4LERA

Crystal structure of a putative outer membrane protein, probably involved in nutrient binding (bvu_1254) from bacteroides vulgatus atcc 8482 at 1.42 a resolution
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
457
structure length
457
Chain Sequence
TNPSLLLTGVAYSAFNQTSSDACHAAKMLILTSGESKYQVYKWTRGDFDYYSNLRDVTKMSEEAGEGSAYQALAHFFRANYFYQLTLDFGSIPYTDALKAETDANYQPAYDSQEVVLAGILKELEEADKMLEGSDEIISGDIIYNGNLVNWRKLINAYRLRILMSLSGKEKVGDIDVKSEFSKIVADGPLMESLSDNGQLIYLDQQDNRYPYFNDSDFGSGRFMDSTYIAELATRQDPRLFAVATQTPNAEKAGKAINDFSSYDGGDPAVPYSLVNDKAVAGNCSKPAPRYYQTPTNEPMVLLGYVEQQLILAEAVVRGWIQGDDKIYYESAVKASFEFYQKYAVSVADYLTQDAAAEYLRNDKVAYSSSLSTDEKIERIIMQKYLPTFLQGSVWLPYYEALRTGYPDFRRAAGVSLPYRWMYPQDEYNNNATHVEAALNEQFGGSDKTSDKPWWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a putative outer membrane protein, probably involved in nutrient binding (BVU_1254) from Bacteroides vulgatus ATCC 8482 at 1.42 A resolution
rcsb
source organism Bacteroides vulgatus
molecule tags Sugar binding protein
molecule keywords Putative outer membrane protein, probably involved in nutrie
total genus 174
structure length 457
sequence length 457
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12771 SusD-like_2 Starch-binding associating with outer membrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4lerA03
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4lerA01
3EHNA 3CKBA 5E76A 3CKCA 3SGHA 3JYSA 4LERA 3I4GA 3LEWA 3EJNA 4L7TA 4F53A 3JQ0A 5T3RA 5FQ4A 3MX3A 5E75A 3CK7A 3IV0A 5LX8A 5T4YA 3HDXA 3FDHA 5FQ6A 3GZSA 5FQ7A 3L22A 3QNKA 4MRUA 3CK8A 3EHMA 3MYVA 3CGHA 5FQ8A 3OTNA 5J90A 3P1UA 4Q69A 4F7AA 3KEZA 3JQ1A 3MCXA 3SNXA 3NQPA 3CK9A 4PUCA
chains in the Genus database with same CATH superfamily
3EH1A 3KL4A 4J7TA 4FLBA 1SA4A 4IWBA 3FH8A 5FT9A 1TR4A 5ITZF 1K3ZD 3EHQA 3G2TA 1VYIA 4TRQA 1XGWA 5BW8C 1FVFA 2DWZA 1OW7A 3FWVA 3G2VA 3J5QB 1TFKB 3LXUX 4GMRA 4GYOA 4U5EE 5B1AC 3C3RA 2OQMA 2XEVA 1N4PA 3LS1A 4XEFA 1OT8A 4ANVA 5HRYA 3KMIA 2XGMA 2H6HA 1E8XA 2LSUA 4O6NA 3EHRA 5ENPD 3Q47B 4EHMA 4CEMA 4U96D 5KYYB 1OWNA 4FA6A 2KW3C 1VYKA 1NG1A 2HKVA 3LDZA 4FX5A 5DQZA 1JCQA 3LS8A 4PS8A 3G4ZA 1G3NB 2EPKX 4GTSA 3LYAA 3SF4A 1UOHA 4E7SA 1FMWA 3MYFA 1R4TA 3OA1A 3QVYA 2YVKA 4OD5A 4ILHB 3SHFA 2GWWA 3PDNA 1YLMA 1V54E 1MJ0A 3PNLB 1D1CA 1TNZA 2XZDG 3FDQA 4UQYA 3QJZA 3PHF2 1YA7O 3F47A 1HX8A 4OIQF 5EX0A 4XE0A 1PV3A 4LNBA 4OAUC 4YT4A 2VYIA 5ENQD 3RK6A 1YA9A 5AQAA 3D9JA 2XCCA 3TAXA 2EILC 1HE9A 2B0HA 1U0BB 3IKOB 4I44A 1H2TC 3QWWA 4JEBA 3BG1B 5B1BC 3LCAA 4CT4A 3VTYA 4HVBA 1KT0A 3MYIA 4WNGA 4ANJA 4W8KA 5L0JA 1YCSB 4ZLDA 3E70C 2BC5A 4OD4A 3S2AA 2CDQA 4B0ZA 3ASNE 1WDYA 3ZUVB 2CG2A 3IHYA 2EPOA 1TJCA 3L8JA 3SNXA 4BX9A 2OKUA 1XNFA 3FUKA 1QSPA 2CFZA 4G11A 3GEEA 3ASDA 3QOUA 5A6BD 3RU0A 4I1OB 3Q7LA 4MNDA 1KTMA 4GTOA 5G04J 3R9MA 4UUCA 3K9IA 4M63A 3T6JA 3EG9B 2PZIA 4C0EA 1HW1A 4UWGA 1Z6TA 1RJ9A 5LOZA 5D91A 3RYLA 2Q9BA 4DBQA 3FUNA 5TJ5E 3SXKA 1G5ZA 2BEDA 3N2ZB 3SFZA 3E34A 4AOFA 5HV9A 2RFMA 2GDCA 3L9TA 4Z9JA 3TD7A 1K1AA 3CKBA 5EYLA 1E90A 4LSZE 4JPSA 4EBKA 3JYSA 1MMGA 2BKKB 3LEWA 1H19A 3SZRA 3TXNA 3WXXA 1OWMA 2RFAA 1RKEB 4XKBA 2I8BA 1NLXA 3DI5A 2GRMA 2AWCA 2MRIA 4I9CA 1K1BA 3A9CA 5ENTD 3R2PA 4IULA 3S7FA 1KLXA 4CJGA 2C2LA 3JQ1A 4A55A 2J9QA 4ULWA 3RVYA 3G2UA 3SGHA 3U2MA 4JZYA 3EZIA 2XGSA 2IM8A 4BSZB 2JLBA 4I6GA 3TWSA 1JOGA 1NL4A 2BF0X 2PM7A 3FUJA 1TN7A 3AG3C 4MVRA 1E2XA 2PBEA 2XQ0A 3QNKA 3AG2C 3DD7A 2GAQA 4Z68A 4DRHB 3ULYA 4GTRA 1IYGA 1A7EA 1A17A 2GGFA 1ST6A 2YEVA 3ZHEB 1OXBA 3NMIA 4EKWA 1DCEA 2C0MA 3L17A 3N71A 3IQ6A 2CYDA 5AN8A 1H6KA 3EH2A 3FVYA 1HG5A 4F1PA 3VF0A 1BD8A 1HU3A 4MVOA 5BUOA 3VRCA 3SQVA 2EIME 3W4YA 3QAQA 4CIHA 1AVOB 1HG2A 2X0CA 2EIKE 2CCYA 1N4QA 3UXGA 4RVBA 3G4XA 4E0HA 3T8KA 1JPJA 1ELKA 3QW1A 2MYSA 5E2QA 3V30A 2R7VA 2ETSA 1VK5A 4BEMJ 5AC4A 2DYRE 1JRAA 5KYXA 2ZXWE 3B7UX 2P9LG 2I15A 4BEJA 1TNYA 1KT1A 3ZFWA 4DI3A 3TWRA 2HMQA 3KAEA 2L9JA 2H6IA 2KCVA 1JWFA 4HRMB 2WMNA 3CGHA 3HVEB 5F28E 4C7OA 1M2VB 1TNOA 2R9RB 4O7GA 2ETCA 5JS5A 3UM0A 5D0QD 3H65A 2HFIA 4N3CA 3EGXA 2R7TA 3D3MA 3NBNB 4HFKB 3FUHA 3JQ0A 2HMZA 2AXZA 4G78A 2HSQA 1RW2A 3UGOA 1FTSA 2XZTG 3TG4A 5DS6A 4KI2A 2F0YA 2H7OA 3ENEA 5DS4A 3PE4A 3S7JA 2AJAA 3FEXA 4DRJB 1QZ2A 4K0RA 1U6HA 2L81A 3IQTA 3I4UA 3FY4A 4L2YA 4D10C 3ULQA 4J8SA 3ISMC 2OG2A 5BV1A 3U3FA 4W8PA 3M15A 4JIOA 3HXEA 3EU9A 5B3SE 1Q0MA 4OIRF 3PZ4A 5AARA 4RG9A 1RCPA 1H2UA 2Y3AA 3PZ1A 4NQ0A 2R7OA 3FU6A 4JURI 4BTBA 3K1IC 3L08A 3LAYA 2YL7A 3AGTA 2KC3A 1NP7A 4C3BA 4BSXA 2KGOA 1ZHZA 2P1AA 5D2MC 4AXHA 4YL0A 3FAPB 1LF8A 2ZIRA 1PCXA 5EHHA 1ELRA 3QVZA 3S27A 4DVYP 5AENA 1E85A 3ZQVA 3APDA 1ZU5A 4I3MA 5A6JA 2R59A 3D9MA 3FXHA 4WWNA 4FADA 4U7EB 1W2WA 3JUEA 1HE1A 2XRHA 3DBSA 4DOZA 4LRZA 3DSUA 3FMSA 3MFNA 3ZVRA 3ML9A 3WG7E 4AE4B 1TWHA 1CPRA 1YZCA 2H7VC 2R25A 2YLGA 3MCXA 5LP0A 3JT1A 4E6HA 4XX5A 1O1TA 1INZA 3APCA 1ZYRF 2B0JA 4NTFA 1HE8A 1IQRA 4YT5A 3ZEFA 3D9NA 3QWVA 1G8XA 2PX3A 1UG3A 2VCBA 3C3QA 1LI5A 3R7QA 5EIDA 3NF1A 4IAQA 2XLDA 2FAPB 3S0XA 1H0AA 5CCMA 5D66A 4TUMA 2XL4A 2NSGA 1BR2A 4HFGA 3Q5MA 4OINF 2JD3A 3U2LA 5CI9A 1ELWA 3W8IA 3RIPA 2VGEA 3L54A 4ULVA 1H6GA 4U5HA 1MQSA 4L2LA 2J4BA 1LD8A 3ZIBA 4D4XA 4ZLCA 1L3PA 3MX3A 3GORA 5ANLA 4DX2A 5JHAA 3E37A 2UUHA 2GRQB 3EIQC 2HZ8A 1L7CA 5L0GA 2H7BA 2FULA 3HIZA 1OY3D 2LAIA 3HNIA 4N2QA 2L6BA 2WB7A 1TEZA 4AV7A 4B93B 3HXBA 3ZIMA 2VCCA 4YJWA 1JMWA 1B68A 4IJJA 3ABMC 4K5CA 4YDOA 3Q6NA 5F5FA 5JRAA 3K1HA 4ATZD 3AGUA 2XXAB 3A11A 5L3VA 1MNEA 2LFFA 3UR3C 3UNGC 2VTBB 3DSVA 3KEAA 3PE3A 4U8HA 4JKVA 5CECB 4GZCA 4EIYA 2R2LA 4NY3A 4ACLA 3CZ6A 3RO2A 2LCHA 2L9BA 5BQGA 1FFTC 3GWNA 1SR2A 2G62A 2Y3DA 3LY8A 3QK0A 1GGQA 1BBHA 3E32A 1EDUA 1S05A 2EIMC 1TN8A 3D9IA 4FC8A 1YARO 3NMKA 3D9KA 2WXLA 2KQ9A 2ZPAA 4HQDA 2NSZA 4N06A 2ETBA 4KZ0A 5ARFA 2Y69E 3NOGD 1V54C 4BESA 4HE8D 1MMNA 4G7ZF 3JXJA 3PZ3A 1OR3A 2AW6A 2P2CP 4TV3A 1YYJA 3MV2B 3QARA 4M3OA 4DK5A 4G24A 3UTMA 3PREA 1WATA 4XEIG 1X81A 3ZC4A 3L8IA 4PDXA 4I9EA 3SY2A 3VLEA 1AWCB 1LS4A 4NCQA 3T9OA 3CHPA 2RD0A 3V79K 3EHNA 3Q6MA 2VSNA 2YHCA 2IU1A 1D1AA 2E0IA 1PD0A 4OIOF 2WL8A 3DE9A 4L9PA 1HH8A 2NUTB 2LQGA 2JABA 3T5VA 2Q7FA 2V4LA 2L0TB 4AK9A 3DPYA 2XLMA 2FEZA 3B71A 2VSOE 1D0YA 1E96B 3EUVA 1ORYA 3M1CB 1HMDA 4G25A 1TNBA 3B13A 1YAUO 4PJNA 3AG3E 1SVXA 3CEXA 4I2WA 5KCMA 3DXJF 3LY9A 4G8LA 2Y4TA 2QZAA 2NPUA 3PH0C 1O87A 3AG4C 1IHGA 3Q7GA 2YRFA 3NKEA 1RMVA 4UWFA 4KYOB 4JEHA 4U5CE 2EPNA 4C9BB 2JEKA 1UW4B 2WM9A 4LDQA 1DCQA 2WPVA 2J8WA 3TULA 4JXTA 3G2WA 5KJLA 1FFHA 5IY5E 2XS8A 4C3EA 3UQ3A 3D9OA 4G7HF 2V0PA 2V4HC 3QC1A 1R5ID 1GM5A 3CVPA 5FCLA 3C98A 3JUIA 1K05A 2LK4A 2EINC 4PR9A 2PL2A 5ARGA 4CYMD 5B3IA 5BT1A 1O3UA 2WXFA 2NUPA 3S7DA 1LVKA 4GTMA 4LDRA 2ZD9A 3Q75A 3I3NA 2LFDA 4QDLA 3UGPA 4R32A 2QC9A 2XLEA 2KYHA 3C5RA 4O6FA 2MHRA 4BJ1A 4GZ6A 3GANA 4KMOA 5JVEA 3CVQA 2Y69C 3UT4A 4GA2A 2IY0C 4DX5D 2QTVA 3ZYMA 4W9RA 1WASA 3FTSA 4J8DA 1N94A 4PJJA 4Y6CA 4U63A 3FOOA 2FO7A 4MTOA 2HUJA 1VDYA 5COFA 2WXOA 4U0SA 2XRYA 3H2UA 1H6OA 4MVMA 3EFOB 3ZPJA 4G1TA 2Z15A 5JHBA 4U0UA 4EHPA 5FTPA 3B7RL 4CGVA 4HOTA 3U8PA 3RQEA 5ENRD 4ATGA 4QI0A 4O6YA 1YJGA 4O1OA 1F1MA 5AYWD 4RLYA 4BJ6A 4FP7A 2A0BA 3NG1A 3NOCD 3RH3A 2R7UA 3VLDA 4HORA 3IXEA 1TWAA 4BG0A 3DSXA 4BT9A 4DLOA 2YKZA 4XEVA 3FTXA 2J9UA 1D1BA 3DSTA 5G2NA 2CHZA 2GRRB 3ESLA 4L7TA 1HFAA 3IHVA 3ZYQA 3SFYA 1QNFA 4WNFA 5EKQD 2WXQA 3QMKA 2GROB 3TXMA 2P58C 3LS0A 2P9SG 4XKCA 2XPZA 4AL1A 3TWTA 5D92A 1IKND 1NFNA 5D0OD 2IOQA 5KNGA 2NSFA 1YZAA 2V5QC 1DOVA 1IHBA 3V7OA 3M79A 5ENNA 5FIOA 3O10A 5CIVA 1O5HA 1TKNA 5AIJA 3O55A 3CVVA 3B0UX 3CQGB 3EU5A 3ZU7B 5KYYA 2QLAA 1BPOA 4RSYA 3SNHA 3PCVA 4XQ1A 2KZTA 3Q49B 3ZYLA 3MKQB 2A68F 3X1OA 2VSYA 3AS5A 4IN3B 4RG6A 4BEPA 5FJYA 3EGDA 1NA0A 3D9PA 1J8YF 2YZSA 2KNHA 2EIJE 4LERA 3B7TA 1E7VA 3JXIA 1OXKA 1OKKA 3IBEA 5JA4D 2QYUA 2A0UA 2LXLA 3ASGA 4MVQA 3RAUA 2ILRA 1GQAA 4EUKB 1KPSB 4BJ6C 1N4SA 4TXPA 3PZ2A 3WG7C 3SBSA 4LLEA 3CSKA 3IEEA 2X6HA 3KEZA 1HW2A 4PJLA 4C48B 4DUIA 4K1OA 4U5BE 5A6BA 2GW1A 3ASOE 3KH2A 1FAPB 1ORSC 3LLIA 4LNUD 2V26A 3AS4A 4E7ZA 1W3BA 3AQBA 1Q2ZA 256BA 2YNQA 1NU9C 4F4BA 1MMDA 4MRUA 2YHSA 3ZG1A 2HM8A 4YWQA 3UX4A 2DYSE 2OEVA 1WTYA 4JJFA 3ZDLA 2J08A 4K03A 3NMJA 2UY1B 3SXMA 2L6HA 1JWGA 1HF8A 4GAAA 3MKRA 3ASHA 3KYIA 5H7PA 2AXVA 2OJED 1LE4A 