1AA 1TKNA 3FOOA 2ZXOA 2VGXA 3Q78A 2ZIRA 5GPGB 4MRUA 1S05A 4YWQA 4UI9C 2R7TA 2EPKX 3QNKA 3UM0A 1YDIA 4JB8P 2EIJC 3LESA 1MNEA 3B7UX 3HYMB 3QTHA 1TR4A 2VCBA 2FBNA 2EINC 1MX2A 2PM7A 1UFBA 3QOUA 3DM9B 1Q0MA 3PCVA 3HXEA 3Q6NA 2R7XA 3UQ3A 4H7YA 2YL7A 4C0EA 1TWGA 4EUKB 3FTZA 2KZTA 4G24A 3RU0A 3ZG1A 1OW8A 4LLEA 1YA9A 1VLSA 3QZCA 3MA5A 2YQYA 5CBOA 3ATPA 5FINA 1TFOB 2XXAB 2IY0C 2QZAA 2R7UA 4C0MA 2C03A 3DXMG 1FMVA 3NKEA 2B0OE 5KYYB 3EZHA 3JRTA 5G04J 3ZQVA 1M56C 3AG3C 4Z9IA 1UJKA 5F28E 3NYJA 2XLMA 2J9UA 1JCQA 1H2VC 2VH3A 4CGVA 2LO6A 1JMWA 4XI0A 4E18A 1BDJB 3BUAA 3LS8A 3EU5A 4I43A 2J9BA 3O48A 1Z5ZA 1LKXA 4CGWA 5JJ7A 3OXLA 1BR4A 2RD9A 1TN7A 3IXEA 2P9LG 1E8WA 2ONDA 4DK5A 2DWZA 2PNOA 1GW6A 3UGOA 2AP3A 2X38A 4I44A 3CHOA 2BE5F 2R02A 1U2VG 3IEGA 4YJWA 4A3TA 1OW7A 2WZFA 3TAXA 2IF4A 1RCPA 2FAPB 2LUHA 1G8XA 4GTPA 4LNBA 3CVPA 4GMLA 4Q69A 1TWAA 3RW0A 3CSTA 3S7FA 1PD0A 3E37A 5CCLA 2KC3A 3N2ZB 3G2UA 3L17A 5LX8A 2EIKE 4PDXA 3O6XA 3B0UX 4NTBA 4DVZA 3J06A 2IEJA 4IJJA 3GEIA 2HJMA 4O1PA 5EYLA 4JL0A 1Q0GA 2AW6A 3GW4A 1SZIA 1M2VB 3B95A 2L6FA 5A6CA 3G50A 1FMWA 1UG3A 1FNTc 1AVOB 3QK0A 3ISMC 4IWBA 2UWJG 1O1SA 4QI0A 3D9LA 3IHVA 4HXIA 1VYKA 5A6JA 3UPVA 4PJMA 1SR2A 3Q6MA 3B7TA 4ANVA 1QNFA 1Z63A 4XKBA 3S7BA 3L0IA 3S0XA 3SBSA 1ZYRF 3FTUA 3PZDA 3I4UA 2FEZA 4JCZA 4GYTA 2MHRA 3MGBA 1WAO1 4MVUA 4EBJA 4AE4A 3FU0A 3FH7A 4EZLA 3RO2A 4OIOF 4PS8A 3MV2B 4RG9A 4G78A 3K33A 2HO1A 5A69A 1QZ2A 2XPZA 3Q73A 3TK0A 3RK6A 2JPUA 1E84A 4MTOA 2A6EF 4MKTA 3MYFA 4DOZA 2FGYA 1BI7B 3PMRA 4TXRA 2ZPAA 3EG9A 4CSAC 3FUJA 3LAYA 3NZSA 5F5FA 1QZXA 1FT1A 3TJ6A 3QVZA 1DCEA 3AG2C 3DWLG 2A0BA 5BQGA 4GMRA 4UDVA 4FP7A 3WG7E 3ZTMA 1LIHA 4L2YA 1J8MF 3DWWA 2NUTA 1S7ZA 3Q9NC 3TWXA 5FZTA 2NXPA 3ZRHA 1ELKA 3E70C 3SNHA 5D0OD 2CFZA 4G26A 1WDYA 2I15A 1MHQA 3IEEA 3E33A 2RFAA 3APCA 2XLDA 2J9VA 2ZD9A 1HO8A 5T3WA 1U6HA 3UGPA 1MYOA 1HW2A 2Q7FA 1BI8B 1GM5A 2ZGGA 2PFDA 3PNTB 3D9PA 4XI9A 2QLAA 4LG6A 2Y39A 4LACB 3E34A 1D0YA 2R5SA 1YYJA 1ZW2A 4HI8A 2E0IA 3IBEA 4J8YA 2VQ2A 4HOSA 1AWCB 1SA5A 2HMQA 4KVOA 5HKPA 3U3FA 4HOTA 2VGXB 1T9KA 3TGOA 3PS6A 2OKUA 2KGOA 3CGHA 3RSEG 1KU2A 2HM8A 3FUIA 2KM4A 4HORA 2RD0A 4Y6WA 5A6AA 5FQ8A 4A2NB 4HFGA 3KPHA 5FQ7A 1OWMA 3B13A 4E7SA 1Y6IA 3QWVA 4O79A 3E30A 4K03A 4NURA 3DZAA 3O4ZA 4IULA 2B0JA 2OJQA 3CEXA 2YLDA 3LEVA 4LUNU 1B89A 5HV9A 2LSUA 4AEZC 1CPRA 3VYWA 2CG3A 3L6AA 1R4TA 1E2XA 3NDBB 3ULQA 4YL3A 3UMVA 5DQZA 3FU5A 4A1SA 5JUAA 3FTWA 4OVUA 2EIMC 1UN9A 4FHKA 2XRZA 2X3MA 5KYYA 4GYOA 2KNHA 1D1AA 2BKGA 3PEUB 2G3KA 3CSFA 5D0QD 2P9KG 3CVYA 2RKKA 4B93B 3NB2A 4RD9A 1JUQA 3NZUA 3NKDA 1RZ4A 2H6FA 4FA6A 2LP4A 4U0UA 3L82A 2KCKA 2YRFA 2XGMA 1SZAA 2Q9CA 2R25A 3PE3A 5LCWJ 3IQ6A 3RIBA 2VCAA 3IQ5A 1ZHXA 3UM1A 2C2LA 4LDKA 3PE4A 3Q7LA 2J07A 5EX0A 5B3SE 4FX5A 1N4RA 3U9MA 3GM2A 4G7HF 1ZW3A 1L7CA 4PJNA 1BLXB 3U66A 5EK0A 1ORJA 5D66A 3C3OA 3AQCA 4GTRA 2YWAA 3WG7C 5KJLA 2YVKA 5A6BD 4MW8A 4G8LA 1UJJA 4HQDA 1H6KA 4E0HA 2XEHA 4GTTA 1E8XA 3EFOA 4XX5A 5DS6A 1OQCA 3FUMA 1G4WR 2L81A 5LFAA 2R2LA 5JJTA 3FXHA 4CDNA 4N3AA 5FCLA 4U0SA 2QFCA 1PY1A 4JTDB 4EHMA 4CDYA 4WWOA 3ASOC 2WXIA 4HRLA 5E3AA 4TUUA 3TJPA 4K0DA 4KXKB 4IAOA 2ETCA 2YHEA 4HOQA 2DB4A 2MYOA 1H2TC 4ILHB 1YVIA 3ONLA 4BWRA 2HS5A 3R9AB 5B1BC 4GCOA 1LS1A 3D9JA 4KNWA 4MW3A 3E4BA 3QKYA 4HBDA 3J5PA 2VCCA 3KMIA 3U8PA 3B7RL 4E85A 4KYOB 3AJIA 1NZNA 3SXMA 2L6HA 3AQBA 3SXKA 2VSYA 1OCCE 1XWJA 3CK9A 2V4HC 2A69F 3OAWA 2P0NA 1OUVA 3K1IC 1ZHZA 3DI5A 3FVYA 4KBQA 3VTYA 4ILGA 4U5DE 4PJLA 3V30A 4APOA 3HXCA 1I4YA 2A5UA 4ANJA 5DLJA 1L5JA 4M3OA 3EZIA 3QB2A 1EF1C 4MVMA 3DD7A 3HNJA 2Y0BG 1T6IA 2BKKB 5CEDB 2Y1LE 3ZWIA 3EHMA 3FUHA 2Q7RA 3FP3A 3PUJA 2GWWA 3A9CA 3C5RA 3S2AA 5AQBA 3ABKE 1RJ9B 2LSVA 1MMDA 1E83A 3HHMA 4YDOA 1TYQG 3ZSUA 3LKUA 1ELRA 3DJUB 2GW1A 3GM1A 3JTLO 5A23A 1OXKA 4JE9A 2XCBA 4A1GA 3N0TA 2QTVA 1NG1A 2CFUA 3CIAA 3L54A 1TNBA 2L6GA 5B1BE 5AJDA 2GGFA 3FEXA 4KZ0A 2DZNA 1FAPB 2DI3A 1NP7A 1HS6A 5EHHA 3I3NA 4BJ6A 4YL1A 5AQ7A 1NZEA 3GWNA 5JT4A 1JPLA 1Z3YA 2P9IG 3DBSA 2CW0F 4XQ1A 5T1DB 2LD6A 4E7ZA 2FO7A 4XIFA 3ZYLA 3FTXA 1SF8A 4U8YD 1JOGA 4WABA 2KBXA 1B68A 3T5XA 3CHPA 2LAIA 2YKZA 5CI9A 3PNLB 4GTSA 4JEUA 3C63A 3OA1A 2LNIA 2PL2A 2M64A 4H4KC 3FWVA 3EH2A 2L6BA 4CS8C 4YT5A 1TWCA 4O6NA 5E2QA 2WXQA 2MYSA 3NMJA 4Z68A 4CS8A 2PX3A 3M15A 3RQFA 1VLTA 2PQRA 4HS2A 3APDA 1I4ZA 2XZDG 2WXJA 3Q15A 3EDTB 3LEWA 3L1MA 2J7PA 1CGNA 3SEOA 5IY5E 2EQXA 5EGYA 2PBEA 3C98A 1UW4B 3MLGA 2DBAA 3KL4A 4AX2A 4ACKA 2L9BA 2WVNA 3W9GA 5BW8C 3LLIA 2L7AA 3HKKA 2WPVA 1IZMA 5KCMA 1GQAA 4JURI 2J7PD 1N9AA 4BEPA 4MVRA 2BL2A 2PF4E 3ZQYA 2R7WA 3TWRA 4E6HA 5M72A 2P7VA 4N2SA 3K66A 4BX8A 5HI7A 3FUKA 1QQEA 1OCZE 1ELWA 2IFUA 4HOUA 1QVXA 2R7VA 4YL0A 1M2OA 1D8DA 4LDQA 1ST6A 3EG9B 3QVYA 2HV6A 3EPVA 3LJ3A 1CPQA 1WWPA 5ENSD 3T9KA 3EHNA 2XLVA 1M6TA 2BF0X 3T6BA 3AS5A 1N52A 2GRQB 3U9JA 3MX3A 3EHRA 5ENOD 3T8MA 4DX6D 2YLGA 1IXVA 3ZGQA 3FEYA 5ANLA 3R7RA 4ILIA 2VYIA 5COMA 3NG1A 2IOLA 4AJWA 5L0GA 5FZSA 1K05A 2A68F 3NYLA 3QMKA 1TNZA 4ANUA 5JP7A 2J8WA 3LUTB 5KNHD 2AXZA 4GZ6A 2WZLA 3Q49B 5EYPF 5CIVA 1DNPA 4Q7CA 2R7QA 4BJTA 4K0RA 1WASA 4FHJA 1OWPA 2H7BA 2W4MA 4QDLA 2IO2C 2NC9A 3CVUA 3JRMO 4J7TA 3LLKA 1NI1A 2F37A 3KSLA 3LJNA 1O5MA 5BNWA 1S64A 2J9QA 4WNFA 4HI9A 1TNOA 3KS2A 1RJ9A 1T5OA 1SMYF 3CHQA 1ORSC 3U64A 2JLBA 2X0CA 1HE1A 4Q5SF 4BESA 2I2OA 5ENTD 3I4GA 4EBAG 4NY3A 2GRNB 2KATA 2VSOE 4YT8A 1H9TA 1NU7D 1EDUA 2V3CC 3ZC4A 5LCWC 1TWHA 4O6YA 3Q79A 3TOLA 1ZU2A 4Q4ZF 2EPOA 2AWYA 3K6BA 4BEMJ 4N6CA 5T3TA 1FPPA 5B3IA 4CYMD 1N0QA 2XS1A 3AU5A 3PHF2 3MEKA
chains in the Genus database with same CATH topology
4G2VA 4WNEA 4LRZA 4I1MA 2WM9A 4CEMA 3FH8A 3FUFA 4KC9A 4U5BE 4N2QA 4ANXA 4JCHA 2XRHA 3TL5A 3OXGA 3TXMA 2A1DD 1YA0A 3RKVA 3CKCA 2NUPB 2OOEA 4G25A 3CQZA 4D10C 5T4YA 4ACLA 3ABMC 3MCXA 3UT4A 3JQ0A 1ZHWA 3UMIA 5FQ4A 4WNDA 5CHEE 4YNDA 4I2ZA 3F46A 3ZEFA 2YHCA 4F4BA 2XPIA 4HFFB 2X6IA 2WXOA 3JYSA 3HTKC 3FY4A 2CG2A 3D9OA 1V55C 2IYLD 2L0TB 3X1OA 2WMNA 3RO3A 4PFPA 3FUEA 1OWOA 4CDRA 4GZDA 2I9CA 4C3DA 3LS1A 5KYXB 4Y6CA 4JC8A 4PK4A 2IJGX 3ABKC 3ZIBA 2ZU6B 5DBKA 2XHEA 2WMOA 3CVQA 4KBLA 4GA0A 4NRHB 5C2YA 4JZAA 3I4RB 3RYLA 3VLDA 1SZ9A 4UQZA 3FTYA 3ONKA 2V8SE 2WXKA 1D0ZA 2GFHA 1HG5A 4W9RA 2R7SA 2E2EA 4LEUA 1UN8A 1H2UA 2G3VA 1Z6AA 3BEEA 4RBNA 2X51A 2D5RB 4J8EA 5LOZA 1VOMA 2H7OA 2J45A 3EH1A 4JEHA 3S29A 3N71A 3SZRA 5A7DB 3L13A 4AP2A 1O87A 4JA7A 5ARFA 4O6MA 2WVOA 4URKA 2OV8A 2W45A 3HVEA 4L7TA 3LY8A 1FFHA 1OCOC 2QY9A 2XGSA 3PRZA 5CMYA 1IQRA 2EILC 3PDNA 3UT7A 2WXRA 5FT9A 4N3CA 1HFAA 3JQ1A 2WXLA 2BUGA 4B8AA 4YVOA 4F1SA 4AXHA 4BG0A 1OCZC 5KYWA 4L2LA 5FZRA 2CNWA 4GPKA 4OIQF 3CLJA 4GYYA 5ANRA 3ML9A 2WVIA 3ASDA 4N06A 3LJBA 2J4DA 1N1CA 3FTVA 3FH5A 4OIPF 2Q9AA 3CK8A 4J8DA 3D9MA 3DAGA 1D1BA 3N24A 4JJGA 1HZ4A 