4LERA

Crystal structure of a putative outer membrane protein, probably involved in nutrient binding (bvu_1254) from bacteroides vulgatus atcc 8482 at 1.42 a resolution
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
457
structure length
457
Chain Sequence
b'TNPSLLLTGVAYSAFNQTSSDACHAAKMLILTSGESKYQVYKWTRGDFDYYSNLRDVTKMSEEAGEGSAYQALAHFFRANYFYQLTLDFGSIPYTDALKAETDANYQPAYDSQEVVLAGILKELEEADKMLEGSDEIISGDIIYNGNLVNWRKLINAYRLRILMSLSGKEKVGDIDVKSEFSKIVADGPLMESLSDNGQLIYLDQQDNRYPYFNDSDFGSGRFMDSTYIAELATRQDPRLFAVATQTPNAEKAGKAINDFSSYDGGDPAVPYSLVNDKAVAGNCSKPAPRYYQTPTNEPMVLLGYVEQQLILAEAVVRGWIQGDDKIYYESAVKASFEFYQKYAVSVADYLTQDAAAEYLRNDKVAYSSSLSTDEKIERIIMQKYLPTFLQGSVWLPYYEALRTGYPDFRRAAGVSLPYRWMYPQDEYNNNATHVEAALNEQFGGSDKTSDKPWWLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative outer membrane protein, probably involved in nutrie
publication title Crystal structure of a putative outer membrane protein, probably involved in nutrient binding (BVU_1254) from Bacteroides vulgatus ATCC 8482 at 1.42 A resolution
rcsb
source organism Bacteroides vulgatus
molecule tags Sugar binding protein
total genus 174
structure length 457
sequence length 457
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12771 SusD-like_2 Starch-binding associating with outer membrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4lerA03
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4lerA01
3EHMA 3MCXA 3OTNA 5FQ4A 3MYVA 5FQ6A 4MRUA 5FQ7A 3JQ1A 3CKBA 3IV0A 3FDHA 5E75A 3JYSA 3JQ0A 5FQ8A 4PUCA 4L7TA 3L22A 3SNXA 5LX8A 3CK8A 3EHNA 3HDXA 3GZSA 3CGHA 3KEZA 4LERA 5E76A 5T4YA 3I4GA 4F7AA 5T3RA 3CK9A 4Q69A 3EJNA 3LEWA 3CK7A 3QNKA 3SGHA 3NQPA 3CKCA 3MX3A 5J90A 4F53A 3P1UA
chains in the Genus database with same CATH superfamily
4HVBA 4MRUA 4F1SA 3T6BA 1CGOA 4ATZD 3UM2A 1Z23A 2YLGA 4BERA 2J7PD 4OVUA 1LD8A 1RZ4A 2I6HA 3FTVA 3SNXA 3FTUA 1E85A 2GROB 3OA1A 4JXTA 5JJ6A 3FUJA 1Z6TA 1NSGB 3RFYA 3EH1A 5BUZA 1OY3D 4DJAA 2XHEA 3Q7AA 3U3WA 3UINC 4BT8A 1MQVA 5CRVA 1XGWA 3AG4C 2XQ0A 3OXFA 5FWQA 3DM5A 4HRLA 4EBAG 5DS4A 4I1MA 4F1PA 2AWYA 3B7UX 4B94A 3ITFA 5KJKA 3CVQA 4B0ZA 3T6GB 3ZIBA 1DCEA 3IHVA 2YRFA 3UM3A 4EHPA 1HW1A 4CX9A 4Y6WA 4QDLA 4H54A 5GPGB 4KBLA 2HS5A 4PR9A 3GODA 5JHAA 2XPZA 2RKKA 3CEXA 3ECSA 2E0IA 1NA0A 4JEHA 5CECB 3ASDA 4KVOA 1H2TC 2LFFA 5CEAA 2Q7FA 3Q9UC 3N24A 3UM0A 2OQMA 4L23A 3POVA 2LP4A 2WXPA 2YL3A 2OVBA 3T5VA 3CHRA 2J8WA 3ASFA 3GM3A 2LXLA 2Y1LE 3PEUB 1OW8A 4OIQF 4U5FE 1MX4A 1OWOA 5A6JA 3ZTZA 2CHZA 3CKCA 2VSOE 3KKBA 3PHF2 3QK0A 2J45A 2F0YA 4I9EA 1BI8B 1YYJA 2YWAA 2H6HA 1U6HA 1Q0GA 4RD9A 2X6IA 3HJCA 5KYUA 2F37A 3DJNB 3L6AA 3X2QC 2WB7A 3SEOA 5EHHA 3RJVA 1DC2A 4BJ1A 3KAEA 3EZIA 3ZDLA 4NQFA 3LVQE 2J0XA 3SGHA 4MNDA 1S70B 3ZVRA 4AE4B 3EDTB 2F8XK 1E90A 3DSSA 3MJWA 3B0VC 1BZ4A 4G7OF 3WXXA 3FMSA 1LI7A 3DE8A 3D9IA 4PJJA 3PS6A 4LG6A 3B13A 2DGJA 4HNAD 3CSKA 3RO2A 4H4KC 5L0IA 2VC9A 3K1IC 1O1RA 2YHSA 3FU3A 2YL1A 4BJ6A 4UQYA 3QB2A 3O4ZA 2FFHA 5BQIA 2VCCA 4D10C 4UQZA 3K1IA 4DI4A 2XEEA 2WXMA 2J49A 3Q73A 5FINA 1IKND 2E2EA 3PDMP 2V4LA 3ZNGA 4PH4B 2VTBB 4ILGA 2KCLA 4EHMA 4I6GA 1WAO1 5EX0A 3B7RL 1S63A 5AGFA 4HFFB 2X6JA 2NUTB 1RJ9A 4NTFA 5JP7A 2V4HC 2OKUA 1EF1C 3CVPA 2WXFA 2I15A 3Q15A 4N39A 1N4SA 4K5CA 4FHJA 1E8ZA 2ZPAA 2WVIA 3C8ZA 2L6JA 1OCRE 3JQ0A 4U5BE 4PUCA 2NXPA 2P2CP 3MA5A 3ML9A 3FOPA 4TXQA 1VYKA 4FU3A 1VYIA 1PCXA 1SZAA 1R4TA 3I4UA 1TNUA 3LS1A 5FT9A 2QUPA 3KSLA 2X38A 2DBAA 2J08A 5ITZF 5LCWJ 3ZSUA 2CNWD 3UNGC 4CDAA 5COGA 2NSZA 5KYYB 4LCTA 2LD6A 4APOA 4ANXA 5JMND 1Q0FA 4G8LA 4BEPA 5EIDA 3K7DA 5LCWC 2L9JA 1YZCA 1OWPA 4C3BA 2PNOA 3R2PA 4IRUA 3ZRHA 1TEZA 4ULWA 2OEVA 5DVWA 1P5QA 3U8VA 4AEZC 4EWCA 4A3VA 2R02A 3EUVA 3DXMG 4LLEA 4YL1A 4FLBA 1HY5A 2CHXA 2ETSA 4XKCA 4FA6A 3E9VA 1NZNA 2MYOA 4AY5A 3ZGQA 2EPKX 4YVQC 2EINC 1K1BA 1LD7A 2X6KA 4YDOA 2HMQA 5HS0A 2PNNA 2ICWG 4Q94A 4UDVA 3EGDB 3MFNA 3HHMA 4XKBA 2P9PG 5AENA 3J06A 4G25A 3PZ2A 1QBQA 3APDA 3QWWA 4JE9A 5CMYA 1HW2A 1OKKA 3FUMA 5ENQD 3ZEFA 2JX0A 5ENTD 1INZA 3ZKJA 5JLIA 5FZSA 4NIKA 5KJLA 4WUYA 3HXCA 1ELWA 3AG4E 3FAJA 4RG6A 4AXHA 3VLFA 4OYSA 4F53A 4ANJA 3F47A 3MYVA 1HG5A 4JL0A 4WJ0A 5KYXB 3B71A 3LDZA 1KU2A 5IY5E 4ACLA 2MYSA 4BPMA 1HFAA 1ST6A 4CS8A 3JSZA 3S7DA 3ZQVA 1JWGA 1U89A 2L7AA 3ATPA 2V8SE 1E8XA 1GGQA 4RSYA 5T8IA 2NUPB 3AJIA 4MKTA 3PMRA 5F5HA 5A6AA 4DOZA 4ER9A 2WMNA 3MKQA 4Q96A 3W9GA 3NKEA 3K33A 2XLOA 4R32A 4MVUA 3CKBA 3NRHA 2EPOA 2J8SD 4CS9A 3FTZA 3ASNC 2A69F 4MTGA 3GYZA 3FU5A 3NBNB 1WDYA 4YT2A 1UOHA 3MEKA 2XENA 3DWLG 3V2XA 1BD8A 2KQ9A 3C8GB 4GQHA 2P1AA 5CI9A 5J90A 3Q9NC 4KZCA 2VCBA 3AU5A 3ENEA 3QJZA 3G50A 4GA0A 3R7RA 2XLEA 1RW2A 1OCCC 3T8MA 3X2QE 4I9CA 2V0PA 5FIOA 1J8MF 3TG4A 3QTHA 3C72A 3AS4A 1YVIA 5FZRA 4KC9A 2KZTA 3Q7GA 2B0JA 4X8QA 2LO6A 2IEJA 2AXZA 5DIZA 3U4TA 3TULA 1JUQA 1BPOA 4M7CA 4DX7D 4J8FA 2WXHA 3SY2A 2VCAA 3R7CA 1A5EA 1EI7A 4RLYA 1QNFA 4WWNA 2A6HF 3JYYA 2DYSC 3U0CA 4C0MA 2ZXWC 4HOQA 1E83A 2YHEA 4G78A 4A4AA 3QZCA 4O6YA 2YLDA 1I5NA 2R2LA 4D4XA 3CVYA 1IQUA 3DSWA 1QPUA 2XPYA 1V55C 2LIGA 5J08A 4JJFA 4Q4ZF 1SZIA 2IO2C 2R05A 3ZN3A 3IQTA 3O10A 1N54A 4EIYA 2R25A 3DM9B 5E33A 3Q7LA 2W9YA 2ZGGA 2DZNA 3RK6A 1YAUO 1A7VA 4C7OB 1YZAA 3QVYA 3L82A 1K40A 3CZ6A 4MVRA 2ILRA 2R59A 4LRZA 1LS4A 4KI2A 3FH8A 5T4YA 1QKRA 3BEHA 3MLGA 1QSPA 1IXVA 4BEMJ 3B0UX 3W9FA 4GMRA 3S7JA 3PE4A 3LAYA 5KNGA 3O39A 5JSLA 3JRTA 4TXRA 1MZCA 4J8DA 2WVNA 1G4US 3EHQA 4NQ0A 3B95A 3IQ6A 1N52A 4UI9K 4RBNA 1KT1A 3V79K 1T6IA 1B68A 2FGYA 3H65A 4GTMA 2A68F 4C3EA 4QFVA 4DX1A 1SYQA 5JRAA 3AAAC 5KJMA 3UT7A 3NQPA 4ZHBA 1TYQG 3FOOA 2NYJA 3PZ4A 1KPSB 2H7BA 2WQ7A 3DRAA 1L3PA 3E30A 2WXKA 3SZ7A 3S7BA 1EDUA 3CVXA 5KCMA 1Y6IA 3SZRA 2PFDA 3RRUA 3L54A 3L8JA 2RSEB 2I9CA 2XRHA 3HVEA 2P0NA 1KT0A 4MVOA 4I6JA 4DRHB 3U66A 5A6CA 4JA7A 3EFOB 2FO7A 4A63B 4MLPA 1HMDA 2WVOA 3ASHA 4NTBA 5FCLA 4FJYA 3W8HA 1G3NB 1OXBA 5JHBA 4J32B 1GS9A 1CPQA 4DLOA 2DWZA 3WG7E 1FAPB 3SBSA 3Q79A 3MZLB 3FUHA 3UKRG 3V30A 2G3KA 3OWTA 3LY7A 1N4RA 3I4RB 4K03A 1HG2A 3JUIA 1ZU5A 1N4QA 3Q47B 4B8CB 1TR2A 1AEPA 2PQNA 4MS6A 2IY0C 2Y3DA 4JURI 3FTYA 4I44A 4DVYP 3K6BA 4I2WA 3VRCA 4AOFA 3LYAA 3MX3A 4I1AA 5T3TA 1PY1A 3CVWA 4FLHA 2YEVA 1PC2A 4I43A 4FESA 4JA9A 2EPMX 5COMA 4IAQA 3VLEA 4NCQA 3FH7A 2VJ8A 2HJ3A 4LLCA 2R7UA 2B0OE 2LAIA 2ONDA 4HS2A 1HE1A 2WXQA 3I5PA 2HFIA 2HM8A 4CIHA 2WZGA 1DVPA 4JC8A 5G55A 3G2TA 4DI3A 1T6QA 1VK5A 2P58C 3H2VA 4JVSA 2M4EA 1Z7Qc 3IEGA 1JOGA 1ORSC 2YVKA 1E84A 1MNEA 1QLEC 1ZW3A 4E17A 3ZYMA 3R9MA 2KGOA 3EZHA 3QAQA 1A7EA 3V7OA 2ZISA 2BEDA 5AC5A 4A1GA 2XL6A 2WVQA 2JABA 5EILA 4O60A 2AU5A 4P9FA 2UUHA 4XWJA 3GORA 1I4ZA 2AW6A 2XL8A 3N2ZB 3WHNA 3ZTMA 2CHWA 3RRNB 1MNDA 4OIPF 2J0WA 4LDKA 2VB6A 2J9WA 3NMKA 1UN8A 2JPUA 3NZUA 4R7LA 5BQGA 5A23A 3RW0A 5C1DA 4JTCB 3PUKA 2LCHA 3QVZA 3IHUA 2A4ZA 4XQ1A 3C3RA 1YLMA 3QKYA 3IKOB 4XEVA 5FJYA 3J5PA 3C98A 4FADA 3GZ2A 2J9UA 1VLTA 4TXPA 2V3CC 3CSTA 4XZ4A 2XXAB 3KS2A 2H6IA 1Z5ZA 2L0TB 3RVYA 3T5XA 4J7TA 1EKYA 2C03A 2Q4FA 3TAXA 4URKA 1OKKD 2ETAA 3L0IA 4BEJA 1OR2A 2HSQA 5A6BA 3ZWIA 3K66A 1TJCA 4AL1A 5ENPD 4UWLA 1HS6A 5ARFA 3EGXA 2P6VA 4U04A 1I4YA 4ANVA 2R5SA 3M79A 3LCAA 3UMKA 3BG0B 3VTYA 3LXUX 1ZHTA 2GA0A 2PF4E 1YARO 1UJKA 4GTOA 3SD5A 1E96B 5TJ5E 1C03A 1RKCA 4O79A 4YJWA 2NC9A 4I3MA 3TJ5A 3FVYA 1OWNA 3S90A 2Q00A 3BRJA 4JTAB 3C62A 1JR8A 4I1OB 2QYJA 4LDQA 5CCLA 3SQVA 3TL5A 3OTNA 3ISMC 3CV0A 1LM3B 2J9BA 3NMIA 2IXOA 3HKKA 3QMKA 3W2WA 3HG0D 3P2BA 2HYZA 4DRXE 4JIOA 3AS5A 2Y3GA 4MVMA 4L6RA 3LY8A 5IY5C 2LFDA 1SZ9A 3CGHA 3HXEA 5HKPA 2I8BA 2HUJA 4CBEA 1JCQA 1XZPA 5ANRA 2EILC 3CK7A 3BQOA 2F22A 3U9JA 3IQCA 4AE4A 2R9RB 3M4CA 3UGPA 2WXRA 1O1TA 3FFLA 1U2VG 3SHFA 1TNYA 4NURA 4CRWA 1T6UA 1BR2A 4G11A 2X51A 2ZXRA 3FH5A 3ZHEB 4PS8A 2IO3C 3D9NA 5L0GA 1JPNA 3EHNA 5C2YA 3HDXA 1IHBA 2VGXA 1W2WA 5A7DB 3V5XA 1NA3A 2QZAA 1ZU4A 2UY1A 3EH2A 4JCZA 5BV1A 3SXMA 3HIZA 2J46A 2FAPB 1U3DA 2VASA 1OWLA 2WXLA 2L6FA 1N1CA 4DBRA 1HE9A 4EBJA 1NU9C 2MRIA 3NMJA 1RKEB 2QC9A 2VTBA 4Y6CA 3RIPA 3S28A 4U63A 3TWVA 3DKAA 1JAFA 2OJQA 4MS2A 1FMWA 3KL4A 3V5YA 3DPYA 3RQGA 5B1AE 1O3UA 1QZXA 2PL2A 4BX8A 1YDIA 5JJ7A 5EX3A 3PUJA 4U95D 4CDMA 4MVQA 1VMAA 4J7YA 1KLXA 4U5EE 3L16A 1LE4A 5JVEA 2CG2A 3U3FA 3FWVA 1W3BA 4YWQA 3L1MA 3VF0A 4B8AA 5ARGA 3ULEG 1AWCB 2XL4A 4W8KA 2B6CA 2YQ8A 3VYWA 1FVHA 