4LERA

Crystal structure of a putative outer membrane protein, probably involved in nutrient binding (bvu_1254) from bacteroides vulgatus atcc 8482 at 1.42 a resolution
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
457
structure length
457
Chain Sequence
TNPSLLLTGVAYSAFNQTSSDACHAAKMLILTSGESKYQVYKWTRGDFDYYSNLRDVTKMSEEAGEGSAYQALAHFFRANYFYQLTLDFGSIPYTDALKAETDANYQPAYDSQEVVLAGILKELEEADKMLEGSDEIISGDIIYNGNLVNWRKLINAYRLRILMSLSGKEKVGDIDVKSEFSKIVADGPLMESLSDNGQLIYLDQQDNRYPYFNDSDFGSGRFMDSTYIAELATRQDPRLFAVATQTPNAEKAGKAINDFSSYDGGDPAVPYSLVNDKAVAGNCSKPAPRYYQTPTNEPMVLLGYVEQQLILAEAVVRGWIQGDDKIYYESAVKASFEFYQKYAVSVADYLTQDAAAEYLRNDKVAYSSSLSTDEKIERIIMQKYLPTFLQGSVWLPYYEALRTGYPDFRRAAGVSLPYRWMYPQDEYNNNATHVEAALNEQFGGSDKTSDKPWWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Putative outer membrane protein, probably involved in nutrie
publication title Crystal structure of a putative outer membrane protein, probably involved in nutrient binding (BVU_1254) from Bacteroides vulgatus ATCC 8482 at 1.42 A resolution
rcsb
source organism Bacteroides vulgatus
total genus 174
structure length 457
sequence length 457
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12771 SusD-like_2 Starch-binding associating with outer membrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4lerA03
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4lerA01
4PUCA 3LEWA 3EJNA 3CGHA 3CK9A 3IV0A 3JYSA 3CK7A 3MCXA 3I4GA 5T4YA 3P1UA 4LERA 3L22A 4Q69A 3JQ0A 3FDHA 4MRUA 3GZSA 3CKCA 5E76A 3EHNA 4F53A 3MYVA 4L7TA 3CKBA 3HDXA 3NQPA 3OTNA 3JQ1A 5FQ6A 5FQ7A 5LX8A 4F7AA 3KEZA 5E75A 3MX3A 5FQ8A 3SGHA 3QNKA 5FQ4A 5J90A 3EHMA 3SNXA 5T3RA 3CK8A
chains in the Genus database with same CATH superfamily
3ECSA 4JE9A 1OXJA 2G3VA 3BEHA 3HNIA 4I1OB 3FDQA 1KTMA 4KMOA 3KYIA 3JSZA 5EX0A 2OQMA 1JPJA 5BT1A 4DXWA 2XEHA 2AVPA 2GW1A 3I4RB 3ZRHA 4JL0A 4FJYA 4O1OA 4ATGA 3CHSA 1FNTc 1VLTA 2MOWA 3NOGD 4URKA 3IEEA 3FUEA 3NMJA 3S29A 2DWZA 3M15A 1MNDA 2DBAA 2IM8A 3LJNA 1J8YF 1EKYA 2F22A 4U0ZA 3TJ5A 3MFNA 3U2MA 2HS5A 3AGUA 3V7OA 4BJ1A 4J0UA 1VYKA 4JC8A 3UQ3A 3AQBA 2WZLA 4YJWA 3ML9A 1QQ3A 2VCBA 2IY0C 5EILA 1H2UA 1QPUA 3ZYQA 2KJGA 3A9CA 4KI2A 1ZYRF 2PP4A 4X8QA 5JSLA 3Q78A 2AWYA 4HB5A 2H7VC 2J9QA 3B7UX 3O4ZA 2BKGA 1S7ZA 1JUQA 4KZCA 1UJJA 1Z5ZA 1OXBA 2I2OA 3J5QB 2XLWA 3LLIA 4C3DA 4GMJA 2OEVA 1HFAA 3S28A 4H54A 1PD1A 2WVIA 1E86A 3EHNA 3MYVA 5JA4D 5FINA 1NFIE 2WQ6A 2KGOA 5E3AA 4AE4B 2OV8A 5HRYA 3UUXA 3TWUA 4I9EA 4DI4A 4DX5D 2RD0A 3OXFA 2VSOE 4XTKA 4M3OA 3ZVVA 2HMQA 5ENPD 2M4EA 4J7TA 1MQVA 3NYMA 4EWCA 3ASNE 2X6HA 4PACA 1ZZPA 2KQ9A 3CKBA 2CG3A 5EGYA 2WVQA 4IAQA 4I17A 4Z9IA 2AXVA 1DCQA 4H7YA 4LEUA 