3EGXA 3SBTB 4CT0A 3SP1A 1Z23A 1SQMA 2FULA 1TEZA 4CIHA 3RKOF 2XPYA 2NSZA 3Q47B 3NYMA 4DLOA 5DIZA 3E9VA 3LYAA 2YHSA 4JPSA 3OWTA 3EIJA 4G23A 4N39A 2MHKA 5ARGA 2VASA 3MV3B 2VJ8A 2R7OA 3ENEA 5G2NA 4DJAA 1E7UA 2P58C 3CR3A 1JWFA 2AXVA 2GRLA 3GZSA 4R7LA 5IY5C 2FF4A 3HDXA 3VTXA 3MKRA 5G55A 2ZXRA 4FLBA 3FU6A 4BSXA 1OWLA 3AU4A 2WXMA 3D3MA 4GZ5A 2BTDA 3TG5A 3LDZA 4HFKB 3URZA 3QARA 4I17A 3TG4A 3OEOA 3IHYA 4FULA 3FFLA 1ZU4A 2CHWA 5BUOA 2PM6A 4AE4B 4J0UA 1KT0A 3WXXA 4J32B 4I6JA 3ZN3A 3I5QA 4C3BA 2CNWD 2AWIA 4PS7A 3POVA 5DS4A 2JEKA 1M57C 3ZVVA 4W8KA 5HQ8A 4CCAA 1VDYA 4LLCA 3OXFA 4A55A 2PX0A 2XQ0A 2C0MA 2A4ZA 3X2QC 4MQ9F 3U9WA 4HEAJ 4FADA 4U5EE 2IONA 3FUDA 3SD5A 3T5VA 4C9BB 1WGWA 3F47A 2R7RA 2VSXE 2YQ8A 2V26A 4FC8A 4BJ5A 4EZKA 5E3CA 3W8IA 1X5BA 4GCNA 3CKBA 3HLZA 4OINF 4U0ZA 4BJ1A 4KVMA 3MYVA 3RRNB 3ZYKA 4UWFA 4GA1A 3KKBA 5EX3A 3LY7A 3QWPA 4X0RA 1OCCC 1HG2A 4CS9A 3OTNA 2Y3DA 5DS5A 4XZ4A 3RRUA 5CI8A 4PS3A 3HJCA 1MQSA 4PUCA 1IW7F 3KEZA 3TD7A 3ZHEA 2X6FA 4C3EA 4FJZA 4EBBA 1E8ZA 4FU3A 2WVQA 1DVPA 5E33A 3GZ1A 4BFRA 3ASFA 5T8IA 2C0LA 1TJCA 4I9CA 4WJ0A 2RG8A 4J6IA 1VYIA 1A17A 4XKCA 5L3VA 3QDNA 3GZ2A 5FWQA 4GZ3A 3UMHA 5E76A 4MS6A 4U5GA 1MMGA 2G62A 3SZ7A 4P29A 2IXPA 4CSAA 2PZIA 4KMOA 1FVHA 3PEVB 4DI3A 3RJVA 5J90A 4ABNA 4DPRA 4N3BA 3W8HA 2XEVA 3MKQB 4UWHA 2IOQA 1J8YF 3Q5MA 3EIQC 4QFVA 2KJGA 3T4RA 1EYHA 3CHMA 3JUIA 2NG1A 3VLFA 2R59A 1INZA 3CVNA 4LCTA 4BEJA 2VB6A 2Q9BA 5G05J 2R17C 3O39A 4GEHA 3VAYA 4ZLCA 4PFOA 3ZW3A 4B8CB 3FULA 2YZSA 3GANA 4YN0B 5DQTA 1HE8A 1D0XA 4IN3B 4CRWA 4RDAA 3D9NA 3FHEA 4ANWA 1HH8A 2CGEA 2JD3A 4MLPA 4BX9A 2XGOA 4ZLDA 4JHJA 1MNDA 4TRQA 2UY1A 3S7DA 3L34A 1U3CA 4F7AA 4WWPA 5EKQD 5AIJA 3UT8A 4CS9C 2NUPA 4GYWA 2DCPA 4UWKA 4JHRA 4GZCA 4U63A 4BT8A 3UR3C 3CVVA 2L9JA 4XE0A 3CEQA 1Z3XA 4JZYA 5FQ6A 5CMWA 3CVXA 2OCCC 3NF1A 5BUZA 3D9KA 4BJ5C 5J08A 5D92A 3EGXB 2WXGA 2J0XA 4AY6A 3PVLA 2O9XA 4BY6A 3APFA 2HR2A 4KT6B 4J30B 3QAQA 2Q3TA 5FZQA 4G7ZF 4JW1A 3QWWA 5G05C 2KC7A 4OYSA 4CS7A 2M63A 2XL4A 4GAAA 3MJWA 2ZXWC 1QLEC 4XLNF 4FLHA 5AENA 2CHXA 4XWJA 2ZXPA 4J8FA 5G04C 4LERA 3JSZA 4CBEA 3WODF 2WXPA 2E87A 5BV0A 2MOWA 5BPPA 5AYWD 3S27A 2LAHA 2Y69C 4AV7A 2PP4A 2C04A 3BG0B 2OVBA 4AIFA 3G2WA 1M2VA 1KT1A 4UI9J 3RIPA 1MMAA 4YT2A 2XRYA 4NQ0A 3K9IA 4P6IC 1FFTC 1P5QA 1XNFA 1PC2A 1W2WA 4KZCA 1EPUA 4WUYA 5L3QA 2MRIA 3W2WA 3HIZA 4O7GA 3NQPA 4HE8D 4XLPF 2CDQA 5B1AC 4GMJA 2J0WA 1ZHTA 2H7VC 4F53A 5BV1A 4UWLA 4XTKA 2MWQA 2Y3BA 1NU9C 2J4BA 1JWGA 3U4TA 2VGYA 2NUTB 1TJFA 2AXUA 4I6EA 3ZYMA 4TV3A 1NA0A 1VMAA 2X6KA 1BPOA 5JHAA 4PJJA 4C7OB 1FTSA 3SNXA 3CQCB 3MKQA 3CZ6A 2FFHA 4AY5A 2DIWA 3ABLC 2M4EA 2X6HA 4U07A 4UQYA 2OVFA 2OG2A 4I6GA 4I9EA 1JPJA 2V4LA 4AOFA 1FCHA 4BJ6C 2FI7A 4G0HA 3KD7A 2I6HA 1OKKA 3LNRA 4EPZA 3S7JA 3ITFA 3JT1A 3FDQA 2I1KA 1MMNA 4OD4A 3JCUQ 3P2BA 1FVFA 2Y4UA 4OVVA 3CSKA 2I1JA 1XGWA 4U8HA 5KJKA 4U5CE 5C1DA 2IQCA 4O6FA 2IXNA 3LCAA 3DMDA 3FUNA 5KJNA 1ZU5A 3B0VC 2J9WA 1E90A 4RG6A 3RRMB 4EBAA 4I1OB 5BT1A 2KZTB 4L23A 3JCKC 3ESLA 3SHFA 3SF4A 3UMKA 1WM5A 4DVYP 4EQFA 4IRUA 4JVSA 4U5FE 4IYPA 4JHKA 3I5PA 3M1CB 3T6JA 3AG1C 3ASGA 4N5CA 4B6IA 4V3IA 3SYNA 3EFOB 5E75A 3EQLF 3W2VA 2EIKC 4AVXA 1IQUA 1NA3A 3FAJA 2QY7A 4I2WA 4WAFA 2DYSC 1E96B 4DBQA 2X6JA 2WQ7A 4CDMA 1IYGA 1V54C 2IXOA 2YEVA 3FHDA 2AVPA 5D91A 2V0PA 2XXAA 3V7OA 3B7SA 4QI2A 2WQHA 1PAQA 3S28A 3RFYA 3DPDA 1Z6TA 4WWNA 2KCLA 3CHSA 2I8BA 3EJNA 3K1HA 4GU5A 2WXHA 4EECA 4GB9A 4AK9A 3ZYQA 1E7VA 1IHGA 4F3VA 1KLXA 2UY1B 3LPZA 2YINA 5B3SC 5KJMA 5F5HA 4Q96A 1LVKA 2WXFA 3AG4C 2WB2A 4B94A 1OWNA 5ENNA 2DGJA 3NRHA 3JYHA 3QC1A 2GRMA 3DJNB 3PREA 3Q7GA 4HVBA 4YVQC 4Q94A 4G7OF 2HV7A 5KYXA 2L0IA 1JPNA 2WXNA 5LP0A 4UQXA 4G11A 3DAFA 4WNGA 4FESA 1LF8A 3ZVRA 4CT4A 4B89A 4ME2A 4B0ZA 3ZHEB 1H19A 2IU1A 3QJZA 2CHZA 4JXTA 1H0AA 5AJLA 2Y3GA 2HYZA 4JJFA 2J46A 3CVLA 2J49A 4UWGA 2J09A 1TR2A 3UNGC 3CHRA 4G1TA 4ATGA 4OIRF 3R7QA 2WL8A 4KNVA 3LVQE 5CCMA 5EDSA 3B9QA 1D1CA 4BT9A 2IOSA 3ZFWA 3ZXSA 2ILRA 5HSWA 2L6JA 2J08A 1Y8MA 4EZJA 2VTBA 4GA2A 3L08A 3TXNA 4DLQA 3SI5A 4HLEA 3KH2A 3UUXA 2YNQA 3EGDA 3IV0A 2KQ9A 3DM5A 1Z3IX 1HXIA 3Q4AB 3ML8A 4L1BA 4KI2A 4BTAA 2WQ6A 4RSYA 3FU3A 2A6HF 3LS0A 2P6VA 2W4BA 4OD5A 3VLEA 4APFA 1U3DA 3BG1B 1HX8A 1E8YA 4UI9K 1BR1A 3ZIMA 5KYNA 4U04A 3GODA 4A3VA 4H7XA 4M63A 5DVWA 1W3BA 2Z15A 3DXJF 5JHBA 2Y3AA 3FDHA 4FJYA 3K7DA 3UX4A 1BR2A 3G2SA 1N54A 1OCRC 5KYUB 3LXUX 4ULWA 3GYZA 4C7OA 1VK5A 4YT4A 2WZGA 3ESKA 3FTSA 2Y4TA 3L22A 4K7BA 3D9IA 1ZBPA 3CK7A 1OKKD 2V5FA 4RVBA 3B0PA 3ECSA 4I3MA 1O5HA 3H65A 4U5HA 3EGDB 5FJYA 3LY9A 2W9YA 5JJ6A 2VSNA 3CVWA 4BTBA 3AS4A 1HU3A 2XCCA 5T3RA 3U3WA 4JA9A 5FTPA 2DYRC 3LVRE 1S0PA 4DBRA 4PH4B 2Y3HA 3ZPJA 2LSEA 4NACA 2KW3C 4FWVA 3L16A 1HF8A 4DI4A 3G2TA 3SFZA 1ZHYA 1PCXA 3PH0C 3IKOB 3HVEB 4MNDA 4EWCA 3G2VA 3KAEA 2XSEA 5KYWB 3ASNC 3ASHA 3PUKA 2KCVA 5KYUA 4AM9A 2IXMA 3SGHA 3RH3A 3AS8A 1WY6A 2WB7A 3MZLB 2PQNA 2VTBB 3CQGB 4J8SA 3P1UA 1PD1A 3CV0A 4I1AA 1TKNA 2ZXOA 2VGXA 4MRUA 4YWQA 4UI9C 2R7TA 3QNKA 2EIJC 3LESA 1MNEA 3B7UX 3HYMB 2FBNA 2PM7A 2EINC 3QOUA 3DM9B 3Q6NA 2R7XA 3UQ3A 4H7YA 4C0EA 1TWGA 3FTZA 2KZTA 4G24A 3RU0A 3ZG1A 4LLEA 3QZCA 3MA5A 2XXAB 2R7UA 4C0MA 2C03A 1FMVA 3NKEA 5KYYB 3EZHA 3JRTA 5G04J 1M56C 3AG3C 1UJKA 3NYJA 2J9UA 1H2VC 2VH3A 4CGVA 2LO6A 4XI0A 3LS8A 4I43A 3O48A 1Z5ZA 1LKXA 4CGWA 5JJ7A 3OXLA 1BR4A 1E8WA 2ONDA 4DK5A 1GW6A 3UGOA 2X38A 4I44A 3CHOA 2BE5F 4A3TA 3IEGA 4YJWA 2WZFA 3TAXA 2IF4A 1G8XA 3CVPA 4GMLA 4Q69A 1TWAA 3CSTA 3S7FA 1PD0A 5CCLA 3L17A 3N2ZB 3G2UA 5LX8A 4PDXA 3O6XA 3B0UX 4DVZA 4IJJA 4JL0A 2AW6A 3GW4A 1SZIA 1M2VB 5A6CA 1FMWA 1UG3A 3QK0A 4IWBA 2UWJG 4HXIA 4QI0A 3D9LA 3IHVA 1VYKA 3UPVA 4PJMA 3Q6MA 3B7TA 4ANVA 1QNFA 1Z63A 4XKBA 3S7BA 3L0IA 3S0XA 3SBSA 1ZYRF 3FTUA 3PZDA 3I4UA 2FEZA 4GYTA 3MGBA 1WAO1 4AE4A 3FU0A 3FH7A 4EZLA 3RO2A 4OIOF 4PS8A 3MV2B 4RG9A 3K33A 2HO1A 1QZ2A 2XPZA 3RK6A 2A6EF 4MKTA 4DOZA 2FGYA 3PMRA 2ZPAA 3EG9A 4CSAC 3FUJA 3LAYA 3NZSA 5F5FA 1QZXA 3AG2C 4FP7A 4L2YA 1J8MF 2NUTA 1S7ZA 2NXPA 3ZRHA 1ELKA 3E70C 3SNHA 5D0OD 2CFZA 4G26A 1MHQA 3IEEA 3APCA 2J9VA 1HO8A 5T3WA 3UGPA 2Q7FA 2PFDA 3PNTB 3D9PA 4XI9A 2Y39A 4LACB 1D0YA 2R5SA 2E0IA 3IBEA 2VQ2A 4HOSA 4KVOA 4HOTA 2VGXB 3TGOA 3PS6A 2KGOA 3CGHA 1KU2A 2HM8A 3FUIA 2KM4A 4HORA 2RD0A 4Y6WA 5FQ8A 4A2NB 4HFGA 5FQ7A 1OWMA 3B13A 4E7SA 1Y6IA 3QWVA 4O79A 4K03A 4NURA 3DZAA 3O4ZA 4IULA 2B0JA 3LEVA 4LUNU 1B89A 2LSUA 4AEZC 3VYWA 2CG3A 3L6AA 3NDBB 3ULQA 3UMVA 5DQZA 3FU5A 4A1SA 3FTWA 4OVUA 2EIMC 1UN9A 4FHKA 2XRZA 2X3MA 5KYYA 4GYOA 2KNHA 1D1AA 3PEUB 2G3KA 3CSFA 5D0QD 3CVYA 4RD9A 1JUQA 3NZUA 3NKDA 4FA6A 4U0UA 2KCKA 2XGMA 1SZAA 2Q9CA 5LCWJ 3PE3A 3RIBA 1ZHXA 2C2LA 3PE4A 3Q7LA 2J07A 5EX0A 4FX5A 4G7HF 4PJNA 3U66A 3AQCA 3WG7C 5KJLA 1UJJA 1H6KA 1E8XA 3EFOA 4XX5A 5DS6A 3FUMA 