1LE2A 2Q00A 3EG9A 2QFCA 3ZN3A 3SI5A 3UI2A 2YLIA 4F3VA 4GPKA 1HXIA 4H54A 3QKYA 3CVUA 3PVLA 1T9KA 1BI8B 5KYUA 3MV3B 4KT6B 1PD1A 4MTFA 4GTTA 2WXRA 2P9IG 4QFVA 2KATA 2WVOA 1T6UA 2TMVP 1X5BA 2I9CA 3AQCA 4IAOA 1GW6A 2LUHA 4EZKA 2HV6A 3RIBA 1UG7A 3EIJA 2YQYA 3CQCB 1SZAA 1NU7D 5AC5A 1RKEA 2LIGA 4DVZA 3L6AA 1E8ZA 1Z5ZA 4MVZA 4HI8A 1M56C 4J30B 1OKKD 4Q96A 4G8KA 5ENSD 2CFUA 3NYLA 2J09A 1AEPA 2FGYA 4FAPB 3Q78A 4BX8A 3ITFA 1EPUA 4MW3A 2Y1LE 4N5QA 3G50A 3ZTZA 3C8GA 3FTWA 3J5PA 1VTMP 4XIFA 1JPLA 5AAOA 5BPPA 2NYJA 4K7BA 1H2VC 3UKUG 2PNOA 1EKYA 2GRLA 2YL3A 1WWPA 4CRWA 2XM4A 1HO8A 1N0RA 3I5QA 1V74B 3HKKA 3CHMA 1MHQA 1OW8A 4XPYA 3C8ZA 1OCZE 4GYWA 1A5EA 3H2VA 3TWQA 4JA9A 2MHKA 1DVPA 4EBAG 1N54A 2HV7A 4XI0A 5M72A 3RRMB 1TQGA 4JTAB 3ABME 3FTUA 3DM9B 3OAWA 1M2OA 1JPNA 4O6MA 2HYZA 2IOSA 1Q0FA 2DVWA 3C63A 3AG2E 5EGYA 1H7IA 2EPLX 3TJ6A 2R05A 2FO1E 3LVRE 4GZDA 1ZU4A 5A6CA 2PNNA 4I17A 4U07A 1U89A 2DZOA 4Y6WA 3PRZA 1ZW3A 3U9MA 3UMIA 3SEOA 4GB9A 4FU3A 2L6FA 1JCSA 1CGOA 4DJAA 5KJNA 4LG6A 3TQOA 2MWQA 4YNDA 3NDBB 4JTDB 2VH3A 3D9HA 3T6GB 2Y0BG 4GCNA 5CRUA 2AVKA 2A5EA 4O79A 4TXQA 4G0HA 5K0IA 1NI1A 3ABLE 1D0XA 2W4BA 1APCA 1IZMA 3DWLG 3OEOA 4C7OB 1Z23A 1QQEA 4KBQA 4BPMA 5ENOD 5CMWA 4D4NA 5JJ7A 4CDAA 2XEEA 3P2BA 3RFYA 1Z5SC 1UN8A 2EIJC 3EGXB 5L0DA 2PF4E 4ER9A 4CSAC 3C8GD 1Z3YA 4XLPF 2DZNA 3TJPA 2J0XA 5G05J 5JMND 4KNWA 4E0IA 4UDVA 2WZGA 4ME2A 3SXZA 4JTCB 2YL0A 2KBXA 4U5FE 2YQ8A 2KM4A 3JZ0A 5J90A 3ZVVA 1SZIA 3DEPA 4C0MA 3DWWA 2XLWA 4YVOA 4BTAA 1OWLA 4HRNA 1E84A 2HJMA 3RVZA 2OVBA 5KYNA 1IW7F 2Q3TA 5BQIA 1K04A 2BE5F 3WHNA 1OCRE 3DPDA 4Q7CA 3OWTA 3QTHA 1NA3A 3RRNB 4IYPA 4B6IA 3S28A 1TFOB 3DE8A 2XHEA 1O5MA 1Z3IX 2CG3A 1UJKA 2X38A 1YYXA 3NZSA 3UM2A 3CVYA 1PAQA 4EZLA 4Z9IA 1O1RA 1S0PA 2EILE 3M4BA 2RG8A 4U9DA 2GRPB 3I4GA 4ONSA 1RKCA 4B8AA 3UM1A 1D0ZA 5B1BE 3W2WA 2HJ3A 1ZHWA 2ZISA 5BUZA 3Q4AB 2FBNA 1S7ZA 2I6HA 2DI3A 3CHOA 3NAWA 3AG1C 2D4UA 3JCKC 2IXPA 4FULA 3R9AB 3Q7FA 3Q15A 1VMAA 2VSXE 4HI9A 2V5FA 1WOLA 2A69F 4F1SA 2QUPA 2WXHA 3CVXA 1DC2A 4XWJA 4H7YA 2ASRA 3QW0A 4CCAA 3G2SA 2X51A 2DYRC 3Q7AA 3JRMO 4DRIB 1I5NA 3RKOF 5DQTA 4PS3A 1JR8A 2UWJG 2J8SD 1A41A 4P29A 4R7LA 2A6EF 3VAYA 4CBEA 4RDAA 3JCUQ 3RKVA 1PC2A 1MMAA 3K33A 3CVWA 4AL0A 1NZNA 3KYJA 2YL1A 4UI9J 2G3KA 2J9BA 2JPUA 1C02A 4PUCA 1H9TA 2WZFA 2OVFA 5CHEE 3ZRHA 4JJGA 2OCCE 3B95A 2PX0A 5KYWB 3UKRG 3B9QA 4NACA 4DI4A 5JUAA 3SP1A 1EA8A 2Q9AA 2VJ8A 4CT0A 3U66A 3ZNGA 2J0WA 4HS2A 4CDMA 3CK7A 2OOCA 4MLPA 3K1IA 2XEHA 3BQOA 3D9LA 4QQIA 3IPMO 1EI7A 1QBQA 2LSVA 2RKKA 2E87A 5T3TA 5B1AE 4AJWA 2CHWA 5CEDB 2WMOA 3UT8A 1YA0A 1SA5A 1MNDA 4AY6A 3LPZA 2C03A 3TWXA 2HSBA 4BWRA 3GEIA 3PMRA 4N39A 3B29A 4F6RD 2WXKA 4YDYA 2VTBA 3V5ZA 3ONKA 3FUMA 1RJ9B 4BJ5A 3E33A 5E33A 2J7PA 3AS8A 1VB5A 3VLFA 4Z9HA 3CVLA 1N4RA 1TR2A 3S90A 2O9XA 3U9JA 4H7XA 4LCTA 3ASOC 4AX2A 3HYMB 3B7SA 4L6RA 2DCPA 4O60A 1T01A 4P9TA 3HG0D 2FF4A 5T3WA 2F22A 3T6BA 4ACKA 3GM2A 1BDJB 5DIZA 3CK8A 3MBGA 4CX9A 1FVHA 4I1AA 3HJCA 1DOWA 4CS7A 4KNVA 4LEUA 2YHEA 3GEHA 4U0ZA 1TNUA 2YWAA 2B0OE 4BT8A 4WGYA 4A63B 1D8EA 4AVXA 3DXMG 2CNWD 4YDWA 4A4AA 3O39A 3HNJA 2J46A 4EPZA 4XLNF 5E3CA 1CGME 3X2QC 2QYJA 3ML8A 3PNTB 3ZSUA 1FT2A 4JB8P 1AP7A 1A7VA 1VLSA 3KPHA 5BV0A 1ORJA 4B8CB 3CQZA 3CHSA 1OR2A 2R7WA 3ESKA 1T6QA 1S70B 3FTZA 4JD2G 5L0IA 4AEZC 1N9AA 2PQNA 3PEVB 3LVQE 3ASNC 1Q0DA 1WAO1 2MOWA 2IXOA 4G26A 1U2VG 1FR0A 3JYYA 1XZQA 3LLKA 2X6FA 1N52A 4Q69A 2R5SA 3LY7A 2M63A 2P9NG 4ZHBA 1Z6AA 5FZTA 3GM3A 2KXPC 4EBBA 2P9UG 1QQ3A 4O1PA 4I2ZA 2ZGGA 2AWYA 1YMPA 4HXIA 4J8YA 1OWOA 2A6HF 3DRAA 5KNHD 1I4YA 3C62A 4CJOA 3ZW3A 2IXMA 2DBAA 2IFUA 3UIOC 5T4YA 1A0BA 3IQ5A 4A3TA 1FNTc 5GPGB 1M2VA 2DGJA 2V8SE 3OXLA 4XPXA 3HNLA 2NUPB 4UWKA 5EILA 4DRXE 2WB2A 5FZSA 3JRTA 3Q9NC 3S7BA 3C7JA 2KCLA 2R03A 3V5XA 3LESA 1XZPA 1ZHXA 4CS9A 4HLLA 3FTVA 3CEQA 4GYTA 3LKUA 2PFDA 3LUTB 1Z63A 2BL2A 4UWHA 2R17C 5BXUA 1RXQA 1OCCE 3IQCA 4CDNA 4FHJA 2ZXRA 4IB4A 2FFHA 3F6QA 3PEUB 1K40A 2VGXA 1YVIA 5CBNA 1C17M 4ANUA 3C3OA 3AJIA 1QKRA 4YK5A 1VLTA 2OCCC 1H9GA 5FZRA 4H4KC 2CGEA 2WVNA 4E85A 3L22A 4CDVA 2XSEA 1N11A 2ICWG 3HXDA 3ABLC 4FJZA 5A6AA 3O4ZA 4M7CA 3DSWA 2A1DD 3U64A 4N4WA 3EPVA 4NTAA 3DAFA 3TGOA 5L3QA 2M64A 2W9YA 2F8YA 4JCHA 3LJBA 4L23A 2XL6A 2Q9CA 3ABKC 2XRZA 2X6KA 1QYMA 4CDRA 5A69A 2XCBA 4JEAA 4AY5A 2HO1A 3OXFA 3ECSA 5HSWA 3FH7A 3RQGA 3U8VA 5AQBA 4NTBA 1FT1A 5EIBE 5F5HA 5A7DB 4AE4A 4CS8C 4U8VD 4HRLA 3CSTA 3ZGQA 3S84A 2VCAA 1IXVA 2H8AA 1K8KG 2HS5A 3HTKC 3QWPA 2IO2C 5CRVA 4YVQC 3W9FA 4F53A 3B0PA 4TUUA 5FQ4A 3IHUA 2BTDA 3MLGA 2VASA 3ASFA 1IQUA 3QB2A 2AP3A 3W8HA 4JCZA 1BI7B 5FINA 4I6EA 1UN9A 2YINA 1ZVZA 2FI7A 4E18A 4P9FA 2ZGDA 4JW1A 4APFA 2WXIA 3RW0A 3FU0A 4G2VA 3TOLA 1N1CA 1JUQA 4BFRA 3UMKA 1LTXA 2DIWA 1S63A 4JEUA 5HKPA 3OXGA 3ZXSA 2XLVA 4JRZA 4A1SA 5LCWC 2WXJA 2JX0A 1LPEA 5FZQA 4EBJA 5KJKA 3US6A 3J06A 4K5BA 4KVOA 2XM0A 1E83A 3I5PA 3GYZA 4V3IA 1BR4A 4KBLA 1NFIE 2XLOA 5JSLA 4PACA 5JT4A 2ZU6B 2R7XA 4XI9A 3CK9A 3CVNA 1HZ4A 3NYMA 2ZXPA 4A1GA 3MJWA 3MGBA 4U5GA 5CERB 1G4WR 1RZ4A 3QZCA 3UMHA 2XL8A 2LO6A 2L6GA 3L1MA 5KWDA 3AU4A 4N2SA 3U3BA 4ANXA 4EECA 3LNRA 4GYYA 3EHMA 3FUIA 1V4AA 4BETA 2H6GA 1OCOE 3F46A 1G4US 1ZW2A 3M4CA 2J9WA 3MEKA 4EWCA 2X3MA 4KVMA 3FUFA 1Y4CA 4U95D 2L7AA 1UJJA 1ZHTA 4B89A 3LEOA 1TJFA 3NYJA 3LJNA 4DX7D 3U3WA 3AJMA 5HI7A 4MTGA 2P61A 2QE9A 3UT7A 3FDHA 4WGZA 5FQ7A 2IYLD 2OOEA 4GMLA 4LLCA 4IARA 2WXPA 1T6IA 2Y3BA 1BLXB 1C03A 4F7AA 3DJUB 2EQXA 4OVVA 4GMJA 2VC9A 4UWLA 3GWLA 4J7WA 4JL0A 5EDSA 3TOMA 2R7QA 4OAVB 2W4MA 5L0FA 1CGNA 3DAGA 4PH4B 2XXAA 3CHRA 3Q9UC 4DX1A 1SQMA 3QDNA 3JTLO 5L0HA 2AVPA 5G05C 1KZOA 3K66A 1OWPA 3BUAA 3RRUA 2IOLA 3L82A 2BUGA 4UQZA 5FQ8A 3ULEG 5JLIA 3B0VC 1JCRA 2OEXA 1QVXA 1OCOC 2ZXWC 3TK0A 1KZPA 2D5RB 5BQHA 2WQ6A 3GODA 1D9SA 3UM3A 5JP7A 4GTPA 2KCKA 4YT2A 1HS6A 3NZUA 4TXRA 2KK1A 1JAFA 5E75A 1P5QA 4GCOA 3ONLA 3FHEA 1LS1A 4GTVA 4PJMA 2B6CA 4PFPA 3W2VA 4N6CA 5CCLA 3K6BA 2J07A 3APFA 1M57C 1Z7Qc 1TYQG 3POVA 5COGA 2L6JA 1ZHYA 3DMDA 4YN0B 4WWPA 4XEKA 5KBAA 1OUVA 3TWUA 3L34A 1B89A 3RJVA 3PUJA 3V2XA 1MQVA 3FTYA 5HQ8A 3DKAA 3KS2A 4CIPA 3HDXA 3R7RA 2I1JA 1OCRC 4UI9K 2NUTA 1WGWA 2Q7RA 3AAAC 5J08A 3HRAA 3KSLA 3ZHEA 2OEWA 3L0IA 2CW0F 4Q4ZF 1L5JA 4APOA 2P9PG 5T1DB 1YYHA 1OXJA 2AXUA 4YL1A 4U5DE 2IEJA 3NB2A 5JJ6A 4NURA 4JE9A 4DJ9A 1SYQA 3Q79A 3N24A 3V2OA 3GZ1A 4JHRA 4B94A 2XPYA 1WM5A 4MS6A 4GU5A 1NZEA 1Q0KA 4LDKA 4FWVA 2L0IA 5DBKA 2J4DA 1ZBPA 1BU9A 3E30A 5KYXB 1Y8MA 3HNKA 3EJNA 2PQRA 1ZZPA 3BG0B 4KZCA 2KC7A 2IO3C 4WWOA 3PZDA 2P6VA 3DJNB 4NRHB 5C1DA 3HVEA 3WAQA 1U3DA 4MKTA 4JVSA 4JC8A 1HMOA 4X0RA 3C18A 4CSAA 1OW6A 1SW6A 2NXPA 4BY6A 1MYOA 4HBDA 4ABNA 1U3CA 1BZ4A 1SF8A 3TG5A 1Q0GA 1MX4A 4URKA 1GS9A 3PUKA 4MQ9F 3T9KA 4GZ5A 3TL5A 3U9WA 1QPUA 4BJTA 3CSFA 4GA1A 4N5CA 2J45A 3ZTMA 5FQ6A 2LP4A 2GFHA 5B3SC 4GQHA 4GA0A 4MVUA 4CZ2D 4G23A 2QNLA 4JHJA 3JSEO 1V55E 3NRHA 3I4RB 1BR1A 4XZ4A 5CEAA 2C0LA 2X6JA 3HXFA 4I6JA 4EBAA 3C72A 1ZB1A 5T3RA 4PFOA 2A4ZA 5G04C 2V3CC 1FMVA 1H6PA 3SD5A 2QY7A 1ZU2A 2HE0A 3MKQA 2LAHA 2LNIA 3ZKJA 1Z3XA 3K7DA 3EGDB 2P9KG 3HHMA 4CS9C 2CHXA 3UIPC 4PS7A 4FJYA 1TWCA 3EZHA 4J6IA 3AG1E 4RQIA 1CPQA 5COMA 2WQHA 3RQFA 4J32B 4NQFA 4IRUA 3R7CA 3SZ7A 3MYVA 5EX3A 4A3VA 2LD6A 2WVQA 1FCHA 3O48A 4OVUA 3ZQYA 4MW8A 2RD9A 4LNGA 2XLHA 4EZJA 3TWWA 5A23A 2R7RA 4JHKA 1AUEA 2ZXOA 5LCWJ 3IEGA 5KYWA 2I1KA 4MVSA 1LIHA 5HS0A 3FAJA 2Y39A 5CMYA 2OJQA 3HLZA 3UUXA 4WAFA 1E8YA 3VTXA 1QLEC 2KZTB 4HNAD 2WQ7A 1WG0A 3EQLF 1WN0A 5EK0A 2VQ2A 3FULA 4U04A 5DS5A 3KD7A 3TWVA 2DB4A 2IXNA 2LSEA 1N0QA 4HLEA 4DLQA 4WNDA 4CGWA 2IBFA 5AQ9A 5L0CA 3IV0A 2XS1A 4FESA 4BJ5C 1D8DA 4XPWA 1MX2A 4IGGA 1E86A 1LI7A 4L1BA 3SYNA 1T5OA 5AQ7A 5KYUB 4N6HA 3S9OA 3ZWIA 2J9VA 4G7OF 2WXGA 2WXNA 3FFLA 2QY9A 3NQPA 2UUIA 1E8WA 3FOPA 1KU2A 3B7BA 4KXKB 1SZ9A 3FH5A 4WABA 3AG4E 4LUNU 2AWIA 2ETAA 5AJLA 2AU5A 3CIAA 2F37A 5G55A 5E3AA 3FHDA 3SXYA 3ABKE 2CNWA 2PP4A 4U9EA 3GM1A 4JC7A 5JJTA 3GZSA 4HOQA 3L16A 4FHKA 1SMYF 4K5AB 2E2EA 3BEHA 4DXWA 4HOUA 3E9VA 2F8XK 1I4ZA 2I2OA 1VOMA 3C8GB 2GA0A 2VGYA 2J7PD 2IQCA 2UY1A 1KNYA 2XPIA 4HFFB 4MBGA 3CAXA 4YDEA 2EPMX 2NC9A 5LFAA 2HR2A 4NC3A 3CHQA 3VM6A 3DXKG 4BERA 1YDIA 3DM5A 5LX8A 1S64A 4J7YA 1MX6A 2Y3GA 4YT8A 3CLJA 4A2NB 2Q4FA 1LKXA 1V55C 5DVWA 3MZLB 4WNEA 1A7DA 3FU5A 3ATPA 3PDMP 3BEEA 2BKGA 2C04A 