1YYXA 4N6HA 4L2LA 3QDNA 3DE9A 1WWPA 4EQFA 3B71A 4ABNA 4BJTA 2RKKA 3U3WA 3VYWA 1DOVA 5D92A 3A11A 2KATA 2FAPB 5DS4A 5G04C 4L2YA 3M79A 1TN7A 3EGDA 2IOLA 1F1MA 1G4WR 1FMWA 3UM0A 1SZAA 3IBEA 3NG1A 2MRIA 3T8MA 2YZSA 1DOWA 4U9EA 2VGYA 4GZ6A 4PS8A 2Y3HA 5E2QA 2GDCA 4G7HF 3GW4A 3B7BA 3HRAA 4U5CE 3W4YA 3PNTB 3FEYA 4N3BA 4UQZA 3PHF2 1RXQA 2HE0A 2ZXRA 3URZA 4EZJA 2EIMC 2Y3AA 3QK0A 5A6CA 3RH3A 3VLDA 4PFPA 4U5FE 2XCCA 2KZTB 5FWQA 4ILGA 1Q2ZA 1BR1A 2A6EF 1N4RA 1BR4A 4C48B 1QKRA 2GRQB 1RKEB 4JCZA 2A5UA 2P9IG 3ZG1A 1WGWA 4YT4A 4GPMA 4IGGA 5CRUA 2EILE 3TXNA 1K8KG 2JABA 2QY7A 5CMYA 5AQ7A 5KJKA 2LP4A 3TWVA 4APFA 3DSXA 1TQGA 3EHMA 2WZFA 2KYHA 4BJ5A 2IXPA 1IHBA 1SR2A 4KVOA 4EZLA 3N0TA 3ZVRA 4G23A 4O60A 5AJDA 1D9SA 1MNEA 1Z3IX 2R7UA 4KBLA 2JX0A 3FOOA 3QWWA 1Z5SC 3GODA 3R2PA 1D0XA 1MZCA 4E0HA 4WGYA 3EZHA 1LD7A 1A7DA 4DX7D 3CHQA 1JCQA 1LKXA 2NUTA 4F4BA 3TG4A 5AQBA 2OOEA 4I2ZA 3FAJA 2FGYA 5L0JA 4JKVA 3PRZA 1ZHYA 1EA8A 2Q00A 3LNRA 1HH8A 4OD4A 2NSZA 2OVFA 3HXDA 4TRQA 5CMWA 2WQHA 3FOPA 4LACB 2XL4A 4OIRF 2PFDA 1BZ4A 1D1CA 2L7AA 2ZPAA 4DRXE 1TEZA 3UGPA 1H9GA 1D0ZA 3ASOE 5A7DB 3IHYA 1YAUO 2PNNA 1H2VC 2OCCE 3CVQA 5CERB 1JRAA 2WL8A 2OG2A 3U9WA 3APFA 2ILRA 3I5QA 2ZD9A 5FCLA 1R4TA 4XEFA 2J8SD 3QOUA 4G25A 1OCOC 2JD3A 3POVA 3CK9A 1BR2A 4KXKB 4LLCA 4M63A 4M7CA 5C2YA 4UQXA 2XQ0A 4YL1A 1SA4A 1NZEA 5T8IA 4IAOA 1V54E 4NQFA 1TWCA 3PZ1A 1M2VB 4J32B 2F8XK 3ABLE 3TAXA 3L17A 4G7OF 1HE9A 3SXKA 1PD0A 2C0LA 3Q7FA 4ONSA 2ZISA 1XWJA 3ONKA 3CK8A 3QARA 3MYIA 3C7JA 4KC9A 3LY7A 4NTBA 1JWFA 3PZ4A 2LD6A 1TJCA 4PJLA 1OY3D 4XZ4A 5CEAA 1K05A 1NBBA 2VTBA 5KYWB 4CT4A 3CSFA 5T1DB 3IQ5A 3AQCA 3KD7A 3KEAA 4YDWA 2BC5A 5H7PA 2GRNB 4RBNA 2P6VA 1WM5A 3SNHA 3AG3E 3HXBA 4FHKA 4IARA 4MVOA 3EIQC 1FTSA 3PDNA 4HORA 1GW6A 2R02A 4CDAA 2B0OE 3FTUA 3L6AA 2OEWA 5L0CA 2XLDA 2NUPB 3FTSA 2CG2A 3EGXA 4I6GA 3DPYA 2H7OA 4ANWA 3BG0B 2DGJA 1TYQG 4OIPF 4XIFA 3TWRA 4CSAC 1TR4A 3SYNA 5TJ5E 3SZ7A 1V54C 3U2LA 2J49A 2H8AA 4XPYA 3UMHA 2WXOA 3FVYA 3WG7C 5CBOA 2DYRE 3Q73A 3PMRA 2J0WA 2WZGA 4ZFHA 3FXHA 4MVZA 1OWMA 3FAPB 4B8CB 1JPLA 4N3AA 4TXRA 3JRTA 3PZ2A 5EIDA 2XENA 3T8KA 3HJCA 5JHAA 4TXPA 3TWWA 4XPXA 5B3SE 3UT7A 4I2WA 4FWVA 5KBAA 5K0IA 1LPEA 2YNQA 4GYWA 2HKVA 2XL8A 3NDBB 3S7FA 4F7AA 2J4BA 5FQ8A 3QMKA 1BD8A 4GTMA 2YLIA 1UG7A 2ETBA 2J09A 3EG9B 5EK0A 5KCMA 2QLAA 1FT2A 1Q0KA 3RQFA 2AWCA 1E85A 3LCAA 1HMOA 5L0IA 2KCLA 1DC2A 4N2SA 3TJPA 2AVKA 4G24A 4R7LA 3CZ6A 3ZQVA 4DVYP 2V4LA 1H19A 2YEVA 5BW8C 4Q5SF 2XRZA 1YYJA 3ZXSA 3H2VA 4MS2A 3ZYKA 5FIOA 5E3CA 4PK4A 2NPUA 2W9YA 5HS0A 1RJ9B 3AG4E 2YVKA 3VAYA 2HYZA 5L3QA 2VB6A 3VLFA 3JYSA 4I9CA 3U9JA 3EH2A 1NZNA 4LG6A 4UUCA 3TWQA 3FDHA 4L9PA 4ACLA 4LSZE 3H2UA 2J9BA 1WOLA 4BTAA 3LVQE 