2L81A 5LFAA 5JJTA 4CDNA 4N3AA 5FCLA 4U0SA 2QFCA 1PY1A 4WWOA 3ASOC 2WXIA 5E3AA 4TUUA 3TJPA 4K0DA 4KXKB 4IAOA 2YHEA 4HOQA 4ILHB 1H2TC 3ONLA 4BWRA 3R9AB 5B1BC 4GCOA 1LS1A 3D9JA 4KNWA 3E4BA 3QKYA 3KMIA 3B7RL 4E85A 4KYOB 1NZNA 3AQBA 2VSYA 3CK9A 2A69F 3OAWA 1OUVA 3K1IC 1ZHZA 3FVYA 4KBQA 3VTYA 4ILGA 4U5DE 4PJLA 4APOA 2A5UA 4ANJA 5DLJA 1L5JA 4M3OA 3EZIA 3QB2A 1EF1C 3DD7A 3EHMA 3FUHA 3FP3A 3PUJA 3S2AA 1RJ9B 2LSVA 1MMDA 3HHMA 3ZSUA 3LKUA 1ELRA 3DJUB 2GW1A 5A23A 2XCBA 4A1GA 3N0TA 2QTVA 1NG1A 2CFUA 3CIAA 3L54A 5AJDA 2GGFA 3FEXA 4KZ0A 1NP7A 1HS6A 5EHHA 3I3NA 4BJ6A 1NZEA 1JPLA 1Z3YA 3DBSA 2CW0F 5T1DB 4E7ZA 2FO7A 4XIFA 3ZYLA 3FTXA 1SF8A 3T5XA 3CHPA 2LAIA 5CI9A 3PNLB 4JEUA 3OA1A 2LNIA 2PL2A 4H4KC 3FWVA 3EH2A 4CS8C 4YT5A 1TWCA 4O6NA 5E2QA 2WXQA 2MYSA 4CS8A 2PX3A 2PQRA 4HS2A 3APDA 2WXJA 3Q15A 3EDTB 3LEWA 2J7PA 3SEOA 2EQXA 5EGYA 3C98A 1UW4B 3MLGA 2DBAA 3KL4A 4AX2A 4ACKA 2L9BA 2WVNA 5BW8C 3LLIA 2WPVA 1IZMA 5KCMA 4JURI 2J7PD 2PF4E 2R7WA 4E6HA 5M72A 2P7VA 4N2SA 3K66A 4BX8A 5HI7A 3FUKA 1QQEA 1ELWA 2IFUA 4HOUA 2R7VA 1M2OA 1ST6A 3EG9B 2HV6A 3EPVA 3LJ3A 3EHNA 2BF0X 3T6BA 3AS5A 1N52A 3MX3A 3T8MA 3ZGQA 3FEYA 5ANLA 3R7RA 4ILIA 2VYIA 3NG1A 2IOLA 4AJWA 5FZSA 2A68F 3NYLA 3QMKA 4ANUA 2AXZA 4GZ6A 2WZLA 3Q49B 1DNPA 4Q7CA 2R7QA 4BJTA 4K0RA 4FHJA 1OWPA 2H7BA 2W4MA 4QDLA 2NC9A 3CVUA 3LLKA 5BNWA 2J9QA 4WNFA 3KS2A 1RJ9A 1SMYF 3CHQA 3U64A 2JLBA 4Q5SF 2I2OA 3I4GA 4EBAG 4NY3A 2KATA 2VSOE 4YT8A 1NU7D 1EDUA 2V3CC 3ZC4A 5LCWC 1TWHA 4O6YA 4Q4ZF 1ZU2A 3K6BA 5T3TA 3AU5A 3PHF2 3MEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEW A;  3CKB A;  5J90 A;  5FQ8 A;  5FQ7 A;  4F53 A;  4MRU A;  3I4G A;  3EHN A;  5FQ4 A;  3JQ1 A;  4PUC A;  3CK8 A;  3KEZ A;  3GZS A;  3EHM A;  3QNK A;  3CKC A;  3MYV A;  3MX3 A;  5E76 A;  3CK9 A;  4Q69 A;  3HDX A;  3EJN A;  4L7T A;  3SGH A;  5E75 A;  3NQP A;  5FQ6 A;  5LX8 A;  5T4Y A;  3L22 A;  3FDH A;  3JYS A;  4LER A;  5T3R A;  4F7A A;  3MCX A;  3OTN A;  3CGH A;  3SNX A;  3IV0 A;  3CK7 A;  3P1U A;  3JQ0 A; 
#chains in the Genus database with same CATH topology
 3UXG A;  4G2V A;  2LFF A;  4WNE A;  1BZ4 A;  2YLI A;  4LRZ A;  4I1M A;  1WG0 A;  3AOU A;  2WM9 A;  4CEM A;  4YDY A;  3C8G A;  3FH8 A;  3FUF A;  4KC9 A;  2HUJ A;  2OEV A;  4U5B E;  4N2Q A;  4ANX A;  4JCH A;  3NAW A;  2XRH A;  1A7V A;  3TL5 A;  1YAU O;  1S63 A;  3OXG A;  3TXM A;  2A1D D;  1YA0 A;  3RKV A;  3BQO A;  1H9G A;  4XPX A;  3HNL A;  3CKC A;  3S9O A;  2NUP B;  5A6K A;  2OOE A;  4G25 A;  3M4B A;  3CQZ A;  3NOG D;  1WAT A;  3FMS A;  1TFK B;  4D10 C;  5T4Y A;  4ACL A;  3ABM C;  3MCX A;  3UT4 A;  5CEA A;  2HSB A;  3JQ0 A;  1ZHW A;  2DZO A;  2LQG A;  3UMI A;  5FQ4 A;  4WND A;  5CHE E;  1N4P A;  1NSG B;  4YND A;  3HXF A;  4WGY A;  4I2Z A;  3MBG A;  3F46 A;  3ZEF A;  2YHC A;  4F4B A;  2XPI A;  4HFF B;  1V74 B;  2X6I A;  3AG4 E;  2WXO A;  5FIO A;  4TUM A;  3JYS A;  3HTK C;  3FY4 A;  3TOM A;  3GWL A;  2CG2 A;  1RXQ A;  3D9O A;  1V55 C;  2IYL D;  4U9E A;  2L0T B;  3X1O A;  2WMN A;  3RO3 A;  4PFP A;  3FUE A;  1OWO A;  1A7D A;  4CDR A;  1RMV A;  3US6 A;  1OY3 D;  4GZD A;  2I9C A;  3ASN E;  4C3D A;  3LS1 A;  5KYX B;  5ENR D;  1Q0D A;  4Y6C A;  4JC8 A;  4PK4 A;  2IJG X;  3ULE G;  3ABK C;  3DEP A;  3ZIB A;  3U0C A;  4O1O A;  2ZU6 B;  3AG1 E;  5DBK A;  2XHE A;  2F8Y A;  1ZZP A;  2WMO A;  3CVQ A;  2P1A A;  3ZXP A;  4KBL A;  1BU9 A;  4GA0 A;  4NRH B;  5C2Y A;  4JZA A;  3I4R B;  3RYL A;  3VLD A;  1SZ9 A;  1YLM A;  3DRA A;  1NBB A;  3MYI A;  4UQZ A;  3FTY A;  3ONK A;  3RF3 A;  4HLL A;  2V8S E;  2WXK A;  3WAQ A;  1D0Z A;  2GFH A;  5JS5 A;  1HG5 A;  1O3U A;  4W9R A;  2R7S A;  3HXD A;  2XEE A;  2CCY A;  2GAQ A;  4CX9 A;  2E2E A;  2H6I A;  4LEU A;  1UN8 A;  3SFX A;  1A41 A;  5H7P A;  3KSQ A;  5AC4 A;  1H2U A;  2G3V A;  1Z6A A;  3BEE A;  4JEA A;  2B0H A;  4RBN A;  2NYJ A;  3DSV A;  2X51 A;  1QBQ A;  2D5R B;  2JAB A;  4J8E A;  5LOZ A;  1VOM A;  2H7O A;  2J45 A;  3EH1 A;  5EID A;  4K5C A;  4JEH A;  2PNN A;  5COF A;  1XZQ A;  3S29 A;  4EIY A;  3N71 A;  4DX2 A;  3SZR A;  2XEN A;  5A7D B;  3JSE O;  4NC3 A;  3L13 A;  1YYX A;  4AP2 A;  1O87 A;  4JA7 A;  5ARF A;  1PV3 A;  4O6M A;  3TWW A;  2OOC A;  2WVO A;  1QSP A;  3DSU A;  1H6G A;  3G4X A;  4URK A;  2OV8 A;  2W45 A;  3KEA A;  3HVE A;  4L7T A;  3LY8 A;  1FFH A;  1YMP A;  3DXK G;  4E17 A;  4N5Q A;  1TNU A;  1OCO C;  3Q75 A;  3DSX A;  2QY9 A;  4MVS A;  2XZT G;  2XGS A;  1TN6 A;  3PRZ A;  5CMY A;  1IQR A;  2EIL C;  3PDN A;  3UT7 A;  2OQM A;  2WXR A;  4YDW A;  3DE9 A;  5FT9 A;  1Z7Q c;  2R03 A;  4N3C A;  1HFA A;  1EKY A;  3JQ1 A;  1D9S A;  2WXL A;  4CZ2 D;  2BUG A;  5AN8 A;  4YVO A;  4B8A A;  1H6P A;  4F1S A;  4AXH A;  1NFI E;  4BG0 A;  1OCZ C;  5KYW A;  3S90 A;  4L2L A;  5FZR A;  3WHN A;  2CNW A;  1Y4C A;  4GPK A;  1KPS B;  4OIQ F;  3CLJ A;  4GYY A;  5ANR A;  4W8P A;  3ML9 A;  2WVI A;  3ASD A;  5ENP D;  1LM3 B;  1V54 E;  4N06 A;  4DUI A;  4ZFH A;  3LJB A;  2J4D A;  1N1C A;  3FTV A;  2JX0 A;  3FH5 A;  4OIP F;  2Q9A A;  3CK8 A;  4J8D A;  3D9M A;  4XEK A;  1E86 A;  3DAG A;  2EIL E;  3BEH A;  4CIP A;  3S84 A;  1D1B A;  3N24 A;  2GDC A;  4JJG A;  1HZ4 A;  4XEI G;  3EGX A;  3SBT B;  4CT0 A;  3SP1 A;  1Z23 A;  5JSL A;  3SY2 A;  1SQM A;  2XS8 A;  4JTC B;  2FUL A;  5BXO A;  3QW0 A;  1TEZ A;  4CIH A;  3RKO F;  4BPM A;  2XPY A;  2NSZ A;  2QC9 A;  3Q47 B;  3NYM A;  4DLO A;  1HW1 A;  5KNG A;  5DIZ A;  1HMO A;  3E9V A;  3LYA A;  2YHS A;  3RVZ A;  4JPS A;  3OWT A;  3EIJ A;  4G23 A;  3ABM E;  4N39 A;  3TWS A;  2MHK A;  4NIK A;  5ARG A;  2VAS A;  3MV3 B;  2VJ8 A;  2R7O A;  3ENE A;  5G2N A;  4DJA A;  1E7U A;  4D4X A;  2P58 C;  3CR3 A;  1HY5 A;  2XL8 A;  1JWF A;  3ZTZ A;  1YAR O;  2AXV A;  2GRL A;  3GZS A;  1IKN D;  5IY5 C;  4R7L A;  3U3B A;  2FF4 A;  2P9P G;  4ONS A;  3HDX A;  2EIJ E;  3VTX A;  2IO3 C;  3MKR A;  5G55 A;  2ZXR A;  4FLB A;  3FU6 A;  4BSX A;  1OWL A;  4TXQ A;  2KK1 A;  3AU4 A;  2B6C A;  2WXM A;  3D3M A;  2H6H A;  1U0B B;  4GZ5 A;  2VGE A;  5AQA A;  2BTD A;  3TG5 A;  4L9P A;  3LDZ A;  1BD8 A;  4HFK B;  3GOR A;  3URZ A;  3U8V A;  2Q00 A;  2AJA A;  2EPM X;  3QAR A;  4I17 A;  1OR3 A;  3TG4 A;  3OEO A;  3DSW A;  3IHY A;  3HG0 D;  1APC A;  4FUL A;  4N4W A;  3FFL A;  1ZU4 A;  2CHW A;  5BUO A;  2PM6 A;  4AE4 B;  4J0U A;  1KT0 A;  3WXX A;  1OW6 A;  4J32 B;  4I6J A;  3ZN3 A;  3I5Q A;  3SFY A;  4C3B A;  2XL6 A;  2CNW D;  1LE2 A;  2AWI A;  4PS7 A;  2GRR B;  3POV A;  2KXP C;  4JD2 G;  2QE9 A;  2EIM E;  5DS4 A;  2JEK A;  4A63 B;  2CYD A;  1M57 C;  4ER9 A;  3ZVV A;  4W8K A;  4HRM B;  2H6G A;  1VDY A;  1RW2 A;  1Z5S C;  4CCA A;  4LLC A;  5HQ8 A;  3OXF A;  1OR2 A;  2QNL A;  4IB4 A;  4A55 