1NP7A 4GCNA 1B89A 2KYHA 3TD7A 4WGZA 5CBOA 2WM9A 4BJ6C 2MOWA 2QTVA 4CDYA 2GRNB 3AGTA 2BKKB 3ZQYA 1MQSA 4KMOA 1H9TA 2EIJE 4HRMB 5HRYA 5KYWB 3UR3C 5KYYA 2TMVP 3TJPA 4XLPF 4AK9A 5DQTA 3BG1B 2JD3A 3B7BA 3BU8A 3NG1A 2J09A 3RKVA 3EG9B 2ETBA 1EYHA 3IHYA 3CVNA 3JYHA 5AQ7A 4U5DE 1WGWA 4HE8D 4CCAA 2H6FA 4APFA 3CK9A 3EJNA 4G2VA 1S05A 2ETCA 1MX6A 2ZIRA 3C3OA 3DXKG 3D9JA 4RG9A 4K0DA 3HYMB 1M57C 2Q9CA 4YT4A 3U9MA 3NYLA 4HI9A 3I3NA 5FTPA 4CGVA 4MTFA 3DXJF 4NY3A 3V2OA 3IQ5A 4P9TA 5F28E 4ABNA 4O6NA 3CIAA 3Q6MA 4C3DA 4YL0A 4DPRA 2XM4A 4LERA 2YINA 3ZPJA 3RSEG 3MV2B 1RXQA 1YMPA 3GZ1A 3SI5A 3KEAA 3HRAA 4N2QA 2IXMA 3LUTB 4XIFA 4K0RA 3UX4A 3GEIA 5D0QD 3T9OA 4HOUA 3F6QA 4CGWA 4DJ9A 2L6BA 3JUEA 4D4NA 5KYXA 2HV7A 3Q6NA 1HZ4A 3C63A 3D9PA 2Q3TA 3DAGA 2AVPA 4I2ZA 3R9AB 2LAHA 1MMAA 1ORYA 3JTLO 5T3WA 5E76A 1X81A 2NUPA 2VSYA 3ESLA 1M2VA 4AP2A 4P6IC 2WXGA 4N06A 2P9UG 3DZAA 3ASGA 1WG0A 4JB8P 4QI2A 3U8PA 4RVBA 4F3VA 1SR2A 2H7OA 3UM1A 3T4RA 4J6IA 3ZIMA 2YLIA 4U8HA 3LS0A 3WG7C 3AQCA 5AQ9A 1SW6A 2P9KG 3FTXA 1RJ9B 4PS3A 5BPPA 4OINF 2QFCA 4HFKB 1KZPA 1E7VA 4WNFA 4OD5A 5EGYA 4L9PA 4G7HF 2IU1A 3ONLA 5ENOD 2XZTG 4YDYA 1TNBA 2NG1A 3ONKA 4GYOA 3PCVA 5FQ6A 4CT0A 4CS8C 1PAQA 4U0UA 3TOLA 2H7VC 3IBEA 1ZB1A 3LLIA 3JYSA 1IZMA 3VAYA 1OCOC 3FEYA 3QARA 1YA9A 3GM2A 1OR3A 2EILE 5LOZA 5BNWA 1UJJA 3ZVVA 5AN8A 1TN8A 2KSFA 1BLXB 2IBFA 4RQIA 3U9WA 2OVFA 5M72A 1Z5SC 4F4BA 5EYLA 5D66A 1OT8A 1ZVZA 3CR3A 2CYDA 3D9KA 3E32A 2OEWA 3CVVA 4CS9C 1XWJA 3JCUQ 2G62A 3CHMA 4IYPA 5BXOA 4ACKA 5L0HA 1OWMA 3EIJA 1TWAA 2GGFA 2C0LA 4HFGA 5CCMA 1V54E 4U5GA 4GMJA 4A1SA 2EQXA 1VOMA 2X0CA 2CFZA 4JC7A 5L3QA 1A17A 3MGBA 3LJBA 3G4XA 1JMWA 3MCXA 3IEEA 2D4UA 1TNZA 3RAUA 1M56C 3UPVA 2YL7A 5LFAA 4C7OA 1ZBPA 3O48A 1T9KA 2GWWA 2HE0A 4GU5A 3DSUA 5HV9A 4CEMA 5K0IA 2XPIA 1T5OA 1F1MA 4WNEA 4TV3A 4F6RD 2CGEA 5E3AA 3I4GA 3VLDA 3DPDA 5A6BD 4NTAA 1QQEA 5G2NA 1ZZPA 3WODF 3SXYA 3DAFA 2DB4A 2W4MA 1E8WA 2RFAA 2GRLA 3JQ1A 4BJ5A 4KBQA 5G05J 2J4DA 3RKOF 2E87A 3OXLA 5FQ8A 4LEUA 5G04J 3E37A 5G05C 5AYWD 3B7SA 4DXWA 1GQAA 1K1AA 3CHPA 3QWPA 3FEXA 2A0BA 3LLKA 2EIKC 2D5RB 1C02A 1MHQA 4BWRA 3ZYLA 4N6CA 1X5BA 3MKQB 2VQ2A 4O1OA 2OG2A 3DWWA 1Z3YA 3LS8A 5JA4D 3FDHA 3KSQA 3HXBA 5KWDA 3M4BA 4ANWA 4Z9HA 2MHRA 2PQRA 3KD7A 2DCPA 3D9LA 2VGYA 1ZW2A 3UMVA 1TR4A 2OU6A 3RQFA 4G1TA 4WAFA 3EFOA 3CHQA 2CCYA 1OCZC 1Y4CA 3TGOA 3KYJA 4ILIA 2EPLX 3N71A 2IJGX 3DJUB 3SBTB 1FR0A 3DEPA 4CS7A 4E0HA 2I1JA 4AX2A 3CAXA 3UIOC 3FHEA 2O9XA 1JPLA 2RD0A 3HNKA 1WM5A 1YYXA 1K8KG 4U5HA 4PJNA 1G5ZA 4UWGA 5CRUA 1Q0DA 3FHDA 2I1KA 2L6GA 4JEBA 1N9AA 4JHRA 1BU9A 2WQ6A 5FZQA 4A2NB 1TWCA 5HSWA 2GRQB 2RG8A 4J8SA 3CQZA 4C0EA 3ULYA 1D8EA 1H6OA 4K1OA 2DZOA 3PZ3A 3RH3A 3KPHA 4PJLA 2PM6A 2XGMA 4BT9A 3NB2A 4NRHB 1PD0A 3AQBA 2P9IG 2VSXE 3RVZA 4Q69A 1LIHA 5BT1A 3DSXA 1FCHA 4GTQA 1RCPA 5FQ4A 4EBBA 2HO1A 3GEHA 1IHGA 4KT6B 5KBAA 4GA1A 4G26A 1WTYA 3SXKA 3TWSA 5KNHD 2JEKA 2BC5A 1V74B 2BE5F 2L0IA 2AWCA 4UUCA 3BUAA 3UGOA 2QY7A 4G23A 5CBNA 1JPJA 2FBNA 2CNWA 1G8XA 4HOSA 4B6IA 4CSAC 4YDWA 3S7FA 3LKUA 2L9BA 2EIME 5B1AC 3V5ZA 1OCOE 3QC1A 3U2MA 5A6KA 4CSAA 4CDRA 3DMDA 4WGYA 3CEQA 3NAWA 2UWJG 3LEVA 2P7VA 3LVRE 3CK8A 3CVUA 1IYGA 4LDRA 2X6FA 4HQDA 5CIVA 3ULQA 3GWNA 3FULA 3US6A 4JEUA 4F7AA 2IFUA 1TFOB 4DX5D 1DOWA 4AJWA 3SXZA 2WZLA 4PFPA 5JUAA 3UT4A 2WPVA 3CLJA 2Y69E 3HLZA 5H7PA 4EPZA 3FU0A 2EPNA 2XXAA 1UW4B 4J8EA 4IJJA 1ORJA 3W2VA 3O55A 2EIJC 4M3OA 3HVEB 2XLHA 4XPYA 2NSFA 3PRZA 1QYMA 2IONA 4YL3A 4ONSA 4GTTA 3OAWA 3UT8A 2LSUA 1H19A 3QOUA 3AJMA 1OQCA 4CJGA 5ENRD 3U64A 1H2VC 1EPUA 1APCA 3E34A 2GDCA 2IXPA 1LTXA 2AXUA 2YQYA 3T6JA 4GTPA 2OOEA 4WNDA 2M64A 3FUKA 4KNWA 1SA5A 5EDSA 3G2SA 4ILHB 3AU4A 5CEDB 3AS8A 1RMVA 4U07A 1Z6AA 4JCHA 3ZYKA 5D91A 5L0DA 1FPPA 1TKNA 4G0HA 4CT4A 2HSBA 1A41A 2IM8A 3PZDA 4KNVA 3DSVA 5B1BE 3SFZA 3RO3A 4G8KA 3LY9A 3CVLA 1OW7A 3MKRA 1N4PA 4GTSA 4ATGA 3TWUA 1FFHA 4TUUA 2UUIA 3HTKC 4MW3A 2DIWA 1VLSA 2IYLD 1ZHWA 1MJ0A 2XS1A 2FULA 3ABMC 2EIKE 4GB9A 4KZ0A 2A0UA 2C04A 2ZXOA 3B0PA 4FHKA 1NLXA 4JPSA 2XLDA 2Y39A 2R7SA 4XI0A 2XLVA 4Q5SF 4WWOA 1AP7A 1A0BA 3CHSA 4X0RA 3G4ZA 1HX8A 2GRPB 3L9TA 4CYMD 2BUGA 3TWQA 1K05A 3D9HA 4JEAA 4GMLA 5COFA 1ELRA 4ZLDA 1HXIA 4HBDA 4BJTA 3APFA 2KW3C 3IXEA 4ANUA 1N0QA 4QI0A 2XCCA 5D92A 2KATA 3ZHEA 2Y4UA 1JRAA 3GW4A 1OCZE 5BW8C 4B89A 3GZSA 1YA0A 4IAOA 3ESKA 1CPRA 4U0ZA 4ZFHA 4UI9J 3KMIA 2QY9A 4U0SA 1XZQA 5AIJA 2J07A 4BESA 3SP1A 3GANA 4UI9C 4OVVA 1D0XA 1VDYA 1SQMA 1HF8A 3CQCB 4LNGA 4BETA 5KJNA 4GYWA 4DRJB 1RKEA 4AY6A 4XPXA 3NYJA 3HNJA 4GYYA 1ZHYA 1QZ2A 2RD9A 5JT4A 2CDQA 3NOGD 2XCBA 4YT8A 3ABKC 4BFRA 4E6HA 5E2QA 1D1BA 3KYIA 1FMVA 1H2UA 3PH0C 3QWVA 2JLBA 3EPVA 3IPMO 3LESA 4QQIA 3CSFA 5BUOA 2GFHA 1Z63A 4N3CA 4BTBA 3RU0A 2PX0A 2XM0A 3UMHA 4EZLA 4AV7A 2OEXA 1BR1A 1Q2ZA 1NU7D 1Y6DA 1D8DA 1NL4A 3F46A 3AGUA 5L0FA 3SYNA 5AQAA 3EGXB 2BTDA 2MHKA 3DD7A 3QNKA 1CGME 3A9CA 1IQRA 4XEKA 1V54C 3T9KA 3P1UA 5KYWA 2DYRE 3LNMB 3ASOC 1KNYA 4UWKA 3JSEO 3K9IA 1H6KA 1IW7F 3EG9A 1LI5A 4Z9JA 4XE0A 5LX8A 4EZKA 1WY6A 4TUMA 3V31A 4BX9A 5F5FA 4UWFA 2YNQA 3JRMO 1HU3A 5T3RA 2NSGA 2NUTA 2G3VA 3MYIA 3S2AA 1TWGA 4H7XA 4DX2A 1Q0MA 4XX5A 3TK0A 2R7QA 4L2YA 4G24A 4GZCA 3ZG1A 3EU5A 1NI1A 3IV0A 4YN0B 2XLWA 1M6TA 5BV0A 3AG1E 3TG5A 1H9GA 1A7DA 5CERB 2KNHA 2Y3BA 4WWPA 5DBKA 1ZHXA 1HO8A 2HJMA 3M1CB 1WN0A 3MBGA 4W8PA 3UQ3A 3AG3E 3S27A 3AG2C 2PP4A 1GW6A 2RFMA 3Q7FA 1EA8A 4CDNA 3PNLB 1ZU2A 2A6EF 2J4BA 1AVOB 4ULVA 4N2SA 4PDXA 4DK5A 2V5FA 2WXNA 1LPEA 2Y3HA 4JRZA 4N5QA 3B7TA 4GZ5A 1L7CA 2OCCC 4GYTA 2QE9A 4GTRA 2KCVA 3QW1A 2VGXB 3TWRA 1BR4A 4V3IA 4HB5A 4J7WA 1T01A 3FY4A 4LSZE 3UKUG 2UY1B 2FF4A 5E3CA 2KBXA 3FUNA 4XEFA 2Y4TA 2KJGA 3FUIA 3UXGA 1ZHZA 4J30B 4H7YA 2ASRA 2IOQA 3OEOA 4FWVA 4LACB 2ZU6B 3EHRA 3D9MA 2ZXPA 3EGDA 3I5QA 4U5CE 5E75A 1QQ3A 2CG3A 5JS5A 3D9OA 5KYUB 2R7XA 3TQOA 2XLMA 2HZ8A 4Q7CA 1PD1A 5ENSD 2VYIA 4ME2A 2R7TA 2FO1E 3KEZA 1HE8A 4HRNA 2WXOA 2V5QC 3RQEA 4C9BB 4NC3A 4J0UA 3ZU7B 2KXPC 2WB2A 4DRIB 1H7IA 1NG1A 3ABME 1TFKB 4FP7A 1UG7A 3HXFA 5BXUA 2KC7A 4IB4A 2XRYA 3ZUVB 2QYUA 3N0TA 4E7ZA 2A5EA 2HKVA 5B3SE 3MV3B 1MMDA 2WXIA 4OAVB 3LPZA 4MVZA 3PREA 5AQBA 5DLJA 3M15A 5HQ8A 4MTOA 4RDAA 4PJMA 2AWIA 2VGEA 2FI7A 2V26A 3EHMA 4AVXA 3U2LA 2WMOA 1TQGA 4JZAA 4CJOA 4GPMA 3NOCD 3TWWA 4AL0A 3LNRA 1YYHA 3G2UA 4FC8A 3Q75A 5AC4A 1VTMP 4FX5A 3Q49B 2I2OA 3HNLA 1TJFA 3O6XA 1MMGA 3TOMA 4U8VD 5AJLA 1FFTC 4LUNU 5KYNA 3C8GA 3PDNA 1H6GA 1E7UA 4MBGA 4C48B 2R17C 4N4WA 2KCKA 3S29A 2X6HA 4LNUD 3C3QA 1Y8MA 2OJED 2MWQA 1J8YF 3DI5A 3ABKE 3B29A 2EIMC 2HV6A 4JHJA 1G4WR 1CGNA 4BSXA 2NPUA 2ZGDA 4K5BA 3ABLC 3VM6A 4GAAA 2QNLA 3DBSA 3E33A 1OXJA 1TWHA 2R03A 3MYFA 1DNPA 3S84A 1U3CA 2IF4A 4HLLA 1JCSA 4N3BA 5JJTA 4CZ2D 1LF8A 2J7PA 1KTMA 2XEHA 2Q7RA 4FULA 4BSZB 1XNFA 1E86A 4BY6A 2Y69C 1Q0KA 1C17M 1S0PA 1LE2A 1Z3IX 3FP3A 4EBKA 3PZ1A 5CI8A 1M2VB 1Z3XA 3UUXA 4EBAA 3W8IA 3C5RA 2ZD9A 3ZXPA 4DVZA 3ASOE 256BA 4XLNF 4JHKA 1FT1A 5DQZA 2XZDG 3B9QA 3NDBB 2R7OA 2Y0BG 4GZDA 4OIRF 2BKGA 2LUHA 4GPKA 1SF8A 4DX6D 1VB5A 3ZC4A 4BTAA 4YDEA 2XSEA 3K1HA 1OUVA 3L34A 4Z9IA 2BL2A 1LKXA 2PBEA 4HORA 1D0YA 1FT2A 3G2WA 5AJDA 2R7WA 4TRQA 5EKQD 2VH3A 3J5QB 4HEAJ 4EUKB 3GWLA 4BJ5C 4JW1A 3URZA 4GEHA 1O87A 1OXKA 4DBQA 1KZOA 3NKDA 4HOTA 5B1BC 4XPWA 3Q5MA 1DOVA 3G2VA 1ZYRF 5LP0A 5AARA 4N5CA 2IOSA 4IN3B 2XRZA 3AG2E 4PFOA 2P9LG 5ENNA 3SNHA 4HLEA 5G04C 1S64A 3TWTA 5FZTA 2Q9AA 2XEVA 3QDNA 4U8YD 4PS7A 1TNOA 2A5UA 1FVFA 5L3VA 3UMIA 2L81A 3LJNA 2OCCE 4WABA 2LK4A 2YHCA 4YVOA 4FAPB 2WQHA 3DEOA 4HXIA 5ANLA 3WAQA 3FAPB 4E7SA 1NZEA 4B93B 1AUEA 3D3MA 4MQ9F 2YL0A 3QW0A 3RF3A 1UN9A 3LEOA 1WASA 4E85A 2IXNA 2WZFA 1H6PA 2C0MA 2XGOA 1JWFA 4FJZA 4JTDB 1TN6A 3HNIA 2LXMA 2P9NG 1D9SA 1MMNA 1R5ID 1MYOA 3FU6A 4YT5A 5DS6A 5EN5D 2Y3AA 1LVKA 5B3IA 1ELKA 3EIQC 2GW1A 1TN7A 3Q78A 3ZW3A 2DI3A 2W4BA 2KZTB 4L2LA 2A1DD 4JKVA 4AIFA 3L13A 2GAQA 2WXJA 3RRMB 4U9EA 4CIPA 3FXHA 2W45A 3H2UA 1M2OA 3C7JA 5D2MC 3GEEA 1N11A 3LEWA 1EQ1A 4XI9A 1UG3A 3NZSA 2AP3A 3UI2A 3E4BA 1E8YA 3L8IA 4YNDA 3TJ6A 1BDJB 3JCKC 4GZ6A 4J8YA 4O6MA 1HMOA 4EQFA 2BF0X 2LNIA 3DE9A 1O5MA 4JZYA 3OXGA 2Q9BA 2YKZA 2GRRB 3BEEA 2OV8A 1FNTc 3UTMA 3TXMA 2P61A 4JJGA 5L0CA 4GZ3A 4P29A 4IARA 2KC3A 3JXJA 3NYMA 3PVLA 3JT1A 2LSVA 1YA7O 1LS1A 1D1AA 4GA2A 3FTSA 3DSTA 2R7VA 1O1SA 4XEIG 3FUDA 3A11A 3T8KA 4E0IA 2DYRC 3TXNA 