4H4KC 3VM6A 3CVXA 3HVEB 4QI2A 3DSSA 2JPUA 1LS1A 3T6JA 1H6KA 3LXUX 1CGOA 2A6HF 3CHMA 4EHMA 2HV6A 4XE0A 3TOLA 3T9KA 3KL4A 4BEPA 3CVUA 4J8FA 1YJGA 3ABME 5G05J 5EDSA 4E6HA 2IJGX 3S7DA 1Z23A 4HRLA 3GWNA 4P29A 3C98A 3R7RA 3VF0A 3KMIA 4YDOA 2LCHA 5LX8A 1WY6A 1H9TA 4XEVA 4F1SA 3E37A 5KNHD 3DSTA 3DBSA 3AG4C 3Q7AA 3CEQA 2HO1A 4G8KA 3FUNA 2XZTG 2QYJA 2FBNA 3C8GD 5BQIA 4IWBA 4AOFA 1E7UA 4YNDA 5AIJA 5CIVA 4HXIA 3LY9A 5A6KA 2BTDA 2C03A 3D9LA 1OWPA 5HQ8A 1PC2A 5AARA 1BPOA 2QZAA 3JQ1A 4OIQF 1BBHA 3WXXA 3JYYA 2G62A 4U95D 1EQ1A 5D0OD 1MX4A 2EINC 4L23A 1E8XA 3Q49B 1MMGA 3Q9UC 4YT8A 1KPSB 3UMIA 3CK7A 1N52A 4GCNA 4W9RA 4F3VA 1WDYA 3ZSUA 3J5PA 2V26A 3EHRA 2C2LA 4KZ0A 4HOUA 4UDVA 2BL2A 5DS6A 3L1MA 3HXFA 3LJBA 4CIHA 2VSNA 2CHWA 3EZIA 2EPLX 1BI7B 1TWHA 4D4XA 4UWFA 5BNWA 3Q47B 2RFAA 5CCMA 4A4AA 3PEUB 5JRAA 2FEZA 3X2QE 4GTTA 4JIOA 5DQTA 1E83A 1MHQA 4J8YA 1VMAA 4LDQA 3M4CA 4LDKA 3I3NA 2RD9A 1Z3XA 3DXKG 3RRNB 5KWDA 2LAHA 1C17M 1XNFA 1OR3A 4ZLDA 3C3QA 3CVPA 3MV3B 3DAFA 2C04A 3CR3A 3GWLA 2L6JA 3Q5MA 4F1PA 4E18A 4ZLCA 4JZYA 3AU5A 4CBEA 2EPMX 3DJUB 3HKKA 2Q4FA 2FO1E 3AS8A 5DIZA 2KCKA 2R7TA 3G50A 4I44A 2EIJE 3U8VA 3ZDLA 4MRUA 5B3IA 3IEGA 3RRUA 4DBRA 3D9KA 3OXLA 2DVWA 2CDQA 3LPZA 3NZSA 3FU6A 1QSPA 4AE4A 5BQGA 3HTKC 5BUOA 2JEKA 4GAAA 4JW1A 2HM8A 2JLBA 1UOHA 5ENSD 3NMIA 2ETAA 4G0HA 5G55A 4GZCA 2V8SE 2OJED 4PJJA 4DX1A 3L8JA 4C7OA 5BQHA 5KYXA 5BXUA 3OA1A 3PE4A 1M56C 3ZU7B 3LKUA 3UTMA 5DVWA 2YL0A 3BUAA 4Z9HA 2XRYA 2XXAB 1LIHA 5G04J 3BRJA 4ANXA 2KNHA 4I1MA 3V79K 4Q69A 4C0MA 4AL0A 1HF8A 5FTPA 2LUHA 3QW0A 1U3CA 1Y4CA 1H6PA 1H2TC 4L6RA 3RRMB 2MYSA 3GEEA 4DBQA 5F5FA 1DVPA 3RQGA 4RG6A 3C5RA 4CS9A 4GYYA 2ZGDA 4WWOA 4BSZB 1EYHA 5BPPA 3WODF 5T3RA 2XPZA 4MVMA 2V0PA 3VRCA 3FUDA 1JOGA 1PCXA 5KJNA 3ABKC 2KZTA 5A23A 3M1CB 3U8PA 2IO3C 1RKEA 1H7IA 4K5AB 3DEPA 2CCYA 1RMVA 2A0BA 3RVZA 3MKQB 1G5ZA 3ENEA 2E87A 1JWGA 4XEKA 4YL3A 5L3VA 2D4UA 3IHVA 3UM1A 3CIAA 3AG2C 3LYAA 4EPZA 3IQCA 4FLBA 4GTQA 1LI5A 3CEXA 1FT1A 4CS9C 3DAGA 3FULA 3RIPA 3F47A 4N4WA 3R9MA 3TQOA 3AS5A 1VLSA 4PR9A 4JPSA 3ZIMA 5ITZF 5JMND 1KU2A 2DZOA 1K04A 2H6GA 2R25A 1EDUA 4CGVA 4XWJA 4JTCB 5JUAA 3EU9A 4U9DA 4G2VA 1NA3A 3ONLA 4GA2A 5D2MC 1AWCB 4BWRA 4AJWA 4HVBA 4ANJA 3JRMO 4PS3A 4JTDB 3ESLA 2EIME 3SFYA 1WASA 3RAUA 3FTVA 3U0CA 3SXMA 4HFKB 4YK5A 3N24A 2WXJA 4ATZD 3CSKA 1C03A 5A6BD 2LO6A 1WAO1 3I4UA 4CDNA 1HX8A 3Q7GA 4GTSA 1LM3B 1I5NA 1M2VA 2Q7RA 2R5SA 2WB2A 1ELWA 3S90A 5CECB 2V3CC 4WGZA 4MVQA 1KT0A 1I4ZA 3G4XA 4JJGA 1EF1C 1IKND 4PUCA 5HSWA 3FUFA 3AJMA 2VASA 5CHEE 2B0HA 1FPPA 4ULWA 2R7SA 5KYWA 4K5BA 4IYPA 2IOQA 2HSBA 4W8PA 3EIJA 4XX5A 4FU3A 3LEVA 1HE1A 1A5EA 2O9XA 3PVLA 1BU9A 2MYOA 4PJNA 4IJJA 3ZFWA 3T5XA 2I9CA 1S05A 