A;  4EBK A;  2PX0 A;  2XQ0 A;  2C0M A;  2A4Z A;  3X2Q C;  1JCR A;  2OU6 A;  4MQ9 F;  4BSZ B;  3U9W A;  4HEA J;  4FAD A;  4U5E E;  2DYR E;  2ION A;  3FUD A;  3SD5 A;  3UTM A;  3T5V A;  256B A;  1YA7 O;  2NPU A;  1TNY A;  4JTA B;  4C9B B;  1WGW A;  3F47 A;  4OAU C;  4MVO A;  2R7R A;  2YL0 A;  2VSX E;  2YQ8 A;  4JIO A;  1LE4 A;  4DRI B;  2V26 A;  4FC8 A;  4BJ5 A;  4EZK A;  5E3C A;  3W8I A;  3BU8 A;  1X5B A;  4GCN A;  2HSQ A;  3CKB A;  3HLZ A;  4OIN F;  2IM8 A;  4NTA A;  4U0Z A;  3DST A;  4A4A A;  4BJ1 A;  4KVM A;  3MYV A;  3RRN B;  1JAF A;  3ZYK A;  4UWF A;  4GA1 A;  3KKB A;  5EX3 A;  3C3R A;  3LY7 A;  3NMK A;  3NMI A;  3QWP A;  4J7W A;  4X0R A;  1HG2 A;  1OCC C;  4Z9J A;  4CS9 A;  3OTN A;  2Y3D A;  3L8I A;  5DS5 A;  4PAC A;  3C18 A;  3ABL E;  4XZ4 A;  1DC2 A;  3RRU A;  5CI8 A;  1SW6 A;  4PS3 A;  3HJC A;  4JC7 A;  4U7E B;  1MQS A;  1WTY A;  4P9T A;  1E85 A;  1SVX A;  4PUC A;  1IW7 F;  3KEZ A;  2KYH A;  3TD7 A;  3ZHE A;  2X6F A;  4C3E A;  3TJ5 A;  4FJZ A;  3AAA C;  4MTF A;  4EBB A;  1Y6D A;  1E8Z A;  4FU3 A;  3ZKJ A;  2WVQ A;  3ZUV B;  1DVP A;  5E33 A;  3DEO A;  2NSF A;  3GZ1 A;  4BFR A;  5L0J A;  3ASF A;  3W4Y A;  5T8I A;  5L0F A;  2C0L A;  1TJC A;  3GEH A;  3W9F A;  4I9C A;  4WJ0 A;  2RG8 A;  2OEX A;  4J6I A;  1VYI A;  1A17 A;  1N4S A;  4XKC A;  3R9M A;  3FOP A;  4PR9 A;  3Q7F A;  5L3V A;  3QDN A;  3GZ2 A;  1JCS A;  5FWQ A;  4GZ3 A;  2P9S G;  3UMH A;  3KYJ A;  5E76 A;  4MS6 A;  3Q9U C;  4U5G A;  1MMG A;  2G62 A;  3SZ7 A;  4P29 A;  5EIB E;  2IXP A;  4CSA A;  2PZI A;  2BED A;  4KMO A;  4NQF A;  1FVH A;  3PEV B;  4DI3 A;  3RJV A;  5J90 A;  3RVY A;  1SA4 A;  4ABN A;  2A5E A;  4DPR A;  1LTX A;  4N3B A;  3W8H A;  3U5S A;  4U95 D;  1YJG A;  2XEV A;  1DOV A;  3MKQ B;  4UWH A;  2IOQ A;  5AAO A;  1EI7 A;  1J8Y F;  3Q5M A;  3EIQ C;  4QFV A;  2AU5 A;  2KJG A;  3T4R A;  1EYH A;  3CHM A;  3V31 A;  3HNI A;  3JUI A;  2AVK A;  2ZGD A;  2OEW A;  3JUE A;  1Q0F A;  2ICW G;  3V2X A;  2NG1 A;  2F0Y A;  3VLF A;  2R59 A;  4DX1 A;  1INZ A;  1AUE A;  3CVN A;  4LCT A;  4BEJ A;  2VB6 A;  1K04 A;  1MX6 A;  2Q9B A;  5G05 J;  4ATZ D;  3C72 A;  2R17 C;  3O39 A;  3ZU7 B;  1A0B A;  4GEH A;  4DJ9 A;  3VAY A;  4ZLC A;  4PFO A;  3ZW3 A;  4B8C B;  1LD7 A;  3FUL A;  3ULY A;  1UG7 A;  2YZS A;  3GAN A;  4YN0 B;  5DQT A;  4HB5 A;  1HE8 A;  3UIO C;  1D0X A;  4IN3 B;  1UOH A;  1FT2 A;  4CRW A;  4RDA A;  3D9N A;  3FHE A;  4ANW A;  2XLE A;  1HH8 A;  3R2P A;  2CGE A;  2JD3 A;  4MLP A;  1N94 A;  4BX9 A;  4BET A;  3ASO E;  2XGO A;  3VM6 A;  4ZLD A;  4JHJ A;  1MND A;  4TRQ A;  4M7C A;  3UM2 A;  1NL4 A;  2UY1 A;  3S7D A;  3T9O A;  3L34 A;  1U3C A;  4GTM A;  3EHQ A;  4WWP A;  5EKQ D;  4F7A A;  5AIJ A;  3NOC D;  3UT8 A;  4CS9 C;  2NUP A;  4GYW A;  4AL1 A;  1N95 A;  2DCP A;  4UWK A;  4JHR A;  4GZC A;  4U63 A;  1RKC A;  4BT8 A;  3UR3 C;  2H8A A;  2F8X K;  3CVV A;  2L9J A;  4XE0 A;  3AG3 E;  3G4Z A;  2LXL A;  3CEQ A;  1Z3X A;  3JXI A;  2DYS E;  1TQG A;  3X2Q E;  4JZY A;  1KZO A;  5FQ6 A;  3L9T A;  2EPL X;  3UKR G;  5CMW A;  2OCC C;  3CVX A;  3NF1 A;  3PZ4 A;  5KWD A;  5BUZ A;  3D9K A;  4L6R A;  4CJO A;  4BJ5 C;  3CAX A;  2P2C P;  1K3Z D;  5J08 A;  3EU9 A;  5D92 A;  3EGX B;  3B71 A;  2J0X A;  2WXG A;  3D9H A;  1EQ1 A;  4LDR A;  4DX7 D;  1JRA A;  4R32 A;  2IBF A;  3PVL A;  4AY6 A;  2O9X A;  4BY6 A;  3RQE A;  3APF A;  3B7B A;  2HR2 A;  4KT6 B;  5CEC B;  1ZVZ A;  4J30 B;  3QAQ A;  2Q3T A;  4FAP B;  5FZQ A;  4G7Z F;  4JW1 A;  3QWW A;  5G05 C;  2KC7 A;  4OYS A;  4CS7 A;  4IAR A;  3O55 A;  2M63 A;  5HRY A;  3NBN B;  2XL4 A;  1N4Q A;  4GAA A;  3MJW A;  2LK4 A;  3H2V A;  2ZXW C;  3DE8 A;  4NCQ A;  1QLE C;  3SQV A;  4XLN F;  4FLH A;  5AEN A;  1ZB1 A;  2CHX A;  4MTG A;  2GRO B;  4XWJ A;  2ZXP A;  4J8F A;  5G04 C;  2GA0 A;  4LER A;  3JSZ A;  4CBE A;  3WOD F;  2WXP A;  2E87 A;  3TWU A;  5BV0 A;  5AAR A;  1OXB A;  2MOW A;  5BPP A;  5AYW D;  3S27 A;  1MX4 A;  2LAH A;  3ZDL A;  2UUI A;  2Y69 C;  4AV7 A;  4DX5 D;  1N11 A;  4MVQ A;  1LI5 A;  2LCH A;  4U96 D;  4DRJ B;  2PP4 A;  2YL1 A;  2C04 A;  3C8Z A;  3BG0 B;  1LI7 A;  2OVB A;  4AIF A;  3H2U A;  3O10 A;  2XLO A;  2OCC E;  3G2W A;  1M2V A;  4XPY A;  2XLW A;  5CRV A;  1KT1 A;  4IGG A;  4UI9 J;  4YDE A;  1EA8 A;  3RIP A;  3U2L A;  1MMA A;  4YT2 A;  2XRY A;  4NQ0 A;  3C8G B;  4NTF A;  3IQC A;  3K9I A;  1K40 A;  4P6I C;  1FFT C;  2HE0 A;  1P5Q A;  4QQI A;  1QKR A;  1XNF A;  1PC2 A;  1W2W A;  4KZC A;  1EPU A;  1T6U A;  4WUY A;  5L3Q A;  2MRI A;  4K5A B;  3W2W A;  1YYH A;  3HIZ A;  4O7G A;  3NQP A;  4HE8 D;  4XLP F;  1NFO A;  2RSE B;  2CDQ A;  5B1A C;  4GMJ A;  2J0W A;  3UI2 A;  1ZHT A;  2H7V C;  3EUV A;  4F53 A;  5BV1 A;  4UWL A;  1WOL A;  4XTK A;  2MWQ A;  2Y3B A;  1NU9 C;  3JYY A;  2J4B A;  1JWG A;  3U4T A;  2VGY A;  1G4U S;  3AG2 E;  2NUT B;  3VF0 A;  1TJF A;  1F1M A;  2AXU A;  4J7Y A;  4I6E A;  3ZYM A;  1NA0 A;  4TV3 A;  1VMA A;  2X6K A;  1BPO A;  4E0I A;  5JHA A;  4PJJ A;  4JKV A;  4C7O B;  1FTS A;  3CQC B;  3SNX A;  3MKQ A;  3CZ6 A;  2FFH A;  4AY5 A;  5ITZ F;  2DIW A;  3ABL C;  2M4E A;  4CJG A;  2X6H A;  4U07 A;  4UQY A;  2OVF A;  2TMV P;  2OG2 A;  5JVE A;  4I6G A;  5D2M C;  4I9E A;  1YCS B;  1JPJ A;  2V4L A;  2R9R B;  4AOF A;  4H54 A;  3UIP C;  1FCH A;  4ZHB A;  3GEE A;  3FAP B;  4BJ6 C;  2FI7 A;  4G0H A;  3MFN A;  3KD7 A;  2I6H A;  1OKK A;  4GTV A;  3LNR A;  4EPZ A;  1OT8 A;  1YZA A;  5JA4 D;  3S7J A;  2A0U A;  3ITF A;  3JT1 A;  2KSF A;  5BQH A;  3AGU A;  3FDQ A;  2I1K A;  1G3N B;  1MMN A;  1JR8 A;  1H7I A;  4OD4 A;  3JCU Q;  3P2B A;  1FVF A;  2Y4U A;  4OVV A;  1OXJ A;  1LD8 A;  1O1T A;  3CSK A;  5JMN D;  2ZIS A;  1QQ3 A;  2I1J A;  1LS4 A;  2GRP B;  1XGW A;  4U8H A;  1R5I D;  5KJK A;  4U5C E;  5C1D A;  2IQC A;  3TUL A;  4O6F A;  2IXN A;  3LCA A;  3LEO A;  3DMD A;  5B1A E;  3FUN A;  5CBN A;  4K1O A;  5KJN A;  1ZU5 A;  3B0V C;  2J9W A;  1E90 A;  4RG6 A;  1RKE B;  4F6R D;  3RRM B;  4EBA A;  4I1O B;  5BT1 A;  2KZT B;  4L23 A;  3JCK C;  1K1B A;  2ASR A;  3ESL A;  3SHF A;  3KYI A;  4EHP A;  3SF4 A;  1C17 M;  3UMK A;  1WM5 A;  4DVY P;  2RFM A;  4EQF A;  4C48 B;  5CRU A;  4IRU A;  4GTQ A;  1KTM A;  2ETS A;  4U8V D;  1ORY A;  2ETB A;  3AJM A;  4JVS A;  4U5F E;  4IYP A;  4JHK A;  3I5P A;  3M1C B;  3T6J A;  3AG1 C;  3ASG A;  1BBH A;  1T01 A;  4N5C A;  4XEV A;  4B6I A;  4V3I A;  4MS2 A;  3SYN A;  3EFO B;  3IHU A;  5E75 A;  3EQL F;  2HZ8 A;  3W2V A;  2EIK C;  2BC5 A;  4AVX A;  5JRA A;  1VB5 A;  1IQU A;  1NA3 A;  3UIN C;  3FAJ A;  2QY7 A;  1IHB A;  4I2W A;  4WAF A;  2DYS C;  1E96 B;  1TN8 A;  1OCR E;  4LSZ E;  3DSS A;  3UM3 A;  4AL0 A;  4DBQ A;  2X6J A;  2WQ7 A;  4CDM A;  1IYG A;  2HFI A;  3SXY A;  4O60 A;  2LIG A;  2ETA A;  1V54 C;  3RQG A;  2IXO A;  5L0H A;  4DRH B;  2YEV A;  4LNG A;  3V2O A;  3FHD A;  2AVP A;  5D91 A;  5K0I A;  4IAQ A;  2V0P A;  2XXA A;  2YL3 A;  3V7O A;  5ENQ D;  3B7S A;  1K1A A;  4QI2 A;  2WQH A;  1PAQ A;  3S28 A;  3V5Y A;  3RFY A;  4X8Q A;  2XM0 A;  3DPD A;  5BXU A;  1I5N A;  1Z6T A;  4Z9H A;  4WWN A;  2KCL A;  3CHS A;  5AGF A;  2I8B A;  3EJN A;  3K1H A;  2XM4 A;  4GU5 A;  1VTM P;  4RLY A;  3AGT A;  2WXH A;  1RKE A;  4EEC A;  4GB9 A;  1KZP A;  4AK9 A;  3C8G D;  3ZYQ A;  1E7V A;  1IHG A;  4F3V A;  4G8K A;  1FR0 A;  1KLX A;  5A6B A;  3QW1 A;  3C7J A;  2UY1 B;  3LPZ A;  2YIN A;  5B3S C;  5KJM A;  4UUC A;  2OJE D;  5F5H A;  4Q96 A;  1LVK A;  2WXF A;  3AG4 C;  3SO8 A;  2WB2 A;  4D4N A;  4B94 A;  1OWN A;  2P9U G;  3V5Z A;  3R7C A;  5ENN A;  3HXB A;  2DGJ A;  3NRH A;  1MJ0 A;  3JYH A;  3QC1 A;  2GRM A;  1QPU A;  4HNA D;  3DJN B;  3PRE A;  3Q7G A;  2EIN E;  2D4U A;  4HVB A;  4YVQ C;  3TQO A;  4Q94 A;  1L3P A;  4G7O F;  1GGQ A;  2HV7 A;  5KYX A;  2L0I A;  3V79 K;  1JPN A;  2WXN A;  5L0C A;  5LP0 A;  4UQX A;  4G11 A;  3DAF A;  3ZNG A;  2P61 A;  4FES A;  4WNG A;  5AQ9 A;  4K5B A;  3T8K A;  3DKA A;  3IQT A;  1LF8 A;  1HE9 A;  3ZVR A;  4CT4 A;  5KBA A;  1S70 B;  1CGM E;  4B89 A;  1DCQ A;  4YK5 A;  4XPW A;  3JXJ A;  4ME2 A;  4B0Z A;  3ZHE B;  1K8K G;  1YZC A;  3JZ0 A;  4RQI A;  1H19 A;  2IU1 A;  3BRJ A;  2HJ3 A;  3QJZ A;  2CHZ A;  4JXT A;  1H0A A;  2NSG A;  5AJL A;  2Y3G A;  2HYZ A;  4JJF A;  2UUH A;  2J46 A;  5HS0 A;  3CVL A;  3TWV A;  1XZP A;  2J49 A;  4UWG A;  3TWT A;  2J09 A;  4BER A;  2QUP A;  1U89 A;  1TR2 A;  3UNG C;  3SXZ A;  1A5E A;  3CHR A;  1HMD A;  4G1T A;  4ATG A;  4OIR F;  3R7Q A;  1O1R A;  2WL8 A;  4KNV A;  2QYU A;  3LVQ E;  5CCM A;  5EDS A;  3B9Q A;  1D1C A;  4BT9 A;  5EN5 D;  2IOS A;  3E32 A;  2XLH A;  3K1I A;  1AP7 A;  3ZFW A;  3ZXS A;  2ILR A;  2R05 A;  5HSW A;  2L6J A;  3T6G B;  2J08 A;  2HKV A;  1Y8M A;  3C3Q A;  1Q2Z A;  4EZJ A;  1C03 A;  2VTB A;  4GA2 A;  1KNY A;  3L08 A;  1V55 E;  5L0I A;  3TXN A;  4DLQ A;  3C62 A;  3SI5 A;  4HLE A;  3KH2 A;  3UUX A;  1MQV A;  3V5X A;  2YNQ A;  3UKU G;  1D8E A;  3EGD A;  5BQI A;  2KQ9 A;  3LNM B;  3IV0 A;  3DM5 A;  1Z3I X;  2DVW A;  1HXI A;  3PDM P;  5AC5 A;  1N0R A;  3Q4A B;  1DOW A;  3ML8 A;  4L1B A;  4OAV B;  3RAU A;  3GM3 A;  1T6Q A;  4N6H A;  4KI2 A;  1H6O A;  4BTA A;  2WQ6 A;  4RSY A;  4MBG A;  4GTO A;  2V5Q C;  1A7E A;  2LFD A;  2A6H F;  3LS0 A;  3FU3 A;  4U9D A;  2P6V A;  2W4B A;  4OD5 A;  3VLE A;  1NFN A;  4APF A;  4CDA A;  1U3D A;  3BG1 B;  1HX8 A;  1E8Y A;  4UI9 K;  5TJ5 E;  1NLX A;  4LNU D;  3PZ1 A;  1BR1 A;  1V4A A;  3ZIM A;  2Q4F A;  3A11 A;  2F22 A;  1CGO A;  5KYN A;  1LPE A;  4U04 A;  4XEF A;  1WN0 A;  3GOD A;  4A3V A;  4H7X A;  4M63 A;  5DVW A;  1W3B A;  2Z15 A;  3DXJ F;  5JHB A;  3PZ2 A;  4MVZ A;  2Y3A A;  3FDH A;  4FJY A;  3M4C A;  3K7D A;  3UX4 A;  1BR2 A;  2QYJ A;  1OCO E;  3G2S A;  1N54 A;  1OCR C;  5KYU B;  3J5Q B;  3LXU X;  2P9N G;  4ULW A;  3L8J A;  3GYZ A;  4C7O A;  4F1P A;  1C02 A;  1VK5 A;  4TXP A;  4YT4 A;  2WZG A;  1SYQ A;  3ESK A;  3FTS A;  2Y4T A;  3L22 A;  4K7B A;  3D9I A;  5EIL A;  1ZBP A;  3CK7 A;  1OKK D;  2V5F A;  4RVB A;  3B0P A;  3ECS A;  4I3M A;  1O5H A;  3U2M A;  3H65 A;  1AEP A;  4U5H A;  2AWC A;  3EGD B;  5FJY A;  1GS9 A;  4DRX E;  3LY9 A;  2W9Y A;  3PZ3 A;  5JJ6 A;  4GQH A;  2VSN A;  3CVW A;  3TWQ A;  4BTB A;  2ZXW E;  3AS4 A;  4P9F A;  1HU3 A;  2XCC A;  5T3R A;  1Q0K A;  3Q7A A;  3VRC A;  3U3W A;  2J8S D;  4JA9 A;  3F6Q A;  5FTP A;  2DYR C;  3LVR E;  1S0P A;  4DBR A;  4PH4 B;  1MZC A;  5CER B;  2Y3H A;  3ZPJ A;  2LSE A;  4NAC A;  2KW3 C;  4FWV A;  4EKW A;  3L16 A;  4WGZ A;  1HF8 A;  4DI4 A;  3G2T A;  3SFZ A;  5JLI A;  1ZHY A;  2LXM A;  5L0D A;  1PCX A;  3B29 A;  5COG A;  3PH0 C;  4HRN A;  4ULV A;  4CDV A;  2EPN A;  3IKO B;  3HVE B;  2Y69 E;  4MND A;  4EWC A;  3M79 A;  3G2V A;  3HRA A;  3KAE A;  2XSE A;  5KYW B;  2HMZ A;  3ASN C;  1G5Z A;  3HNK A;  3DPY A;  3ASH A;  3PUK A;  2KCV A;  2VC9 A;  1X81 A;  4GPM A;  5KYU A;  3IPM O;  4AM9 A;  2IXM A;  3SGH A;  2FO1 E;  3RH3 A;  4DXW A;  3AS8 A;  1QYM A;  1WY6 A;  2WB7 A;  3MZL B;  2PQN A;  2VTB B;  4JRZ A;  4JEB A;  3CQG B;  4J8S A;  3P1U A;  1PD1 A;  3CV0 A;  4I1A A;  1TKN A;  3FOO A;  2ZXO A;  2VGX A;  3Q78 A;  2ZIR A;  5GPG B;  4MRU A;  1S05 A;  4YWQ A;  4UI9 C;  2R7T A;  2EPK X;  3QNK A;  3UM0 A;  1YDI A;  4JB8 P;  2EIJ C;  3LES A;  1MNE A;  3B7U X;  3HYM B;  3QTH A;  1TR4 A;  2VCB A;  2FBN A;  2EIN C;  1MX2 A;  2PM7 A;  1UFB A;  3QOU A;  3DM9 B;  1Q0M A;  3PCV A;  3HXE A;  3Q6N A;  2R7X A;  3UQ3 A;  4H7Y A;  2YL7 A;  4C0E A;  1TWG A;  4EUK B;  3FTZ A;  2KZT A;  4G24 A;  3RU0 A;  3ZG1 A;  1OW8 A;  4LLE A;  1YA9 A;  1VLS A;  3QZC A;  3MA5 A;  2YQY A;  5CBO A;  3ATP A;  5FIN A;  1TFO B;  2XXA B;  2IY0 C;  2QZA A;  2R7U A;  4C0M A;  2C03 A;  3DXM G;  1FMV A;  3NKE A;  2B0O E;  5KYY B;  3EZH A;  3JRT A;  5G04 J;  3ZQV A;  1M56 C;  3AG3 C;  4Z9I A;  1UJK A;  5F28 E;  3NYJ A;  2XLM A;  2J9U A;  1JCQ A;  1H2V C;  2VH3 A;  4CGV A;  2LO6 A;  1JMW A;  4XI0 A;  4E18 A;  1BDJ B;  3BUA A;  3LS8 A;  3EU5 A;  4I43 A;  2J9B A;  3O48 A;  1Z5Z A;  1LKX A;  4CGW A;  5JJ7 A;  3OXL A;  1BR4 A;  2RD9 A;  1TN7 A;  3IXE A;  2P9L G;  1E8W A;  2OND A;  4DK5 A;  2DWZ A;  2PNO A;  1GW6 A;  3UGO A;  2AP3 A;  2X38 A;  4I44 A;  3CHO A;  2BE5 F;  2R02 A;  1U2V G;  3IEG A;  4YJW A;  4A3T A;  1OW7 A;  2WZF A;  3TAX A;  2IF4 A;  1RCP A;  2FAP B;  2LUH A;  1G8X A;  4GTP A;  4LNB A;  3CVP A;  4GML A;  4Q69 A;  1TWA A;  3RW0 A;  3CST A;  3S7F A;  1PD0 A;  3E37 A;  5CCL A;  2KC3 A;  3N2Z B;  3G2U A;  3L17 A;  5LX8 A;  2EIK E;  4PDX A;  3O6X A;  3B0U X;  4NTB A;  4DVZ A;  3J06 A;  2IEJ A;  4IJJ A;  3GEI A;  2HJM A;  4O1P A;  5EYL A;  4JL0 A;  1Q0G A;  2AW6 A;  3GW4 A;  1SZI A;  1M2V B;  3B95 A;  2L6F A;  5A6C A;  3G50 A;  1FMW A;  1UG3 A;  1FNT c;  1AVO B;  3QK0 A;  3ISM C;  4IWB A;  2UWJ G;  1O1S A;  4QI0 A;  3D9L A;  3IHV A;  4HXI A;  1VYK A;  5A6J A;  3UPV A;  4PJM A;  1SR2 A;  3Q6M A;  3B7T A;  4ANV A;  1QNF A;  1Z63 A;  4XKB A;  3S7B A;  3L0I A;  3S0X A;  3SBS A;  1ZYR F;  3FTU A;  3PZD A;  3I4U A;  2FEZ A;  4JCZ A;  4GYT A;  2MHR A;  3MGB A;  1WAO 1;  4MVU A;  4EBJ A;  4AE4 A;  3FU0 A;  3FH7 A;  4EZL A;  3RO2 A;  4OIO F;  4PS8 A;  3MV2 B;  4RG9 A;  4G78 A;  3K33 A;  2HO1 A;  5A69 A;  1QZ2 A;  2XPZ A;  3Q73 A;  3TK0 A;  3RK6 A;  2JPU A;  1E84 A;  4MTO A;  2A6E F;  4MKT A;  3MYF A;  4DOZ A;  2FGY A;  1BI7 B;  3PMR A;  4TXR A;  2ZPA A;  3EG9 A;  4CSA C;  3FUJ A;  