1XWJA 2Y3HA 5KJMA 1WY6A 1EF1C 3NKDA 5ANRA 4E17A 1UFBA 2IJGX 4ZFHA 2P7VA 3UMVA 2NG1A 1M6TA 3Q73A 2P0NA 2OU6A 2VB6A 3BU8A 4HB5A 4J8FA 3SBTB 4DPRA 1OCCC 4K0DA 2G3VA 3WODF 3L13A 2EINE 4U8YD 3AOUA 5A6KA 4Q94A 4ANWA 4GEHA 1J8MF 2WZLA 1O1SA 3ZYKA 4LACB 4YL3A 2MYOA 1TN6A 4JA7A 4AIFA 3CV0A 2ONDA 1QZXA 3U0CA 3FUEA 3CKCA 4AM9A 1E7UA 3MA5A 3UPVA 4OIPF 4I1MA 1MZCA 4AP2A 5CI8A 3V5YA 2YLDA 5C2YA 4WJ0A 4ILGA 3VYWA 4GZ3A 4C3DA 4N3BA 3S29A 2W45A 2A5UA 4ILIA 2XENA 1NFOA 1FPPA 4HEAJ 2EIKC 1LD7A 3UINC 3X2QE 5AGFA 3RF3A 2IONA 4P6IC 1EQ1A 3ZXPA 5BXOA 3FUDA 4CDYA 1HY5A 3DSSA 5EN5D 4J0UA 1NBBA 4QI2A 5T8IA 5EYPF 3URZA 1OQCA 2KJGA 1EYHA 3LEVA 3TJ5A 3OTNA 2M4EA 1OCZC 3P1UA 5CBOA 4DBRA 2RSEB 3DZAA 3PS6A 2LXMA 2VGXB 2DYSC 2WXMA 2IF4A 3SFXA 5E76A 3U4TA 3AU5A 4JZAA 2X6IA 3T8MA 4MS2A 3DEOA 3W9GA 4XTKA 4Q5SF 4UI9C 1NSGB 2Y4UA 1Y6DA 2H6FA 3E4BA 3FP3A 3T5XA 3T4RA 3HXCA 4DX6D 5AJDA 2R02A 2J49A 2PM6A 1PY1A 4PK4A 2XGOA 1TWGA 4X8QA 3SO8A 3EFOA 3RO3A 3FEYA 3RSEG 5BNWA 4HOSA 4UQXA 3GW4A 3LJ3A 3KSQA 4FLHA 4I43A 3N0TA 2R7SA 3GZ2A 4WUYA 3O6XA 1DNPA 4GTQA 2KSFA 3JYHA 3KKBA 5IY5C 3LNMB 3V31A 3EDTB 4OYSA 4GPMA 2WVIA 3U5SA 4CS8A 2GRNB 3FU3A 1Y6IA 1N95A 4NIKA 5FWQA 4RBNA 2OV8A 4RD9A 3JSZA 3CR3A 5DLJA 4EQFA 3BRJA 4KC9A 4N3AA 1LM3B 4J8EA
chains in the Genus database with same CATH topology
3EH1A 3KL4A 4FLBA 4IWBA 3FH8A 5FT9A 3G2TA 1VYIA 4TRQA 1XGWA 5BW8C 1FVFA 3FWVA 3G2VA 3LXUX 4GYOA 4U5EE 5B1AC 2XEVA 3LS1A 4ANVA 3KMIA 2XGMA 1E8XA 2LSUA 4O6NA 3Q47B 4CEMA 5KYYB 1OWNA 4FA6A 2KW3C 1VYKA 1NG1A 3LDZA 4FX5A 5DQZA 3LS8A 4PS8A 3LYAA 3SF4A 4E7SA 1FMWA 3OA1A 4OD5A 4ILHB 3SHFA 3PDNA 3PNLB 1D1CA 3FDQA 4UQYA 3QJZA 3PHF2 3F47A 1HX8A 4OIQF 5EX0A 4XE0A 4YT4A 2VYIA 3RK6A 3D9JA 2XCCA 3TAXA 2EILC 3IKOB 4I44A 1H2TC 3QWWA 3BG1B 5B1BC 3LCAA 4CT4A 3VTYA 4HVBA 1KT0A 4WNGA 4ANJA 4W8KA 4ZLDA 3E70C 3S2AA 4OD4A 2CDQA 4B0ZA 2CG2A 3IHYA 1TJCA 3SNXA 4BX9A 1XNFA 3FUKA 2CFZA 4G11A 3ASDA 3QOUA 3RU0A 4I1OB 3Q7LA 4MNDA 5G04J 3K9IA 4M63A 3T6JA 3EG9B 2PZIA 4C0EA 4UWGA 1Z6TA 1RJ9A 5LOZA 5D91A 3RYLA 2Q9BA 4DBQA 3FUNA 3N2ZB 3SFZA 4AOFA 3TD7A 3CKBA 1E90A 4JPSA 3JYSA 1MMGA 3LEWA 1H19A 3SZRA 3TXNA 3WXXA 1OWMA 4XKBA 2I8BA 2GRMA 2MRIA 4I9CA 4IULA 3S7FA 1KLXA 2C2LA 3JQ1A 4A55A 2J9QA 4ULWA 3G2UA 3SGHA 4JZYA 3EZIA 2XGSA 2JLBA 4I6GA 2BF0X 2PM7A 3FUJA 3AG3C 2XQ0A 3QNKA 3AG2C 3DD7A 1IYGA 1A17A 2GGFA 1ST6A 2YEVA 3ZHEB 2C0MA 3L17A 3N71A 1H6KA 3EH2A 3FVYA 1HG5A 1HU3A 5BUOA 3QAQA 4CIHA 1HG2A 4RVBA 1JPJA 1ELKA 2MYSA 5E2QA 2R7VA 1VK5A 5KYXA 3B7UX 3ZFWA 4BEJA 1KT1A 4DI3A 3KAEA 2L9JA 2KCVA 1JWFA 2WMNA 3CGHA 3HVEB 4C7OA 1M2VB 4O7GA 5D0QD 3H65A 4N3CA 3EGXA 2R7TA 3D3MA 4HFKB 3FUHA 3JQ0A 2AXZA 3UGOA 1FTSA 3TG4A 5DS6A 4KI2A 2H7OA 3ENEA 5DS4A 3PE4A 3S7JA 3FEXA 1QZ2A 4K0RA 2L81A 3I4UA 3FY4A 4L2YA 4D10C 3ULQA 4J8SA 2OG2A 5BV1A 4OIRF 4RG9A 1H2UA 2Y3AA 4NQ0A 2R7OA 3FU6A 4JURI 4BTBA 3K1IC 3L08A 3LAYA 1NP7A 4C3BA 4BSXA 2KGOA 1ZHZA 4AXHA 1LF8A 1PCXA 5EHHA 1ELRA 3S27A 4DVYP 5AENA 3APDA 1ZU5A 4I3MA 2R59A 3D9MA 4WWNA 4FADA 1W2WA 2XRHA 3DBSA 4DOZA 4LRZA 3ZVRA 3ML9A 4AE4B 1TWHA 2H7VC 3MCXA 5LP0A 3JT1A 4E6HA 4XX5A 1INZA 3APCA 1ZYRF 2B0JA 1HE8A 1IQRA 4YT5A 3ZEFA 3D9NA 3QWVA 1G8XA 2PX3A 1UG3A 3R7QA 3NF1A 3S0XA 1H0AA 5CCMA 2XL4A 1BR2A 4HFGA 3Q5MA 4OINF 2JD3A 5CI9A 1ELWA 3W8IA 3RIPA 3L54A 4U5HA 1MQSA 4L2LA 2J4BA 3ZIBA 4ZLCA 3MX3A 5ANLA 5JHAA 3EIQC 2H7BA 2FULA 3HIZA 2LAIA 4N2QA 2WB7A 1TEZA 4AV7A 3ZIMA 4YJWA 4IJJA 3ABMC 3Q6NA 5F5FA 3K1HA 2XXAB 5L3VA 1MNEA 3UR3C 3UNGC 2VTBB 3PE3A 4U8HA 4GZCA 4NY3A 4ACLA 3CZ6A 3RO2A 2L9BA 1FFTC 2G62A 2Y3DA 3LY8A 3QK0A 1EDUA 2EIMC 3D9IA 4FC8A 3D9KA 2WXLA 2KQ9A 2ZPAA 2NSZA 4N06A 4KZ0A 5ARFA 1V54C 4HE8D 1MMNA 4G7ZF 2AW6A 4TV3A 3MV2B 3QARA 4M3OA 4DK5A 4G24A 3PREA 3ZC4A 4PDXA 4I9EA 3VLEA 3CHPA 2RD0A 3EHNA 3Q6MA 2VSNA 2YHCA 2IU1A 1D1AA 2E0IA 1PD0A 4OIOF 2WL8A 1HH8A 2NUTB 3T5VA 2Q7FA 2V4LA 2L0TB 4AK9A 2FEZA 2VSOE 1D0YA 1E96B 3M1CB 4G25A 3B13A 4PJNA 4I2WA 5KCMA 3DXJF 3LY9A 2Y4TA 3PH0C 1O87A 3AG4C 1IHGA 3Q7GA 3NKEA 4UWFA 4KYOB 4JEHA 4U5CE 4C9BB 2JEKA 1UW4B 2WM9A 2WPVA 4JXTA 3G2WA 5KJLA 1FFHA 4C3EA 3UQ3A 3D9OA 4G7HF 2V0PA 3QC1A 3CVPA 5FCLA 3C98A 3JUIA 2EINC 2PL2A 5ARGA 5BT1A 2WXFA 2NUPA 3S7DA 1LVKA 3I3NA 4QDLA 3UGPA 4O6FA 4BJ1A 4GZ6A 3GANA 4KMOA 3CVQA 2Y69C 3UT4A 4GA2A 2QTVA 3ZYMA 4W9RA 3FTSA 4J8DA 4PJJA 4Y6CA 4U63A 2FO7A 1VDYA 2WXOA 4U0SA 2XRYA 3EFOB 3ZPJA 4G1TA 2Z15A 5JHBA 4U0UA 5FTPA 3B7RL 4CGVA 4HOTA 4ATGA 4QI0A 4O6YA 5AYWD 4BJ6A 4FP7A 3NG1A 3RH3A 2R7UA 3VLDA 4HORA 1TWAA 4BG0A 4BT9A 4DLOA 3FTXA 2J9UA 1D1BA 5G2NA 2CHZA 3ESLA 4L7TA 1HFAA 3IHVA 3ZYQA 1QNFA 4WNFA 5EKQD 2WXQA 3QMKA 3TXMA 2P58C 3LS0A 4XKCA 2XPZA 5D92A 5D0OD 2IOQA 3V7OA 5ENNA 1O5HA 1TKNA 5AIJA 3CVVA 3B0UX 3CQGB 5KYYA 1BPOA 4RSYA 3SNHA 2KZTA 3Q49B 3ZYLA 3MKQB 2A68F 3X1OA 2VSYA 3AS5A 4IN3B 4RG6A 5FJYA 3EGDA 1NA0A 3D9PA 1J8YF 2YZSA 2KNHA 4LERA 3B7TA 1E7VA 1OKKA 3IBEA 3ASGA 2ILRA 4BJ6C 3WG7C 3SBSA 4LLEA 3CSKA 3IEEA 2X6HA 3KEZA 4PJLA 4U5BE 2GW1A 3KH2A 3LLIA 2V26A 3AS4A 4E7ZA 1W3BA 3AQBA 2YNQA 1NU9C 4F4BA 1MMDA 4MRUA 2YHSA 3ZG1A 2HM8A 4YWQA 3UX4A 4JJFA 2J08A 4K03A 2UY1B 1JWGA 1HF8A 4GAAA 3MKRA 3ASHA 2AXVA 3EG9A 2QFCA 3ZN3A 3SI5A 4F3VA 4GPKA 1HXIA 3QKYA 3CVUA 3PVLA 5KYUA 3MV3B 4KT6B 1PD1A 2WXRA 4QFVA 2KATA 2WVOA 1X5BA 2I9CA 3AQCA 4IAOA 1GW6A 4EZKA 2HV6A 3RIBA 3EIJA 3CQCB 1SZAA 1NU7D 4DVZA 3L6AA 1E8ZA 1Z5ZA 1M56C 4J30B 1OKKD 4Q96A 2CFUA 3NYLA 2J09A 2FGYA 4BX8A 3ITFA 1EPUA 3FTWA 4XIFA 1JPLA 5BPPA 4K7BA 1H2VC 2GRLA 4CRWA 1HO8A 3I5QA 3CHMA 1MHQA 4GYWA 4JA9A 2MHKA 1DVPA 4EBAG 1N54A 2HV7A 4XI0A 5M72A 3RRMB 3FTUA 3DM9B 3OAWA 1M2OA 1JPNA 4O6MA 2HYZA 2IOSA 5EGYA 3LVRE 4GZDA 1ZU4A 5A6CA 4I17A 4U07A 4Y6WA 3PRZA 3UMIA 3SEOA 4GB9A 4FU3A 4DJAA 5KJNA 2MWQA 4YNDA 3NDBB 2VH3A 4GCNA 4O79A 4G0HA 1D0XA 2W4BA 1IZMA 3OEOA 4C7OB 1Z23A 1QQEA 4KBQA 5CMWA 5JJ7A 3P2BA 3RFYA 1UN8A 2EIJC 3EGXB 2PF4E 4CSAC 1Z3YA 4XLPF 3TJPA 2J0XA 5G05J 4KNWA 2WZGA 4ME2A 4U5FE 2YQ8A 2KM4A 5J90A 3ZVVA 1SZIA 4C0MA 4YVOA 4BTAA 1OWLA 2OVBA 5KYNA 1IW7F 2Q3TA 2BE5F 3DPDA 4Q7CA 3OWTA 3RRNB 1NA3A 4IYPA 4B6IA 3S28A 2XHEA 1Z3IX 2CG3A 1UJKA 2X38A 3NZSA 3CVYA 1PAQA 4EZLA 1S0PA 2RG8A 3I4GA 4B8AA 1D0ZA 3W2WA 1ZHWA 5BUZA 3Q4AB 2FBNA 1S7ZA 2I6HA 3CHOA 3AG1C 3JCKC 2IXPA 4FULA 3R9AB 3Q15A 1VMAA 2VSXE 2V5FA 2A69F 4F1SA 2WXHA 3CVXA 4XWJA 4H7YA 4CCAA 3G2SA 2X51A 2DYRC 3RKOF 5DQTA 4PS3A 2UWJG 4P29A 4R7LA 2A6EF 3VAYA 4CBEA 4RDAA 3JCUQ 3RKVA 1PC2A 1MMAA 3K33A 3CVWA 1NZNA 4UI9J 2G3KA 4PUCA 2WZFA 2OVFA 5CHEE 3ZRHA 4JJGA 2PX0A 5KYWB 3B9QA 4NACA 4DI4A 3SP1A 2Q9AA 2VJ8A 4CT0A 3U66A 2J0WA 4HS2A 4CDMA 3CK7A 4MLPA 3D9LA 2LSVA 2E87A 5T3TA 4AJWA 2CHWA 2WMOA 3UT8A 1YA0A 1MNDA 4AY6A 3LPZA 2C03A 4BWRA 4N39A 3PMRA 2WXKA 2VTBA 3ONKA 3FUMA 1RJ9B 4BJ5A 5E33A 2J7PA 3AS8A 3VLFA 3CVLA 1TR2A 2O9XA 4H7XA 4LCTA 3ASOC 4AX2A 3HYMB 3B7SA 2DCPA 2FF4A 5T3WA 3T6BA 4ACKA 5DIZA 3CK8A 1FVHA 4I1AA 3HJCA 4CS7A 4KNVA 4LEUA 2YHEA 4U0ZA 4BT8A 4AVXA 2CNWD 3O39A 2J46A 4EPZA 4XLNF 5E3CA 3ML8A 3X2QC 3PNTB 3ZSUA 5BV0A 4B8CB 3CQZA 3CHSA 2R7WA 3ESKA 3FTZA 4AEZC 2PQNA 3PEVB 3LVQE 3ASNC 1WAO1 2MOWA 2IXOA 4G26A 3LLKA 2X6FA 1N52A 4Q69A 2R5SA 3LY7A 2M63A 1Z6AA 4EBBA 4I2ZA 4HXIA 1OWOA 2A6HF 3ZW3A 2IXMA 2DBAA 2IFUA 5T4YA 4A3TA 1M2VA 2DGJA 2V8SE 3OXLA 2NUPB 4UWKA 2WB2A 5FZSA 3JRTA 3S7BA 2KCLA 3LESA 1ZHXA 4CS9A 3FTVA 3CEQA 4GYTA 3LKUA 2PFDA 1Z63A 4UWHA 2R17C 4CDNA 4FHJA 2ZXRA 2FFHA 3PEUB 2VGXA 4ANUA 2OCCC 5FZRA 4H4KC 2CGEA 2WVNA 4E85A 3L22A 2XSEA 3ABLC 4FJZA 3O4ZA 2A1DD 3U64A 3EPVA 3DAFA 3TGOA 5L3QA 2W9YA 4JCHA 3LJBA 4L23A 3ABKC 2Q9CA 2XRZA 2X6KA 4CDRA 2XCBA 4AY5A 2HO1A 3OXFA 3ECSA 5HSWA 3FH7A 5F5HA 5A7DB 4AE4A 4CS8C 3CSTA 3ZGQA 3HTKC 3QWPA 4YVQC 4F53A 3B0PA 4TUUA 5FQ4A 2BTDA 3MLGA 2VASA 3ASFA 1IQUA 3QB2A 3W8HA 4I6EA 1UN9A 2YINA 2FI7A 4APFA 4JW1A 2WXIA 4G2VA 3FU0A 1N1CA 1JUQA 4BFRA 3UMKA 2DIWA 4JEUA 3ZXSA 3OXGA 5LCWC 4A1SA 2WXJA 5FZQA 5KJKA 4KVOA 3I5PA 3GYZA 4V3IA 1BR4A 4KBLA 2ZU6B 2R7XA 4XI9A 3CVNA 3CK9A 1HZ4A 3NYMA 2ZXPA 4A1GA 3MJWA 3MGBA 4U5GA 3QZCA 3UMHA 2LO6A 3AU4A 4N2SA 4ANXA 4EECA 3LNRA 4GYYA 3EHMA 3FUIA 3F46A 2J9WA 3MEKA 4EWCA 2X3MA 4KVMA 3FUFA 1UJJA 1ZHTA 4B89A 1TJFA 3NYJA 3U3WA 5HI7A 3UT7A 3FDHA 5FQ7A 2IYLD 2OOEA 4GMLA 4LLCA 2WXPA 2Y3BA 4F7AA 3DJUB 2EQXA 4OVVA 4GMJA 4UWLA 4JL0A 5EDSA 2R7QA 2W4MA 3DAGA 4PH4B 2XXAA 3CHRA 