1QYMA 4G8LA 1OKKD 5T3WA 2NUPA 3FUKA 1U89A 3DSVA 3CVYA 3KYJA 4EECA 1UJKA 5KYNA 3JUIA 2AW6A 1NP7A 1S70B 3SHFA 2YL1A 3NMKA 1DCEA 1TNBA 1IYGA 3V31A 2ZGGA 2X6FA 3C8GB 1N0QA 1ZW3A 2WB7A 4HE8D 1HMDA 1NU7D 3ZTZA 4U5DE 1IXVA 1Z6TA 1OCOE 4A55A 3Q6NA 4JURI 4JHKA 3S27A 2M64A 4FP7A 4GZ5A 2GGFA 4NIKA 3QB2A 1T6UA 5EYLA 1U2VG 2XLVA 2CGEA 4G26A 1OWOA 1JCRA 3PZDA 4EBAA 1BDJB 5JHBA 3S9OA 2F0YA 4FAPB 4BX9A 1Z7Qc 3EG9A 4E17A 4CDRA 2J9WA 3UNGC 4V3IA 1Q0MA 4O6YA 2XCBA 5D66A 5KYYB 2VC9A 4BFRA 3ZQYA 4D4NA 3LS1A 4HQDA 2EIKC 2A4ZA 4DOZA 3GM2A 4E85A 2GWWA 2GA0A 4N5QA 3D9NA 3FH8A 2KBXA 5EYPF 3B29A 4JHRA 4CJGA 1RJ9A 1OCCC 3I5PA 2P9SG 1LVKA 1G3NB 5AN8A 3SNXA 3D9IA 2Z15A 3EJNA 1TJFA 4P6IC 1ZVZA 3E4BA 5EX3A 2VYIA 4HOQA 3JUEA 3JQ0A 1H6GA 2L0TB 3EUVA 3NKDA 3GZSA 4AEZC 1TNYA 4XQ1A 2WXRA 3TULA 5COFA 4GA0A 3HVEA 3QTHA 2PZIA 3HHMA 4J8DA 3EHQA 4F6RD 4JA7A 2VSYA 4DVZA 3SGHA 4GEHA 3WG7E 3FTWA 2AXZA 1HG2A 2GROB 4CSAA 3G2WA 1MJ0A 5A6JA 2X6IA 3G2VA 4C3EA 4K5CA 4K0DA 1T5OA 3IPMO 5BXOA 4B89A 4HFFB 3DSWA 1D8DA 1J8MF 2KW3C 3C3OA 1AEPA 2QE9A 4LDRA 1K1BA 3DPDA 3QKYA 4N6CA 2L6FA 4IULA 1TWGA 2J9VA 3FTZA 4Y6WA 2XM4A 5CI9A 4UI9K 1D1AA 1OWLA 3D9PA 5LCWJ 3FUJA 4TUUA 5ENOD 2R9RB 2EPNA 4J30B 4Y6CA 4GYOA 1SA5A 3EU5A 4BT8A 3S7BA 4ULVA 4FJZA 3HG0D 3IV0A 4HFGA 3HNKA 4I1AA 2RSEB 1S63A 4IRUA 3ZW3A 3TWSA 3HLZA 2Q7FA 3ZHEB 2KC7A 3K9IA 5L0GA 1YVIA 1NG1A 1A7VA 1SQMA 4D10C 3EGDB 5EN5D 4GB9A 2QYUA 2WXLA 4U8YD 4ACKA 1N94A 3APDA 3RKVA 5L0HA 1R5ID 3ULEG 4U5EE 3L0IA 2H6IA 1FFHA 3VTXA 4BSXA 3CHPA 3FTXA 4NTFA 5COMA 1N54A 2GAQA 3EPVA 2DYSC 3P2BA 3Q4AB 3QWPA 3U66A 2XL6A 4BEJA 2CYDA 2IYLD 3RF3A 3AGTA 3DE8A 3B0VC 1YYHA 3KS2A 4WAFA 2XGSA 2XRHA 3ITFA 3TOMA 1PAQA 4XPWA 3W2WA 4UQYA 3RJVA 4BETA 2V5QC 2AU5A 1HG5A 1ZW2A 2PL2A 4FESA 3RO2A 1NU9C 3FFLA 1T6QA 3NBNB 2R05A 3Q75A 4RSYA 3CV0A 3DMDA 1FCHA 1Z3YA 1N9AA 2ETCA 5E76A 3PDMP 2CNWD 2YL7A 4J6IA 4WUYA 4ER9A 3ISMC 3ZYMA 4BPMA 5ENQD 5AENA 3B7RL 4P9FA 5FQ7A 4AM9A 4O79A 2WXQA 3SP1A 1ZBPA 3H65A 3FHEA 2YRFA 2PM7A 1M57C 2UY1B 4AV7A 4LRZA 3U5SA 3CQGB 4QFVA 1ST6A 4CDYA 3APCA 3C72A 4O6FA 4JZAA 4AY5A 1V4AA 4BEMJ 1YZCA 1Q0GA 1QZXA 3W8HA 5HV9A 2AWIA 2HSQA 4DX6D 4BG0A 3O39A 1KZPA 4L1BA 4PDXA 2IXMA 3NAWA 5LOZA 1UG3A 4I43A 1OUVA 2QFCA 2CHXA 2I15A 1Z6AA 2E2EA 2Y3DA 3GORA 1OQCA 5FQ4A 2EINE 4HLEA 3UX4A 4GCOA 4DLQA 3PZ3A 4U5BE 4IB4A 3OXGA 4UI9C 3C62A 4DK5A 4BTBA 1JMWA 4GTVA 3DSUA 2LAIA 4AK9A 3CQCB 2LXMA 3V2XA 2F37A 3FU3A 4OVVA 1LE2A 3U3FA 3ZXPA 3MEKA 4LCTA 3J06A 2VGXB 1SF8A 4GTOA 3TXMA 4XLPF 1ORJA 4AP2A 2XXAA 4CIPA 3MKRA 1ZU5A 1AP7A 4AX2A 1QNFA 3NF1A 3FMSA 1IZMA 2KC3A 1TFKB 2EPOA 4NCQA 2ICWG 2NXPA 2DIWA 1MX2A 3QZCA 3EFOB 1QQEA 1V55C 3GEHA 4QQIA 4Q94A 3Q9NC 4QI0A 5KJLA 