2L6HA 4EKWA 4KYOB 2HMZA 4XTKA 4L1BA 4U96D 2PX3A 3RYLA 4OIOF 2EINE 3NF1A 4GTVA 3VTXA 2H8AA 1WOLA 2CW0F 2FEZA 1HH8A 4PK4A 2WL8A 1L5JA 5EK0A 4YK5A 5AAOA 5FQ7A 4O6FA 4G7ZF 4NACA 4DUIA 4M63A 2LSEA 2KM4A 1SVXA 3ABLE 2LQGA 3GM1A 4O7GA 5CHEE 1PV3A 1H0AA 2IQCA 2B0HA 3ZFWA 4MVSA 2IOLA 5A69A 3AG1C 2YZSA 3CHOA 5EYPF 1DCQA 3L08A 4LNBA 2HR2A 4KVMA 2VSNA 3AG3C 4WNGA 4U9DA 3U3BA 4KXKB 1N95A 2XS8A 3S0XA 2CFUA 2X3MA 4Z68A 3SO8A 3FTWA 4L7TA 1K3ZD 1WATA 4GCOA 4ZLCA 3SF4A 3X1OA 2DVWA 2M63A 1OW6A 3TWXA 1JCRA 1YJGA 4DLQA 3R7QA 4EECA 1NBBA 5T1DB 3ASNE 1NFIE 3KH2A 2PM7A 4EZJA 1WWPA 4N6HA 4IGGA 1N94A 3LJ3A 4UQXA 1SMYF 1S7ZA 1GM5A 4A55A 5L0JA 4MW8A 3FUEA 3ZXSA 2F8YA 3EU9A 1N0RA 4BG0A 3CQGB 4U7EB 1OCCE 2AXVA 4OD4A 3AOUA 3PEVB 5DS5A 4IULA 3ZYQA 5BQHA 3SFXA 1K04A 1D0ZA 2QLAA 1QVXA 4W9RA 4K5AB 5EIBE 1BBHA 3E70C 2P9SG 4UWHA 4JD2G 3EQLF 4K7BA 4A3TA 3W4YA 3FDQA 1OCRC 2KK1A 1SA4A 2R7RA 2C2LA 2PZIA 1V4AA 3HXDA 2DYSE 2XGSA 5HI7A 1NFOA 2ZXWE 3PNTB 3S9OA 4AM9A 5B3SC 4I17A 2GRMA 5CMWA 2J9VA 1FTSA 3C8GD 1D1CA 3FUFA 4I6EA 4HI8A 1MX2A 1E2XA 3L17A 3SFYA 1UFBA 3ML8A 4IWBA 1U0BB 4PACA 3C18A 1YCSB 2H6GA 3APCA 1NFNA 2Z15A 3L22A 4E18A 2OOCA 1V55E 2AVKA 3U5SA 4N3AA 4O1PA 1O5HA 3UIPC 3RIBA 4OAUC 5D0OD 3JZ0A 2AJAA 2J9QA 3JXIA 3Q4AB 1BI7B 3PE3A 4CDVA
chains in the Genus database with same CATH topology
4HVBA 4MRUA 4F1SA 3T6BA 1Z23A 2J7PD 4OVUA 2I6HA 3FTVA 3SNXA 3FTUA 3OA1A 4JXTA 5JJ6A 3FUJA 1Z6TA 3RFYA 3EH1A 5BUZA 4DJAA 2XHEA 3U3WA 4BT8A 1XGWA 3AG4C 2XQ0A 3OXFA 5FWQA 3DM5A 4EBAG 5DS4A 4I1MA 3B7UX 4B94A 3ITFA 5KJKA 3CVQA 4B0ZA 3ZIBA 3IHVA 4Y6WA 4QDLA 4KBLA 5JHAA 3GODA 2XPZA 3ECSA 2E0IA 1NA0A 4JEHA 3ASDA 4KVOA 1H2TC 2Q7FA 3N24A 4L23A 3POVA 2WXPA 2OVBA 3T5VA 3CHRA 3ASFA 3PEUB 4OIQF 4U5FE 1OWOA 2CHZA 3CKCA 2VSOE 3KKBA 3PHF2 3QK0A 2J45A 4I9EA 4RD9A 2X6IA 3HJCA 5KYUA 3DJNB 3L6AA 3X2QC 2WB7A 3SEOA 5EHHA 3RJVA 4BJ1A 3KAEA 3EZIA 3LVQE 2J0XA 3SGHA 4MNDA 3ZVRA 4AE4B 3EDTB 1E90A 3MJWA 3B0VC 4G7OF 3WXXA 3D9IA 4PJJA 3PS6A 3B13A 2DGJA 3CSKA 3RO2A 4H4KC 3K1IC 2YHSA 3FU3A 4UQYA 4BJ6A 3QB2A 3O4ZA 2FFHA 4D10C 4UQZA 4DI4A 2WXMA 2J49A 2E2EA 2V4LA 4PH4B 2VTBB 4ILGA 2KCLA 4I6GA 1WAO1 5EX0A 3B7RL 4HFFB 2X6JA 2NUTB 1RJ9A 1EF1C 3CVPA 2WXFA 3Q15A 4N39A 4FHJA 1E8ZA 2ZPAA 2WVIA 2L6JA 3JQ0A 4U5BE 4PUCA 2NXPA 3MA5A 3ML9A 1VYKA 4FU3A 1VYIA 1PCXA 1SZAA 3I4UA 3LS1A 5FT9A 2X38A 2DBAA 2J08A 5LCWJ 3ZSUA 2CNWD 3UNGC 4LCTA 2NSZA 4APOA 5KYYB 4ANXA 3K7DA 5LCWC 2L9JA 1OWPA 4C3BA 4IRUA 3ZRHA 1TEZA 4ULWA 1P5QA 5DVWA 4AEZC 4EWCA 4A3VA 4LLEA 4FLBA 2CHXA 4XKCA 4FA6A 3E9VA 1NZNA 4AY5A 3ZGQA 4YVQC 2EINC 2X6KA 4Q94A 3EGDB 3HHMA 4XKBA 5AENA 4G25A 3APDA 3QWWA 5CMYA 1OKKA 3FUMA 3ZEFA 1INZA 5FZSA 5KJLA 4WUYA 1ELWA 3FAJA 4RG6A 4AXHA 3VLFA 4OYSA 4F53A 4ANJA 3F47A 3MYVA 1HG5A 4JL0A 4WJ0A 5KYXB 3LDZA 1KU2A 4ACLA 2MYSA 1HFAA 1ST6A 4CS8A 3JSZA 3S7DA 1JWGA 2V8SE 1E8XA 4RSYA 5T8IA 2NUPB 4MKTA 3PMRA 5F5HA 4DOZA 2WMNA 3MKQA 4Q96A 3NKEA 3K33A 3CKBA 3NRHA 4CS9A 3FTZA 3ASNC 2A69F 3GYZA 3FU5A 4YT2A 3MEKA 2KQ9A 5J90A 5CI9A 4KZCA 3AU5A 3ENEA 3QJZA 4GA0A 3R7RA 1OCCC 3T8MA 4I9CA 2V0PA 1J8MF 3TG4A 3AS4A 5FZRA 4KC9A 2KZTA 3Q7GA 2B0JA 2LO6A 2AXZA 5DIZA 3U4TA 1JUQA 1BPOA 4J8FA 2WXHA 1QNFA 4WWNA 2A6HF 2DYSC 4C0MA 2ZXWC 4HOQA 2YHEA 3QZCA 4O6YA 3CVYA 1IQUA 2XPYA 1V55C 5J08A 4JJFA 4Q4ZF 1SZIA 3ZN3A 1N54A 3DM9B 5E33A 3Q7LA 2W9YA 3RK6A 4C7OB 3CZ6A 2ILRA 2R59A 4LRZA 4KI2A 3FH8A 5T4YA 3MLGA 3B0UX 3S7JA 3PE4A 3LAYA 3O39A 3JRTA 4J8DA 2WVNA 4NQ0A 1N52A 4UI9K 4RBNA 1KT1A 2FGYA 3H65A 2A68F 4C3EA 4QFVA 5KJMA 3UT7A 3NQPA 2H7BA 2WQ7A 2WXKA 3SZ7A 3S7BA 1EDUA 3CVXA 5KCMA 1Y6IA 3SZRA 2PFDA 3RRUA 3L54A 2I9CA 2XRHA 3HVEA 1KT0A 4I6JA 3U66A 5A6CA 4JA7A 3EFOB 2FO7A 4MLPA 2WVOA 3ASHA 5FCLA 4FJYA 3W8HA 5JHBA 4J32B 4DLOA 3SBSA 3MZLB 3FUHA 2G3KA 3OWTA 3LY7A 3I4RB 4K03A 1HG2A 3JUIA 1ZU5A 3Q47B 4B8CB 1TR2A 2PQNA 4MS6A 2Y3DA 4JURI 3FTYA 4I44A 4DVYP 3K6BA 4I2WA 4AOFA 3LYAA 3MX3A 4I1AA 5T3TA 1PY1A 3CVWA 4FLHA 2YEVA 1PC2A 4I43A 4FESA 4JA9A 3VLEA 3FH7A 2VJ8A 2R7UA 4LLCA 2LAIA 4HS2A 2ONDA 2WXQA 3I5PA 2HM8A 4CIHA 2WZGA 1DVPA 4JC8A 5G55A 3G2TA 4DI3A 1VK5A 2P58C 4JVSA 2M4EA 3IEGA 1MNEA 1QLEC 3ZYMA 2KGOA 3EZHA 3QAQA 3V7OA 4A1GA 2WVQA 4XWJA 2AW6A 3N2ZB 2CHWA 3RRNB 1MNDA 4OIPF 2J0WA 2VB6A 2J9WA 1UN8A 3NZUA 4R7LA 5A23A 5C1DA 3PUKA 2A4ZA 3QKYA 3IKOB 5FJYA 3C98A 4FADA 3GZ2A 2J9UA 2V3CC 3CSTA 4XZ4A 2XXAB 3KS2A 1Z5ZA 2L0TB 3T5XA 2C03A 3TAXA 4URKA 1OKKD 3L0IA 4BEJA 3K66A 1TJCA 4UWLA 1HS6A 5ARFA 3EGXA 2P6VA 4U04A 4ANVA 2R5SA 3LCAA 3UMKA 3BG0B 3VTYA 3LXUX 1ZHTA 2PF4E 1UJKA 3SD5A 1E96B 4O79A 4YJWA 2NC9A 4I3MA 3FVYA 1OWNA 4I1OB 5CCLA 3TL5A 3OTNA 3CV0A 2IXOA 3QMKA 3W2WA 3P2BA 2HYZA 3AS5A 2Y3GA 3LY8A 5IY5C 1SZ9A 3CGHA 2I8BA 4CBEA 5ANRA 2EILC 3CK7A 4AE4A 3UGPA 2WXRA 3FFLA 3SHFA 4NURA 4CRWA 1BR2A 4G11A 2X51A 2ZXRA 3FH5A 3ZHEB 4PS8A 3D9NA 1JPNA 3EHNA 5C2YA 3HDXA 2VGXA 1W2WA 5A7DB 1NA3A 1ZU4A 2UY1A 3EH2A 5BV1A 3HIZA 2J46A 1U3DA 2VASA 1OWLA 2WXLA 4DBRA 1N1CA 1NU9C 2MRIA 2VTBA 4Y6CA 3RIPA 3S28A 4U63A 1FMWA 3KL4A 1QZXA 2PL2A 4BX8A 5JJ7A 5EX3A 3PUJA 4CDMA 1VMAA 1KLXA 4U5EE 3L16A 2CG2A 3FWVA 1W3BA 4YWQA 4B8AA 5ARGA 2XL4A 4W8KA 2YQ8A 3VYWA 1FVHA 1NP7A 4GCNA 1B89A 3TD7A 2WM9A 4BJ6C 2MOWA 2QTVA 1MQSA 4KMOA 5KYWB 3UR3C 5KYYA 3TJPA 4XLPF 4AK9A 5DQTA 3BG1B 2JD3A 3RKVA 3NG1A 2J09A 3EG9B 1EYHA 3IHYA 3CVNA 3JYHA 4U5DE 1WGWA 4HE8D 4CCAA 4APFA 3CK9A 3EJNA 4G2VA 3D9JA 4RG9A 4K0DA 3HYMB 1M57C 2Q9CA 4YT4A 3NYLA 5FTPA 3I3NA 4CGVA 3DXJF 4NY3A 4ABNA 4O6NA 3CIAA 3Q6MA 4C3DA 4DPRA 4LERA 2YINA 3ZPJA 3MV2B 3GZ1A 3SI5A 4N2QA 2IXMA 4XIFA 4K0RA 3UX4A 5D0QD 4HOUA 4CGWA 5KYXA 2HV7A 3Q6NA 1HZ4A 3D9PA 2Q3TA 3DAGA 2AVPA 4I2ZA 3R9AB 2LAHA 1MMAA 5T3WA 5E76A 2VSYA 2NUPA 3ESLA 1M2VA 4AP2A 4P6IC 2WXGA 4N06A 3DZAA 3ASGA 4QI2A 4RVBA 4F3VA 2H7OA 3T4RA 4J6IA 3ZIMA 4U8HA 3LS0A 3WG7C 3AQCA 3FTXA 1RJ9B 4PS3A 5BPPA 4OINF 2QFCA 4HFKB 1E7VA 4WNFA 4OD5A 5EGYA 4G7HF 2IU1A 3ONLA 4GYOA 2NG1A 3ONKA 5FQ6A 4CT0A 4CS8C 1PAQA 4U0UA 2H7VC 3IBEA 3LLIA 3JYSA 1IZMA 3VAYA 1OCOC 3FEYA 3QARA 5LOZA 5BNWA 1UJJA 3ZVVA 3U9WA 2OVFA 5M72A 4F4BA 3CR3A 3D9KA 3CVVA 4CS9C 3JCUQ 2G62A 3CHMA 4IYPA 4ACKA 1OWMA 3EIJA 1TWAA 2GGFA 2C0LA 4HFGA 5CCMA 4U5GA 4GMJA 4A1SA 2EQXA 1VOMA 2CFZA 5L3QA 1A17A 3MGBA 3LJBA 3MCXA 3IEEA 1M56C 3UPVA 5LFAA 4C7OA 1ZBPA 3O48A 4GU5A 4CEMA 2XPIA 4WNEA 4TV3A 2CGEA 5E3AA 3I4GA 3VLDA 3DPDA 1QQEA 5G2NA 3WODF 3DAFA 2W4MA 1E8WA 2GRLA 3JQ1A 4BJ5A 4KBQA 5G05J 2J4DA 3RKOF 2E87A 3OXLA 5FQ8A 4LEUA 5G04J 5G05C 5AYWD 3B7SA 3QWPA 3CHPA 3FEXA 3LLKA 2EIKC 2D5RB 1MHQA 4BWRA 3ZYLA 1X5BA 3MKQB 2VQ2A 2OG2A 1Z3YA 3LS8A 3FDHA 4ANWA 2PQRA 3KD7A 2DCPA 3D9LA 2VGYA 3UMVA 4G1TA 4WAFA 3EFOA 3CHQA 1OCZC 3TGOA 4ILIA 3N71A 2IJGX 3DJUB 3SBTB 4CS7A 2I1JA 4AX2A 3FHEA 2O9XA 1JPLA 2RD0A 1WM5A 4U5HA 4PJNA 4UWGA 2I1KA 3FHDA 4JHRA 2WQ6A 5FZQA 4A2NB 1TWCA 5HSWA 2RG8A 4J8SA 3CQZA 4C0EA 3RH3A 4PJLA 2PM6A 2XGMA 4BT9A 4NRHB 1PD0A 3AQBA 2VSXE 4Q69A 5BT1A 1FCHA 5FQ4A 4EBBA 2HO1A 1IHGA 4KT6B 4GA1A 4G26A 2JEKA 2L0IA 2BE5F 3UGOA 2QY7A 4G23A 1JPJA 2FBNA 2CNWA 1G8XA 4HOSA 4B6IA 4CSAC 3S7FA 3LKUA 2L9BA 5B1AC 3QC1A 4CSAA 4CDRA 3DMDA 3CEQA 2UWJG 3LEVA 2P7VA 3LVRE 3CK8A 3CVUA 1IYGA 2X6FA 3ULQA 3FULA 4JEUA 4F7AA 2IFUA 4AJWA 2WZLA 4PFPA 3UT4A 2WPVA 3CLJA 3HLZA 4EPZA 3FU0A 2XXAA 1UW4B 4J8EA 4IJJA 3W2VA 2EIJC 4M3OA 3HVEB 3PRZA 2IONA 3UT8A 3OAWA 2LSUA 1H19A 3QOUA 3U64A 1H2VC 1EPUA 2IXPA 2AXUA 3T6JA 2OOEA 4WNDA 3FUKA 4KNWA 5EDSA 3G2SA 4ILHB 3AU4A 3AS8A 4U07A 1Z6AA 4JCHA 3ZYKA 5D91A 1TKNA 4G0HA 4CT4A 3PZDA 3SFZA 4KNVA 3RO3A 3LY9A 3CVLA 3MKRA 4ATGA 1FFHA 4TUUA 3HTKC 2DIWA 2IYLD 1ZHWA 2FULA 3ABMC 4GB9A 4KZ0A 2C04A 2ZXOA 3B0PA 4FHKA 4JPSA 2Y39A 2R7SA 4XI0A 4Q5SF 4WWOA 3CHSA 4X0RA 1HX8A 2BUGA 4GMLA 1ELRA 4ZLDA 1HXIA 4BJTA 3APFA 2KW3C 4ANUA 4QI0A 2XCCA 5D92A 2KATA 3ZHEA 2Y4UA 3GW4A 5BW8C 4B89A 3GZSA 1YA0A 4IAOA 3ESKA 4U0ZA 4UI9J 3KMIA 2QY9A 4U0SA 5AIJA 2J07A 3SP1A 3GANA 4UI9C 4OVVA 1D0XA 1VDYA 1SQMA 1HF8A 3CQCB 5KJNA 4GYWA 4AY6A 3NYJA 4GYYA 1ZHYA 1QZ2A 2CDQA 2XCBA 4YT8A 3ABKC 4BFRA 4E6HA 5E2QA 1D1BA 1FMVA 1H2UA 3PH0C 3QWVA 2JLBA 3EPVA 3LESA 3CSFA 5BUOA 2GFHA 1Z63A 4N3CA 4BTBA 3RU0A 2PX0A 3UMHA 4EZLA 4AV7A 1BR1A 1NU7D 3F46A 3SYNA 3EGXB 2BTDA 2MHKA 3DD7A 3QNKA 1IQRA 1V54C 3P1UA 5KYWA 3ASOC 4UWKA 3K9IA 1H6KA 1IW7F 3EG9A 4XE0A 5LX8A 4EZKA 1WY6A 4BX9A 5F5FA 