3LAY A;  3NZS A;  5F5F A;  1QZX A;  1FT1 A;  3TJ6 A;  3QVZ A;  1DCE A;  3AG2 C;  3DWL G;  2A0B A;  5BQG A;  4GMR A;  4UDV A;  4FP7 A;  3WG7 E;  3ZTM A;  1LIH A;  4L2Y A;  1J8M F;  3DWW A;  2NUT A;  1S7Z A;  3Q9N C;  3TWX A;  5FZT A;  2NXP A;  3ZRH A;  1ELK A;  3E70 C;  3SNH A;  5D0O D;  2CFZ A;  4G26 A;  1WDY A;  2I15 A;  1MHQ A;  3IEE A;  3E33 A;  2RFA A;  3APC A;  2XLD A;  2J9V A;  2ZD9 A;  1HO8 A;  5T3W A;  1U6H A;  3UGP A;  1MYO A;  1HW2 A;  2Q7F A;  1BI8 B;  1GM5 A;  2ZGG A;  2PFD A;  3PNT B;  3D9P A;  4XI9 A;  2QLA A;  4LG6 A;  2Y39 A;  4LAC B;  3E34 A;  1D0Y A;  2R5S A;  1YYJ A;  1ZW2 A;  4HI8 A;  2E0I A;  3IBE A;  4J8Y A;  2VQ2 A;  4HOS A;  1AWC B;  1SA5 A;  2HMQ A;  4KVO A;  5HKP A;  3U3F A;  4HOT A;  2VGX B;  1T9K A;  3TGO A;  3PS6 A;  2OKU A;  2KGO A;  3CGH A;  3RSE G;  1KU2 A;  2HM8 A;  3FUI A;  2KM4 A;  4HOR A;  2RD0 A;  4Y6W A;  5A6A A;  5FQ8 A;  4A2N B;  4HFG A;  3KPH A;  5FQ7 A;  1OWM A;  3B13 A;  4E7S A;  1Y6I A;  3QWV A;  4O79 A;  3E30 A;  4K03 A;  4NUR A;  3DZA A;  3O4Z A;  4IUL A;  2B0J A;  2OJQ A;  3CEX A;  2YLD A;  3LEV A;  4LUN U;  1B89 A;  5HV9 A;  2LSU A;  4AEZ C;  1CPR A;  3VYW A;  2CG3 A;  3L6A A;  1R4T A;  1E2X A;  3NDB B;  3ULQ A;  4YL3 A;  3UMV A;  5DQZ A;  3FU5 A;  4A1S A;  5JUA A;  3FTW A;  4OVU A;  2EIM C;  1UN9 A;  4FHK A;  2XRZ A;  2X3M A;  5KYY A;  4GYO A;  2KNH A;  1D1A A;  2BKG A;  3PEU B;  2G3K A;  3CSF A;  5D0Q D;  2P9K G;  3CVY A;  2RKK A;  4B93 B;  3NB2 A;  4RD9 A;  1JUQ A;  3NZU A;  3NKD A;  1RZ4 A;  2H6F A;  4FA6 A;  2LP4 A;  4U0U A;  3L82 A;  2KCK A;  2YRF A;  2XGM A;  1SZA A;  2Q9C A;  2R25 A;  3PE3 A;  5LCW J;  3IQ6 A;  3RIB A;  2VCA A;  3IQ5 A;  1ZHX A;  3UM1 A;  2C2L A;  4LDK A;  3PE4 A;  3Q7L A;  2J07 A;  5EX0 A;  5B3S E;  4FX5 A;  1N4R A;  3U9M A;  3GM2 A;  4G7H F;  1ZW3 A;  1L7C A;  4PJN A;  1BLX B;  3U66 A;  5EK0 A;  1ORJ A;  5D66 A;  3C3O A;  3AQC A;  4GTR A;  2YWA A;  3WG7 C;  5KJL A;  2YVK A;  5A6B D;  4MW8 A;  4G8L A;  1UJJ A;  4HQD A;  1H6K A;  4E0H A;  2XEH A;  4GTT A;  1E8X A;  3EFO A;  4XX5 A;  5DS6 A;  1OQC A;  3FUM A;  1G4W R;  2L81 A;  5LFA A;  2R2L A;  5JJT A;  3FXH A;  4CDN A;  4N3A A;  5FCL A;  4U0S A;  2QFC A;  1PY1 A;  4JTD B;  4EHM A;  4CDY A;  4WWO A;  3ASO C;  2WXI A;  4HRL A;  5E3A A;  4TUU A;  3TJP A;  4K0D A;  4KXK B;  4IAO A;  2ETC A;  2YHE A;  4HOQ A;  2DB4 A;  2MYO A;  1H2T C;  4ILH B;  1YVI A;  3ONL A;  4BWR A;  2HS5 A;  3R9A B;  5B1B C;  4GCO A;  1LS1 A;  3D9J A;  4KNW A;  4MW3 A;  3E4B A;  3QKY A;  4HBD A;  3J5P A;  2VCC A;  3KMI A;  3U8P A;  3B7R L;  4E85 A;  4KYO B;  3AJI A;  1NZN A;  3SXM A;  2L6H A;  3AQB A;  3SXK A;  2VSY A;  1OCC E;  1XWJ A;  3CK9 A;  2V4H C;  2A69 F;  3OAW A;  2P0N A;  1OUV A;  3K1I C;  1ZHZ A;  3DI5 A;  3FVY A;  4KBQ A;  3VTY A;  4ILG A;  4U5D E;  4PJL A;  3V30 A;  4APO A;  3HXC A;  1I4Y A;  2A5U A;  4ANJ A;  5DLJ A;  1L5J A;  4M3O A;  3EZI A;  3QB2 A;  1EF1 C;  4MVM A;  3DD7 A;  3HNJ A;  2Y0B G;  1T6I A;  2BKK B;  5CED B;  2Y1L E;  3ZWI A;  3EHM A;  3FUH A;  2Q7R A;  3FP3 A;  3PUJ A;  2GWW A;  3A9C A;  3C5R A;  3S2A A;  5AQB A;  3ABK E;  1RJ9 B;  2LSV A;  1MMD A;  1E83 A;  3HHM A;  4YDO A;  1TYQ G;  3ZSU A;  3LKU A;  1ELR A;  3DJU B;  2GW1 A;  3GM1 A;  3JTL O;  5A23 A;  1OXK A;  4JE9 A;  2XCB A;  4A1G A;  3N0T A;  2QTV A;  1NG1 A;  2CFU A;  3CIA A;  3L54 A;  1TNB A;  2L6G A;  5B1B E;  5AJD A;  2GGF A;  3FEX A;  4KZ0 A;  2DZN A;  1FAP B;  2DI3 A;  1NP7 A;  1HS6 A;  5EHH A;  3I3N A;  4BJ6 A;  4YL1 A;  5AQ7 A;  1NZE A;  3GWN A;  5JT4 A;  1JPL A;  1Z3Y A;  2P9I G;  3DBS A;  2CW0 F;  4XQ1 A;  5T1D B;  2LD6 A;  4E7Z A;  2FO7 A;  4XIF A;  3ZYL A;  3FTX A;  1SF8 A;  4U8Y D;  1JOG A;  4WAB A;  2KBX A;  1B68 A;  3T5X A;  3CHP A;  2LAI A;  2YKZ A;  5CI9 A;  3PNL B;  4GTS A;  4JEU A;  3C63 A;  3OA1 A;  2LNI A;  2PL2 A;  2M64 A;  4H4K C;  3FWV A;  3EH2 A;  2L6B A;  4CS8 C;  4YT5 A;  1TWC A;  4O6N A;  5E2Q A;  2WXQ A;  2MYS A;  3NMJ A;  4Z68 A;  4CS8 A;  2PX3 A;  3M15 A;  3RQF A;  1VLT A;  2PQR A;  4HS2 A;  3APD A;  1I4Z A;  2XZD G;  2WXJ A;  3Q15 A;  3EDT B;  3LEW A;  3L1M A;  2J7P A;  1CGN A;  3SEO A;  5IY5 E;  2EQX A;  5EGY A;  2PBE A;  3C98 A;  1UW4 B;  3MLG A;  2DBA A;  3KL4 A;  4AX2 A;  4ACK A;  2L9B A;  2WVN A;  3W9G A;  5BW8 C;  3LLI A;  2L7A A;  3HKK A;  2WPV A;  1IZM A;  5KCM A;  1GQA A;  4JUR I;  2J7P D;  1N9A A;  4BEP A;  4MVR A;  2BL2 A;  2PF4 E;  3ZQY A;  2R7W A;  3TWR A;  4E6H A;  5M72 A;  2P7V A;  4N2S A;  3K66 A;  4BX8 A;  5HI7 A;  3FUK A;  1QQE A;  1OCZ E;  1ELW A;  2IFU A;  4HOU A;  1QVX A;  2R7V A;  4YL0 A;  1M2O A;  1D8D A;  4LDQ A;  1ST6 A;  3EG9 B;  3QVY A;  2HV6 A;  3EPV A;  3LJ3 A;  1CPQ A;  1WWP A;  5ENS D;  3T9K A;  3EHN A;  2XLV A;  1M6T A;  2BF0 X;  3T6B A;  3AS5 A;  1N52 A;  2GRQ B;  3U9J A;  3MX3 A;  3EHR A;  5ENO D;  3T8M A;  4DX6 D;  2YLG A;  1IXV A;  3ZGQ A;  3FEY A;  5ANL A;  3R7R A;  4ILI A;  2VYI A;  5COM A;  3NG1 A;  2IOL A;  4AJW A;  5L0G A;  5FZS A;  1K05 A;  2A68 F;  3NYL A;  3QMK A;  1TNZ A;  4ANU A;  5JP7 A;  2J8W A;  3LUT B;  5KNH D;  2AXZ A;  4GZ6 A;  2WZL A;  3Q49 B;  5EYP F;  5CIV A;  1DNP A;  4Q7C A;  2R7Q A;  4BJT A;  4K0R A;  1WAS A;  4FHJ A;  1OWP A;  2H7B A;  2W4M A;  4QDL A;  2IO2 C;  2NC9 A;  3CVU A;  3JRM O;  4J7T A;  3LLK A;  1NI1 A;  2F37 A;  3KSL A;  3LJN A;  1O5M A;  5BNW A;  1S64 A;  2J9Q A;  4WNF A;  4HI9 A;  1TNO A;  3KS2 A;  1RJ9 A;  1T5O A;  1SMY F;  3CHQ A;  1ORS C;  3U64 A;  2JLB A;  2X0C A;  1HE1 A;  4Q5S F;  4BES A;  2I2O A;  5ENT D;  3I4G A;  4EBA G;  4NY3 A;  2GRN B;  2KAT A;  2VSO E;  4YT8 A;  1H9T A;  1NU7 D;  1EDU A;  2V3C C;  3ZC4 A;  5LCW C;  1TWH A;  4O6Y A;  3Q79 A;  3TOL A;  1ZU2 A;  4Q4Z F;  2EPO A;  2AWY A;  3K6B A;  4BEM J;  4N6C A;  5T3T A;  1FPP A;  5B3I A;  4CYM D;  1N0Q A;  2XS1 A;  3AU5 A;  3PHF 2;  3MEK A; 
#chains in the Genus database with same CATH homology