4DJAA 3W8IA 4DRJB 4BESA 3B9QA 4OYSA 3KEZA 3MX3A 2P9NG 4K03A 2E0IA 4G7ZF 1NL4A 2J4DA 2P9PG 4CX9A 2XPIA 4YT5A 1PV3A 1H6OA 2KM4A 1YDIA 2TMVP 4MLPA 2WXMA 1T6IA 4Q7CA 4GTPA 4Q96A 5D0QD 4DLOA 5DQZA 1N95A 5T4YA 3UMKA 3QWVA 4CRWA 3KSQA 2I6HA 2BUGA 1SZ9A 3KPHA 1ELKA 2Y0BG 3R7QA 5B1AC 5KJMA 3MKQA 4G1TA 5FQ6A 5FZQA 4AXHA 3K7DA 2W4BA 3C3RA 3ASGA 4U8HA 3DM9B 4GMRA 3SD5A 1AUEA 3GEIA 3K1IC 4PH4B 5ARGA 1LE4A 4JHJA 4TUMA 3IQ6A 1N4QA 4WWPA 4ILHB 3AAAC 3Q7LA 3C8ZA 4NURA 1T01A 3QVZA 3U4TA 5D91A 3RSEG 3CQZA 1U3DA 2DCPA 4MVSA 2BKKB 5FT9A 2XLOA 3DEOA 1APCA 5B1BC 3F6QA 1P5QA 2NG1A 3K33A 1LS4A 5CEDB 3G2SA 1L5JA 4K1OA 2MHRA 4UWHA 3L22A 1IHGA 3JCKC 2DZNA 1YA7O 2PF4E 3SI5A 4O7GA 1LTXA 4JB8P 3FU0A 3N71A 4EKWA 2Q3TA 4N2QA 2XGMA 2WQ7A 1TFOB 1WG0A 1SVXA 4U0SA 3ZNGA 3O10A 2Y69C 4HEAJ 1N11A 1VDYA 1NI1A 3IQTA 3CGHA 2P9UG 1G4US 2Q9CA 1OCZC 3ZWIA 1S0PA 3JXJA 3ABKE 5F5HA 3NB2A 3NZUA 2WXPA 3DXJF 5FZTA 4JEHA 4RLYA 3T4RA 4EBJA 3NRHA 2Y4UA 2ZIRA 3HDXA 5AYWD 3TGOA 3AOUA 3LUTB 2H6HA 4O6MA 3ZIBA 4EIYA 2HMZA 3TK0A 2H6FA 1KT1A 3RO3A 4U04A 4KNWA 2IOSA 1TNOA 2IU1A 2NYJA 3AG2E 1E7VA 1N0RA 1NSGB 4B93B 3L16A 5JT4A 3TD7A 4MVUA 4HLLA 2XPYA 3LY8A 4WWNA 3JTLO 3HXEA 1CGNA 5L0FA 2W4MA 3ML8A 4JTAB 4JEAA 1BLXB 1L3PA 4OVUA 5G05C 3RYLA 2HUJA 2BEDA 2YHCA 3OTNA 3E30A 2EPKX 4PFOA 2GRMA 2UWJG 5CI8A 4OAVB 3G2UA 2CFZA 4H7XA 1N1CA 1M6TA 1IQRA 4A1SA 1SMYF 4NRHB 3UT8A 3EDTB 3IXEA 4J8EA 4HNAD 1OT8A 4LNUD 4TXQA 1I4YA 3K6BA 2IO2C 5HI7A 3S84A 4DJ9A 1B68A 2Y39A 4RG9A 3K66A 4A1GA 4GQHA 3SZRA 3BG1B 4N3CA 3FUHA 2WM9A 4GTRA 3FHDA 1OCRC 2ASRA 3C8GA 4N06A 3AS4A 2XHEA 5JP7A 4BERA 2L6BA 3OEOA 5J90A 2A69F 5T3TA 1MMNA 5A6AA 3PUJA 1OW6A 2PX0A 5KYUB 4BJ6C 3UI2A 3B13A 1RCPA 2FO7A 3B7TA 3CHOA 5IY5E 3D9OA 2OJQA 1E8WA 2R59A 2YKZA 3ZUVB 2VH3A 3G2TA 2EQXA 4F53A 5LP0A 3RW0A 2ZXWC 4FX5A 3L08A 2DB4A 4I3MA 1D8EA 2WMOA 3FEXA 3O6XA 5L0DA 2BE5F 2Y3GA 4HRNA 2PQNA 2YINA 4YDEA 4CYMD 4K7BA 1O1SA 1A0BA 5KYYA 3MBGA 3MYFA 2HV7A 2ZXOA 1RZ4A 2J7PA 4GZDA 1D0YA 3P1UA 4FHJA 4BT9A 2UUIA 1GQAA 1E8YA 2R03A 3UIOC 4ZHBA 4FULA 1D1BA 2WXNA 1GM5A 2FULA 4N5CA 5A69A 4I6EA 2R7WA 1Y8MA 1JPNA 5E33A 2A5EA 3LS8A 3O48A 1XGWA 4CDVA 3RFYA 4AY6A 3ASDA 4LLEA 3PUKA 4AVXA 1L7CA 1ZB1A 5BV1A 1O87A 3SY2A 4WABA 2HJ3A 2KK1A 4YL0A 3CAXA 5BUZA 4HBDA 1PY1A 3MA5A 4BY6A 3CKCA 4XI9A 2B0JA 2Q9AA 4MQ9F 3HIZA 4CT0A 5IY5C 1HXIA 2LIGA 3M4BA 1O5MA 2R2LA 3NKEA 3B95A 3SF4A 2LFDA 3UKRG 3KAEA 3E33A 2P9LG 4UWLA 3FU5A 2LXLA 2J0XA 2QNLA 1A7EA 1B89A 2YL3A 3DI5A 4GA1A 3PS6A 3B0PA 5C1DA 4B8AA 4JC7A 3S2AA 256BA 4LNBA 2A1DD 4C7OB 5KYXB 3PEVB 3JXIA 2A68F 5LFAA 2OOCA 3GM3A 4W8KA 3UKUG 3RK6A 1E96B 1X5BA 4IN3B 1EI7A 1FFTC 2IQCA 3MGBA 1K3ZD 3TWXA 4U63A 4JCHA 2P9KG 1JCSA 2YHSA 4A63B 