1SQMA 3QDNA 2AVPA 5G05C 3K66A 1OWPA 3RRUA 2IOLA 2BUGA 4UQZA 5FQ8A 3B0VC 1OCOC 2ZXWC 2D5RB 2WQ6A 3GODA 2KCKA 4YT2A 1HS6A 3NZUA 5E75A 1P5QA 4GCOA 3ONLA 3FHEA 1LS1A 4PJMA 4PFPA 3W2VA 5CCLA 3K6BA 2J07A 3APFA 1M57C 3POVA 2L6JA 1ZHYA 3DMDA 4YN0B 4WWPA 1OUVA 3L34A 1B89A 3RJVA 3PUJA 3FTYA 5HQ8A 3KS2A 3HDXA 3R7RA 2I1JA 1OCRC 4UI9K 2NUTA 1WGWA 5J08A 3ZHEA 3L0IA 2CW0F 4Q4ZF 1L5JA 4APOA 5T1DB 2AXUA 4U5DE 5JJ6A 4NURA 3N24A 3GZ1A 4JHRA 4B94A 2XPYA 1WM5A 4MS6A 4GU5A 1NZEA 4FWVA 2L0IA 5DBKA 2J4DA 1ZBPA 5KYXB 1Y8MA 3EJNA 2PQRA 4KZCA 3BG0B 2KC7A 4WWOA 3PZDA 2P6VA 3DJNB 4NRHB 5C1DA 3HVEA 4MKTA 1U3DA 4JVSA 4JC8A 4X0RA 4CSAA 2NXPA 4BY6A 4ABNA 1U3CA 3TG5A 1SF8A 4URKA 3PUKA 4MQ9F 4GZ5A 3TL5A 3U9WA 4BJTA 3CSFA 4GA1A 4N5CA 2J45A 5FQ6A 2GFHA 5B3SC 4GA0A 4G23A 4JHJA 3NRHA 3I4RB 1BR1A 4XZ4A 2C0LA 2X6JA 4I6JA 4EBAA 5T3RA 4PFOA 2A4ZA 5G04C 2V3CC 1FMVA 3SD5A 2QY7A 1ZU2A 3MKQA 2LAHA 2LNIA 1Z3XA 3K7DA 3EGDB 3HHMA 4CS9C 2CHXA 4PS7A 4FJYA 1TWCA 3EZHA 4J6IA 2WQHA 4J32B 4IRUA 3SZ7A 3MYVA 5EX3A 4A3VA 2WVQA 1FCHA 3O48A 4OVUA 4EZJA 5A23A 2R7RA 4JHKA 2ZXOA 5LCWJ 3IEGA 5KYWA 2I1KA 3FAJA 2Y39A 5CMYA 3HLZA 3UUXA 4WAFA 1E8YA 3VTXA 1QLEC 2KZTB 2WQ7A 3EQLF 2VQ2A 3FULA 4U04A 5DS5A 3KD7A 4HLEA 2IXNA 2LSEA 4DLQA 4WNDA 4CGWA 3IV0A 4FESA 4BJ5C 4L1BA 3SYNA 5KYUB 2J9VA 4G7OF 2WXGA 2WXNA 3FFLA 2QY9A 3NQPA 1E8WA 1KU2A 4KXKB 1SZ9A 3FH5A 4LUNU 2AWIA 5AJLA 3CIAA 5G55A 5E3AA 3FHDA 2CNWA 2PP4A 5JJTA 3GZSA 4HOQA 3L16A 4FHKA 1SMYF 2E2EA 4HOUA 3E9VA 2I2OA 1VOMA 2VGYA 2J7PD 2IQCA 2UY1A 2XPIA 4HFFB 2NC9A 5LFAA 2HR2A 3CHQA 3DM5A 5LX8A 2Y3GA 4YT8A 3CLJA 4A2NB 1LKXA 1V55C 5DVWA 3MZLB 4WNEA 3FU5A 3BEEA 2C04A 2Y3HA 5KJMA 1WY6A 1EF1C 3NKDA 5ANRA 2IJGX 2P7VA 3UMVA 2NG1A 2VB6A 4J8FA 3SBTB 4DPRA 1OCCC 4K0DA 2G3VA 3WODF 3L13A 4Q94A 4ANWA 4GEHA 1J8MF 2WZLA 3ZYKA 4LACB 4JA7A 4AIFA 3CV0A 2ONDA 1QZXA 3FUEA 3CKCA 4AM9A 1E7UA 3MA5A 3UPVA 4OIPF 4I1MA 4AP2A 5CI8A 5C2YA 4WJ0A 4ILGA 3VYWA 4GZ3A 4C3DA 4N3BA 3S29A 2W45A 2A5UA 4ILIA 4HEAJ 2EIKC 2IONA 4P6IC 3FUDA 4J0UA 4QI2A 5T8IA 3URZA 2KJGA 1EYHA 3LEVA 3OTNA 2M4EA 1OCZC 3P1UA 4DBRA 3PS6A 3DZAA 2VGXB 2DYSC 2WXMA 2IF4A 5E76A 3U4TA 3AU5A 4JZAA 2X6IA 3T8MA 4XTKA 4Q5SF 4UI9C 2Y4UA 3E4BA 3FP3A 3T5XA 3T4RA 5AJDA 2J49A 2PM6A 1PY1A 4PK4A 2XGOA 1TWGA 3EFOA 3RO3A 3FEYA 5BNWA 4HOSA 4UQXA 3GW4A 3LJ3A 4FLHA 4I43A 3N0TA 2R7SA 3GZ2A 4WUYA 3O6XA 1DNPA 3JYHA 3KKBA 5IY5C 3EDTB 4OYSA 2WVIA 4CS8A 3FU3A 1Y6IA 5FWQA 4RBNA 2OV8A 4RD9A 3JSZA 3CR3A 5DLJA 4EQFA 4KC9A 4N3AA 4J8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHN A;  3CKB A;  5E76 A;  3CKC A;  3SGH A;  3JYS A;  4LER A;  3I4G A;  3LEW A;  3EJN A;  4L7T A;  4F53 A;  3JQ0 A;  5T3R A;  5FQ4 A;  3MX3 A;  5E75 A;  3CK7 A;  3IV0 A;  5LX8 A;  5T4Y A;  3HDX A;  3FDH A;  5FQ6 A;  3GZS A;  5FQ7 A;  3L22 A;  3QNK A;  4MRU A;  3CK8 A;  3EHM A;  3MYV A;  3CGH A;  5FQ8 A;  3OTN A;  5J90 A;  3P1U A;  4Q69 A;  4F7A A;  3KEZ A;  3JQ1 A;  3MCX A;  3SNX A;  3NQP A;  3CK9 A;  4PUC A; 
#chains in the Genus database with same CATH topology
 3EH1 A;  3KL4 A;  4J7T A;  4FLB A;  1SA4 A;  4IWB A;  3FH8 A;  5FT9 A;  1TR4 A;  5ITZ F;  1K3Z D;  3EHQ A;  3G2T A;  1VYI A;  4TRQ A;  1XGW A;  5BW8 C;  1FVF A;  2DWZ A;  1OW7 A;  3FWV A;  3G2V A;  3J5Q B;  1TFK B;  3LXU X;  4GMR A;  4GYO A;  4U5E E;  5B1A C;  3C3R A;  2OQM A;  2XEV A;  1N4P A;  3LS1 A;  4XEF A;  1OT8 A;  4ANV A;  5HRY A;  3KMI A;  2XGM A;  2H6H A;  1E8X A;  2LSU A;  4O6N A;  3EHR A;  5ENP D;  3Q47 B;  4EHM A;  4CEM A;  4U96 D;  5KYY B;  1OWN A;  4FA6 A;  2KW3 C;  1VYK A;  1NG1 A;  2HKV A;  3LDZ A;  4FX5 A;  5DQZ A;  1JCQ A;  3LS8 A;  4PS8 A;  3G4Z A;  1G3N B;  2EPK X;  4GTS A;  3LYA A;  3SF4 A;  1UOH A;  4E7S A;  1FMW A;  3MYF A;  1R4T A;  3OA1 A;  3QVY A;  2YVK A;  4OD5 A;  4ILH B;  3SHF A;  2GWW A;  3PDN A;  1YLM A;  1V54 E;  1MJ0 A;  3PNL B;  1D1C A;  1TNZ A;  2XZD G;  3FDQ A;  4UQY A;  3QJZ A;  3PHF 2;  1YA7 O;  3F47 A;  1HX8 A;  4OIQ F;  5EX0 A;  4XE0 A;  1PV3 A;  4LNB A;  4OAU C;  4YT4 A;  2VYI A;  5ENQ D;  3RK6 A;  1YA9 A;  5AQA A;  3D9J A;  2XCC A;  3TAX A;  2EIL C;  1HE9 A;  2B0H A;  1U0B B;  3IKO B;  4I44 A;  1H2T C;  3QWW A;  4JEB A;  3BG1 B;  5B1B C;  3LCA A;  4CT4 A;  3VTY A;  4HVB A;  1KT0 A;  3MYI A;  4WNG A;  4ANJ A;  4W8K A;  5L0J A;  1YCS B;  4ZLD A;  3E70 C;  2BC5 A;  4OD4 A;  3S2A A;  2CDQ A;  4B0Z A;  3ASN E;  1WDY A;  3ZUV B;  2CG2 A;  3IHY A;  2EPO A;  1TJC A;  3L8J A;  3SNX A;  4BX9 A;  2OKU A;  1XNF A;  3FUK A;  1QSP A;  2CFZ A;  4G11 A;  3GEE A;  3ASD A;  3QOU A;  5A6B D;  3RU0 A;  4I1O B;  3Q7L A;  4MND A;  1KTM A;  4GTO A;  5G04 J;  3R9M A;  4UUC A;  3K9I A;  4M63 A;  3T6J A;  3EG9 B;  2PZI A;  4C0E A;  1HW1 A;  4UWG A;  1Z6T A;  1RJ9 A;  5LOZ A;  5D91 A;  3RYL A;  2Q9B A;  4DBQ A;  3FUN A;  5TJ5 E;  3SXK A;  1G5Z A;  2BED A;  3N2Z B;  3SFZ A;  3E34 A;  4AOF A;  5HV9 A;  2RFM A;  2GDC A;  3L9T A;  4Z9J A;  3TD7 A;  1K1A A;  3CKB A;  5EYL A;  1E90 A;  4LSZ E;  4JPS A;  4EBK A;  3JYS A;  1MMG A;  2BKK B;  3LEW A;  1H19 A;  3SZR A;  3TXN A;  3WXX A;  1OWM A;  2RFA A;  1RKE B;  4XKB A;  2I8B A;  1NLX A;  3DI5 A;  2GRM A;  2AWC A;  2MRI A;  4I9C A;  1K1B A;  3A9C A;  5ENT D;  3R2P A;  4IUL A;  3S7F A;  1KLX A;  4CJG A;  2C2L A;  3JQ1 A;  4A55 A;  2J9Q A;  4ULW A;  3RVY A;  3G2U A;  3SGH A;  3U2M A;  4JZY A;  3EZI A;  2XGS A;  2IM8 A;  4BSZ B;  2JLB A;  4I6G A;  3TWS A;  1JOG A;  1NL4 A;  2BF0 X;  2PM7 A;  3FUJ A;  1TN7 A;  3AG3 C;  4MVR A;  1E2X A;  2PBE A;  2XQ0 A;  3QNK A;  3AG2 C;  3DD7 A;  2GAQ A;  4Z68 A;  4DRH B;  3ULY A;  4GTR A;  1IYG A;  1A7E A;  1A17 A;  2GGF A;  1ST6 A;  2YEV A;  3ZHE B;  1OXB A;  3NMI A;  4EKW A;  1DCE A;  2C0M A;  3L17 A;  3N71 A;  3IQ6 A;  2CYD A;  5AN8 A;  1H6K A;  3EH2 A;  3FVY A;  1HG5 A;  4F1P A;  3VF0 A;  1BD8 A;  1HU3 A;  4MVO A;  5BUO A;  3VRC A;  3SQV A;  2EIM E;  3W4Y A;  3QAQ A;  4CIH A;  1AVO B;  1HG2 A;  2X0C A;  2EIK E;  2CCY A;  1N4Q A;  3UXG A;  4RVB A;  3G4X A;  4E0H A;  3T8K A;  1JPJ A;  1ELK A;  3QW1 A;  2MYS A;  5E2Q A;  3V30 A;  2R7V A;  2ETS A;  1VK5 A;  4BEM J;  5AC4 A;  2DYR E;  1JRA A;  5KYX A;  2ZXW E;  3B7U X;  2P9L G;  2I15 A;  4BEJ A;  1TNY A;  1KT1 A;  3ZFW A;  4DI3 A;  3TWR A;  2HMQ A;  3KAE A;  2L9J A;  2H6I A;  2KCV A;  1JWF A;  4HRM B;  2WMN A;  3CGH A;  3HVE B;  5F28 E;  4C7O A;  1M2V B;  1TNO A;  2R9R B;  4O7G A;  2ETC A;  5JS5 A;  3UM0 A;  5D0Q D;  3H65 A;  2HFI A;  4N3C A;  3EGX A;  2R7T A;  3D3M A;  3NBN B;  4HFK B;  3FUH A;  3JQ0 A;  2HMZ A;  2AXZ A;  4G78 A;  2HSQ A;  1RW2 A;  3UGO A;  1FTS A;  2XZT G;  3TG4 A;  5DS6 A;  4KI2 A;  2F0Y A;  2H7O A;  3ENE A;  5DS4 A;  3PE4 A;  3S7J A;  2AJA A;  3FEX A;  4DRJ B;  1QZ2 A;  4K0R A;  1U6H A;  2L81 A;  3IQT A;  3I4U A;  3FY4 A;  4L2Y A;  4D10 C;  3ULQ A;  4J8S A;  3ISM C;  2OG2 A;  5BV1 A;  3U3F A;  4W8P A;  3M15 A;  4JIO A;  3HXE A;  3EU9 A;  5B3S E;  1Q0M A;  4OIR F;  3PZ4 A;  5AAR A;  4RG9 A;  1RCP A;  1H2U A;  2Y3A A;  3PZ1 A;  4NQ0 A;  2R7O A;  3FU6 A;  4JUR I;  4BTB A;  3K1I C;  3L08 A;  3LAY A;  2YL7 A;  3AGT A;  2KC3 A;  1NP7 A;  4C3B A;  4BSX A;  2KGO A;  1ZHZ A;  2P1A A;  5D2M C;  4AXH A;  4YL0 A;  3FAP B;  1LF8 A;  2ZIR A;  1PCX A;  5EHH A;  1ELR A;  3QVZ A;  3S27 A;  4DVY P;  5AEN A;  1E85 A;  3ZQV A;  3APD A;  1ZU5 A;  4I3M A;  5A6J A;  2R59 A;  3D9M A;  3FXH A;  4WWN A;  4FAD A;  4U7E B;  1W2W A;  3JUE A;  1HE1 A;  2XRH A;  3DBS A;  4DOZ A;  4LRZ A;  3DSU A;  3FMS A;  3MFN A;  3ZVR A;  3ML9 A;  3WG7 E;  4AE4 B;  1TWH A;  1CPR A;  1YZC A;  2H7V C;  2R25 A;  2YLG A;  3MCX A;  5LP0 A;  3JT1 A;  4E6H A;  4XX5 A;  1O1T A;  1INZ A;  3APC A;  1ZYR F;  2B0J A;  4NTF A;  1HE8 A;  1IQR A;  4YT5 A;  3ZEF A;  3D9N A;  3QWV A;  1G8X A;  2PX3 A;  1UG3 A;  2VCB A;  3C3Q A;  1LI5 A;  3R7Q A;  5EID A;  3NF1 A;  4IAQ A;  2XLD A;  2FAP B;  3S0X A;  1H0A A;  5CCM A;  5D66 A;  4TUM A;  2XL4 A;  2NSG A;  1BR2 A;  4HFG A;  3Q5M A;  4OIN F;  2JD3 A;  3U2L A;  5CI9 A;  1ELW A;  3W8I A;  3RIP A;  2VGE A;  3L54 A;  4ULV A;  1H6G A;  4U5H A;  1MQS A;  4L2L A;  2J4B A;  1LD8 A;  3ZIB A;  4D4X A;  4ZLC A;  1L3P A;  3MX3 A;  3GOR A;  5ANL A;  4DX2 A;  5JHA A;  3E37 A;  2UUH A;  2GRQ B;  3EIQ C;  2HZ8 A;  1L7C A;  5L0G A;  2H7B A;  2FUL A;  3HIZ A;  1OY3 D;  2LAI A;  3HNI A;  4N2Q A;  2L6B A;  2WB7 A;  1TEZ A;  4AV7 A;  4B93 B;  3HXB A;  3ZIM A;  2VCC A;  4YJW A;  1JMW A;  1B68 A;  4IJJ A;  3ABM C;  4K5C A;  4YDO A;  3Q6N A;  5F5F A;  5JRA A;  3K1H A;  4ATZ D;  3AGU A;  2XXA B;  3A11 A;  5L3V A;  1MNE A;  2LFF A;  3UR3 C;  3UNG C;  2VTB B;  3DSV A;  3KEA A;  3PE3 A;  4U8H A;  4JKV A;  5CEC B;  4GZC A;  4EIY A;  2R2L A;  4NY3 A;  4ACL A;  3CZ6 A;  3RO2 A;  2LCH A;  2L9B A;  5BQG A;  1FFT C;  3GWN A;  1SR2 A;  2G62 A;  2Y3D A;  3LY8 A;  3QK0 A;  1GGQ A;  1BBH A;  3E32 A;  1EDU A;  1S05 A;  2EIM C;  1TN8 A;  3D9I A;  4FC8 A;  1YAR O;  3NMK A;  3D9K A;  2WXL A;  2KQ9 A;  2ZPA A;  4HQD A;  2NSZ A;  4N06 A;  2ETB A;  4KZ0 A;  5ARF A;  2Y69 E;  3NOG D;  1V54 C;  4BES A;  4HE8 D;  1MMN A;  4G7Z F;  3JXJ A;  3PZ3 A;  1OR3 A;  2AW6 A;  2P2C P;  4TV3 A;  1YYJ A;  3MV2 B;  3QAR A;  4M3O A;  4DK5 A;  4G24 A;  3UTM A;  3PRE A;  1WAT A;  4XEI G;  1X81 A;  3ZC4 A;  3L8I A;  4PDX A;  4I9E A;  3SY2 A;  3VLE A;  1AWC B;  1LS4 A;  4NCQ A;  3T9O A;  3CHP A;  2RD0 A;  3V79 K;  3EHN A;  3Q6M A;  2VSN A;  2YHC A;  2IU1 A;  1D1A A;  2E0I A;  1PD0 A;  4OIO F;  2WL8 A;  3DE9 A;  4L9P A;  1HH8 A;  2NUT B;  2LQG A;  2JAB A;  3T5V A;  2Q7F A;  2V4L A;  2L0T B;  4AK9 A;  3DPY A;  2XLM A;  2FEZ A;  3B71 A;  2VSO E;  1D0Y A;  1E96 B;  3EUV A;  1ORY A;  3M1C B;  1HMD A;  4G25 A;  1TNB A;  3B13 A;  1YAU O;  4PJN A;  3AG3 E;  1SVX A;  3CEX A;  4I2W A;  5KCM A;  3DXJ F;  3LY9 A;  4G8L A;  2Y4T A;  2QZA A;  2NPU A;  3PH0 C;  1O87 A;  3AG4 C;  1IHG A;  3Q7G A;  2YRF A;  3NKE A;  1RMV A;  4UWF A;  4KYO B;  4JEH A;  4U5C E;  2EPN A;  4C9B B;  2JEK A;  1UW4 B;  2WM9 A;  4LDQ A;  1DCQ A;  2WPV A;  2J8W A;  3TUL A;  4JXT A;  3G2W A;  5KJL A;  1FFH A;  5IY5 E;  2XS8 A;  4C3E A;  3UQ3 A;  3D9O A;  4G7H F;  2V0P A;  2V4H C;  3QC1 A;  1R5I D;  1GM5 A;  3CVP A;  5FCL A;  3C98 A;  3JUI A;  1K05 A;  2LK4 A;  2EIN C;  4PR9 A;  2PL2 A;  5ARG A;  4CYM D;  5B3I A;  5BT1 A;  1O3U A;  2WXF A;  2NUP A;  3S7D A;  1LVK A;  4GTM A;  4LDR A;  2ZD9 A;  3Q75 A;  3I3N A;  2LFD A;  4QDL A;  3UGP A;  4R32 A;  2QC9 A;  2XLE A;  2KYH A;  3C5R A;  4O6F A;  2MHR A;  4BJ1 A;  4GZ6 A;  3GAN A;  4KMO A;  5JVE A;  3CVQ A;  2Y69 C;  3UT4 A;  4GA2 A;  2IY0 C;  4DX5 D;  2QTV A;  3ZYM A;  4W9R A;  1WAS A;  3FTS A;  4J8D A;  1N94 A;  4PJJ A;  4Y6C A;  4U63 A;  3FOO A;  2FO7 A;  4MTO A;  2HUJ A;  1VDY A;  5COF A;  2WXO A;  4U0S A;  2XRY A;  3H2U A;  1H6O A;  4MVM A;  3EFO B;  3ZPJ A;  4G1T A;  2Z15 A;  5JHB A;  4U0U A;  4EHP A;  5FTP A;  3B7R L;  4CGV A;  4HOT A;  3U8P A;  3RQE A;  5ENR D;  4ATG A;  4QI0 A;  4O6Y A;  1YJG A;  4O1O A;  1F1M A;  5AYW D;  4RLY A;  4BJ6 A;  4FP7 A;  2A0B A;  3NG1 A;  3NOC D;  3RH3 A;  2R7U A;  3VLD A;  4HOR A;  3IXE A;  1TWA A;  4BG0 A;  3DSX A;  4BT9 A;  4DLO A;  2YKZ A;  4XEV A;  3FTX A;  2J9U A;  1D1B A;  3DST A;  5G2N A;  2CHZ A;  2GRR B;  3ESL A;  4L7T A;  1HFA A;  3IHV A;  3ZYQ A;  3SFY A;  1QNF A;  4WNF A;  5EKQ D;  2WXQ A;  3QMK A;  2GRO B;  3TXM A;  2P58 C;  3LS0 A;  2P9S G;  4XKC A;  2XPZ A;  4AL1 A;  3TWT A;  5D92 A;  1IKN D;  1NFN A;  5D0O D;  2IOQ A;  5KNG A;  2NSF A;  1YZA A;  2V5Q C;  1DOV A;  1IHB A;  3V7O A;  3M79 A;  5ENN A;  5FIO A;  3O10 A;  5CIV A;  1O5H A;  1TKN A;  5AIJ A;  3O55 A;  3CVV A;  3B0U X;  3CQG B;  3EU5 A;  3ZU7 B;  5KYY A;  2QLA A;  1BPO A;  4RSY A;  3SNH A;  3PCV A;  4XQ1 A;  2KZT A;  3Q49 B;  3ZYL A;  3MKQ B;  2A68 F;  3X1O A;  2VSY A;  3AS5 A;  4IN3 B;  4RG6 A;  4BEP A;  5FJY A;  3EGD A;  1NA0 A;  3D9P A;  1J8Y F;  2YZS A;  2KNH A;  2EIJ E;  4LER A;  3B7T A;  1E7V A;  3JXI A;  1OXK A;  1OKK A;  3IBE A;  5JA4 D;  2QYU A;  2A0U A;  2LXL A;  3ASG A;  4MVQ A;  3RAU A;  2ILR A;  1GQA A;  4EUK B;  1KPS B;  4BJ6 C;  1N4S A;  4TXP A;  3PZ2 A;  3WG7 C;  3SBS A;  4LLE A;  3CSK A;  3IEE A;  2X6H A;  3KEZ A;  1HW2 A;  4PJL A;  4C48 B;  4DUI A;  4K1O A;  4U5B E;  5A6B A;  2GW1 A;  3ASO E;  3KH2 A;  1FAP B;  1ORS C;  3LLI A;  4LNU D;  2V26 A;  3AS4 A;  4E7Z A;  1W3B A;  3AQB A;  1Q2Z A;  256B A;  2YNQ A;  1NU9 C;  4F4B A;  1MMD A;  4MRU A;  2YHS A;  3ZG1 A;  2HM8 A;  4YWQ A;  3UX4 A;  2DYS E;  2OEV A;  1WTY A;  4JJF A;  3ZDL A;  2J08 A;  4K03 A;  3NMJ A;  2UY1 B;  3SXM A;  2L6H A;  1JWG A;  1HF8 A;  4GAA A;  3MKR A;  3ASH A;  3KYI A;  5H7P A;  2AXV A;  2OJE D;  1LE4 A;  1LE2 A;  2Q00 A;  3EG9 A;  2QFC A;  3ZN3 A;  3SI5 A;  3UI2 A;  2YLI A;  4F3V A;  4GPK A;  1HXI A;  4H54 A;  3QKY A;  3CVU A;  3PVL A;  1T9K A;  1BI8 B;  5KYU A;  3MV3 B;  4KT6 B;  1PD1 A;  4MTF A;  4GTT A;  2WXR A;  2P9I G;  4QFV A;  2KAT A;  2WVO A;  1T6U A;  2TMV P;  1X5B A;  2I9C A;  3AQC A;  4IAO A;  1GW6 A;  2LUH A;  4EZK A;  2HV6 A;  3RIB A;  1UG7 A;  3EIJ A;  2YQY A;  3CQC B;  1SZA A;  1NU7 D;  5AC5 A;  1RKE A;  2LIG A;  4DVZ A;  3L6A A;  1E8Z A;  1Z5Z A;  4MVZ A;  4HI8 A;  1M56 C;  4J30 B;  1OKK D;  4Q96 A;  4G8K A;  5ENS D;  2CFU A;  3NYL A;  2J09 A;  1AEP A;  2FGY A;  4FAP B;  3Q78 A;  4BX8 A;  3ITF A;  1EPU A;  4MW3 A;  2Y1L E;  4N5Q A;  3G50 A;  3ZTZ A;  3C8G A;  3FTW A;  3J5P A;  1VTM P;  4XIF A;  1JPL A;  5AAO A;  5BPP A;  2NYJ A;  4K7B A;  1H2V C;  3UKU G;  2PNO A;  1EKY A;  2GRL A;  2YL3 A;  1WWP A;  4CRW A;  2XM4 A;  1HO8 A;  1N0R A;  3I5Q A;  1V74 B;  3HKK A;  3CHM A;  1MHQ A;  1OW8 A;  4XPY A;  3C8Z A;  1OCZ E;  4GYW A;  1A5E A;  3H2V A;  3TWQ A;  4JA9 A;  2MHK A;  1DVP A;  4EBA G;  1N54 A;  2HV7 A;  4XI0 A;  5M72 A;  3RRM B;  1TQG A;  4JTA B;  3ABM E;  3FTU A;  3DM9 B;  3OAW A;  1M2O A;  1JPN A;  4O6M A;  2HYZ A;  2IOS A;  1Q0F A;  2DVW A;  3C63 A;  3AG2 E;  5EGY A;  1H7I A;  2EPL X;  3TJ6 A;  2R05 A;  2FO1 E;  3LVR E;  4GZD A;  1ZU4 A;  5A6C A;  2PNN A;  4I17 A;  4U07 A;  1U89 A;  2DZO A;  4Y6W A;  3PRZ A;  1ZW3 A;  3U9M A;  3UMI A;  3SEO A;  4GB9 A;  4FU3 A;  2L6F A;  1JCS A;  1CGO A;  4DJA A;  5KJN A;  4LG6 A;  3TQO A;  2MWQ A;  4YND A;  3NDB B;  4JTD B;  2VH3 A;  3D9H A;  3T6G B;  2Y0B G;  4GCN A;  5CRU A;  2AVK A;  2A5E A;  4O79 A;  4TXQ A;  4G0H A;  5K0I A;  1NI1 A;  3ABL E;  1D0X A;  2W4B A;  1APC A;  1IZM A;  3DWL G;  3OEO A;  4C7O B;  1Z23 A;  1QQE A;  4KBQ A;  4BPM A;  5ENO D;  5CMW A;  4D4N A;  5JJ7 A;  4CDA A;  2XEE A;  3P2B A;  3RFY A;  1Z5S C;  1UN8 A;  2EIJ C;  3EGX B;  5L0D A;  2PF4 E;  4ER9 A;  4CSA C;  3C8G D;  1Z3Y A;  4XLP F;  2DZN A;  3TJP A;  2J0X A;  5G05 J;  5JMN D;  4KNW A;  4E0I A;  4UDV A;  2WZG A;  4ME2 A;  3SXZ A;  4JTC B;  2YL0 A;  2KBX A;  4U5F E;  2YQ8 A;  2KM4 A;  3JZ0 A;  5J90 A;  3ZVV A;  1SZI A;  3DEP A;  4C0M A;  3DWW A;  2XLW A;  4YVO A;  4BTA A;  1OWL A;  4HRN A;  1E84 A;  2HJM A;  3RVZ A;  2OVB A;  5KYN A;  1IW7 F;  2Q3T A;  5BQI A;  1K04 A;  2BE5 F;  3WHN A;  1OCR E;  3DPD A;  4Q7C A;  3OWT A;  3QTH A;  1NA3 A;  3RRN B;  4IYP A;  4B6I A;  3S28 A;  1TFO B;  3DE8 A;  2XHE A;  1O5M A;  1Z3I X;  2CG3 A;  1UJK A;  2X38 A;  1YYX A;  3NZS A;  3UM2 A;  3CVY A;  1PAQ A;  4EZL A;  4Z9I A;  1O1R A;  1S0P A;  2EIL E;  3M4B A;  2RG8 A;  4U9D A;  2GRP B;  3I4G A;  4ONS A;  1RKC A;  4B8A A;  3UM1 A;  1D0Z A;  5B1B E;  3W2W A;  2HJ3 A;  1ZHW A;  2ZIS A;  5BUZ A;  3Q4A B;  2FBN A;  1S7Z A;  2I6H A;  2DI3 A;  3CHO A;  3NAW A;  3AG1 C;  2D4U A;  3JCK C;  2IXP A;  4FUL A;  3R9A B;  3Q7F A;  3Q15 A;  1VMA A;  2VSX E;  4HI9 A;  2V5F A;  1WOL A;  2A69 F;  4F1S A;  2QUP A;  2WXH A;  3CVX A;  1DC2 A;  4XWJ A;  4H7Y A;  2ASR A;  3QW0 A;  4CCA A;  3G2S A;  2X51 A;  2DYR C;  3Q7A A;  3JRM O;  4DRI B;  1I5N A;  3RKO F;  5DQT A;  4PS3 A;  1JR8 A;  2UWJ G;  2J8S D;  1A41 A;  4P29 A;  4R7L A;  2A6E F;  3VAY A;  4CBE A;  4RDA A;  3JCU Q;  3RKV A;  1PC2 A;  1MMA A;  3K33 A;  3CVW A;  4AL0 A;  1NZN A;  3KYJ A;  2YL1 A;  4UI9 J;  2G3K A;  2J9B A;  2JPU A;  1C02 A;  4PUC A;  1H9T A;  2WZF A;  2OVF A;  5CHE E;  3ZRH A;  4JJG A;  2OCC E;  3B95 A;  2PX0 A;  5KYW B;  3UKR G;  3B9Q A;  4NAC A;  4DI4 A;  5JUA A;  3SP1 A;  1EA8 A;  2Q9A A;  2VJ8 A;  4CT0 A;  3U66 A;  3ZNG A;  2J0W A;  4HS2 A;  4CDM A;  3CK7 A;  2OOC A;  4MLP A;  3K1I A;  2XEH A;  3BQO A;  3D9L A;  4QQI A;  3IPM O;  