4UWFA 2YNQA 1HU3A 5T3RA 2NUTA 2G3VA 3S2AA 1TWGA 4H7XA 4XX5A 2R7QA 4L2YA 4G24A 4GZCA 3ZG1A 3IV0A 4YN0B 5BV0A 3TG5A 2KNHA 2Y3BA 4WWPA 5DBKA 1ZHXA 1HO8A 3M1CB 3UQ3A 3S27A 3AG2C 2PP4A 1GW6A 4CDNA 3PNLB 1ZU2A 2A6EF 2J4BA 4N2SA 4PDXA 4DK5A 2V5FA 2WXNA 2Y3HA 3B7TA 4GZ5A 2OCCC 4GYTA 2KCVA 2VGXB 1BR4A 4V3IA 3FY4A 2UY1B 2FF4A 5E3CA 3FUNA 2Y4TA 2KJGA 3FUIA 1ZHZA 4J30B 4H7YA 2IOQA 3OEOA 4FWVA 4LACB 2ZU6B 3D9MA 2ZXPA 3EGDA 3I5QA 4U5CE 5E75A 2CG3A 3D9OA 5KYUB 2R7XA 4Q7CA 1PD1A 2VYIA 4ME2A 2R7TA 3KEZA 1HE8A 2WXOA 4C9BB 4J0UA 2WB2A 1NG1A 4FP7A 2KC7A 2XRYA 3N0TA 4E7ZA 3MV3B 1MMDA 2WXIA 3LPZA 3PREA 5DLJA 5HQ8A 4RDAA 4PJMA 2AWIA 2FI7A 2V26A 3EHMA 4AVXA 2WMOA 4JZAA 3LNRA 3G2UA 4FC8A 4FX5A 3Q49B 2I2OA 1TJFA 3O6XA 1MMGA 5AJLA 1FFTC 4LUNU 5KYNA 3PDNA 1E7UA 2R17C 2KCKA 3S29A 2X6HA 1Y8MA 2MWQA 1J8YF 2EIMC 2HV6A 4JHJA 4BSXA 3ABLC 4GAAA 3DBSA 1TWHA 1DNPA 1U3CA 2IF4A 4N3BA 5JJTA 1LF8A 2J7PA 4FULA 1XNFA 4BY6A 2Y69C 1S0PA 1Z3IX 3FP3A 5CI8A 1M2VB 1Z3XA 3UUXA 4EBAA 3W8IA 4DVZA 4XLNF 4JHKA 5DQZA 3B9QA 3NDBB 2R7OA 4GZDA 4OIRF 4GPKA 1SF8A 3ZC4A 4BTAA 2XSEA 3K1HA 1OUVA 3L34A 1LKXA 4HORA 1D0YA 3G2WA 5AJDA 2R7WA 4TRQA 5EKQD 2VH3A 4HEAJ 4BJ5C 4JW1A 3URZA 4GEHA 1O87A 4DBQA 3NKDA 4HOTA 5B1BC 3Q5MA 3G2VA 1ZYRF 5LP0A 4N5CA 2IOSA 4IN3B 2XRZA 4PFOA 5ENNA 3SNHA 4HLEA 5G04C 2Q9AA 2XEVA 3QDNA 4PS7A 2A5UA 1FVFA 5L3VA 3UMIA 2L81A 2YHCA 4YVOA 5ANLA 2WQHA 4HXIA 4E7SA 1NZEA 3D3MA 4MQ9F 1UN9A 4E85A 2IXNA 2WZFA 2C0MA 2XGOA 1JWFA 4FJZA 1MMNA 3FU6A 4YT5A 5DS6A 2Y3AA 1LVKA 1ELKA 3EIQC 2GW1A 3ZW3A 2W4BA 2KZTB 4L2LA 2A1DD 4AIFA 3L13A 2WXJA 3RRMB 2W45A 1M2OA 3LEWA 4XI9A 1UG3A 3NZSA 3E4BA 1E8YA 4YNDA 3JCKC 4GZ6A 4O6MA 4EQFA 2BF0X 2LNIA 4JZYA 3OXGA 2Q9BA 3BEEA 2OV8A 3TXMA 4GZ3A 4JJGA 4P29A 3NYMA 3PVLA 3JT1A 2LSVA 1LS1A 1D1AA 4GA2A 3FTSA 2R7VA 3FUDA 2DYRC 3TXNA 4KYOB 4XTKA 4L1BA 2PX3A 3NF1A 3RYLA 4OIOF 3VTXA 2FEZA 2CW0F 1HH8A 4PK4A 2WL8A 1L5JA 5FQ7A 4O6FA 4G7ZF 4NACA 4M63A 2LSEA 2KM4A 4O7GA 5CHEE 1H0AA 2IQCA 3ZFWA 2IOLA 3AG1C 2YZSA 3CHOA 3L08A 2HR2A 4KVMA 2VSNA 3AG3C 4WNGA 4KXKB 3S0XA 2CFUA 2X3MA 3FTWA 4L7TA 4GCOA 4ZLCA 3SF4A 3X1OA 2M63A 4DLQA 3R7QA 4EECA 5T1DB 3KH2A 2PM7A 4EZJA 3LJ3A 4UQXA 1SMYF 1S7ZA 4A55A 3FUEA 3ZXSA 4BG0A 3CQGB 2AXVA 4OD4A 3PEVB 5DS5A 4IULA 3ZYQA 1D0ZA 4W9RA 3E70C 4UWHA 3EQLF 4K7BA 4A3TA 3FDQA 1OCRC 2R7RA 2C2LA 2PZIA 5HI7A 2XGSA 3PNTB 4AM9A 5B3SC 4I17A 2GRMA 5CMWA 2J9VA 1FTSA 1D1CA 3FUFA 4I6EA 3L17A 3ML8A 4IWBA 3APCA 2Z15A 3L22A 4N3AA 1O5HA 3RIBA 5D0OD 2J9QA 3Q4AB 3PE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHM A;  3MCX A;  3OTN A;  5FQ4 A;  3MYV A;  5FQ6 A;  4MRU A;  5FQ7 A;  3JQ1 A;  3CKB A;  3IV0 A;  3FDH A;  5E75 A;  3JYS A;  3JQ0 A;  5FQ8 A;  4PUC A;  4L7T A;  3L22 A;  3SNX A;  5LX8 A;  3CK8 A;  3EHN A;  3HDX A;  3GZS A;  3CGH A;  3KEZ A;  4LER A;  5E76 A;  5T4Y A;  3I4G A;  4F7A A;  5T3R A;  3CK9 A;  4Q69 A;  3EJN A;  3LEW A;  3CK7 A;  3QNK A;  3SGH A;  3NQP A;  3CKC A;  3MX3 A;  5J90 A;  4F53 A;  3P1U A; 
#chains in the Genus database with same CATH topology
 4HVB A;  4MRU A;  4F1S A;  3T6B A;  1CGO A;  4ATZ D;  3UM2 A;  1Z23 A;  2YLG A;  4BER A;  2J7P D;  4OVU A;  1LD8 A;  1RZ4 A;  2I6H A;  3FTV A;  3SNX A;  3FTU A;  1E85 A;  2GRO B;  3OA1 A;  4JXT A;  5JJ6 A;  3FUJ A;  1Z6T A;  1NSG B;  3RFY A;  3EH1 A;  5BUZ A;  1OY3 D;  4DJA A;  2XHE A;  3Q7A A;  3U3W A;  3UIN C;  4BT8 A;  1MQV A;  5CRV A;  1XGW A;  3AG4 C;  2XQ0 A;  3OXF A;  5FWQ A;  3DM5 A;  4HRL A;  4EBA G;  5DS4 A;  4I1M A;  4F1P A;  2AWY A;  3B7U X;  4B94 A;  3ITF A;  5KJK A;  3CVQ A;  4B0Z A;  3T6G B;  3ZIB A;  1DCE A;  3IHV A;  2YRF A;  3UM3 A;  4EHP A;  1HW1 A;  4CX9 A;  4Y6W A;  4QDL A;  4H54 A;  5GPG B;  4KBL A;  2HS5 A;  4PR9 A;  3GOD A;  5JHA A;  2XPZ A;  2RKK A;  3CEX A;  3ECS A;  2E0I A;  1NA0 A;  4JEH A;  5CEC B;  3ASD A;  4KVO A;  1H2T C;  2LFF A;  5CEA A;  2Q7F A;  3Q9U C;  3N24 A;  3UM0 A;  2OQM A;  4L23 A;  3POV A;  2LP4 A;  2WXP A;  2YL3 A;  2OVB A;  3T5V A;  3CHR A;  2J8W A;  3ASF A;  3GM3 A;  2LXL A;  2Y1L E;  3PEU B;  1OW8 A;  4OIQ F;  4U5F E;  1MX4 A;  1OWO A;  5A6J A;  3ZTZ A;  2CHZ A;  3CKC A;  2VSO E;  3KKB A;  3PHF 2;  3QK0 A;  2J45 A;  2F0Y A;  4I9E A;  1BI8 B;  1YYJ A;  2YWA A;  2H6H A;  1U6H A;  1Q0G A;  4RD9 A;  2X6I A;  3HJC A;  5KYU A;  2F37 A;  3DJN B;  3L6A A;  3X2Q C;  2WB7 A;  3SEO A;  5EHH A;  3RJV A;  1DC2 A;  4BJ1 A;  3KAE A;  3EZI A;  3ZDL A;  4NQF A;  3LVQ E;  2J0X A;  3SGH A;  4MND A;  1S70 B;  3ZVR A;  4AE4 B;  3EDT B;  2F8X K;  1E90 A;  3DSS A;  3MJW A;  3B0V C;  1BZ4 A;  4G7O F;  3WXX A;  3FMS A;  1LI7 A;  3DE8 A;  3D9I A;  4PJJ A;  3PS6 A;  4LG6 A;  3B13 A;  2DGJ A;  4HNA D;  3CSK A;  3RO2 A;  4H4K C;  5L0I A;  2VC9 A;  3K1I C;  1O1R A;  2YHS A;  3FU3 A;  2YL1 A;  4BJ6 A;  4UQY A;  3QB2 A;  3O4Z A;  2FFH A;  5BQI A;  2VCC A;  4D10 C;  4UQZ A;  3K1I A;  4DI4 A;  2XEE A;  2WXM A;  2J49 A;  3Q73 A;  5FIN A;  1IKN D;  2E2E A;  3PDM P;  2V4L A;  3ZNG A;  4PH4 B;  2VTB B;  4ILG A;  2KCL A;  4EHM A;  4I6G A;  1WAO 1;  5EX0 A;  3B7R L;  1S63 A;  5AGF A;  4HFF B;  2X6J A;  2NUT B;  1RJ9 A;  4NTF A;  5JP7 A;  2V4H C;  2OKU A;  1EF1 C;  3CVP A;  2WXF A;  2I15 A;  3Q15 A;  4N39 A;  1N4S A;  4K5C A;  4FHJ A;  1E8Z A;  2ZPA A;  2WVI A;  3C8Z A;  2L6J A;  1OCR E;  3JQ0 A;  4U5B E;  4PUC A;  2NXP A;  2P2C P;  3MA5 A;  3ML9 A;  3FOP A;  4TXQ A;  1VYK A;  4FU3 A;  1VYI A;  1PCX A;  1SZA A;  1R4T A;  3I4U A;  1TNU A;  3LS1 A;  5FT9 A;  2QUP A;  3KSL A;  2X38 A;  2DBA A;  2J08 A;  5ITZ F;  5LCW J;  3ZSU A;  2CNW D;  3UNG C;  4CDA A;  5COG A;  2NSZ A;  5KYY B;  4LCT A;  2LD6 A;  4APO A;  4ANX A;  5JMN D;  1Q0F A;  4G8L A;  4BEP A;  5EID A;  3K7D A;  5LCW C;  2L9J A;  1YZC A;  1OWP A;  4C3B A;  2PNO A;  3R2P A;  4IRU A;  3ZRH A;  1TEZ A;  4ULW A;  2OEV A;  5DVW A;  1P5Q A;  3U8V A;  4AEZ C;  4EWC A;  4A3V A;  2R02 A;  3EUV A;  3DXM G;  4LLE A;  4YL1 A;  4FLB A;  1HY5 A;  2CHX A;  2ETS A;  4XKC A;  4FA6 A;  3E9V A;  1NZN A;  2MYO A;  4AY5 A;  3ZGQ A;  2EPK X;  4YVQ C;  2EIN C;  1K1B A;  1LD7 A;  2X6K A;  4YDO A;  2HMQ A;  5HS0 A;  2PNN A;  2ICW G;  4Q94 A;  4UDV A;  3EGD B;  3MFN A;  3HHM A;  4XKB A;  2P9P G;  5AEN A;  3J06 A;  4G25 A;  3PZ2 A;  1QBQ A;  3APD A;  3QWW A;  4JE9 A;  5CMY A;  1HW2 A;  1OKK A;  3FUM A;  5ENQ D;  3ZEF A;  2JX0 A;  5ENT D;  1INZ A;  3ZKJ A;  5JLI A;  5FZS A;  4NIK A;  5KJL A;  4WUY A;  3HXC A;  1ELW A;  3AG4 E;  3FAJ A;  4RG6 A;  4AXH A;  3VLF A;  4OYS A;  4F53 A;  4ANJ A;  3F47 A;  3MYV A;  1HG5 A;  4JL0 A;  4WJ0 A;  5KYX B;  3B71 A;  3LDZ A;  1KU2 A;  5IY5 E;  4ACL A;  2MYS A;  4BPM A;  1HFA A;  1ST6 A;  4CS8 A;  3JSZ A;  3S7D A;  3ZQV A;  1JWG A;  1U89 A;  2L7A A;  3ATP A;  2V8S E;  1E8X A;  1GGQ A;  4RSY A;  5T8I A;  2NUP B;  3AJI A;  4MKT A;  3PMR A;  5F5H A;  5A6A A;  4DOZ A;  4ER9 A;  2WMN A;  3MKQ A;  4Q96 A;  3W9G A;  3NKE A;  3K33 A;  2XLO A;  4R32 A;  4MVU A;  3CKB A;  3NRH A;  2EPO A;  2J8S D;  4CS9 A;  3FTZ A;  3ASN C;  2A69 F;  4MTG A;  3GYZ A;  3FU5 A;  3NBN B;  1WDY A;  4YT2 A;  1UOH A;  3MEK A;  2XEN A;  3DWL G;  3V2X A;  1BD8 A;  2KQ9 A;  3C8G B;  4GQH A;  2P1A A;  5CI9 A;  5J90 A;  3Q9N C;  4KZC A;  2VCB A;  3AU5 A;  3ENE A;  3QJZ A;  3G50 A;  4GA0 A;  3R7R A;  2XLE A;  1RW2 A;  1OCC C;  3T8M A;  3X2Q E;  4I9C A;  2V0P A;  5FIO A;  1J8M F;  3TG4 A;  3QTH A;  3C72 A;  3AS4 A;  1YVI A;  5FZR A;  4KC9 A;  2KZT A;  3Q7G A;  2B0J A;  4X8Q A;  2LO6 A;  2IEJ A;  2AXZ A;  5DIZ A;  3U4T A;  3TUL A;  1JUQ A;  1BPO A;  4M7C A;  4DX7 D;  4J8F A;  2WXH A;  3SY2 A;  2VCA A;  3R7C A;  1A5E A;  1EI7 A;  4RLY A;  1QNF A;  4WWN A;  2A6H F;  3JYY A;  2DYS C;  3U0C A;  4C0M A;  2ZXW C;  4HOQ A;  1E83 A;  2YHE A;  4G78 A;  4A4A A;  3QZC A;  4O6Y A;  2YLD A;  1I5N A;  2R2L A;  4D4X A;  3CVY A;  1IQU A;  3DSW A;  1QPU A;  2XPY A;  1V55 C;  2LIG A;  5J08 A;  4JJF A;  4Q4Z F;  1SZI A;  2IO2 C;  2R05 A;  3ZN3 A;  3IQT A;  3O10 A;  1N54 A;  4EIY A;  2R25 A;  3DM9 B;  5E33 A;  3Q7L A;  2W9Y A;  2ZGG A;  2DZN A;  3RK6 A;  1YAU O;  1A7V A;  4C7O B;  1YZA A;  3QVY A;  3L82 A;  1K40 A;  3CZ6 A;  4MVR A;  2ILR A;  2R59 A;  4LRZ A;  1LS4 A;  4KI2 A;  3FH8 A;  5T4Y A;  1QKR A;  3BEH