2YQYA 4NACA 3UM3A 2BF0X 4HI8A 3KH2A 2CHZA 3MCXA 1SW6A 2LFFA 2CFUA 5FJYA 3LLKA 3ZHEA 2EIKE 4PS7A 4JEUA 3L54A 4I6JA 4CS8A 3S7JA 1QBQA 4B6IA 2GRRB 2OKUA 2KXPC 4YWQA 4PJMA 1S64A 3E32A 4XKCA 4AIFA 1FVHA 2X0CA 3JZ0A 1HE8A 4B94A 3GZ1A 5ANRA 4MTGA 1OCCE 4UWKA 4ANVA 2WMNA 4EZKA 2F8YA 3T6GB 5JJ6A 1GGQA 2Y4TA 3LEWA 4EBAG 2PNOA 1YZAA 3IKOB 2XLEA 3ATPA 2H7BA 3W2VA 1YMPA 2L6HA 4RVBA 2P2CP 3ASNC 4E0IA 3PH0C 4HRMB 2VGEA 3ZYLA 1OR2A 1VK5A 4Z68A 3CVNA 3L8IA 3GANA 4OIOF 2LSEA 3HNJA 2LSUA 2V5FA 3QJZA 3Q79A 3DD7A 3SEOA 1MQSA 1TNUA 3QNKA 5HKPA 4NY3A 3TJ6A 4CS8C 2UUHA 1TR2A 5AGFA 1ZU2A 3HXCA 3BU8A 2P58C 3ESKA 3I4GA 2YLGA 3HNLA 2R7VA 4EUKB 5JVEA 2XLMA 4MTOA 1ORSC 4RD9A 1WATA 4ILIA 4CZ2D 5EKQD 1VTMP 1A41A 3ZTMA 3ZGQA 2PM6A 4C9BB 2GRPB 2B6CA 3SBTB 1W3BA 5DLJA 1NFNA 2WXIA 3E34A 1ORYA 1KLXA 4U5GA 2UY1A 2WXGA 4HOSA 3FWVA 1IW7F 2QY9A 2R7QA 3KSLA 1FAPB 4EHPA 3DRAA 3V30A 3OWTA 4BJ5C 2Y3BA 4Q4ZF 2RG8A 3JYHA 5AAOA 3UGOA 2EILC 4U07A 3UT4A 2HJMA 1MX6A 4U5HA 3LS0A 4UI9J 3SQVA 4FA6A 1Z63A 3R7CA 3OAWA 3V5ZA 2DYSE 1WTYA 5EHHA 4GYTA 3D3MA 4LERA 4MBGA 2L9JA 1LF8A 4UWGA 5ENTD 4O6NA 2XEVA 4WJ0A 2ZU6B 3VLEA 3TL5A 3SFXA 3ZKJA 4CJOA 1ZU4A 2LK4A 3U64A 3B0UX 5FZRA 2VGXA 5A6BA 4G78A 3AU4A 1H0AA 4KVMA 1Q0FA 1LI7A 1MMAA 5JJ7A 1INZA 1HU3A 1OW8A 3L82A 4U8VD 2QTVA 4MW3A 4TV3A 2X3MA 2HR2A 3EFOA 2M63A 2VCCA 4OD5A 3MZLB 2FFHA 4WNEA 3MLGA 3DXMG 3UIPC 3ASOC 1VB5A 1WN0A 2ETSA 5JLIA 1NLXA 2OCCC 1YCSB 1O3UA 2XLHA 3NYLA 1TKNA 4KT6B 1NA0A 4RDAA 1T9KA 3G4ZA 3DM5A 2XS1A 4DRHB 3WAQA 1HW2A 3D9HA 4C0EA 5M72A 5AC5A 2IBFA 1CPQA 3S0XA 3EQLF 5GPGB 1U0BB 2PBEA 1OKKA 1GS9A 2NSGA 5CCLA 5COGA 4YVOA 5DS5A 2R7XA 2NC9A 2R7RA 3C18A 3GM1A 3UPVA 4MNDA 3QC1A 3ABLC 1SZIA 3X1OA 3VTYA 5BV0A 4NC3A 2L81A 3EH1A 4XEIG 2LSVA 5AJLA 2X6JA 1MMDA 4G11A 1ZHTA 4KBQA 4MTFA 2AXUA 1YA9A 1V74B 3UMVA 3LEOA 2NSFA 3LESA 2P0NA 3E9VA 1HZ4A 2X38A 2P7VA 2G3KA 2RFMA 1ELRA 3JT1A 5ANLA 2WVNA 1TWAA 1X81A 4OAUC 3CLJA 3FP3A 4J8SA 2WVOA 1DNPA 2Y1LE 3D9MA 2NUTB 3AG3C 4X0RA 5CRVA 2J8WA 3RIBA 2HFIA 1FR0A 1OXKA 2XGOA 4JD2G 2X51A 4GZ3A 5JS5A 2IF4A 1VYIA 4E7ZA 1M2OA 1V55E 2KSFA 4FADA 3LNMB 4WNFA 2XZDG 1IQUA 2J45A 1NFOA 3DWWA 4OINF 3FH5A 2R7OA 5FZSA 3AG1E 1JAFA 4P9TA 2XS8A 1HS6A 2DYRC 2LNIA 1QLEC 4WNDA 2P1AA 2IONA 3JCUQ 1N4PA 3JSEO 4CS7A 4XKBA 3LVRE 3RU0A 1QZ2A 5B3SC 5B1AE 1BI8B 2J46A 4MKTA 1E8ZA 2R17C 2HZ8A 4JJFA 5E75A 2XEEA 1KNYA 2I1JA 1O1TA 1O1RA 1FMVA 2GFHA 3GYZA 3SXZA 2YWAA 2P61A 1C02A 4EBKA 3W9FA 4FLHA 3B7SA 3SFZA 4BX8A 3TG5A 2WXHA 3ASFA 3LJ3A 3K1IA 1HW1A 1OWNA 1UFBA 4C3BA 1CGME 4WNGA 2VJ8A 3MV2B 2VTBB 2LQGA 4DRIB 1ZHZA 2L6GA 4KNVA 4GU5A 2WPVA 3ASHA 4K0RA 2OEXA 2IXOA 3D9JA 1Y6DA 2OU6A 4U0UA 4CEMA 4EBBA 2IFUA 2CW0F 3UINC 3FUIA 3AG1C 