 4G2V A;  4WNE A;  4LRZ A;  4I1M A;  2WM9 A;  4CEM A;  3FH8 A;  3FUF A;  4KC9 A;  4U5B E;  4N2Q A;  4ANX A;  4JCH A;  2XRH A;  3TL5 A;  3OXG A;  3TXM A;  2A1D D;  1YA0 A;  3RKV A;  3CKC A;  2NUP B;  2OOE A;  4G25 A;  3CQZ A;  4D10 C;  5T4Y A;  4ACL A;  3ABM C;  3MCX A;  3UT4 A;  3JQ0 A;  1ZHW A;  3UMI A;  5FQ4 A;  4WND A;  5CHE E;  4YND A;  4I2Z A;  3F46 A;  3ZEF A;  2YHC A;  4F4B A;  2XPI A;  4HFF B;  2X6I A;  2WXO A;  3JYS A;  3HTK C;  3FY4 A;  2CG2 A;  3D9O A;  1V55 C;  2IYL D;  2L0T B;  3X1O A;  2WMN A;  3RO3 A;  4PFP A;  3FUE A;  1OWO A;  4CDR A;  4GZD A;  2I9C A;  4C3D A;  3LS1 A;  5KYX B;  4Y6C A;  4JC8 A;  4PK4 A;  2IJG X;  3ABK C;  3ZIB A;  2ZU6 B;  5DBK A;  2XHE A;  2WMO A;  3CVQ A;  4KBL A;  4GA0 A;  4NRH B;  5C2Y A;  4JZA A;  3I4R B;  3RYL A;  3VLD A;  1SZ9 A;  4UQZ A;  3FTY A;  3ONK A;  2V8S E;  2WXK A;  1D0Z A;  2GFH A;  1HG5 A;  4W9R A;  2R7S A;  2E2E A;  4LEU A;  1UN8 A;  1H2U A;  2G3V A;  1Z6A A;  3BEE A;  4RBN A;  2X51 A;  2D5R B;  4J8E A;  5LOZ A;  1VOM A;  2H7O A;  2J45 A;  3EH1 A;  4JEH A;  3S29 A;  3N71 A;  3SZR A;  5A7D B;  3L13 A;  4AP2 A;  1O87 A;  4JA7 A;  5ARF A;  4O6M A;  2WVO A;  4URK A;  2OV8 A;  2W45 A;  3HVE A;  4L7T A;  3LY8 A;  1FFH A;  1OCO C;  2QY9 A;  2XGS A;  3PRZ A;  5CMY A;  1IQR A;  2EIL C;  3PDN A;  3UT7 A;  2WXR A;  5FT9 A;  4N3C A;  1HFA A;  3JQ1 A;  2WXL A;  2BUG A;  4B8A A;  4YVO A;  4F1S A;  4AXH A;  4BG0 A;  1OCZ C;  5KYW A;  4L2L A;  5FZR A;  2CNW A;  4GPK A;  4OIQ F;  3CLJ A;  4GYY A;  5ANR A;  3ML9 A;  2WVI A;  3ASD A;  4N06 A;  3LJB A;  2J4D A;  1N1C A;  3FTV A;  3FH5 A;  4OIP F;  2Q9A A;  3CK8 A;  4J8D A;  3D9M A;  3DAG A;  1D1B A;  3N24 A;  4JJG A;  1HZ4 A;  3EGX A;  3SBT B;  4CT0 A;  3SP1 A;  1Z23 A;  1SQM A;  2FUL A;  1TEZ A;  4CIH A;  3RKO F;  2XPY A;  2NSZ A;  3Q47 B;  3NYM A;  4DLO A;  5DIZ A;  3E9V A;  3LYA A;  2YHS A;  4JPS A;  3OWT A;  3EIJ A;  4G23 A;  4N39 A;  2MHK A;  5ARG A;  2VAS A;  3MV3 B;  2VJ8 A;  2R7O A;  3ENE A;  5G2N A;  4DJA A;  1E7U A;  2P58 C;  3CR3 A;  1JWF A;  2AXV A;  2GRL A;  3GZS A;  4R7L A;  5IY5 C;  2FF4 A;  3HDX A;  3VTX A;  3MKR A;  5G55 A;  2ZXR A;  4FLB A;  3FU6 A;  4BSX A;  1OWL A;  3AU4 A;  2WXM A;  3D3M A;  4GZ5 A;  2BTD A;  3TG5 A;  3LDZ A;  4HFK B;  3URZ A;  3QAR A;  4I17 A;  3TG4 A;  3OEO A;  3IHY A;  4FUL A;  3FFL A;  1ZU4 A;  2CHW A;  5BUO A;  2PM6 A;  4AE4 B;  4J0U A;  1KT0 A;  3WXX A;  4J32 B;  4I6J A;  3ZN3 A;  3I5Q A;  4C3B A;  2CNW D;  2AWI A;  4PS7 A;  3POV A;  5DS4 A;  2JEK A;  1M57 C;  3ZVV A;  4W8K A;  5HQ8 A;  4CCA A;  1VDY A;  4LLC A;  3OXF A;  4A55 A;  2PX0 A;  2XQ0 A;  2C0M A;  2A4Z A;  3X2Q C;  4MQ9 F;  3U9W A;  4HEA J;  4FAD A;  4U5E E;  2ION A;  3FUD A;  3SD5 A;  3T5V A;  4C9B B;  1WGW A;  3F47 A;  2R7R A;  2VSX E;  2YQ8 A;  2V26 A;  4FC8 A;  4BJ5 A;  4EZK A;  5E3C A;  3W8I A;  1X5B A;  4GCN A;  3CKB A;  3HLZ A;  4OIN F;  4U0Z A;  4BJ1 A;  4KVM A;  3MYV A;  3RRN B;  3ZYK A;  4UWF A;  4GA1 A;  3KKB A;  5EX3 A;  3LY7 A;  3QWP A;  4X0R A;  1OCC C;  1HG2 A;  4CS9 A;  3OTN A;  2Y3D A;  5DS5 A;  4XZ4 A;  3RRU A;  5CI8 A;  4PS3 A;  3HJC A;  1MQS A;  4PUC A;  1IW7 F;  3KEZ A;  3TD7 A;  3ZHE A;  2X6F A;  4C3E A;  4FJZ A;  4EBB A;  1E8Z A;  4FU3 A;  2WVQ A;  1DVP A;  5E33 A;  3GZ1 A;  4BFR A;  3ASF A;  5T8I A;  2C0L A;  1TJC A;  4I9C A;  4WJ0 A;  2RG8 A;  4J6I A;  1VYI A;  1A17 A;  4XKC A;  5L3V A;  3QDN A;  3GZ2 A;  5FWQ A;  4GZ3 A;  3UMH A;  5E76 A;  4MS6 A;  4U5G A;  1MMG A;  2G62 A;  3SZ7 A;  4P29 A;  2IXP A;  4CSA A;  2PZI A;  4KMO A;  1FVH A;  3PEV B;  4DI3 A;  3RJV A;  5J90 A;  4ABN A;  4DPR A;  4N3B A;  3W8H A;  2XEV A;  3MKQ B;  4UWH A;  2IOQ A;  1J8Y F;  3Q5M A;  3EIQ C;  4QFV A;  2KJG A;  3T4R A;  1EYH A;  3CHM A;  3JUI A;  2NG1 A;  3VLF A;  2R59 A;  1INZ A;  3CVN A;  4LCT A;  4BEJ A;  2VB6 A;  2Q9B A;  5G05 J;  2R17 C;  3O39 A;  4GEH A;  3VAY A;  4ZLC A;  4PFO A;  3ZW3 A;  4B8C B;  3FUL A;  2YZS A;  3GAN A;  4YN0 B;  5DQT A;  1HE8 A;  1D0X A;  4IN3 B;  4CRW A;  4RDA A;  3D9N A;  3FHE A;  4ANW A;  1HH8 A;  2CGE A;  2JD3 A;  4MLP A;  4BX9 A;  2XGO A;  4ZLD A;  4JHJ A;  1MND A;  4TRQ A;  2UY1 A;  3S7D A;  3L34 A;  1U3C A;  4F7A A;  4WWP A;  5EKQ D;  5AIJ A;  3UT8 A;  4CS9 C;  2NUP A;  4GYW A;  2DCP A;  4UWK A;  4JHR A;  4GZC A;  4U63 A;  4BT8 A;  3UR3 C;  3CVV A;  2L9J A;  4XE0 A;  3CEQ A;  1Z3X A;  4JZY A;  5FQ6 A;  5CMW A;  3CVX A;  2OCC C;  3NF1 A;  5BUZ A;  3D9K A;  4BJ5 C;  5J08 A;  5D92 A;  3EGX B;  2WXG A;  2J0X A;  4AY6 A;  3PVL A;  2O9X A;  4BY6 A;  3APF A;  2HR2 A;  4KT6 B;  4J30 B;  3QAQ A;  2Q3T A;  5FZQ A;  4G7Z F;  4JW1 A;  3QWW A;  5G05 C;  2KC7 A;  4OYS A;  4CS7 A;  2M63 A;  2XL4 A;  4GAA A;  3MJW A;  2ZXW C;  1QLE C;  4XLN F;  4FLH A;  5AEN A;  2CHX A;  4XWJ A;  2ZXP A;  4J8F A;  5G04 C;  4LER A;  3JSZ A;  4CBE A;  3WOD F;  2WXP A;  2E87 A;  5BV0 A;  2MOW A;  5BPP A;  5AYW D;  3S27 A;  2LAH A;  2Y69 C;  4AV7 A;  2PP4 A;  2C04 A;  3BG0 B;  2OVB A;  4AIF A;  3G2W A;  1M2V A;  1KT1 A;  4UI9 J;  3RIP A;  1MMA A;  4YT2 A;  2XRY A;  4NQ0 A;  3K9I A;  4P6I C;  1FFT C;  1P5Q A;  1XNF A;  1PC2 A;  1W2W A;  4KZC A;  1EPU A;  4WUY A;  5L3Q A;  2MRI A;  3W2W A;  3HIZ A;  4O7G A;  3NQP A;  4HE8 D;  4XLP F;  2CDQ A;  5B1A C;  4GMJ A;  2J0W A;  1ZHT A;  2H7V C;  4F53 A;  5BV1 A;  4UWL A;  4XTK A;  2MWQ A;  2Y3B A;  1NU9 C;  2J4B A;  1JWG A;  3U4T A;  2VGY A;  2NUT B;  1TJF A;  2AXU A;  4I6E A;  3ZYM A;  4TV3 A;  1NA0 A;  1VMA A;  2X6K A;  1BPO A;  5JHA A;  4PJJ A;  4C7O B;  1FTS A;  3SNX A;  3CQC B;  3MKQ A;  3CZ6 A;  2FFH A;  4AY5 A;  2DIW A;  3ABL C;  2M4E A;  2X6H A;  4U07 A;  4UQY A;  2OVF A;  2OG2 A;  4I6G A;  4I9E A;  1JPJ A;  2V4L A;  4AOF A;  1FCH A;  4BJ6 C;  2FI7 A;  4G0H A;  3KD7 A;  2I6H A;  1OKK A;  3LNR A;  4EPZ A;  3S7J A;  3ITF A;  3JT1 A;  3FDQ A;  2I1K A;  1MMN A;  4OD4 A;  3JCU Q;  3P2B A;  1FVF A;  2Y4U A;  4OVV A;  3CSK A;  2I1J A;  1XGW A;  4U8H A;  5KJK A;  4U5C E;  5C1D A;  2IQC A;  4O6F A;  2IXN A;  3LCA A;  3DMD A;  3FUN A;  5KJN A;  1ZU5 A;  3B0V C;  2J9W A;  1E90 A;  4RG6 A;  3RRM B;  4EBA A;  4I1O B;  5BT1 A;  2KZT B;  4L23 A;  3JCK C;  3ESL A;  3SHF A;  3SF4 A;  3UMK A;  1WM5 A;  4DVY P;  4EQF A;  4IRU A;  4JVS A;  4U5F E;  4IYP A;  4JHK A;  3I5P A;  3M1C B;  3T6J A;  3AG1 C;  3ASG A;  4N5C A;  4B6I A;  4V3I A;  3SYN A;  3EFO B;  5E75 A;  3EQL F;  3W2V A;  2EIK C;  4AVX A;  1IQU A;  1NA3 A;  3FAJ A;  2QY7 A;  4I2W A;  4WAF A;  2DYS C;  1E96 B;  4DBQ A;  2X6J A;  2WQ7 A;  4CDM A;  1IYG A;  1V54 C;  2IXO A;  2YEV A;  3FHD A;  2AVP A;  5D91 A;  2V0P A;  2XXA A;  3V7O A;  3B7S A;  4QI2 A;  2WQH A;  1PAQ A;  3S28 A;  3RFY A;  3DPD A;  1Z6T A;  4WWN A;  2KCL A;  3CHS A;  2I8B A;  3EJN A;  3K1H A;  4GU5 A;  2WXH A;  4EEC A;  4GB9 A;  4AK9 A;  3ZYQ A;  1E7V A;  1IHG A;  4F3V A;  1KLX A;  2UY1 B;  3LPZ A;  2YIN A;  5B3S C;  5KJM A;  5F5H A;  4Q96 A;  1LVK A;  2WXF A;  3AG4 C;  2WB2 A;  4B94 A;  1OWN A;  5ENN A;  2DGJ A;  3NRH A;  3JYH A;  3QC1 A;  2GRM A;  3DJN B;  3PRE A;  3Q7G A;  4HVB A;  4YVQ C;  4Q94 A;  4G7O F;  2HV7 A;  5KYX A;  2L0I A;  1JPN A;  2WXN A;  5LP0 A;  4UQX A;  4G11 A;  3DAF A;  4WNG A;  4FES A;  1LF8 A;  3ZVR A;  4CT4 A;  4B89 A;  4ME2 A;  4B0Z A;  3ZHE B;  1H19 A;  2IU1 A;  3QJZ A;  2CHZ A;  4JXT A;  1H0A A;  5AJL A;  2Y3G A;  2HYZ A;  4JJF A;  2J46 A;  3CVL A;  2J49 