1EI7 A;  1QBQ A;  2LSV A;  2RKK A;  2E87 A;  5T3T A;  5B1A E;  4AJW A;  2CHW A;  5CED B;  2WMO A;  3UT8 A;  1YA0 A;  1SA5 A;  1MND A;  4AY6 A;  3LPZ A;  2C03 A;  3TWX A;  2HSB A;  4BWR A;  3GEI A;  3PMR A;  4N39 A;  3B29 A;  4F6R D;  2WXK A;  4YDY A;  2VTB A;  3V5Z A;  3ONK A;  3FUM A;  1RJ9 B;  4BJ5 A;  3E33 A;  5E33 A;  2J7P A;  3AS8 A;  1VB5 A;  3VLF A;  4Z9H A;  3CVL A;  1N4R A;  1TR2 A;  3S90 A;  2O9X A;  3U9J A;  4H7X A;  4LCT A;  3ASO C;  4AX2 A;  3HYM B;  3B7S A;  4L6R A;  2DCP A;  4O60 A;  1T01 A;  4P9T A;  3HG0 D;  2FF4 A;  5T3W A;  2F22 A;  3T6B A;  4ACK A;  3GM2 A;  1BDJ B;  5DIZ A;  3CK8 A;  3MBG A;  4CX9 A;  1FVH A;  4I1A A;  3HJC A;  1DOW A;  4CS7 A;  4KNV A;  4LEU A;  2YHE A;  3GEH A;  4U0Z A;  1TNU A;  2YWA A;  2B0O E;  4BT8 A;  4WGY A;  4A63 B;  1D8E A;  4AVX A;  3DXM G;  2CNW D;  4YDW A;  4A4A A;  3O39 A;  3HNJ A;  2J46 A;  4EPZ A;  4XLN F;  5E3C A;  1CGM E;  3X2Q C;  2QYJ A;  3ML8 A;  3PNT B;  3ZSU A;  1FT2 A;  4JB8 P;  1AP7 A;  1A7V A;  1VLS A;  3KPH A;  5BV0 A;  1ORJ A;  4B8C B;  3CQZ A;  3CHS A;  1OR2 A;  2R7W A;  3ESK A;  1T6Q A;  1S70 B;  3FTZ A;  4JD2 G;  5L0I A;  4AEZ C;  1N9A A;  2PQN A;  3PEV B;  3LVQ E;  3ASN C;  1Q0D A;  1WAO 1;  2MOW A;  2IXO A;  4G26 A;  1U2V G;  1FR0 A;  3JYY A;  1XZQ A;  3LLK A;  2X6F A;  1N52 A;  4Q69 A;  2R5S A;  3LY7 A;  2M63 A;  2P9N G;  4ZHB A;  1Z6A A;  5FZT A;  3GM3 A;  2KXP C;  4EBB A;  2P9U G;  1QQ3 A;  4O1P A;  4I2Z A;  2ZGG A;  2AWY A;  1YMP A;  4HXI A;  4J8Y A;  1OWO A;  2A6H F;  3DRA A;  5KNH D;  1I4Y A;  3C62 A;  4CJO A;  3ZW3 A;  2IXM A;  2DBA A;  2IFU A;  3UIO C;  5T4Y A;  1A0B A;  3IQ5 A;  4A3T A;  1FNT c;  5GPG B;  1M2V A;  2DGJ A;  2V8S E;  3OXL A;  4XPX A;  3HNL A;  2NUP B;  4UWK A;  5EIL A;  4DRX E;  2WB2 A;  5FZS A;  3JRT A;  3Q9N C;  3S7B A;  3C7J A;  2KCL A;  2R03 A;  3V5X A;  3LES A;  1XZP A;  1ZHX A;  4CS9 A;  4HLL A;  3FTV A;  3CEQ A;  4GYT A;  3LKU A;  2PFD A;  3LUT B;  1Z63 A;  2BL2 A;  4UWH A;  2R17 C;  5BXU A;  1RXQ A;  1OCC E;  3IQC A;  4CDN A;  4FHJ A;  2ZXR A;  4IB4 A;  2FFH A;  3F6Q A;  3PEU B;  1K40 A;  2VGX A;  1YVI A;  5CBN A;  1C17 M;  4ANU A;  3C3O A;  3AJI A;  1QKR A;  4YK5 A;  1VLT A;  2OCC C;  1H9G A;  5FZR A;  4H4K C;  2CGE A;  2WVN A;  4E85 A;  3L22 A;  4CDV A;  2XSE A;  1N11 A;  2ICW G;  3HXD A;  3ABL C;  4FJZ A;  5A6A A;  3O4Z A;  4M7C A;  3DSW A;  2A1D D;  3U64 A;  4N4W A;  3EPV A;  4NTA A;  3DAF A;  3TGO A;  5L3Q A;  2M64 A;  2W9Y A;  2F8Y A;  4JCH A;  3LJB A;  4L23 A;  2XL6 A;  2Q9C A;  3ABK C;  2XRZ A;  2X6K A;  1QYM A;  4CDR A;  5A69 A;  2XCB A;  4JEA A;  4AY5 A;  2HO1 A;  3OXF A;  3ECS A;  5HSW A;  3FH7 A;  3RQG A;  3U8V A;  5AQB A;  4NTB A;  1FT1 A;  5EIB E;  5F5H A;  5A7D B;  4AE4 A;  4CS8 C;  4U8V D;  4HRL A;  3CST A;  3ZGQ A;  3S84 A;  2VCA A;  1IXV A;  2H8A A;  1K8K G;  2HS5 A;  3HTK C;  3QWP A;  2IO2 C;  5CRV A;  4YVQ C;  3W9F A;  4F53 A;  3B0P A;  4TUU A;  5FQ4 A;  3IHU A;  2BTD A;  3MLG A;  2VAS A;  3ASF A;  1IQU A;  3QB2 A;  2AP3 A;  3W8H A;  4JCZ A;  1BI7 B;  5FIN A;  4I6E A;  1UN9 A;  2YIN A;  1ZVZ A;  2FI7 A;  4E18 A;  4P9F A;  2ZGD A;  4JW1 A;  4APF A;  2WXI A;  3RW0 A;  3FU0 A;  4G2V A;  3TOL A;  1N1C A;  1JUQ A;  4BFR A;  3UMK A;  1LTX A;  2DIW A;  1S63 A;  4JEU A;  5HKP A;  3OXG A;  3ZXS A;  2XLV A;  4JRZ A;  4A1S A;  5LCW C;  2WXJ A;  2JX0 A;  1LPE A;  5FZQ A;  4EBJ A;  5KJK A;  3US6 A;  3J06 A;  4K5B A;  4KVO A;  2XM0 A;  1E83 A;  3I5P A;  3GYZ A;  4V3I A;  1BR4 A;  4KBL A;  1NFI E;  2XLO A;  5JSL A;  4PAC A;  5JT4 A;  2ZU6 B;  2R7X A;  4XI9 A;  3CK9 A;  3CVN A;  1HZ4 A;  3NYM A;  2ZXP A;  4A1G A;  3MJW A;  3MGB A;  4U5G A;  5CER B;  1G4W R;  1RZ4 A;  3QZC A;  3UMH A;  2XL8 A;  2LO6 A;  2L6G A;  3L1M A;  5KWD A;  3AU4 A;  4N2S A;  3U3B A;  4ANX A;  4EEC A;  3LNR A;  4GYY A;  3EHM A;  3FUI A;  1V4A A;  4BET A;  2H6G A;  1OCO E;  3F46 A;  1G4U S;  1ZW2 A;  3M4C A;  2J9W A;  3MEK A;  4EWC A;  2X3M A;  4KVM A;  3FUF A;  1Y4C A;  4U95 D;  2L7A A;  1UJJ A;  1ZHT A;  4B89 A;  3LEO A;  1TJF A;  3NYJ A;  3LJN A;  4DX7 D;  3U3W A;  3AJM A;  5HI7 A;  4MTG A;  2P61 A;  2QE9 A;  3UT7 A;  3FDH A;  4WGZ A;  5FQ7 A;  2IYL D;  2OOE A;  4GML A;  4LLC A;  4IAR A;  2WXP A;  1T6I A;  2Y3B A;  1BLX B;  1C03 A;  4F7A A;  3DJU B;  2EQX A;  4OVV A;  4GMJ A;  2VC9 A;  4UWL A;  3GWL A;  4J7W A;  4JL0 A;  5EDS A;  3TOM A;  2R7Q A;  4OAV B;  2W4M A;  5L0F A;  1CGN A;  3DAG A;  4PH4 B;  2XXA A;  3CHR A;  3Q9U C;  4DX1 A;  1SQM A;  3QDN A;  3JTL O;  5L0H A;  2AVP A;  5G05 C;  1KZO A;  3K66 A;  1OWP A;  3BUA A;  3RRU A;  2IOL A;  3L82 A;  2BUG A;  4UQZ A;  5FQ8 A;  3ULE G;  5JLI A;  3B0V C;  1JCR A;  2OEX A;  1QVX A;  1OCO C;  2ZXW C;  3TK0 A;  1KZP A;  2D5R B;  5BQH A;  2WQ6 A;  3GOD A;  1D9S A;  3UM3 A;  5JP7 A;  4GTP A;  2KCK A;  4YT2 A;  1HS6 A;  3NZU A;  4TXR A;  2KK1 A;  1JAF A;  5E75 A;  1P5Q A;  4GCO A;  3ONL A;  3FHE A;  1LS1 A;  4GTV A;  4PJM A;  2B6C A;  4PFP A;  3W2V A;  4N6C A;  5CCL A;  3K6B A;  2J07 A;  3APF A;  1M57 C;  1Z7Q c;  1TYQ G;  3POV A;  5COG A;  2L6J A;  1ZHY A;  3DMD A;  4YN0 B;  4WWP A;  4XEK A;  5KBA A;  1OUV A;  3TWU A;  3L34 A;  1B89 A;  3RJV A;  3PUJ A;  3V2X A;  1MQV A;  3FTY A;  5HQ8 A;  3DKA A;  3KS2 A;  4CIP A;  3HDX A;  3R7R A;  2I1J A;  1OCR C;  4UI9 K;  2NUT A;  1WGW A;  2Q7R A;  3AAA C;  5J08 A;  3HRA A;  3KSL A;  3ZHE A;  2OEW A;  3L0I A;  2CW0 F;  4Q4Z F;  1L5J A;  4APO A;  2P9P G;  5T1D B;  1YYH A;  1OXJ A;  2AXU A;  4YL1 A;  4U5D E;  2IEJ A;  3NB2 A;  5JJ6 A;  4NUR A;  4JE9 A;  4DJ9 A;  1SYQ A;  3Q79 A;  3N24 A;  3V2O A;  3GZ1 A;  4JHR A;  4B94 A;  2XPY A;  1WM5 A;  4MS6 A;  4GU5 A;  1NZE A;  1Q0K A;  4LDK A;  4FWV A;  2L0I A;  5DBK A;  2J4D A;  1ZBP A;  1BU9 A;  3E30 A;  5KYX B;  1Y8M A;  3HNK A;  3EJN A;  2PQR A;  1ZZP A;  3BG0 B;  4KZC A;  2KC7 A;  2IO3 C;  4WWO A;  3PZD A;  2P6V A;  3DJN B;  4NRH B;  5C1D A;  3HVE A;  3WAQ A;  1U3D A;  4MKT A;  4JVS A;  4JC8 A;  1HMO A;  4X0R A;  3C18 A;  4CSA A;  1OW6 A;  1SW6 A;  2NXP A;  4BY6 A;  1MYO A;  4HBD A;  4ABN A;  1U3C A;  1BZ4 A;  1SF8 A;  3TG5 A;  1Q0G A;  1MX4 A;  4URK A;  1GS9 A;  3PUK A;  4MQ9 F;  3T9K A;  4GZ5 A;  3TL5 A;  3U9W A;  1QPU A;  4BJT A;  3CSF A;  4GA1 A;  4N5C A;  2J45 A;  3ZTM A;  5FQ6 A;  2LP4 A;  2GFH A;  5B3S C;  4GQH A;  4GA0 A;  4MVU A;  4CZ2 D;  4G23 A;  2QNL A;  4JHJ A;  3JSE O;  1V55 E;  3NRH A;  3I4R B;  1BR1 A;  4XZ4 A;  5CEA A;  2C0L A;  2X6J A;  3HXF A;  4I6J A;  4EBA A;  3C72 A;  1ZB1 A;  5T3R A;  4PFO A;  2A4Z A;  5G04 C;  2V3C C;  1FMV A;  1H6P A;  3SD5 A;  2QY7 A;  1ZU2 A;  2HE0 A;  3MKQ A;  2LAH A;  2LNI A;  3ZKJ A;  1Z3X A;  3K7D A;  3EGD B;  2P9K G;  3HHM A;  4CS9 C;  2CHX A;  3UIP C;  4PS7 A;  4FJY A;  1TWC A;  3EZH A;  4J6I A;  3AG1 E;  4RQI A;  1CPQ A;  5COM A;  2WQH A;  3RQF A;  4J32 B;  4NQF A;  4IRU A;  3R7C A;  3SZ7 A;  3MYV A;  5EX3 A;  4A3V A;  2LD6 A;  2WVQ A;  1FCH A;  3O48 A;  4OVU A;  3ZQY A;  4MW8 A;  2RD9 A;  4LNG A;  2XLH A;  4EZJ A;  3TWW A;  5A23 A;  2R7R A;  4JHK A;  1AUE A;  2ZXO A;  5LCW J;  3IEG A;  5KYW A;  2I1K A;  4MVS A;  1LIH A;  5HS0 A;  3FAJ A;  2Y39 A;  5CMY A;  2OJQ A;  3HLZ A;  3UUX A;  4WAF A;  1E8Y A;  3VTX A;  1QLE C;  2KZT B;  4HNA D;  2WQ7 A;  1WG0 A;  3EQL F;  1WN0 A;  5EK0 A;  2VQ2 A;  3FUL A;  4U04 A;  5DS5 A;  3KD7 A;  3TWV A;  2DB4 A;  2IXN A;  2LSE A;  1N0Q A;  4HLE A;  4DLQ A;  4WND A;  4CGW A;  2IBF A;  5AQ9 A;  5L0C A;  3IV0 A;  2XS1 A;  4FES A;  4BJ5 C;  1D8D A;  4XPW A;  1MX2 A;  4IGG A;  1E86 A;  1LI7 A;  4L1B A;  3SYN A;  1T5O A;  5AQ7 A;  5KYU B;  4N6H A;  3S9O A;  3ZWI A;  2J9V A;  4G7O F;  2WXG A;  2WXN A;  3FFL A;  2QY9 A;  3NQP A;  2UUI A;  1E8W A;  3FOP A;  1KU2 A;  3B7B A;  4KXK B;  1SZ9 A;  3FH5 A;  4WAB A;  3AG4 E;  4LUN U;  2AWI A;  2ETA A;  5AJL A;  2AU5 A;  3CIA A;  2F37 A;  5G55 A;  5E3A A;  3FHD A;  3SXY A;  3ABK E;  2CNW A;  2PP4 A;  4U9E A;  3GM1 A;  4JC7 A;  5JJT A;  3GZS A;  4HOQ A;  3L16 A;  4FHK A;  1SMY F;  4K5A B;  2E2E A;  3BEH A;  4DXW A;  4HOU A;  3E9V A;  2F8X K;  1I4Z A;  2I2O A;  1VOM A;  3C8G B;  2GA0 A;  2VGY A;  2J7P D;  2IQC A;  2UY1 A;  1KNY A;  