5B1BE 5LCWC 2YQ8A 2DI3A 2W45A 3KKBA 2VSXE 3WHNA 4XI0A 3BEEA 3UM2A 1RW2A 4U7EB 4U96D 3T9OA 1A17A 3EGXB 4MS6A 3GZ2A 3QAQA 3E70C 4R32A 2J9UA 4FC8A 3ULQA 3PREA 4L7TA 2FF4A 4CCAA 1HY5A 3T5VA 4AL1A 1JR8A 3L34A 1ZHXA 3FH7A 2OVBA 4RQIA 3AJIA 3QW1A 2Y69E 4ANUA 4KYOB 3R9AB 3QVYA 3SBSA 5CBNA 1YA0A 3SXYA 5AC4A 5KNGA 3LAYA 2WXKA 4NTAA 5KYUA 5F28E 4APOA 3DJNB 1U6HA 1OCZE 3K1HA 2MHKA 2ONDA 4JA9A 3ABMC 2J07A 3L13A 4HS2A 3C63A 2KCVA 3W9GA 3V2OA 2IEJA 3TWTA 4CGWA 3U9MA 1G8XA 5G2NA 3U3BA 1EPUA 2I8BA 2J7PD 4A2NB 3T6BA 3ZPJA 3UXGA 4HOTA 4JVSA 2V4HC 1Y6IA 2MWQA 2Q9BA 4DUIA 1UN8A 1O5HA 3RKOF 2L0IA 3MJWA 3PE3A 4GMLA 3ULYA 2YLDA 4YVQC 3FUMA 4CDMA 2FI7A 2L9BA 3PNLB 5EIBE 1KZOA 1ZHWA 4DPRA 2ZXPA 2GRLA 1CPRA 3FY4A 3Q15A 3N2ZB 5ENRD 3NYJA 1OW7A 2CNWA 3Q6MA 4O1PA 5AQAA 3V5XA 4LNGA 5ARFA 1QVXA 2I1KA 1SYQA 4B0ZA 4YT2A 5DBKA 1E84A 1N4SA 3F46A 2A0UA 1XZPA 1TN6A 2PX3A 1YLMA 2QUPA 4JRZA 2X6KA 3ZN3A 4A3VA 1K40A 4YDYA 4MVRA 3ZC4A 4N39A 3O55A 4JXTA 3RQEA 4Z9JA 4HI9A 1OCRE 5AQ9A 5J08A 4GPKA 4LUNU 1LD8A 3DZAA 2C0MA 3LDZA 3CVLA 3HYMB 1E2XA 1UW4B 3X2QC 3NOCD 2XSEA 3DWLG 3ZEFA 3CVVA 3SO8A 4XLNF 2PQRA 4QDLA 1VOMA 1E90A 3CVWA 3CHRA 3UR3C 2QC9A 2VCAA 3BQOA 4ME2A 3V5YA 2YHEA 2ZXWE 3NQPA 1Q0DA 4BJ6A 1FVFA 5JJTA 1TN8A 4NQ0A 1K1AA 1TNZA 4E7SA 1W2WA 4MW8A 4J7YA 1MYOA 2J08A 3RVYA 1YARO 1AVOB 2WXFA 1XZQA 1HO8A 3FTYA 2EIJC 4J7WA 3DKAA 4A3TA 5ENNA 2VQ2A 1UN9A 3L9TA 2XM0A 3US6A 1RKCA 4DX2A 2AJAA 2IXNA 4JEBA 4DI3A 3PCVA 2AP3A 3CSTA 3IHUA 2D5RB 4YN0B
chains in the Genus database with same CATH topology
3ECSA 2G3VA 4I1OB 3FDQA 4KMOA 3JSZA 5EX0A 1JPJA 5BT1A 2AVPA 2GW1A 3I4RB 3ZRHA 4JL0A 4FJYA 4ATGA 3CHSA 2MOWA 4URKA 3IEEA 3FUEA 3S29A 1MNDA 2DBAA 1J8YF 4U0ZA 3V7OA 4BJ1A 4J0UA 1VYKA 4JC8A 3UQ3A 3AQBA 2WZLA 4YJWA 3ML9A 1H2UA 3ZYQA 2KJGA 4KI2A 1ZYRF 2PP4A 2H7VC 2J9QA 3B7UX 3O4ZA 1S7ZA 1JUQA 4KZCA 1UJJA 1Z5ZA 2I2OA 4C3DA 3LLIA 4GMJA 1HFAA 3S28A 1PD1A 2WVIA 3EHNA 3MYVA 2WQ6A 2KGOA 5E3AA 4AE4B 2OV8A 3UUXA 4I9EA 4DI4A 2RD0A 3OXFA 2VSOE 4XTKA 4M3OA 3ZVVA 2M4EA 3NYMA 4EWCA 2X6HA 2KQ9A 3CKBA 2CG3A 5EGYA 2WVQA 4I17A 2AXVA 4H7YA 4LEUA 4L2LA 3QDNA 4EQFA 4ABNA 4BJTA 3U3WA 3VYWA 5D92A 2KATA 5DS4A 5G04C 4L2YA 3EGDA 2IOLA 1FMWA 1SZAA 3IBEA 3NG1A 2MRIA 3T8MA 2YZSA 2VGYA 4GZ6A 4PS8A 2Y3HA 5E2QA 4G7HF 3GW4A 4U5CE 3PNTB 3FEYA 4N3BA 4UQZA 3PHF2 2ZXRA 3URZA 4EZJA 2EIMC 2Y3AA 3QK0A 5A6CA 3RH3A 3VLDA 4PFPA 4U5FE 2XCCA 2KZTB 5FWQA 4ILGA 1BR1A 2A6EF 1BR4A 2A5UA 3ZG1A 1WGWA 4YT4A 3TXNA 2QY7A 5CMYA 5KJKA 4APFA 3EHMA 2WZFA 4BJ5A 2IXPA 4KVOA 4EZLA 3N0TA 3ZVRA 4G23A 5AJDA 1MNEA 1Z3IX 2R7UA 4KBLA 3QWWA 3GODA 1D0XA 3EZHA 3CHQA 1LKXA 2NUTA 4F4BA 3TG4A 2OOEA 4I2ZA 3FAJA 2FGYA 3PRZA 1ZHYA 1HH8A 3LNRA 4OD4A 2NSZA 