A;  4UWG A;  2J09 A;  1TR2 A;  3UNG C;  3CHR A;  4G1T A;  4ATG A;  4OIR F;  3R7Q A;  2WL8 A;  4KNV A;  3LVQ E;  5CCM A;  5EDS A;  3B9Q A;  1D1C A;  4BT9 A;  2IOS A;  3ZFW A;  3ZXS A;  2ILR A;  5HSW A;  2L6J A;  2J08 A;  1Y8M A;  4EZJ A;  2VTB A;  4GA2 A;  3L08 A;  3TXN A;  4DLQ A;  3SI5 A;  4HLE A;  3KH2 A;  3UUX A;  2YNQ A;  3EGD A;  3IV0 A;  2KQ9 A;  3DM5 A;  1Z3I X;  1HXI A;  3Q4A B;  3ML8 A;  4L1B A;  4KI2 A;  4BTA A;  2WQ6 A;  4RSY A;  3FU3 A;  2A6H F;  3LS0 A;  2P6V A;  2W4B A;  4OD5 A;  3VLE A;  4APF A;  1U3D A;  3BG1 B;  1HX8 A;  1E8Y A;  4UI9 K;  1BR1 A;  3ZIM A;  5KYN A;  4U04 A;  3GOD A;  4A3V A;  4H7X A;  4M63 A;  5DVW A;  1W3B A;  2Z15 A;  3DXJ F;  5JHB A;  2Y3A A;  3FDH A;  4FJY A;  3K7D A;  3UX4 A;  1BR2 A;  3G2S A;  1N54 A;  1OCR C;  5KYU B;  3LXU X;  4ULW A;  3GYZ A;  4C7O A;  1VK5 A;  4YT4 A;  2WZG A;  3ESK A;  3FTS A;  2Y4T A;  3L22 A;  4K7B A;  3D9I A;  1ZBP A;  3CK7 A;  1OKK D;  2V5F A;  4RVB A;  3B0P A;  3ECS A;  4I3M A;  1O5H A;  3H65 A;  4U5H A;  3EGD B;  5FJY A;  3LY9 A;  2W9Y A;  5JJ6 A;  2VSN A;  3CVW A;  4BTB A;  3AS4 A;  1HU3 A;  2XCC A;  5T3R A;  3U3W A;  4JA9 A;  5FTP A;  2DYR C;  3LVR E;  1S0P A;  4DBR A;  4PH4 B;  2Y3H A;  3ZPJ A;  2LSE A;  4NAC A;  2KW3 C;  4FWV A;  3L16 A;  1HF8 A;  4DI4 A;  3G2T A;  3SFZ A;  1ZHY A;  1PCX A;  3PH0 C;  3IKO B;  3HVE B;  4MND A;  4EWC A;  3G2V A;  3KAE A;  2XSE A;  5KYW B;  3ASN C;  3ASH A;  3PUK A;  2KCV A;  5KYU A;  4AM9 A;  2IXM A;  3SGH A;  3RH3 A;  3AS8 A;  1WY6 A;  2WB7 A;  3MZL B;  2PQN A;  2VTB B;  3CQG B;  4J8S A;  3P1U A;  1PD1 A;  3CV0 A;  4I1A A;  1TKN A;  2ZXO A;  2VGX A;  4MRU A;  4YWQ A;  4UI9 C;  2R7T A;  3QNK A;  2EIJ C;  3LES A;  1MNE A;  3B7U X;  3HYM B;  2FBN A;  2PM7 A;  2EIN C;  3QOU A;  3DM9 B;  3Q6N A;  2R7X A;  3UQ3 A;  4H7Y A;  4C0E A;  1TWG A;  3FTZ A;  2KZT A;  4G24 A;  3RU0 A;  3ZG1 A;  4LLE A;  3QZC A;  3MA5 A;  2XXA B;  2R7U A;  4C0M A;  2C03 A;  1FMV A;  3NKE A;  5KYY B;  3EZH A;  3JRT A;  5G04 J;  1M56 C;  3AG3 C;  1UJK A;  3NYJ A;  2J9U A;  1H2V C;  2VH3 A;  4CGV A;  2LO6 A;  4XI0 A;  3LS8 A;  4I43 A;  3O48 A;  1Z5Z A;  1LKX A;  4CGW A;  5JJ7 A;  3OXL A;  1BR4 A;  1E8W A;  2OND A;  4DK5 A;  1GW6 A;  3UGO A;  2X38 A;  4I44 A;  3CHO A;  2BE5 F;  4A3T A;  3IEG A;  4YJW A;  2WZF A;  3TAX A;  2IF4 A;  1G8X A;  3CVP A;  4GML A;  4Q69 A;  1TWA A;  3CST A;  3S7F A;  1PD0 A;  5CCL A;  3L17 A;  3N2Z B;  3G2U A;  5LX8 A;  4PDX A;  3O6X A;  3B0U X;  4DVZ A;  4IJJ A;  4JL0 A;  2AW6 A;  3GW4 A;  1SZI A;  1M2V B;  5A6C A;  1FMW A;  1UG3 A;  3QK0 A;  4IWB A;  2UWJ G;  4HXI A;  4QI0 A;  3D9L A;  3IHV A;  1VYK A;  3UPV A;  4PJM A;  3Q6M A;  3B7T A;  4ANV A;  1QNF A;  1Z63 A;  4XKB A;  3S7B A;  3L0I A;  3S0X A;  3SBS A;  1ZYR F;  3FTU A;  3PZD A;  3I4U A;  2FEZ A;  4GYT A;  3MGB A;  1WAO 1;  4AE4 A;  3FU0 A;  3FH7 A;  4EZL A;  3RO2 A;  4OIO F;  4PS8 A;  3MV2 B;  4RG9 A;  3K33 A;  2HO1 A;  1QZ2 A;  2XPZ A;  3RK6 A;  2A6E F;  4MKT A;  4DOZ A;  2FGY A;  3PMR A;  2ZPA A;  3EG9 A;  4CSA C;  3FUJ A;  3LAY A;  3NZS A;  5F5F A;  1QZX A;  3AG2 C;  4FP7 A;  4L2Y A;  1J8M F;  2NUT A;  1S7Z A;  2NXP A;  3ZRH A;  1ELK A;  3E70 C;  3SNH A;  5D0O D;  2CFZ A;  4G26 A;  1MHQ A;  3IEE A;  3APC A;  2J9V A;  1HO8 A;  5T3W A;  3UGP A;  2Q7F A;  2PFD A;  3PNT B;  3D9P A;  4XI9 A;  2Y39 A;  4LAC B;  1D0Y A;  2R5S A;  2E0I A;  3IBE A;  2VQ2 A;  4HOS A;  4KVO A;  4HOT A;  2VGX B;  3TGO A;  3PS6 A;  2KGO A;  3CGH A;  1KU2 A;  2HM8 A;  3FUI A;  2KM4 A;  4HOR A;  2RD0 A;  4Y6W A;  5FQ8 A;  4A2N B;  4HFG A;  5FQ7 A;  1OWM A;  3B13 A;  4E7S A;  1Y6I A;  3QWV A;  4O79 A;  4K03 A;  4NUR A;  3DZA A;  3O4Z A;  4IUL A;  2B0J A;  3LEV A;  4LUN U;  1B89 A;  2LSU A;  4AEZ C;  3VYW A;  2CG3 A;  3L6A A;  3NDB B;  3ULQ A;  3UMV A;  5DQZ A;  3FU5 A;  4A1S A;  3FTW A;  4OVU A;  2EIM C;  1UN9 A;  4FHK A;  2XRZ A;  2X3M A;  5KYY A;  4GYO A;  2KNH A;  1D1A A;  3PEU B;  2G3K A;  3CSF A;  5D0Q D;  3CVY A;  4RD9 A;  1JUQ A;  3NZU A;  3NKD A;  4FA6 A;  4U0U A;  2KCK A;  2XGM A;  1SZA A;  2Q9C A;  5LCW J;  3PE3 A;  3RIB A;  1ZHX A;  2C2L A;  3PE4 A;  3Q7L A;  2J07 A;  5EX0 A;  4FX5 A;  4G7H F;  4PJN A;  3U66 A;  3AQC A;  3WG7 C;  5KJL A;  1UJJ A;  1H6K A;  1E8X A;  3EFO A;  4XX5 A;  5DS6 A;  3FUM A;  2L81 A;  5LFA A;  5JJT A;  4CDN A;  4N3A A;  5FCL A;  4U0S A;  2QFC A;  1PY1 A;  4WWO A;  3ASO C;  2WXI A;  5E3A A;  4TUU A;  3TJP A;  4K0D A;  4KXK B;  4IAO A;  2YHE A;  4HOQ A;  4ILH B;  1H2T C;  3ONL A;  4BWR A;  3R9A B;  5B1B C;  4GCO A;  1LS1 A;  3D9J A;  4KNW A;  3E4B A;  3QKY A;  3KMI A;  3B7R L;  4E85 A;  4KYO B;  1NZN A;  3AQB A;  2VSY A;  3CK9 A;  2A69 F;  3OAW A;  1OUV A;  3K1I C;  1ZHZ A;  3FVY A;  4KBQ A;  3VTY A;  4ILG A;  4U5D E;  4PJL A;  4APO A;  2A5U A;  4ANJ A;  5DLJ A;  1L5J A;  4M3O A;  3EZI A;  3QB2 A;  1EF1 C;  3DD7 A;  3EHM A;  3FUH A;  3FP3 A;  3PUJ A;  3S2A A;  1RJ9 B;  2LSV A;  1MMD A;  3HHM A;  3ZSU A;  3LKU A;  1ELR A;  3DJU B;  2GW1 A;  5A23 A;  2XCB A;  4A1G A;  3N0T A;  2QTV A;  1NG1 A;  2CFU A;  3CIA A;  3L54 A;  5AJD A;  2GGF A;  3FEX A;  4KZ0 A;  1NP7 A;  1HS6 A;  5EHH A;  3I3N A;  4BJ6 A;  1NZE A;  1JPL A;  1Z3Y A;  3DBS A;  2CW0 F;  5T1D B;  4E7Z A;  2FO7 A;  4XIF A;  3ZYL A;  3FTX A;  1SF8 A;  3T5X A;  3CHP A;  2LAI A;  5CI9 A;  3PNL B;  4JEU A;  3OA1 A;  2LNI A;  2PL2 A;  4H4K C;  3FWV A;  3EH2 A;  4CS8 C;  4YT5 A;  1TWC A;  4O6N A;  5E2Q A;  2WXQ A;  2MYS A;  4CS8 A;  2PX3 A;  2PQR A;  4HS2 A;  3APD A;  2WXJ A;  3Q15 A;  3EDT B;  3LEW A;  2J7P A;  3SEO A;  2EQX A;  5EGY A;  3C98 A;  1UW4 B;  3MLG A;  2DBA A;  3KL4 A;  4AX2 A;  4ACK A;  2L9B A;  2WVN A;  5BW8 C;  3LLI A;  2WPV A;  1IZM A;  5KCM A;  4JUR I;  2J7P D;  2PF4 E;  2R7W A;  4E6H A;  5M72 A;  2P7V A;  4N2S A;  3K66 A;  4BX8 A;  5HI7 A;  3FUK A;  1QQE A;  1ELW A;  2IFU A;  4HOU A;  2R7V A;  1M2O A;  1ST6 A;  3EG9 B;  2HV6 A;  3EPV A;  3LJ3 A;  3EHN A;  2BF0 X;  3T6B A;  3AS5 A;  1N52 A;  3MX3 A;  3T8M A;  3ZGQ A;  3FEY A;  5ANL A;  3R7R A;  4ILI A;  2VYI A;  3NG1 A;  2IOL A;  4AJW A;  5FZS A;  2A68 F;  3NYL A;  3QMK A;  4ANU A;  2AXZ A;  4GZ6 A;  2WZL A;  3Q49 B;  1DNP A;  4Q7C A;  2R7Q A;  4BJT A;  4K0R A;  4FHJ A;  1OWP A;  2H7B A;  2W4M A;  4QDL A;  2NC9 A;  3CVU A;  3LLK A;  5BNW A;  2J9Q A;  4WNF A;  3KS2 A;  1RJ9 A;  1SMY F;  3CHQ A;  3U64 A;  2JLB A;  4Q5S F;  2I2O A;  3I4G A;  4EBA G;  4NY3 A;  2KAT A;  2VSO E;  4YT8 A;  1NU7 D;  1EDU A;  2V3C C;  3ZC4 A;  5LCW C;  1TWH A;  4O6Y A;  4Q4Z F;  1ZU2 A;  3K6B A;  5T3T A;  3AU5 A;  3PHF 2;  3MEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...