A;  3MLG A;  1QSP A;  1IXV A;  4BEM J;  3B0U X;  3W9F A;  4GMR A;  3S7J A;  3PE4 A;  3LAY A;  5KNG A;  3O39 A;  5JSL A;  3JRT A;  4TXR A;  1MZC A;  4J8D A;  2WVN A;  1G4U S;  3EHQ A;  4NQ0 A;  3B95 A;  3IQ6 A;  1N52 A;  4UI9 K;  4RBN A;  1KT1 A;  3V79 K;  1T6I A;  1B68 A;  2FGY A;  3H65 A;  4GTM A;  2A68 F;  4C3E A;  4QFV A;  4DX1 A;  1SYQ A;  5JRA A;  3AAA C;  5KJM A;  3UT7 A;  3NQP A;  4ZHB A;  1TYQ G;  3FOO A;  2NYJ A;  3PZ4 A;  1KPS B;  2H7B A;  2WQ7 A;  3DRA A;  1L3P A;  3E30 A;  2WXK A;  3SZ7 A;  3S7B A;  1EDU A;  3CVX A;  5KCM A;  1Y6I A;  3SZR A;  2PFD A;  3RRU A;  3L54 A;  3L8J A;  2RSE B;  2I9C A;  2XRH A;  3HVE A;  2P0N A;  1KT0 A;  4MVO A;  4I6J A;  4DRH B;  3U66 A;  5A6C A;  4JA7 A;  3EFO B;  2FO7 A;  4A63 B;  4MLP A;  1HMD A;  2WVO A;  3ASH A;  4NTB A;  5FCL A;  4FJY A;  3W8H A;  1G3N B;  1OXB A;  5JHB A;  4J32 B;  1GS9 A;  1CPQ A;  4DLO A;  2DWZ A;  3WG7 E;  1FAP B;  3SBS A;  3Q79 A;  3MZL B;  3FUH A;  3UKR G;  3V30 A;  2G3K A;  3OWT A;  3LY7 A;  1N4R A;  3I4R B;  4K03 A;  1HG2 A;  3JUI A;  1ZU5 A;  1N4Q A;  3Q47 B;  4B8C B;  1TR2 A;  1AEP A;  2PQN A;  4MS6 A;  2IY0 C;  2Y3D A;  4JUR I;  3FTY A;  4I44 A;  4DVY P;  3K6B A;  4I2W A;  3VRC A;  4AOF A;  3LYA A;  3MX3 A;  4I1A A;  5T3T A;  1PY1 A;  3CVW A;  4FLH A;  2YEV A;  1PC2 A;  4I43 A;  4FES A;  4JA9 A;  2EPM X;  5COM A;  4IAQ A;  3VLE A;  4NCQ A;  3FH7 A;  2VJ8 A;  2HJ3 A;  4LLC A;  2R7U A;  2B0O E;  2LAI A;  2OND A;  4HS2 A;  1HE1 A;  2WXQ A;  3I5P A;  2HFI A;  2HM8 A;  4CIH A;  2WZG A;  1DVP A;  4JC8 A;  5G55 A;  3G2T A;  4DI3 A;  1T6Q A;  1VK5 A;  2P58 C;  3H2V A;  4JVS A;  2M4E A;  1Z7Q c;  3IEG A;  1JOG A;  1ORS C;  2YVK A;  1E84 A;  1MNE A;  1QLE C;  1ZW3 A;  4E17 A;  3ZYM A;  3R9M A;  2KGO A;  3EZH A;  3QAQ A;  1A7E A;  3V7O A;  2ZIS A;  2BED A;  5AC5 A;  4A1G A;  2XL6 A;  2WVQ A;  2JAB A;  5EIL A;  4O60 A;  2AU5 A;  4P9F A;  2UUH A;  4XWJ A;  3GOR A;  1I4Z A;  2AW6 A;  2XL8 A;  3N2Z B;  3WHN A;  3ZTM A;  2CHW A;  3RRN B;  1MND A;  4OIP F;  2J0W A;  4LDK A;  2VB6 A;  2J9W A;  3NMK A;  1UN8 A;  2JPU A;  3NZU A;  4R7L A;  5BQG A;  5A23 A;  3RW0 A;  5C1D A;  4JTC B;  3PUK A;  2LCH A;  3QVZ A;  3IHU A;  2A4Z A;  4XQ1 A;  3C3R A;  1YLM A;  3QKY A;  3IKO B;  4XEV A;  5FJY A;  3J5P A;  3C98 A;  4FAD A;  3GZ2 A;  2J9U A;  1VLT A;  4TXP A;  2V3C C;  3CST A;  4XZ4 A;  2XXA B;  3KS2 A;  2H6I A;  1Z5Z A;  2L0T B;  3RVY A;  3T5X A;  4J7T A;  1EKY A;  2C03 A;  2Q4F A;  3TAX A;  4URK A;  1OKK D;  2ETA A;  3L0I A;  4BEJ A;  1OR2 A;  2HSQ A;  5A6B A;  3ZWI A;  3K66 A;  1TJC A;  4AL1 A;  5ENP D;  4UWL A;  1HS6 A;  5ARF A;  3EGX A;  2P6V A;  4U04 A;  1I4Y A;  4ANV A;  2R5S A;  3M79 A;  3LCA A;  3UMK A;  3BG0 B;  3VTY A;  3LXU X;  1ZHT A;  2GA0 A;  2PF4 E;  1YAR O;  1UJK A;  4GTO A;  3SD5 A;  1E96 B;  5TJ5 E;  1C03 A;  1RKC A;  4O79 A;  4YJW A;  2NC9 A;  4I3M A;  3TJ5 A;  3FVY A;  1OWN A;  3S90 A;  2Q00 A;  3BRJ A;  4JTA B;  3C62 A;  1JR8 A;  4I1O B;  2QYJ A;  4LDQ A;  5CCL A;  3SQV A;  3TL5 A;  3OTN A;  3ISM C;  3CV0 A;  1LM3 B;  2J9B A;  3NMI A;  2IXO A;  3HKK A;  3QMK A;  3W2W A;  3HG0 D;  3P2B A;  2HYZ A;  4DRX E;  4JIO A;  3AS5 A;  2Y3G A;  4MVM A;  4L6R A;  3LY8 A;  5IY5 C;  2LFD A;  1SZ9 A;  3CGH A;  3HXE A;  5HKP A;  2I8B A;  2HUJ A;  4CBE A;  1JCQ A;  1XZP A;  5ANR A;  2EIL C;  3CK7 A;  3BQO A;  2F22 A;  3U9J A;  3IQC A;  4AE4 A;  2R9R B;  3M4C A;  3UGP A;  2WXR A;  1O1T A;  3FFL A;  1U2V G;  3SHF A;  1TNY A;  4NUR A;  4CRW A;  1T6U A;  1BR2 A;  4G11 A;  2X51 A;  2ZXR A;  3FH5 A;  3ZHE B;  4PS8 A;  2IO3 C;  3D9N A;  5L0G A;  1JPN A;  3EHN A;  5C2Y A;  3HDX A;  1IHB A;  2VGX A;  1W2W A;  5A7D B;  3V5X A;  1NA3 A;  2QZA A;  1ZU4 A;  2UY1 A;  3EH2 A;  4JCZ A;  5BV1 A;  3SXM A;  3HIZ A;  2J46 A;  2FAP B;  1U3D A;  2VAS A;  1OWL A;  2WXL A;  2L6F A;  1N1C A;  4DBR A;  1HE9 A;  4EBJ A;  1NU9 C;  2MRI A;  3NMJ A;  1RKE B;  2QC9 A;  2VTB A;  4Y6C A;  3RIP A;  3S28 A;  4U63 A;  3TWV A;  3DKA A;  1JAF A;  2OJQ A;  4MS2 A;  1FMW A;  3KL4 A;  3V5Y A;  3DPY A;  3RQG A;  5B1A E;  1O3U A;  1QZX A;  2PL2 A;  4BX8 A;  1YDI A;  5JJ7 A;  5EX3 A;  3PUJ A;  4U95 D;  4CDM A;  4MVQ A;  1VMA A;  4J7Y A;  1KLX A;  4U5E E;  3L16 A;  1LE4 A;  5JVE A;  2CG2 A;  3U3F A;  3FWV A;  1W3B A;  4YWQ A;  3L1M A;  3VF0 A;  4B8A A;  5ARG A;  3ULE G;  1AWC B;  2XL4 A;  4W8K A;  2B6C A;  2YQ8 A;  3VYW A;  1FVH A;  1NP7 A;  4GCN A;  1B89 A;  2KYH A;  3TD7 A;  4WGZ A;  5CBO A;  2WM9 A;  4BJ6 C;  2MOW A;  2QTV A;  4CDY A;  2GRN B;  3AGT A;  2BKK B;  3ZQY A;  1MQS A;  4KMO A;  1H9T A;  2EIJ E;  4HRM B;  5HRY A;  5KYW B;  3UR3 C;  5KYY A;  2TMV P;  3TJP A;  4XLP F;  4AK9 A;  5DQT A;  3BG1 B;  2JD3 A;  3B7B A;  3BU8 A;  3NG1 A;  2J09 A;  3RKV A;  3EG9 B;  2ETB A;  1EYH A;  3IHY A;  3CVN A;  3JYH A;  5AQ7 A;  4U5D E;  1WGW A;  4HE8 D;  4CCA A;  2H6F A;  4APF A;  3CK9 A;  3EJN A;  4G2V A;  1S05 A;  2ETC A;  1MX6 A;  2ZIR A;  3C3O A;  3DXK G;  3D9J A;  4RG9 A;  4K0D A;  3HYM B;  1M57 C;  2Q9C A;  4YT4 A;  3U9M A;  3NYL A;  4HI9 A;  3I3N A;  5FTP A;  4CGV A;  4MTF A;  3DXJ F;  4NY3 A;  3V2O A;  3IQ5 A;  4P9T A;  5F28 E;  4ABN A;  4O6N A;  3CIA A;  3Q6M A;  4C3D A;  4YL0 A;  4DPR A;  2XM4 A;  4LER A;  2YIN A;  3ZPJ A;  3RSE G;  3MV2 B;  1RXQ A;  1YMP A;  3GZ1 A;  3SI5 A;  3KEA A;  3HRA A;  4N2Q A;  2IXM A;  3LUT B;  4XIF A;  4K0R A;  3UX4 A;  3GEI A;  5D0Q D;  3T9O A;  4HOU A;  3F6Q A;  4CGW A;  4DJ9 A;  2L6B A;  3JUE A;  4D4N A;  5KYX A;  2HV7 A;  3Q6N A;  1HZ4 A;  3C63 A;  3D9P A;  2Q3T A;  3DAG A;  2AVP A;  4I2Z A;  3R9A B;  2LAH A;  1MMA A;  1ORY A;  3JTL O;  5T3W A;  5E76 A;  1X81 A;  2NUP A;  2VSY A;  3ESL A;  1M2V A;  4AP2 A;  4P6I C;  2WXG A;  4N06 A;  2P9U G;  3DZA A;  3ASG A;  1WG0 A;  4JB8 P;  4QI2 A;  3U8P A;  4RVB A;  4F3V A;  1SR2 A;  2H7O A;  3UM1 A;  3T4R A;  4J6I A;  3ZIM A;  2YLI A;  4U8H A;  3LS0 A;  3WG7 C;  3AQC A;  5AQ9 A;  1SW6 A;  2P9K G;  3FTX A;  1RJ9 B;  4PS3 A;  5BPP A;  4OIN F;  2QFC A;  4HFK B;  1KZP A;  1E7V A;  4WNF A;  4OD5 A;  5EGY A;  4L9P A;  4G7H F;  2IU1 A;  3ONL A;  5ENO D;  2XZT G;  4YDY A;  1TNB A;  2NG1 A;  3ONK A;  4GYO A;  3PCV A;  5FQ6 A;  4CT0 A;  4CS8 C;  1PAQ A;  4U0U A;  3TOL A;  2H7V C;  3IBE A;  1ZB1 A;  3LLI A;  3JYS A;  1IZM A;  3VAY A;  1OCO C;  3FEY A;  3QAR A;  1YA9 A;  3GM2 A;  1OR3 A;  2EIL E;  5LOZ A;  5BNW A;  1UJJ A;  3ZVV A;  5AN8 A;  1TN8 A;  2KSF A;  1BLX B;  2IBF A;  4RQI A;  3U9W A;  2OVF A;  5M72 A;  1Z5S C;  4F4B A;  5EYL A;  5D66 A;  1OT8 A;  1ZVZ A;  3CR3 A;  2CYD A;  3D9K A;  3E32 A;  2OEW A;  3CVV A;  4CS9 C;  1XWJ A;  3JCU Q;  2G62 A;  3CHM A;  4IYP A;  5BXO A;  4ACK A;  5L0H A;  1OWM A;  3EIJ A;  1TWA A;  2GGF A;  2C0L A;  4HFG A;  5CCM A;  1V54 E;  4U5G A;  4GMJ A;  4A1S A;  2EQX A;  1VOM A;  2X0C A;  2CFZ A;  4JC7 A;  5L3Q A;  1A17 A;  3MGB A;  3LJB A;  3G4X A;  1JMW A;  3MCX A;  3IEE A;  2D4U A;  1TNZ A;  3RAU A;  1M56 C;  3UPV A;  2YL7 A;  5LFA A;  4C7O A;  1ZBP A;  3O48 A;  1T9K A;  2GWW A;  2HE0 A;  4GU5 A;  3DSU A;  5HV9 A;  4CEM A;  5K0I A;  2XPI A;  1T5O A;  1F1M A;  4WNE A;  4TV3 A;  4F6R D;  2CGE A;  5E3A A;  3I4G A;  3VLD A;  3DPD A;  5A6B D;  4NTA A;  1QQE A;  5G2N A;  1ZZP A;  3WOD F;  3SXY A;  3DAF A;  2DB4 A;  2W4M A;  1E8W A;  2RFA A;  2GRL A;  3JQ1 A;  4BJ5 A;  4KBQ A;  5G05 J;  2J4D A;  3RKO F;  2E87 A;  3OXL A;  5FQ8 A;  4LEU A;  5G04 J;  3E37 A;  5G05 C;  5AYW D;  3B7S A;  4DXW A;  1GQA A;  1K1A A;  3CHP A;  3QWP A;  3FEX A;  2A0B A;  3LLK A;  2EIK C;  2D5R B;  1C02 A;  1MHQ A;  4BWR A;  3ZYL A;  4N6C A;  1X5B A;  3MKQ B;  2VQ2 A;  4O1O A;  2OG2 A;  3DWW A;  1Z3Y A;  3LS8 A;  5JA4 D;  3FDH A;  3KSQ A;  3HXB A;  5KWD A;  3M4B A;  4ANW A;  4Z9H A;  2MHR A;  2PQR A;  3KD7 A;  2DCP A;  3D9L A;  2VGY A;  1ZW2 A;  3UMV A;  1TR4 A;  2OU6 A;  3RQF A;  4G1T A;  4WAF A;  3EFO A;  3CHQ A;  2CCY A;  1OCZ C;  1Y4C A;  3TGO A;  3KYJ A;  4ILI A;  2EPL X;  3N71 A;  2IJG X;  3DJU B;  3SBT B;  1FR0 A;  3DEP A;  4CS7 A;  4E0H A;  2I1J A;  4AX2 A;  3CAX A;  3UIO C;  3FHE A;  2O9X A;  1JPL A;  2RD0 A;  3HNK A;  1WM5 A;  1YYX A;  1K8K G;  4U5H A;  4PJN A;  1G5Z A;  