2XPI A;  4HFF B;  4MBG A;  3CAX A;  4YDE A;  2EPM X;  2NC9 A;  5LFA A;  2HR2 A;  4NC3 A;  3CHQ A;  3VM6 A;  3DXK G;  4BER A;  1YDI A;  3DM5 A;  5LX8 A;  1S64 A;  4J7Y A;  1MX6 A;  2Y3G A;  4YT8 A;  3CLJ A;  4A2N B;  2Q4F A;  1LKX A;  1V55 C;  5DVW A;  3MZL B;  4WNE A;  1A7D A;  3FU5 A;  3ATP A;  3PDM P;  3BEE A;  2BKG A;  2C04 A;  1XWJ A;  2Y3H A;  5KJM A;  1WY6 A;  1EF1 C;  3NKD A;  5ANR A;  4E17 A;  1UFB A;  2IJG X;  4ZFH A;  2P7V A;  3UMV A;  2NG1 A;  1M6T A;  3Q73 A;  2P0N A;  2OU6 A;  2VB6 A;  3BU8 A;  4HB5 A;  4J8F A;  3SBT B;  4DPR A;  1OCC C;  4K0D A;  2G3V A;  3WOD F;  3L13 A;  2EIN E;  4U8Y D;  3AOU A;  5A6K A;  4Q94 A;  4ANW A;  4GEH A;  1J8M F;  2WZL A;  1O1S A;  3ZYK A;  4LAC B;  4YL3 A;  2MYO A;  1TN6 A;  4JA7 A;  4AIF A;  3CV0 A;  2OND A;  1QZX A;  3U0C A;  3FUE A;  3CKC A;  4AM9 A;  1E7U A;  3MA5 A;  3UPV A;  4OIP F;  4I1M A;  1MZC A;  4AP2 A;  5CI8 A;  3V5Y A;  2YLD A;  5C2Y A;  4WJ0 A;  4ILG A;  3VYW A;  4GZ3 A;  4C3D A;  4N3B A;  3S29 A;  2W45 A;  2A5U A;  4ILI A;  2XEN A;  1NFO A;  1FPP A;  4HEA J;  2EIK C;  1LD7 A;  3UIN C;  3X2Q E;  5AGF A;  3RF3 A;  2ION A;  4P6I C;  1EQ1 A;  3ZXP A;  5BXO A;  3FUD A;  4CDY A;  1HY5 A;  3DSS A;  5EN5 D;  4J0U A;  1NBB A;  4QI2 A;  5T8I A;  5EYP F;  3URZ A;  1OQC A;  2KJG A;  1EYH A;  3LEV A;  3TJ5 A;  3OTN A;  2M4E A;  1OCZ C;  3P1U A;  5CBO A;  4DBR A;  2RSE B;  3DZA A;  3PS6 A;  2LXM A;  2VGX B;  2DYS C;  2WXM A;  2IF4 A;  3SFX A;  5E76 A;  3U4T A;  3AU5 A;  4JZA A;  2X6I A;  3T8M A;  4MS2 A;  3DEO A;  3W9G A;  4XTK A;  4Q5S F;  4UI9 C;  1NSG B;  2Y4U A;  1Y6D A;  2H6F A;  3E4B A;  3FP3 A;  3T5X A;  3T4R A;  3HXC A;  4DX6 D;  5AJD A;  2R02 A;  2J49 A;  2PM6 A;  1PY1 A;  4PK4 A;  2XGO A;  1TWG A;  4X8Q A;  3SO8 A;  3EFO A;  3RO3 A;  3FEY A;  3RSE G;  5BNW A;  4HOS A;  4UQX A;  3GW4 A;  3LJ3 A;  3KSQ A;  4FLH A;  4I43 A;  3N0T A;  2R7S A;  3GZ2 A;  4WUY A;  3O6X A;  1DNP A;  4GTQ A;  2KSF A;  3JYH A;  3KKB A;  5IY5 C;  3LNM B;  3V31 A;  3EDT B;  4OYS A;  4GPM A;  2WVI A;  3U5S A;  4CS8 A;  2GRN B;  3FU3 A;  1Y6I A;  1N95 A;  4NIK A;  5FWQ A;  4RBN A;  2OV8 A;  4RD9 A;  3JSZ A;  3CR3 A;  5DLJ A;  4EQF A;  3BRJ A;  4KC9 A;  4N3A A;  1LM3 B;  4J8E A; 
#chains in the Genus database with same CATH homology
 3EH1 A;  3KL4 A;  4FLB A;  4IWB A;  3FH8 A;  5FT9 A;  3G2T A;  1VYI A;  4TRQ A;  1XGW A;  5BW8 C;  1FVF A;  3FWV A;  3G2V A;  3LXU X;  4GYO A;  4U5E E;  5B1A C;  2XEV A;  3LS1 A;  4ANV A;  3KMI A;  2XGM A;  1E8X A;  2LSU A;  4O6N A;  3Q47 B;  4CEM A;  5KYY B;  1OWN A;  4FA6 A;  2KW3 C;  1VYK A;  1NG1 A;  3LDZ A;  4FX5 A;  5DQZ A;  3LS8 A;  4PS8 A;  3LYA A;  3SF4 A;  4E7S A;  1FMW A;  3OA1 A;  4OD5 A;  4ILH B;  3SHF A;  3PDN A;  3PNL B;  1D1C A;  3FDQ A;  4UQY A;  3QJZ A;  3PHF 2;  3F47 A;  1HX8 A;  4OIQ F;  5EX0 A;  4XE0 A;  4YT4 A;  2VYI A;  3RK6 A;  3D9J A;  2XCC A;  3TAX A;  2EIL C;  3IKO B;  4I44 A;  1H2T C;  3QWW A;  3BG1 B;  5B1B C;  3LCA A;  4CT4 A;  3VTY A;  4HVB A;  1KT0 A;  4WNG A;  4ANJ A;  4W8K A;  4ZLD A;  3E70 C;  3S2A A;  4OD4 A;  2CDQ A;  4B0Z A;  2CG2 A;  3IHY A;  1TJC A;  3SNX A;  4BX9 A;  1XNF A;  3FUK A;  2CFZ A;  4G11 A;  3ASD A;  3QOU A;  3RU0 A;  4I1O B;  3Q7L A;  4MND A;  5G04 J;  3K9I A;  4M63 A;  3T6J A;  3EG9 B;  2PZI A;  4C0E A;  4UWG A;  1Z6T A;  1RJ9 A;  5LOZ A;  5D91 A;  3RYL A;  2Q9B A;  4DBQ A;  3FUN A;  3N2Z B;  3SFZ A;  4AOF A;  3TD7 A;  3CKB A;  1E90 A;  4JPS A;  3JYS A;  1MMG A;  3LEW A;  1H19 A;  3SZR A;  3TXN A;  3WXX A;  1OWM A;  4XKB A;  2I8B A;  2GRM A;  2MRI A;  4I9C A;  4IUL A;  3S7F A;  1KLX A;  2C2L A;  3JQ1 A;  4A55 A;  2J9Q A;  4ULW A;  3G2U A;  3SGH A;  4JZY A;  3EZI A;  2XGS A;  2JLB A;  4I6G A;  2BF0 X;  2PM7 A;  3FUJ A;  3AG3 C;  2XQ0 A;  3QNK A;  3AG2 C;  3DD7 A;  1IYG A;  1A17 A;  2GGF A;  1ST6 A;  2YEV A;  3ZHE B;  2C0M A;  3L17 A;  3N71 A;  1H6K A;  3EH2 A;  3FVY A;  1HG5 A;  1HU3 A;  5BUO A;  3QAQ A;  4CIH A;  1HG2 A;  4RVB A;  1JPJ A;  1ELK A;  2MYS A;  5E2Q A;  2R7V A;  1VK5 A;  5KYX A;  3B7U X;  3ZFW A;  4BEJ A;  1KT1 A;  4DI3 A;  3KAE A;  2L9J A;  2KCV A;  1JWF A;  2WMN A;  3CGH A;  3HVE B;  4C7O A;  1M2V B;  4O7G A;  5D0Q D;  3H65 A;  4N3C A;  3EGX A;  2R7T A;  3D3M A;  4HFK B;  3FUH A;  3JQ0 A;  2AXZ A;  3UGO A;  1FTS A;  3TG4 A;  5DS6 A;  4KI2 A;  2H7O A;  3ENE A;  5DS4 A;  3PE4 A;  3S7J A;  3FEX A;  1QZ2 A;  4K0R A;  2L81 A;  3I4U A;  3FY4 A;  4L2Y A;  4D10 C;  3ULQ A;  4J8S A;  2OG2 A;  5BV1 A;  4OIR F;  4RG9 A;  1H2U A;  2Y3A A;  4NQ0 A;  2R7O A;  3FU6 A;  4JUR I;  4BTB A;  3K1I C;  3L08 A;  3LAY A;  1NP7 A;  4C3B A;  4BSX A;  2KGO A;  1ZHZ A;  4AXH A;  1LF8 A;  1PCX A;  5EHH A;  1ELR A;  3S27 A;  4DVY P;  5AEN A;  3APD A;  1ZU5 A;  4I3M A;  2R59 A;  3D9M A;  4WWN A;  4FAD A;  1W2W A;  2XRH A;  3DBS A;  4DOZ A;  4LRZ A;  3ZVR A;  3ML9 A;  4AE4 B;  1TWH A;  2H7V C;  3MCX A;  5LP0 A;  3JT1 A;  4E6H A;  4XX5 A;  1INZ A;  3APC A;  1ZYR F;  2B0J A;  1HE8 A;  1IQR A;  4YT5 A;  3ZEF A;  3D9N A;  3QWV A;  1G8X A;  2PX3 A;  1UG3 A;  3R7Q A;  3NF1 A;  3S0X A;  1H0A A;  5CCM A;  2XL4 A;  1BR2 A;  4HFG A;  3Q5M A;  4OIN F;  2JD3 A;  5CI9 A;  1ELW A;  3W8I A;  3RIP A;  3L54 A;  4U5H A;  1MQS A;  4L2L A;  2J4B A;  3ZIB A;  4ZLC A;  3MX3 A;  5ANL A;  5JHA A;  3EIQ C;  2H7B A;  2FUL A;  3HIZ A;  2LAI A;  4N2Q A;  2WB7 A;  1TEZ A;  4AV7 A;  3ZIM A;  4YJW A;  4IJJ A;  3ABM C;  3Q6N A;  5F5F A;  3K1H A;  2XXA B;  5L3V A;  1MNE A;  3UR3 C;  3UNG C;  2VTB B;  3PE3 A;  4U8H A;  4GZC A;  4NY3 A;  4ACL A;  3CZ6 A;  3RO2 A;  2L9B A;  1FFT C;  2G62 A;  2Y3D A;  3LY8 A;  3QK0 A;  1EDU A;  2EIM C;  3D9I A;  4FC8 A;  3D9K A;  2WXL A;  2KQ9 A;  2ZPA A;  2NSZ A;  4N06 A;  4KZ0 A;  5ARF A;  1V54 C;  4HE8 D;  1MMN A;  4G7Z F;  2AW6 A;  4TV3 A;  3MV2 B;  3QAR A;  4M3O A;  4DK5 A;  4G24 A;  3PRE A;  3ZC4 A;  4PDX A;  4I9E A;  3VLE A;  3CHP A;  2RD0 A;  3EHN A;  3Q6M A;  2VSN A;  2YHC A;  2IU1 A;  1D1A A;  2E0I A;  1PD0 A;  4OIO F;  2WL8 A;  1HH8 A;  2NUT B;  3T5V A;  2Q7F A;  2V4L A;  2L0T B;  4AK9 A;  2FEZ A;  2VSO E;  1D0Y A;  1E96 B;  3M1C B;  4G25 A;  3B13 A;  4PJN A;  4I2W A;  5KCM A;  3DXJ F;  3LY9 A;  2Y4T A;  3PH0 C;  1O87 A;  3AG4 C;  1IHG A;  3Q7G A;  3NKE A;  4UWF A;  4KYO B;  4JEH A;  4U5C E;  4C9B B;  2JEK A;  1UW4 B;  2WM9 A;  2WPV A;  4JXT A;  3G2W A;  5KJL A;  1FFH A;  4C3E A;  3UQ3 A;  3D9O A;  4G7H F;  2V0P A;  3QC1 A;  3CVP A;  5FCL A;  3C98 A;  3JUI A;  2EIN C;  2PL2 A;  5ARG A;  5BT1 A;  2WXF A;  2NUP A;  3S7D A;  1LVK A;  3I3N A;  4QDL A;  3UGP A;  4O6F A;  4BJ1 A;  4GZ6 A;  3GAN A;  4KMO A;  3CVQ A;  2Y69 C;  3UT4 A;  4GA2 A;  2QTV A;  3ZYM A;  4W9R A;  3FTS A;  4J8D A;  4PJJ A;  4Y6C A;  4U63 A;  2FO7 A;  1VDY A;  2WXO A;  4U0S A;  2XRY A;  3EFO B;  3ZPJ A;  4G1T A;  2Z15 A;  5JHB A;  4U0U A;  5FTP A;  3B7R L;  4CGV A;  4HOT A;  4ATG A;  4QI0 A;  4O6Y A;  5AYW D;  4BJ6 A;  4FP7 A;  3NG1 A;  3RH3 A;  2R7U A;  3VLD A;  4HOR A;  1TWA A;  4BG0 A;  4BT9 A;  4DLO A;  3FTX A;  2J9U A;  1D1B A;  5G2N A;  2CHZ A;  3ESL A;  4L7T A;  1HFA A;  3IHV A;  3ZYQ A;  1QNF A;  4WNF A;  5EKQ D;  2WXQ A;  3QMK A;  3TXM A;  2P58 C;  3LS0 A;  4XKC A;  2XPZ A;  5D92 A;  5D0O D;  2IOQ A;  3V7O A;  5ENN A;  1O5H A;  1TKN A;  5AIJ A;  3CVV A;  3B0U X;  3CQG B;  5KYY A;  1BPO A;  4RSY A;  3SNH A;  2KZT A;  3Q49 B;  3ZYL A;  3MKQ B;  2A68 F;  3X1O A;  2VSY A;  3AS5 A;  4IN3 B;  4RG6 A;  5FJY A;  3EGD A;  1NA0 A;  3D9P A;  1J8Y F;  2YZS A;  2KNH A;  4LER A;  3B7T A;  1E7V A;  1OKK A;  3IBE A;  3ASG A;  2ILR A;  4BJ6 C;  3WG7 C;  3SBS A;  4LLE A;  3CSK A;  3IEE A;  2X6H A;  3KEZ A;  4PJL A;  4U5B E;  2GW1 A;  3KH2 A;  3LLI A;  2V26 A;  3AS4 A;  4E7Z A;  1W3B A;  3AQB A;  2YNQ A;  1NU9 C;  4F4B A;  1MMD A;  4MRU A;  2YHS A;  3ZG1 A;  2HM8 A;  4YWQ A;  3UX4 A;  4JJF A;  2J08 A;  4K03 A;  2UY1 B;  1JWG A;  1HF8 A;  4GAA A;  3MKR A;  3ASH A;  2AXV A;  3EG9 A;  2QFC A;  3ZN3 A;  3SI5 A;  4F3V A;  4GPK A;  1HXI A;  3QKY A;  3CVU A;  3PVL A;  5KYU A;  3MV3 B;  4KT6 B;  1PD1 A;  2WXR A;  4QFV A;  2KAT A;  2WVO A;  1X5B A;  2I9C A;  3AQC A;  4IAO A;  1GW6 A;  4EZK A;  2HV6 A;  3RIB