4UWG A;  5CRU A;  1Q0D A;  3FHD A;  2I1K A;  2L6G A;  4JEB A;  1N9A A;  4JHR A;  1BU9 A;  2WQ6 A;  5FZQ A;  4A2N B;  1TWC A;  5HSW A;  2GRQ B;  2RG8 A;  4J8S A;  3CQZ A;  4C0E A;  3ULY A;  1D8E A;  1H6O A;  4K1O A;  2DZO A;  3PZ3 A;  3RH3 A;  3KPH A;  4PJL A;  2PM6 A;  2XGM A;  4BT9 A;  3NB2 A;  4NRH B;  1PD0 A;  3AQB A;  2P9I G;  2VSX E;  3RVZ A;  4Q69 A;  1LIH A;  5BT1 A;  3DSX A;  1FCH A;  4GTQ A;  1RCP A;  5FQ4 A;  4EBB A;  2HO1 A;  3GEH A;  1IHG A;  4KT6 B;  5KBA A;  4GA1 A;  4G26 A;  1WTY A;  3SXK A;  3TWS A;  5KNH D;  2JEK A;  2BC5 A;  1V74 B;  2BE5 F;  2L0I A;  2AWC A;  4UUC A;  3BUA A;  3UGO A;  2QY7 A;  4G23 A;  5CBN A;  1JPJ A;  2FBN A;  2CNW A;  1G8X A;  4HOS A;  4B6I A;  4CSA C;  4YDW A;  3S7F A;  3LKU A;  2L9B A;  2EIM E;  5B1A C;  3V5Z A;  1OCO E;  3QC1 A;  3U2M A;  5A6K A;  4CSA A;  4CDR A;  3DMD A;  4WGY A;  3CEQ A;  3NAW A;  2UWJ G;  3LEV A;  2P7V A;  3LVR E;  3CK8 A;  3CVU A;  1IYG A;  4LDR A;  2X6F A;  4HQD A;  5CIV A;  3ULQ A;  3GWN A;  3FUL A;  3US6 A;  4JEU A;  4F7A A;  2IFU A;  1TFO B;  4DX5 D;  1DOW A;  4AJW A;  3SXZ A;  2WZL A;  4PFP A;  5JUA A;  3UT4 A;  2WPV A;  3CLJ A;  2Y69 E;  3HLZ A;  5H7P A;  4EPZ A;  3FU0 A;  2EPN A;  2XXA A;  1UW4 B;  4J8E A;  4IJJ A;  1ORJ A;  3W2V A;  3O55 A;  2EIJ C;  4M3O A;  3HVE B;  2XLH A;  4XPY A;  2NSF A;  3PRZ A;  1QYM A;  2ION A;  4YL3 A;  4ONS A;  4GTT A;  3OAW A;  3UT8 A;  2LSU A;  1H19 A;  3QOU A;  3AJM A;  1OQC A;  4CJG A;  5ENR D;  3U64 A;  1H2V C;  1EPU A;  1APC A;  3E34 A;  2GDC A;  2IXP A;  1LTX A;  2AXU A;  2YQY A;  3T6J A;  4GTP A;  2OOE A;  4WND A;  2M64 A;  3FUK A;  4KNW A;  1SA5 A;  5EDS A;  3G2S A;  4ILH B;  3AU4 A;  5CED B;  3AS8 A;  1RMV A;  4U07 A;  1Z6A A;  4JCH A;  3ZYK A;  5D91 A;  5L0D A;  1FPP A;  1TKN A;  4G0H A;  4CT4 A;  2HSB A;  1A41 A;  2IM8 A;  3PZD A;  4KNV A;  3DSV A;  5B1B E;  3SFZ A;  3RO3 A;  4G8K A;  3LY9 A;  3CVL A;  1OW7 A;  3MKR A;  1N4P A;  4GTS A;  4ATG A;  3TWU A;  1FFH A;  4TUU A;  2UUI A;  3HTK C;  4MW3 A;  2DIW A;  1VLS A;  2IYL D;  1ZHW A;  1MJ0 A;  2XS1 A;  2FUL A;  3ABM C;  2EIK E;  4GB9 A;  4KZ0 A;  2A0U A;  2C04 A;  2ZXO A;  3B0P A;  4FHK A;  1NLX A;  4JPS A;  2XLD A;  2Y39 A;  2R7S A;  4XI0 A;  2XLV A;  4Q5S F;  4WWO A;  1AP7 A;  1A0B A;  3CHS A;  4X0R A;  3G4Z A;  1HX8 A;  2GRP B;  3L9T A;  4CYM D;  2BUG A;  3TWQ A;  1K05 A;  3D9H A;  4JEA A;  4GML A;  5COF A;  1ELR A;  4ZLD A;  1HXI A;  4HBD A;  4BJT A;  3APF A;  2KW3 C;  3IXE A;  4ANU A;  1N0Q A;  4QI0 A;  2XCC A;  5D92 A;  2KAT A;  3ZHE A;  2Y4U A;  1JRA A;  3GW4 A;  1OCZ E;  5BW8 C;  4B89 A;  3GZS A;  1YA0 A;  4IAO A;  3ESK A;  1CPR A;  4U0Z A;  4ZFH A;  4UI9 J;  3KMI A;  2QY9 A;  4U0S A;  1XZQ A;  5AIJ A;  2J07 A;  4BES A;  3SP1 A;  3GAN A;  4UI9 C;  4OVV A;  1D0X A;  1VDY A;  1SQM A;  1HF8 A;  3CQC B;  4LNG A;  4BET A;  5KJN A;  4GYW A;  4DRJ B;  1RKE A;  4AY6 A;  4XPX A;  3NYJ A;  3HNJ A;  4GYY A;  1ZHY A;  1QZ2 A;  2RD9 A;  5JT4 A;  2CDQ A;  3NOG D;  2XCB A;  4YT8 A;  3ABK C;  4BFR A;  4E6H A;  5E2Q A;  1D1B A;  3KYI A;  1FMV A;  1H2U A;  3PH0 C;  3QWV A;  2JLB A;  3EPV A;  3IPM O;  3LES A;  4QQI A;  3CSF A;  5BUO A;  2GFH A;  1Z63 A;  4N3C A;  4BTB A;  3RU0 A;  2PX0 A;  2XM0 A;  3UMH A;  4EZL A;  4AV7 A;  2OEX A;  1BR1 A;  1Q2Z A;  1NU7 D;  1Y6D A;  1D8D A;  1NL4 A;  3F46 A;  3AGU A;  5L0F A;  3SYN A;  5AQA A;  3EGX B;  2BTD A;  2MHK A;  3DD7 A;  3QNK A;  1CGM E;  3A9C A;  1IQR A;  4XEK A;  1V54 C;  3T9K A;  3P1U A;  5KYW A;  2DYR E;  3LNM B;  3ASO C;  1KNY A;  4UWK A;  3JSE O;  3K9I A;  1H6K A;  1IW7 F;  3EG9 A;  1LI5 A;  4Z9J A;  4XE0 A;  5LX8 A;  4EZK A;  1WY6 A;  4TUM A;  3V31 A;  4BX9 A;  5F5F A;  4UWF A;  2YNQ A;  3JRM O;  1HU3 A;  5T3R A;  2NSG A;  2NUT A;  2G3V A;  3MYI A;  3S2A A;  1TWG A;  4H7X A;  4DX2 A;  1Q0M A;  4XX5 A;  3TK0 A;  2R7Q A;  4L2Y A;  4G24 A;  4GZC A;  3ZG1 A;  3EU5 A;  1NI1 A;  3IV0 A;  4YN0 B;  2XLW A;  1M6T A;  5BV0 A;  3AG1 E;  3TG5 A;  1H9G A;  1A7D A;  5CER B;  2KNH A;  2Y3B A;  4WWP A;  5DBK A;  1ZHX A;  1HO8 A;  2HJM A;  3M1C B;  1WN0 A;  3MBG A;  4W8P A;  3UQ3 A;  3AG3 E;  3S27 A;  3AG2 C;  2PP4 A;  1GW6 A;  2RFM A;  3Q7F A;  1EA8 A;  4CDN A;  3PNL B;  1ZU2 A;  2A6E F;  2J4B A;  1AVO B;  4ULV A;  4N2S A;  4PDX A;  4DK5 A;  2V5F A;  2WXN A;  1LPE A;  2Y3H A;  4JRZ A;  4N5Q A;  3B7T A;  4GZ5 A;  1L7C A;  2OCC C;  4GYT A;  2QE9 A;  4GTR A;  2KCV A;  3QW1 A;  2VGX B;  3TWR A;  1BR4 A;  4V3I A;  4HB5 A;  4J7W A;  1T01 A;  3FY4 A;  4LSZ E;  3UKU G;  2UY1 B;  2FF4 A;  5E3C A;  2KBX A;  3FUN A;  4XEF A;  2Y4T A;  2KJG A;  3FUI A;  3UXG A;  1ZHZ A;  4J30 B;  4H7Y A;  2ASR A;  2IOQ A;  3OEO A;  4FWV A;  4LAC B;  2ZU6 B;  3EHR A;  3D9M A;  2ZXP A;  3EGD A;  3I5Q A;  4U5C E;  5E75 A;  1QQ3 A;  2CG3 A;  5JS5 A;  3D9O A;  5KYU B;  2R7X A;  3TQO A;  2XLM A;  2HZ8 A;  4Q7C A;  1PD1 A;  5ENS D;  2VYI A;  4ME2 A;  2R7T A;  2FO1 E;  3KEZ A;  1HE8 A;  4HRN A;  2WXO A;  2V5Q C;  3RQE A;  4C9B B;  4NC3 A;  4J0U A;  3ZU7 B;  2KXP C;  2WB2 A;  4DRI B;  1H7I A;  1NG1 A;  3ABM E;  1TFK B;  4FP7 A;  1UG7 A;  3HXF A;  5BXU A;  2KC7 A;  4IB4 A;  2XRY A;  3ZUV B;  2QYU A;  3N0T A;  4E7Z A;  2A5E A;  2HKV A;  5B3S E;  3MV3 B;  1MMD A;  2WXI A;  4OAV B;  3LPZ A;  4MVZ A;  3PRE A;  5AQB A;  5DLJ A;  3M15 A;  5HQ8 A;  4MTO A;  4RDA A;  4PJM A;  2AWI A;  2VGE A;  2FI7 A;  2V26 A;  3EHM A;  4AVX A;  3U2L A;  2WMO A;  1TQG A;  4JZA A;  4CJO A;  4GPM A;  3NOC D;  3TWW A;  4AL0 A;  3LNR A;  1YYH A;  3G2U A;  4FC8 A;  3Q75 A;  5AC4 A;  1VTM P;  4FX5 A;  3Q49 B;  2I2O A;  3HNL A;  1TJF A;  3O6X A;  1MMG A;  3TOM A;  4U8V D;  5AJL A;  1FFT C;  4LUN U;  5KYN A;  3C8G A;  3PDN A;  1H6G A;  1E7U A;  4MBG A;  4C48 B;  2R17 C;  4N4W A;  2KCK A;  3S29 A;  2X6H A;  4LNU D;  3C3Q A;  1Y8M A;  2OJE D;  2MWQ A;  1J8Y F;  3DI5 A;  3ABK E;  3B29 A;  2EIM C;  2HV6 A;  4JHJ A;  1G4W R;  1CGN A;  4BSX A;  2NPU A;  2ZGD A;  4K5B A;  3ABL C;  3VM6 A;  4GAA A;  2QNL A;  3DBS A;  3E33 A;  1OXJ A;  1TWH A;  2R03 A;  3MYF A;  1DNP A;  3S84 A;  1U3C A;  2IF4 A;  4HLL A;  1JCS A;  4N3B A;  5JJT A;  4CZ2 D;  1LF8 A;  2J7P A;  1KTM A;  2XEH A;  2Q7R A;  4FUL A;  4BSZ B;  1XNF A;  1E86 A;  4BY6 A;  2Y69 C;  1Q0K A;  1C17 M;  1S0P A;  1LE2 A;  1Z3I X;  3FP3 A;  4EBK A;  3PZ1 A;  5CI8 A;  1M2V B;  1Z3X A;  3UUX A;  4EBA A;  3W8I A;  3C5R A;  2ZD9 A;  3ZXP A;  4DVZ A;  3ASO E;  256B A;  4XLN F;  4JHK A;  1FT1 A;  5DQZ A;  2XZD G;  3B9Q A;  3NDB B;  2R7O A;  2Y0B G;  4GZD A;  4OIR F;  2BKG A;  2LUH A;  4GPK A;  1SF8 A;  4DX6 D;  1VB5 A;  3ZC4 A;  4BTA A;  4YDE A;  2XSE A;  3K1H A;  1OUV A;  3L34 A;  4Z9I A;  2BL2 A;  1LKX A;  2PBE A;  4HOR A;  1D0Y A;  1FT2 A;  3G2W A;  5AJD A;  2R7W A;  4TRQ A;  5EKQ D;  2VH3 A;  3J5Q B;  4HEA J;  4EUK B;  3GWL A;  4BJ5 C;  4JW1 A;  3URZ A;  4GEH A;  1O87 A;  1OXK A;  4DBQ A;  1KZO A;  3NKD A;  4HOT A;  5B1B C;  4XPW A;  3Q5M A;  1DOV A;  3G2V A;  1ZYR F;  5LP0 A;  5AAR A;  4N5C A;  2IOS A;  4IN3 B;  2XRZ A;  3AG2 E;  4PFO A;  2P9L G;  5ENN A;  3SNH A;  4HLE A;  5G04 C;  1S64 A;  3TWT A;  5FZT A;  2Q9A A;  2XEV A;  3QDN A;  4U8Y D;  4PS7 A;  1TNO A;  2A5U A;  1FVF A;  5L3V A;  3UMI A;  2L81 A;  3LJN A;  2OCC E;  4WAB A;  2LK4 A;  2YHC A;  4YVO A;  4FAP B;  2WQH A;  3DEO A;  4HXI A;  5ANL A;  3WAQ A;  3FAP B;  4E7S A;  1NZE A;  4B93 B;  1AUE A;  3D3M A;  4MQ9 F;  2YL0 A;  3QW0 A;  3RF3 A;  1UN9 A;  3LEO A;  1WAS A;  4E85 A;  2IXN A;  2WZF A;  1H6P A;  2C0M A;  2XGO A;  1JWF A;  4FJZ A;  4JTD B;  1TN6 A;  3HNI A;  2LXM A;  2P9N G;  1D9S A;  1MMN A;  1R5I D;  1MYO A;  3FU6 A;  4YT5 A;  5DS6 A;  5EN5 D;  2Y3A A;  1LVK A;  5B3I A;  1ELK A;  3EIQ C;  2GW1 A;  1TN7 A;  3Q78 A;  3ZW3 A;  2DI3 A;  2W4B A;  2KZT B;  4L2L A;  2A1D D;  4JKV A;  4AIF A;  3L13 A;  2GAQ A;  2WXJ A;  3RRM B;  4U9E A;  4CIP A;  3FXH A;  2W45 A;  3H2U A;  1M2O A;  3C7J A;  5D2M C;  3GEE A;  1N11 A;  3LEW A;  1EQ1 A;  4XI9 A;  1UG3 A;  3NZS A;  2AP3 A;  3UI2 A;  3E4B A;  1E8Y A;  3L8I A;  4YND A;  3TJ6 A;  1BDJ B;  3JCK C;  4GZ6 A;  4J8Y A;  4O6M A;  1HMO A;  4EQF A;  2BF0 X;  2LNI A;  3DE9 A;  1O5M A;  4JZY A;  3OXG A;  2Q9B A;  2YKZ A;  2GRR B;  3BEE A;  2OV8 A;  1FNT c;  3UTM A;  3TXM A;  2P61 A;  4JJG A;  5L0C A;  4GZ3 A;  4P29 A;  4IAR A;  2KC3 A;  3JXJ A;  3NYM A;  3PVL A;  3JT1 A;  2LSV A;  1YA7 O;  1LS1 A;  1D1A A;  4GA2 A;  3FTS A;  3DST A;  2R7V A;  1O1S A;  4XEI G;  3FUD A;  3A11 A;  3T8K A;  4E0I A;  2DYR C;  3TXN A;  2L6H A;  4EKW A;  4KYO B;  2HMZ A;  4XTK A;  4L1B A;  4U96 D;  2PX3 A;  3RYL A;  4OIO F;  2EIN E;  3NF1 A;  4GTV A;  3VTX A;  2H8A A;  1WOL A;  2CW0 F;  2FEZ A;  1HH8 A;  4PK4 A;  2WL8 A;  1L5J A;  5EK0 A;  4YK5 A;  5AAO A;  5FQ7 A;  4O6F A;  4G7Z F;  4NAC A;  4DUI A;  4M63 A;  2LSE A;  2KM4 A;  1SVX A;  3ABL E;  2LQG A;  3GM1 A;  4O7G A;  5CHE E;  1PV3 A;  1H0A A;  2IQC A;  2B0H A;  3ZFW A;  4MVS A;  2IOL A;  5A69 A;  3AG1 C;  2YZS A;  3CHO A;  5EYP F;  1DCQ A;  3L08 A;  4LNB A;  2HR2 A;  4KVM A;  2VSN A;  3AG3 C;  4WNG A;  4U9D A;  3U3B A;  4KXK B;  1N95 A;  2XS8 A;  3S0X A;  2CFU A;  2X3M A;  4Z68 A;  3SO8 A;  3FTW A;  4L7T A;  1K3Z D;  1WAT A;  4GCO A;  4ZLC A;  3SF4 A;  3X1O A;  2DVW A;  2M63 A;  1OW6 A;  3TWX A;  1JCR A;  1YJG A;  4DLQ A;  3R7Q A;  4EEC A;  1NBB A;  5T1D B;  3ASN E;  1NFI E;  3KH2 A;  2PM7 A;  4EZJ A;  1WWP A;  4N6H A;  4IGG A;  1N94 A;  3LJ3 A;  4UQX A;  1SMY F;  1S7Z A;  1GM5 A;  4A55 A;  5L0J A;  4MW8 A;  3FUE A;  3ZXS A;  2F8Y A;  3EU9 A;  1N0R A;  4BG0 A;  3CQG B;  4U7E B;  1OCC E;  2AXV A;  4OD4 A;  3AOU A;  3PEV B;  5DS5 A;  4IUL A;  3ZYQ A;  5BQH A;  3SFX A;  1K04 A;  1D0Z A;  2QLA A;  1QVX A;  4W9R A;  4K5A B;  5EIB E;  1BBH A;  3E70 C;  2P9S G;  4UWH A;  4JD2 G;  3EQL F;  4K7B A;  4A3T A;  3W4Y A;  3FDQ A;  1OCR C;  2KK1 A;  1SA4 A;  2R7R A;  2C2L A;  2PZI A;  1V4A A;  3HXD A;  2DYS E;  2XGS A;  5HI7 A;  1NFO A;  2ZXW E;  3PNT B;  3S9O A;  4AM9 A;  5B3S C;  4I17 A;  2GRM A;  5CMW A;  2J9V A;  1FTS A;  3C8G D;  1D1C A;  3FUF A;  4I6E A;  4HI8 A;  1MX2 A;  1E2X A;  3L17 A;  3SFY A;  1UFB A;  3ML8 A;  4IWB A;  1U0B B;  4PAC A;  3C18 A;  1YCS B;  2H6G A;  3APC A;  1NFN A;  2Z15 A;  3L22 A;  4E18 A;  2OOC A;  1V55 E;  2AVK A;  3U5S A;  4N3A A;  4O1P A;  1O5H A;  3UIP C;  3RIB A;  4OAU C;  5D0O D;  3JZ0 A;  2AJA A;  2J9Q A;  3JXI A;  3Q4A B;  1BI7 B;  3PE3 A;  4CDV A; 
#chains in the Genus database with same CATH homology
 4HVB A;  4MRU A;  4F1S A;  3T6B A;  1Z23 A;  2J7P D;  4OVU A;  2I6H A;  3FTV A;  3SNX A;  3FTU A;  3OA1 A;  4JXT A;  5JJ6 A;  3FUJ A;  1Z6T A;  3RFY A;  3EH1 A;  5BUZ A;  4DJA A;  2XHE A;  3U3W A;  4BT8 A;  1XGW A;  3AG4 C;  2XQ0 A;  3OXF A;  5FWQ A;  3DM5 A;  4EBA G;  5DS4 A;  4I1M A;  3B7U X;  4B94 A;  3ITF A;  5KJK A;  3CVQ A;  4B0Z A;  3ZIB A;  3IHV A;  4Y6W A;  4QDL A;  4KBL A;  5JHA A;  3GOD A;  2XPZ A;  3ECS A;  2E0I A;  1NA0 A;  4JEH A;  3ASD A;  4KVO A;  1H2T C;  2Q7F A;  3N24 A;  4L23 A;  3POV A;  2WXP A;  2OVB A;  3T5V A;  3CHR A;  3ASF A;  3PEU B;  4OIQ F;  4U5F E;  1OWO A;  2CHZ A;  3CKC A;  2VSO E;  3KKB A;  3PHF 2;  3QK0 A;  2J45 A;  4I9E A;  4RD9 A;  2X6I A;  3HJC A;  5KYU A;  3DJN B;  3L6A A;  3X2Q C;  2WB7 A;  3SEO A;  5EHH A;  3RJV A;  4BJ1 A;  3KAE A;  3EZI A;  3LVQ E;  2J0X A;  3SGH A;  4MND A;  3ZVR A;  4AE4 B;  3EDT B;  1E90 A;  3MJW A;  3B0V C;  4G7O F;  3WXX A;  3D9I A;  4PJJ A;  3PS6 A;  3B13 A;  2DGJ A;  3CSK A;  3RO2 A;  4H4K C;  3K1I C;  2YHS A;  3FU3 A;  4UQY A;  4BJ6 A;  3QB2 A;  3O4Z A;  2FFH A;  4D10 C;  4UQZ A;  4DI4 A;  2WXM A;  2J49 A;  2E2E A;  2V4L A;  4PH4 B;  2VTB B;  4ILG A;  2KCL A;  4I6G A;  1WAO 1;  5EX0 A;  3B7R L;  4HFF B;  2X6J A;  2NUT B;  1RJ9 A;  1EF1 C;  3CVP A;  2WXF A;  3Q15 A;  4N39 A;  4FHJ A;  1E8Z A;  2ZPA A;  2WVI A;  2L6J A;  3JQ0 A;  4U5B E;  4PUC A;  2NXP A;  3MA5 A;  3ML9 A;  1VYK A;  4FU3 A;  1VYI A;  1PCX A;  1SZA A;  3I4U A;  3LS1 A;  5FT9 A;  2X38 A;  2DBA A;  2J08 A;  5LCW J;  3ZSU A;  2CNW D;  3UNG C;  4LCT A;  2NSZ A;  4APO A;  5KYY B;  4ANX A;  3K7D A;  5LCW C;  2L9J A;  1OWP A;  4C3B A;  4IRU A;  3ZRH A;  1TEZ A;  4ULW A;  1P5Q A;  5DVW A;  4AEZ C;  4EWC A;  4A3V A;  4LLE A;  4FLB A;  2CHX A;  4XKC A;  4FA6 A;  3E9V A;  1NZN A;  4AY5 A;  3ZGQ A;  4YVQ C;  2EIN C;  2X6K A;  4Q94 A;  3EGD B;  3HHM A;  4XKB A;  5AEN A;  4G25 A;  3APD A;  3QWW A;  5CMY A;  1OKK A;  3FUM A;  3ZEF A;  1INZ A;  5FZS A;  5KJL A;  4WUY A;  1ELW A;  3FAJ A;  4RG6 A;  4AXH A;  3VLF A;  4OYS A;  4F53 A;  4ANJ A;  3F47 A;  3MYV A;  1HG5 A;  4JL0 A;  4WJ0 A;  5KYX B;  3LDZ A;  1KU2 A;  4ACL A;  2MYS A;  1HFA A;  1ST6 A;  4CS8 A;  3JSZ A;  3S7D A;  1JWG A;  2V8S E;  1E8X A;  4RSY A;  5T8I A;  2NUP B;  4MKT A;  3PMR A;  5F5H A;  4DOZ A;  2WMN A;  3MKQ A;  4Q96 A;  3NKE A;  3K33 A;  3CKB A;  3NRH A;  4CS9 A;  3FTZ A;  3ASN C;  2A69 F;  3GYZ A;  3FU5 A;  4YT2 A;  3MEK A;  2KQ9 A;  5J90 A;  5CI9 A;  4KZC A;  3AU5 A;  3ENE A;  3QJZ A;  4GA0 A;  3R7R A;  1OCC C;  3T8M A;  4I9C A;  2V0P A;  1J8M F;  3TG4 A;  3AS4 A;  5FZR A;  4KC9 A;  2KZT A;  3Q7G A;  2B0J A;  2LO6 A;  2AXZ A;  5DIZ A;  3U4T A;  1JUQ A;  1BPO A;  4J8F A;  2WXH A;  1QNF A;  4WWN A;  2A6H F;  2DYS C;  4C0M A;  2ZXW C;  4HOQ A;  2YHE A;  3QZC A;  4O6Y A;  3CVY A;  1IQU A;  2XPY A;  1V55 C;  5J08 A;  4JJF A;  4Q4Z F;  1SZI A;  3ZN3 A;  1N54 A;  3DM9 B;  5E33 A;  3Q7L A;  2W9Y A;  3RK6 A;  4C7O B;  3CZ6 A;  2ILR A;  2R59 A;  4LRZ A;  4KI2 A;  3FH8 A;  5T4Y A;  3MLG A;  3B0U X;  3S7J A;  3PE4 A;  3LAY A;  3O39 A;  3JRT A;  4J8D A;  2WVN A;  4NQ0 A;  1N52 A;  4UI9 K;  4RBN A;  1KT1 A;  2FGY A;  3H65 A;  2A68 F;  4C3E A;  4QFV A;  5KJM A;  3UT7 A;  3NQP A;  2H7B A;  2WQ7 A;  2WXK A;  3SZ7 A;  3S7B A;  1EDU A;  3CVX A;  5KCM A;  1Y6I A;  3SZR A;  2PFD A;  3RRU A;  3L54 A;  2I9C A;  2XRH A;  3HVE A;  1KT0 A;  4I6J A;  3U66 A;  5A6C A;  4JA7 A;  3EFO B;  2FO7 A;  4MLP A;  2WVO A;  3ASH A;  5FCL A;  4FJY A;  3W8H A;  5JHB A;  4J32 B;  4DLO A;  3SBS A;  3MZL B;  3FUH A;  2G3K A;  3OWT A;  3LY7 A;  3I4R B;  4K03 A;  1HG2 A;  3JUI A;  1ZU5 A;  3Q47 B;  4B8C B;  1TR2 A;  2PQN A;  4MS6 A;  2Y3D A;  4JUR I;  3FTY A;  4I44 A;  4DVY P;  3K6B A;  4I2W A;  4AOF A;  3LYA A;  3MX3 A;  4I1A A;  5T3T A;  1PY1 A;  3CVW A;  4FLH A;  2YEV A;  1PC2 A;  4I43 A;  4FES A;  4JA9 A;  3VLE A;  3FH7 A;  2VJ8 A;  2R7U A;  4LLC A;  2LAI A;  4HS2 A;  2OND A;  2WXQ A;  3I5P A;  2HM8 A;  4CIH A;  2WZG A;  1DVP A;  4JC8 A;  5G55 A;  3G2T A;  4DI3 A;  1VK5 A;  2P58 C;  4JVS A;  2M4E A;  3IEG A;  1MNE A;  1QLE C;  3ZYM A;  2KGO A;  3EZH A;  3QAQ A;  3V7O A;  4A1G A;  2WVQ A;  4XWJ A;  2AW6 A;  3N2Z B;  2CHW A;  3RRN B;  1MND A;  4OIP F;  2J0W A;  2VB6 A;  2J9W A;  1UN8 A;  3NZU A;  4R7L A;  5A23 A;  5C1D A;  3PUK A;  2A4Z A;  3QKY A;  3IKO B;  5FJY A;  3C98 A;  4FAD A;  3GZ2 A;  2J9U A;  2V3C C;  3CST A;  4XZ4 A;  2XXA B;  3KS2 A;  1Z5Z A;  2L0T B;  3T5X A;  2C03 A;  3TAX A;  4URK A;  1OKK D;  3L0I A;  4BEJ A;  3K66 A;  1TJC A;  4UWL A;  1HS6 A;  5ARF A;  3EGX A;  2P6V A;  4U04 A;  4ANV A;  2R5S A;  3LCA A;  3UMK A;  3BG0 B;  3VTY A;  3LXU X;  1ZHT A;  2PF4 E;  1UJK A;  3SD5 A;  1E96 B;  4O79 A;  4YJW A;  2NC9 A;  4I3M A;  3FVY A;  1OWN A;  4I1O B;  5CCL A;  3TL5 A;  3OTN A;  3CV0 A;  2IXO A;  3QMK A;  3W2W A;  3P2B A;  2HYZ A;  3AS5 A;  2Y3G A;  3LY8 A;  5IY5 C;  1SZ9 A;  3CGH A;  2I8B A;  4CBE A;  5ANR A;  2EIL C;  3CK7 A;  4AE4 A;  3UGP A;  2WXR A;  3FFL A;  3SHF A;  4NUR A;  4CRW A;  1BR2 A;  4G11 A;  2X51 A;  2ZXR A;  3FH5 A;  3ZHE B;  4PS8 A;  3D9N A;  1JPN A;  3EHN A;  5C2Y A;  3HDX A;  2VGX A;  1W2W A;  5A7D B;  1NA3 A;  1ZU4 A;  2UY1 A;  3EH2 A;  5BV1 A;  3HIZ A;  2J46 A;  1U3D A;  2VAS A;  1OWL A;  2WXL A;  4DBR A;  1N1C A;  1NU9 C;  2MRI A;  2VTB A;  4Y6C A;  3RIP A;  3S28 A;  4U63 A;  1FMW A;  3KL4 A;  1QZX A;  2PL2 A;  4BX8 A;  5JJ7 A;  5EX3 A;  3PUJ A;  4CDM A;  1VMA A;  1KLX A;  4U5E E;  3L16 A;  2CG2 A;  3FWV A;  1W3B A;  4YWQ A;  4B8A A;  5ARG A;  2XL4 A;  4W8K A;  2YQ8 A;  3VYW A;  1FVH A;  1NP7 A;  4GCN A;  1B89 A;  3TD7 A;  2WM9 A;  4BJ6 C;  2MOW A;  2QTV A;  1MQS A;  4KMO A;  5KYW B;  3UR3 C;  5KYY A;  3TJP A;  4XLP F;  4AK9 A;  5DQT A;  3BG1 B;  2JD3 A;  3RKV A;  3NG1 A;  2J09 A;  3EG9 B;  1EYH A;  3IHY A;  3CVN A;  