A;  3EIJ A;  3CQC B;  1SZA A;  1NU7 D;  4DVZ A;  3L6A A;  1E8Z A;  1Z5Z A;  1M56 C;  4J30 B;  1OKK D;  4Q96 A;  2CFU A;  3NYL A;  2J09 A;  2FGY A;  4BX8 A;  3ITF A;  1EPU A;  3FTW A;  4XIF A;  1JPL A;  5BPP A;  4K7B A;  1H2V C;  2GRL A;  4CRW A;  1HO8 A;  3I5Q A;  3CHM A;  1MHQ A;  4GYW A;  4JA9 A;  2MHK A;  1DVP A;  4EBA G;  1N54 A;  2HV7 A;  4XI0 A;  5M72 A;  3RRM B;  3FTU A;  3DM9 B;  3OAW A;  1M2O A;  1JPN A;  4O6M A;  2HYZ A;  2IOS A;  5EGY A;  3LVR E;  4GZD A;  1ZU4 A;  5A6C A;  4I17 A;  4U07 A;  4Y6W A;  3PRZ A;  3UMI A;  3SEO A;  4GB9 A;  4FU3 A;  4DJA A;  5KJN A;  2MWQ A;  4YND A;  3NDB B;  2VH3 A;  4GCN A;  4O79 A;  4G0H A;  1D0X A;  2W4B A;  1IZM A;  3OEO A;  4C7O B;  1Z23 A;  1QQE A;  4KBQ A;  5CMW A;  5JJ7 A;  3P2B A;  3RFY A;  1UN8 A;  2EIJ C;  3EGX B;  2PF4 E;  4CSA C;  1Z3Y A;  4XLP F;  3TJP A;  2J0X A;  5G05 J;  4KNW A;  2WZG A;  4ME2 A;  4U5F E;  2YQ8 A;  2KM4 A;  5J90 A;  3ZVV A;  1SZI A;  4C0M A;  4YVO A;  4BTA A;  1OWL A;  2OVB A;  5KYN A;  1IW7 F;  2Q3T A;  2BE5 F;  3DPD A;  4Q7C A;  3OWT A;  3RRN B;  1NA3 A;  4IYP A;  4B6I A;  3S28 A;  2XHE A;  1Z3I X;  2CG3 A;  1UJK A;  2X38 A;  3NZS A;  3CVY A;  1PAQ A;  4EZL A;  1S0P A;  2RG8 A;  3I4G A;  4B8A A;  1D0Z A;  3W2W A;  1ZHW A;  5BUZ A;  3Q4A B;  2FBN A;  1S7Z A;  2I6H A;  3CHO A;  3AG1 C;  3JCK C;  2IXP A;  4FUL A;  3R9A B;  3Q15 A;  1VMA A;  2VSX E;  2V5F A;  2A69 F;  4F1S A;  2WXH A;  3CVX A;  4XWJ A;  4H7Y A;  4CCA A;  3G2S A;  2X51 A;  2DYR C;  3RKO F;  5DQT A;  4PS3 A;  2UWJ G;  4P29 A;  4R7L A;  2A6E F;  3VAY A;  4CBE A;  4RDA A;  3JCU Q;  3RKV A;  1PC2 A;  1MMA A;  3K33 A;  3CVW A;  1NZN A;  4UI9 J;  2G3K A;  4PUC A;  2WZF A;  2OVF A;  5CHE E;  3ZRH A;  4JJG A;  2PX0 A;  5KYW B;  3B9Q A;  4NAC A;  4DI4 A;  3SP1 A;  2Q9A A;  2VJ8 A;  4CT0 A;  3U66 A;  2J0W A;  4HS2 A;  4CDM A;  3CK7 A;  4MLP A;  3D9L A;  2LSV A;  2E87 A;  5T3T A;  4AJW A;  2CHW A;  2WMO A;  3UT8 A;  1YA0 A;  1MND A;  4AY6 A;  3LPZ A;  2C03 A;  4BWR A;  4N39 A;  3PMR A;  2WXK A;  2VTB A;  3ONK A;  3FUM A;  1RJ9 B;  4BJ5 A;  5E33 A;  2J7P A;  3AS8 A;  3VLF A;  3CVL A;  1TR2 A;  2O9X A;  4H7X A;  4LCT A;  3ASO C;  4AX2 A;  3HYM B;  3B7S A;  2DCP A;  2FF4 A;  5T3W A;  3T6B A;  4ACK A;  5DIZ A;  3CK8 A;  1FVH A;  4I1A A;  3HJC A;  4CS7 A;  4KNV A;  4LEU A;  2YHE A;  4U0Z A;  4BT8 A;  4AVX A;  2CNW D;  3O39 A;  2J46 A;  4EPZ A;  4XLN F;  5E3C A;  3ML8 A;  3X2Q C;  3PNT B;  3ZSU A;  5BV0 A;  4B8C B;  3CQZ A;  3CHS A;  2R7W A;  3ESK A;  3FTZ A;  4AEZ C;  2PQN A;  3PEV B;  3LVQ E;  3ASN C;  1WAO 1;  2MOW A;  2IXO A;  4G26 A;  3LLK A;  2X6F A;  1N52 A;  4Q69 A;  2R5S A;  3LY7 A;  2M63 A;  1Z6A A;  4EBB A;  4I2Z A;  4HXI A;  1OWO A;  2A6H F;  3ZW3 A;  2IXM A;  2DBA A;  2IFU A;  5T4Y A;  4A3T A;  1M2V A;  2DGJ A;  2V8S E;  3OXL A;  2NUP B;  4UWK A;  2WB2 A;  5FZS A;  3JRT A;  3S7B A;  2KCL A;  3LES A;  1ZHX A;  4CS9 A;  3FTV A;  3CEQ A;  4GYT A;  3LKU A;  2PFD A;  1Z63 A;  4UWH A;  2R17 C;  4CDN A;  4FHJ A;  2ZXR A;  2FFH A;  3PEU B;  2VGX A;  4ANU A;  2OCC C;  5FZR A;  4H4K C;  2CGE A;  2WVN A;  4E85 A;  3L22 A;  2XSE A;  3ABL C;  4FJZ A;  3O4Z A;  2A1D D;  3U64 A;  3EPV A;  3DAF A;  3TGO A;  5L3Q A;  2W9Y A;  4JCH A;  3LJB A;  4L23 A;  3ABK C;  2Q9C A;  2XRZ A;  2X6K A;  4CDR A;  2XCB A;  4AY5 A;  2HO1 A;  3OXF A;  3ECS A;  5HSW A;  3FH7 A;  5F5H A;  5A7D B;  4AE4 A;  4CS8 C;  3CST A;  3ZGQ A;  3HTK C;  3QWP A;  4YVQ C;  4F53 A;  3B0P A;  4TUU A;  5FQ4 A;  2BTD A;  3MLG A;  2VAS A;  3ASF A;  1IQU A;  3QB2 A;  3W8H A;  4I6E A;  1UN9 A;  2YIN A;  2FI7 A;  4APF A;  4JW1 A;  2WXI A;  4G2V A;  3FU0 A;  1N1C A;  1JUQ A;  4BFR A;  3UMK A;  2DIW A;  4JEU A;  3ZXS A;  3OXG A;  5LCW C;  4A1S A;  2WXJ A;  5FZQ A;  5KJK A;  4KVO A;  3I5P A;  3GYZ A;  4V3I A;  1BR4 A;  4KBL A;  2ZU6 B;  2R7X A;  4XI9 A;  3CVN A;  3CK9 A;  1HZ4 A;  3NYM A;  2ZXP A;  4A1G A;  3MJW A;  3MGB A;  4U5G A;  3QZC A;  3UMH A;  2LO6 A;  3AU4 A;  4N2S A;  4ANX A;  4EEC A;  3LNR A;  4GYY A;  3EHM A;  3FUI A;  3F46 A;  2J9W A;  3MEK A;  4EWC A;  2X3M A;  4KVM A;  3FUF A;  1UJJ A;  1ZHT A;  4B89 A;  1TJF A;  3NYJ A;  3U3W A;  5HI7 A;  3UT7 A;  3FDH A;  5FQ7 A;  2IYL D;  2OOE A;  4GML A;  4LLC A;  2WXP A;  2Y3B A;  4F7A A;  3DJU B;  2EQX A;  4OVV A;  4GMJ A;  4UWL A;  4JL0 A;  5EDS A;  2R7Q A;  2W4M A;  3DAG A;  4PH4 B;  2XXA A;  3CHR A;  1SQM A;  3QDN A;  2AVP A;  5G05 C;  3K66 A;  1OWP A;  3RRU A;  2IOL A;  2BUG A;  4UQZ A;  5FQ8 A;  3B0V C;  1OCO C;  2ZXW C;  2D5R B;  2WQ6 A;  3GOD A;  2KCK A;  4YT2 A;  1HS6 A;  3NZU A;  5E75 A;  1P5Q A;  4GCO A;  3ONL A;  3FHE A;  1LS1 A;  4PJM A;  4PFP A;  3W2V A;  5CCL A;  3K6B A;  2J07 A;  3APF A;  1M57 C;  3POV A;  2L6J A;  1ZHY A;  3DMD A;  4YN0 B;  4WWP A;  1OUV A;  3L34 A;  1B89 A;  3RJV A;  3PUJ A;  3FTY A;  5HQ8 A;  3KS2 A;  3HDX A;  3R7R A;  2I1J A;  1OCR C;  4UI9 K;  2NUT A;  1WGW A;  5J08 A;  3ZHE A;  3L0I A;  2CW0 F;  4Q4Z F;  1L5J A;  4APO A;  5T1D B;  2AXU A;  4U5D E;  5JJ6 A;  4NUR A;  3N24 A;  3GZ1 A;  4JHR A;  4B94 A;  2XPY A;  1WM5 A;  4MS6 A;  4GU5 A;  1NZE A;  4FWV A;  2L0I A;  5DBK A;  2J4D A;  1ZBP A;  5KYX B;  1Y8M A;  3EJN A;  2PQR A;  4KZC A;  3BG0 B;  2KC7 A;  4WWO A;  3PZD A;  2P6V A;  3DJN B;  4NRH B;  5C1D A;  3HVE A;  4MKT A;  1U3D A;  4JVS A;  4JC8 A;  4X0R A;  4CSA A;  2NXP A;  4BY6 A;  4ABN A;  1U3C A;  3TG5 A;  1SF8 A;  4URK A;  3PUK A;  4MQ9 F;  4GZ5 A;  3TL5 A;  3U9W A;  4BJT A;  3CSF A;  4GA1 A;  4N5C A;  2J45 A;  5FQ6 A;  2GFH A;  5B3S C;  4GA0 A;  4G23 A;  4JHJ A;  3NRH A;  3I4R B;  1BR1 A;  4XZ4 A;  2C0L A;  2X6J A;  4I6J A;  4EBA A;  5T3R A;  4PFO A;  2A4Z A;  5G04 C;  2V3C C;  1FMV A;  3SD5 A;  2QY7 A;  1ZU2 A;  3MKQ A;  2LAH A;  2LNI A;  1Z3X A;  3K7D A;  3EGD B;  3HHM A;  4CS9 C;  2CHX A;  4PS7 A;  4FJY A;  1TWC A;  3EZH A;  4J6I A;  2WQH A;  4J32 B;  4IRU A;  3SZ7 A;  3MYV A;  5EX3 A;  4A3V A;  2WVQ A;  1FCH A;  3O48 A;  4OVU A;  4EZJ A;  5A23 A;  2R7R A;  4JHK A;  2ZXO A;  5LCW J;  3IEG A;  5KYW A;  2I1K A;  3FAJ A;  2Y39 A;  5CMY A;  3HLZ A;  3UUX A;  4WAF A;  1E8Y A;  3VTX A;  1QLE C;  2KZT B;  2WQ7 A;  3EQL F;  2VQ2 A;  3FUL A;  4U04 A;  5DS5 A;  3KD7 A;  4HLE A;  2IXN A;  2LSE A;  4DLQ A;  4WND A;  4CGW A;  3IV0 A;  4FES A;  4BJ5 C;  4L1B A;  3SYN A;  5KYU B;  2J9V A;  4G7O F;  2WXG A;  2WXN A;  3FFL A;  2QY9 A;  3NQP A;  1E8W A;  1KU2 A;  4KXK B;  1SZ9 A;  3FH5 A;  4LUN U;  2AWI A;  5AJL A;  3CIA A;  5G55 A;  5E3A A;  3FHD A;  2CNW A;  2PP4 A;  5JJT A;  3GZS A;  4HOQ A;  3L16 A;  4FHK A;  1SMY F;  2E2E A;  4HOU A;  3E9V A;  2I2O A;  1VOM A;  2VGY A;  2J7P D;  2IQC A;  2UY1 A;  2XPI A;  4HFF B;  2NC9 A;  5LFA A;  2HR2 A;  3CHQ A;  3DM5 A;  5LX8 A;  2Y3G A;  4YT8 A;  3CLJ A;  4A2N B;  1LKX A;  1V55 C;  5DVW A;  3MZL B;  4WNE A;  3FU5 A;  3BEE A;  2C04 A;  2Y3H A;  5KJM A;  1WY6 A;  1EF1 C;  3NKD A;  5ANR A;  2IJG X;  2P7V A;  3UMV A;  2NG1 A;  2VB6 A;  4J8F A;  3SBT B;  4DPR A;  1OCC C;  4K0D A;  2G3V A;  3WOD F;  3L13 A;  4Q94 A;  4ANW A;  4GEH A;  1J8M F;  2WZL A;  3ZYK A;  4LAC B;  4JA7 A;  4AIF A;  3CV0 A;  2OND A;  1QZX A;  3FUE A;  3CKC A;  4AM9 A;  1E7U A;  3MA5 A;  3UPV A;  4OIP F;  4I1M A;  4AP2 A;  5CI8 A;  5C2Y A;  4WJ0 A;  4ILG A;  3VYW A;  4GZ3 A;  4C3D A;  4N3B A;  3S29 A;  2W45 A;  2A5U A;  4ILI A;  4HEA J;  2EIK C;  2ION A;  4P6I C;  3FUD A;  4J0U A;  4QI2 A;  5T8I A;  3URZ A;  2KJG A;  1EYH A;  3LEV A;  3OTN A;  2M4E A;  1OCZ C;  3P1U A;  4DBR A;  3PS6 A;  3DZA A;  2VGX B;  2DYS C;  2WXM A;  2IF4 A;  5E76 A;  3U4T A;  3AU5 A;  4JZA A;  2X6I A;  3T8M A;  4XTK A;  4Q5S F;  4UI9 C;  2Y4U A;  3E4B A;  3FP3 A;  3T5X A;  3T4R A;  5AJD A;  2J49 A;  2PM6 A;  1PY1 A;  4PK4 A;  2XGO A;  1TWG A;  3EFO A;  3RO3 A;  3FEY A;  5BNW A;  4HOS A;  4UQX A;  3GW4 A;  3LJ3 A;  4FLH A;  4I43 A;  3N0T A;  2R7S A;  3GZ2 A;  4WUY A;  3O6X A;  1DNP A;  3JYH A;  3KKB A;  5IY5 C;  3EDT B;  4OYS A;  2WVI A;  4CS8 A;  3FU3 A;  1Y6I A;  5FWQ A;  4RBN A;  2OV8 A;  4RD9 A;  3JSZ A;  3CR3 A;  5DLJ A;  4EQF A;  4KC9 A;  4N3A A;  4J8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...