3JYH A;  4U5D E;  1WGW A;  4HE8 D;  4CCA A;  4APF A;  3CK9 A;  3EJN A;  4G2V A;  3D9J A;  4RG9 A;  4K0D A;  3HYM B;  1M57 C;  2Q9C A;  4YT4 A;  3NYL A;  5FTP A;  3I3N A;  4CGV A;  3DXJ F;  4NY3 A;  4ABN A;  4O6N A;  3CIA A;  3Q6M A;  4C3D A;  4DPR A;  4LER A;  2YIN A;  3ZPJ A;  3MV2 B;  3GZ1 A;  3SI5 A;  4N2Q A;  2IXM A;  4XIF A;  4K0R A;  3UX4 A;  5D0Q D;  4HOU A;  4CGW A;  5KYX A;  2HV7 A;  3Q6N A;  1HZ4 A;  3D9P A;  2Q3T A;  3DAG A;  2AVP A;  4I2Z A;  3R9A B;  2LAH A;  1MMA A;  5T3W A;  5E76 A;  2VSY A;  2NUP A;  3ESL A;  1M2V A;  4AP2 A;  4P6I C;  2WXG A;  4N06 A;  3DZA A;  3ASG A;  4QI2 A;  4RVB A;  4F3V A;  2H7O A;  3T4R A;  4J6I A;  3ZIM A;  4U8H A;  3LS0 A;  3WG7 C;  3AQC A;  3FTX A;  1RJ9 B;  4PS3 A;  5BPP A;  4OIN F;  2QFC A;  4HFK B;  1E7V A;  4WNF A;  4OD5 A;  5EGY A;  4G7H F;  2IU1 A;  3ONL A;  4GYO A;  2NG1 A;  3ONK A;  5FQ6 A;  4CT0 A;  4CS8 C;  1PAQ A;  4U0U A;  2H7V C;  3IBE A;  3LLI A;  3JYS A;  1IZM A;  3VAY A;  1OCO C;  3FEY A;  3QAR A;  5LOZ A;  5BNW A;  1UJJ A;  3ZVV A;  3U9W A;  2OVF A;  5M72 A;  4F4B A;  3CR3 A;  3D9K A;  3CVV A;  4CS9 C;  3JCU Q;  2G62 A;  3CHM A;  4IYP A;  4ACK A;  1OWM A;  3EIJ A;  1TWA A;  2GGF A;  2C0L A;  4HFG A;  5CCM A;  4U5G A;  4GMJ A;  4A1S A;  2EQX A;  1VOM A;  2CFZ A;  5L3Q A;  1A17 A;  3MGB A;  3LJB A;  3MCX A;  3IEE A;  1M56 C;  3UPV A;  5LFA A;  4C7O A;  1ZBP A;  3O48 A;  4GU5 A;  4CEM A;  2XPI A;  4WNE A;  4TV3 A;  2CGE A;  5E3A A;  3I4G A;  3VLD A;  3DPD A;  1QQE A;  5G2N A;  3WOD F;  3DAF A;  2W4M A;  1E8W A;  2GRL A;  3JQ1 A;  4BJ5 A;  4KBQ A;  5G05 J;  2J4D A;  3RKO F;  2E87 A;  3OXL A;  5FQ8 A;  4LEU A;  5G04 J;  5G05 C;  5AYW D;  3B7S A;  3QWP A;  3CHP A;  3FEX A;  3LLK A;  2EIK C;  2D5R B;  1MHQ A;  4BWR A;  3ZYL A;  1X5B A;  3MKQ B;  2VQ2 A;  2OG2 A;  1Z3Y A;  3LS8 A;  3FDH A;  4ANW A;  2PQR A;  3KD7 A;  2DCP A;  3D9L A;  2VGY A;  3UMV A;  4G1T A;  4WAF A;  3EFO A;  3CHQ A;  1OCZ C;  3TGO A;  4ILI A;  3N71 A;  2IJG X;  3DJU B;  3SBT B;  4CS7 A;  2I1J A;  4AX2 A;  3FHE A;  2O9X A;  1JPL A;  2RD0 A;  1WM5 A;  4U5H A;  4PJN A;  4UWG A;  2I1K A;  3FHD A;  4JHR A;  2WQ6 A;  5FZQ A;  4A2N B;  1TWC A;  5HSW A;  2RG8 A;  4J8S A;  3CQZ A;  4C0E A;  3RH3 A;  4PJL A;  2PM6 A;  2XGM A;  4BT9 A;  4NRH B;  1PD0 A;  3AQB A;  2VSX E;  4Q69 A;  5BT1 A;  1FCH A;  5FQ4 A;  4EBB A;  2HO1 A;  1IHG A;  4KT6 B;  4GA1 A;  4G26 A;  2JEK A;  2L0I A;  2BE5 F;  3UGO A;  2QY7 A;  4G23 A;  1JPJ A;  2FBN A;  2CNW A;  1G8X A;  4HOS A;  4B6I A;  4CSA C;  3S7F A;  3LKU A;  2L9B A;  5B1A C;  3QC1 A;  4CSA A;  4CDR A;  3DMD A;  3CEQ A;  2UWJ G;  3LEV A;  2P7V A;  3LVR E;  3CK8 A;  3CVU A;  1IYG A;  2X6F A;  3ULQ A;  3FUL A;  4JEU A;  4F7A A;  2IFU A;  4AJW A;  2WZL A;  4PFP A;  3UT4 A;  2WPV A;  3CLJ A;  3HLZ A;  4EPZ A;  3FU0 A;  2XXA A;  1UW4 B;  4J8E A;  4IJJ A;  3W2V A;  2EIJ C;  4M3O A;  3HVE B;  3PRZ A;  2ION A;  3UT8 A;  3OAW A;  2LSU A;  1H19 A;  3QOU A;  3U64 A;  1H2V C;  1EPU A;  2IXP A;  2AXU A;  3T6J A;  2OOE A;  4WND A;  3FUK A;  4KNW A;  5EDS A;  3G2S A;  4ILH B;  3AU4 A;  3AS8 A;  4U07 A;  1Z6A A;  4JCH A;  3ZYK A;  5D91 A;  1TKN A;  4G0H A;  4CT4 A;  3PZD A;  3SFZ A;  4KNV A;  3RO3 A;  3LY9 A;  3CVL A;  3MKR A;  4ATG A;  1FFH A;  4TUU A;  3HTK C;  2DIW A;  2IYL D;  1ZHW A;  2FUL A;  3ABM C;  4GB9 A;  4KZ0 A;  2C04 A;  2ZXO A;  3B0P A;  4FHK A;  4JPS A;  2Y39 A;  2R7S A;  4XI0 A;  4Q5S F;  4WWO A;  3CHS A;  4X0R A;  1HX8 A;  2BUG A;  4GML A;  1ELR A;  4ZLD A;  1HXI A;  4BJT A;  3APF A;  2KW3 C;  4ANU A;  4QI0 A;  2XCC A;  5D92 A;  2KAT A;  3ZHE A;  2Y4U A;  3GW4 A;  5BW8 C;  4B89 A;  3GZS A;  1YA0 A;  4IAO A;  3ESK A;  4U0Z A;  4UI9 J;  3KMI A;  2QY9 A;  4U0S A;  5AIJ A;  2J07 A;  3SP1 A;  3GAN A;  4UI9 C;  4OVV A;  1D0X A;  1VDY A;  1SQM A;  1HF8 A;  3CQC B;  5KJN A;  4GYW A;  4AY6 A;  3NYJ A;  4GYY A;  1ZHY A;  1QZ2 A;  2CDQ A;  2XCB A;  4YT8 A;  3ABK C;  4BFR A;  4E6H A;  5E2Q A;  1D1B A;  1FMV A;  1H2U A;  3PH0 C;  3QWV A;  2JLB A;  3EPV A;  3LES A;  3CSF A;  5BUO A;  2GFH A;  1Z63 A;  4N3C A;  4BTB A;  3RU0 A;  2PX0 A;  3UMH A;  4EZL A;  4AV7 A;  1BR1 A;  1NU7 D;  3F46 A;  3SYN A;  3EGX B;  2BTD A;  2MHK A;  3DD7 A;  3QNK A;  1IQR A;  1V54 C;  3P1U A;  5KYW A;  3ASO C;  4UWK A;  3K9I A;  1H6K A;  1IW7 F;  3EG9 A;  4XE0 A;  5LX8 A;  4EZK A;  1WY6 A;  4BX9 A;  5F5F A;  4UWF A;  2YNQ A;  1HU3 A;  5T3R A;  2NUT A;  2G3V A;  3S2A A;  1TWG A;  4H7X A;  4XX5 A;  2R7Q A;  4L2Y A;  4G24 A;  4GZC A;  3ZG1 A;  3IV0 A;  4YN0 B;  5BV0 A;  3TG5 A;  2KNH A;  2Y3B A;  4WWP A;  5DBK A;  1ZHX A;  1HO8 A;  3M1C B;  3UQ3 A;  3S27 A;  3AG2 C;  2PP4 A;  1GW6 A;  4CDN A;  3PNL B;  1ZU2 A;  2A6E F;  2J4B A;  4N2S A;  4PDX A;  4DK5 A;  2V5F A;  2WXN A;  2Y3H A;  3B7T A;  4GZ5 A;  2OCC C;  4GYT A;  2KCV A;  2VGX B;  1BR4 A;  4V3I A;  3FY4 A;  2UY1 B;  2FF4 A;  5E3C A;  3FUN A;  2Y4T A;  2KJG A;  3FUI A;  1ZHZ A;  4J30 B;  4H7Y A;  2IOQ A;  3OEO A;  4FWV A;  4LAC B;  2ZU6 B;  3D9M A;  2ZXP A;  3EGD A;  3I5Q A;  4U5C E;  5E75 A;  2CG3 A;  3D9O A;  5KYU B;  2R7X A;  4Q7C A;  1PD1 A;  2VYI A;  4ME2 A;  2R7T A;  3KEZ A;  1HE8 A;  2WXO A;  4C9B B;  4J0U A;  2WB2 A;  1NG1 A;  4FP7 A;  2KC7 A;  2XRY A;  3N0T A;  4E7Z A;  3MV3 B;  1MMD A;  2WXI A;  3LPZ A;  3PRE A;  5DLJ A;  5HQ8 A;  4RDA A;  4PJM A;  2AWI A;  2FI7 A;  2V26 A;  3EHM A;  4AVX A;  2WMO A;  4JZA A;  3LNR A;  3G2U A;  4FC8 A;  4FX5 A;  3Q49 B;  2I2O A;  1TJF A;  3O6X A;  1MMG A;  5AJL A;  1FFT C;  4LUN U;  5KYN A;  3PDN A;  1E7U A;  2R17 C;  2KCK A;  3S29 A;  2X6H A;  1Y8M A;  2MWQ A;  1J8Y F;  2EIM C;  2HV6 A;  4JHJ A;  4BSX A;  3ABL C;  4GAA A;  3DBS A;  1TWH A;  1DNP A;  1U3C A;  2IF4 A;  4N3B A;  5JJT A;  1LF8 A;  2J7P A;  4FUL A;  1XNF A;  4BY6 A;  2Y69 C;  1S0P A;  1Z3I X;  3FP3 A;  5CI8 A;  1M2V B;  1Z3X A;  3UUX A;  4EBA A;  3W8I A;  4DVZ A;  4XLN F;  4JHK A;  5DQZ A;  3B9Q A;  3NDB B;  2R7O A;  4GZD A;  4OIR F;  4GPK A;  1SF8 A;  3ZC4 A;  4BTA A;  2XSE A;  3K1H A;  1OUV A;  3L34 A;  1LKX A;  4HOR A;  1D0Y A;  3G2W A;  5AJD A;  2R7W A;  4TRQ A;  5EKQ D;  2VH3 A;  4HEA J;  4BJ5 C;  4JW1 A;  3URZ A;  4GEH A;  1O87 A;  4DBQ A;  3NKD A;  4HOT A;  5B1B C;  3Q5M A;  3G2V A;  1ZYR F;  5LP0 A;  4N5C A;  2IOS A;  4IN3 B;  2XRZ A;  4PFO A;  5ENN A;  3SNH A;  4HLE A;  5G04 C;  2Q9A A;  2XEV A;  3QDN A;  4PS7 A;  2A5U A;  1FVF A;  5L3V A;  3UMI A;  2L81 A;  2YHC A;  4YVO A;  5ANL A;  2WQH A;  4HXI A;  4E7S A;  1NZE A;  3D3M A;  4MQ9 F;  1UN9 A;  4E85 A;  2IXN A;  2WZF A;  2C0M A;  2XGO A;  1JWF A;  4FJZ A;  1MMN A;  3FU6 A;  4YT5 A;  5DS6 A;  2Y3A A;  1LVK A;  1ELK A;  3EIQ C;  2GW1 A;  3ZW3 A;  2W4B A;  2KZT B;  4L2L A;  2A1D D;  4AIF A;  3L13 A;  2WXJ A;  3RRM B;  2W45 A;  1M2O A;  3LEW A;  4XI9 A;  1UG3 A;  3NZS A;  3E4B A;  1E8Y A;  4YND A;  3JCK C;  4GZ6 A;  4O6M A;  4EQF A;  2BF0 X;  2LNI A;  4JZY A;  3OXG A;  2Q9B A;  3BEE A;  2OV8 A;  3TXM A;  4GZ3 A;  4JJG A;  4P29 A;  3NYM A;  3PVL A;  3JT1 A;  2LSV A;  1LS1 A;  1D1A A;  4GA2 A;  3FTS A;  2R7V A;  3FUD A;  2DYR C;  3TXN A;  4KYO B;  4XTK A;  4L1B A;  2PX3 A;  3NF1 A;  3RYL A;  4OIO F;  3VTX A;  2FEZ A;  2CW0 F;  1HH8 A;  4PK4 A;  2WL8 A;  1L5J A;  5FQ7 A;  4O6F A;  4G7Z F;  4NAC A;  4M63 A;  2LSE A;  2KM4 A;  4O7G A;  5CHE E;  1H0A A;  2IQC A;  3ZFW A;  2IOL A;  3AG1 C;  2YZS A;  3CHO A;  3L08 A;  2HR2 A;  4KVM A;  2VSN A;  3AG3 C;  4WNG A;  4KXK B;  3S0X A;  2CFU A;  2X3M A;  3FTW A;  4L7T A;  4GCO A;  4ZLC A;  3SF4 A;  3X1O A;  2M63 A;  4DLQ A;  3R7Q A;  4EEC A;  5T1D B;  3KH2 A;  2PM7 A;  4EZJ A;  3LJ3 A;  4UQX A;  1SMY F;  1S7Z A;  4A55 A;  3FUE A;  3ZXS A;  4BG0 A;  3CQG B;  2AXV A;  4OD4 A;  3PEV B;  5DS5 A;  4IUL A;  3ZYQ A;  1D0Z A;  4W9R A;  3E70 C;  4UWH A;  3EQL F;  4K7B A;  4A3T A;  3FDQ A;  1OCR C;  2R7R A;  2C2L A;  2PZI A;  5HI7 A;  2XGS A;  3PNT B;  4AM9 A;  5B3S C;  4I17 A;  2GRM A;  5CMW A;  2J9V A;  1FTS A;  1D1C A;  3FUF A;  4I6E A;  3L17 A;  3ML8 A;  4IWB A;  3APC A;  2Z15 A;  3L22 A;  4N3A A;  1O5H A;  3RIB A;  5D0O D;  2J9Q A;  3Q4A B;  3PE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...