2OVFA 4TRQA 5CMWA 2WQHA 4LACB 2XL4A 4OIRF 2PFDA 1D1CA 2ZPAA 1TEZA 3UGPA 1D0ZA 5A7DB 3IHYA 1H2VC 3CVQA 2WL8A 2OG2A 3U9WA 3APFA 2ILRA 3I5QA 5FCLA 4G25A 3QOUA 1OCOC 2JD3A 3POVA 3CK9A 1BR2A 4KXKB 4LLCA 4M63A 5C2YA 4UQXA 2XQ0A 1NZEA 5T8IA 4IAOA 1TWCA 1M2VB 4J32B 3TAXA 3L17A 4G7OF 1PD0A 2C0LA 3ONKA 3CK8A 3QARA 4KC9A 3LY7A 1JWFA 1TJCA 4PJLA 4XZ4A 2VTBA 5KYWB 4CT4A 3CSFA 5T1DB 3AQCA 3KD7A 4RBNA 2P6VA 1WM5A 3SNHA 4FHKA 3EIQC 1FTSA 3PDNA 4HORA 1GW6A 3FTUA 3L6AA 2NUPB 3FTSA 2CG2A 3EGXA 4I6GA 2H7OA 4ANWA 3BG0B 2DGJA 4OIPF 4XIFA 4CSAC 3SYNA 3SZ7A 1V54C 2J49A 3UMHA 2WXOA 3FVYA 3WG7C 3PMRA 2J0WA 2WZGA 1OWMA 4B8CB 1JPLA 4N3AA 3JRTA 3HJCA 5JHAA 3UT7A 4I2WA 4FWVA 2YNQA 4GYWA 3NDBB 3S7FA 4F7AA 2J4BA 5FQ8A 3QMKA 2J09A 3EG9B 5KCMA 3LCAA 2KCLA 4N2SA 3TJPA 4R7LA 4G24A 3CZ6A 4DVYP 2V4LA 1H19A 2YEVA 5BW8C 4Q5SF 2XRZA 3ZXSA 3ZYKA 5E3CA 4PK4A 2W9YA 1RJ9B 3VAYA 2HYZA 5L3QA 2VB6A 3VLFA 3JYSA 4I9CA 3EH2A 1NZNA 3FDHA 4ACLA 4BTAA 3LVQE 4H4KC 3CVXA 3HVEB 4QI2A 1LS1A 3T6JA 1H6KA 3LXUX 2A6HF 3CHMA 2HV6A 4XE0A 3KL4A 3CVUA 4J8FA 5G05J 5EDSA 4E6HA 2IJGX 3S7DA 1Z23A 4P29A 3C98A 3R7RA 3KMIA 5LX8A 1WY6A 4F1SA 3DBSA 3AG4C 3CEQA 2HO1A 3FUNA 2FBNA 4IWBA 4AOFA 1E7UA 4YNDA 5AIJA 4HXIA 3LY9A 2BTDA 2C03A 3D9LA 1OWPA 5HQ8A 1PC2A 1BPOA 3JQ1A 4OIQF 3WXXA 2G62A 5D0OD 2EINC 4L23A 3Q49B 1E8XA 1MMGA 4YT8A 3UMIA 3CK7A 1N52A 4GCNA 4W9RA 4F3VA 3ZSUA 2V26A 2C2LA 4KZ0A 4HOUA 5DS6A 3LJBA 4CIHA 2VSNA 2CHWA 3EZIA 1TWHA 5BNWA 4UWFA 3Q47B 5CCMA 3PEUB 2FEZA 5DQTA 1MHQA 1VMAA 3I3NA 1Z3XA 3RRNB 2LAHA 1XNFA 4ZLDA 3CVPA 3MV3B 3DAFA 2C04A 3CR3A 2L6JA 3Q5MA 4ZLCA 4JZYA 3AU5A 4CBEA 3DJUB 3AS8A 5DIZA 2KCKA 2R7TA 4I44A 4MRUA 3IEGA 3RRUA 4DBRA 3D9KA 3OXLA 3LPZA 2CDQA 3NZSA 3FU6A 4AE4A 3HTKC 5BUOA 2JEKA 4GAAA 4JW1A 2HM8A 2JLBA 4G0HA 5G55A 4GZCA 2V8SE 4PJJA 4C7OA 5KYXA 3OA1A 3PE4A 1M56C 3LKUA 5DVWA 2XRYA 2XXAB 5G04J 4ANXA 2KNHA 4I1MA 4Q69A 4C0MA 1HF8A 5FTPA 1U3CA 1H2TC 3RRMB 2MYSA 4DBQA 5F5FA 1DVPA 4RG6A 4CS9A 4GYYA 4WWOA 1EYHA 5BPPA 3WODF 5T3RA 2XPZA 2V0PA 3FUDA 1PCXA 5KJNA 3ABKC 2KZTA 5A23A 3M1CB 3MKQB 3ENEA 2E87A 1JWGA 5L3VA 3IHVA 3CIAA 3AG2C 3LYAA 4EPZA 4FLBA 4CS9C 3DAGA 3FULA 3RIPA 3F47A 3AS5A 4JPSA 3ZIMA 1KU2A 1EDUA 4CGVA 4XWJA 4G2VA 1NA3A 3ONLA 4GA2A 4BWRA 4AJWA 4HVBA 4ANJA 4PS3A 3ESLA 3FTVA 4HFKB 3N24A 2WXJA 3CSKA 2LO6A 1WAO1 3I4UA 4CDNA 1HX8A 3Q7GA 1M2VA 2R5SA 2WB2A 1ELWA 2V3CC 1KT0A 4JJGA 1EF1C 4PUCA 5HSWA 3FUFA 2VASA 5CHEE 4ULWA 2R7SA 5KYWA 4IYPA 2IOQA 3EIJA 4XX5A 4FU3A 3LEVA 2O9XA 3PVLA 4PJNA 4IJJA 3ZFWA 3T5XA 2I9CA 1OKKD 5T3WA 2NUPA 3FUKA 3CVYA 4EECA 1UJKA 5KYNA 3JUIA 2AW6A 1NP7A 3SHFA 1IYGA 2X6FA 2WB7A 4HE8D 1NU7D 4U5DE 1Z6TA 4A55A 3Q6NA 4JURI 4JHKA 3S27A 4FP7A 4GZ5A 2GGFA 3QB2A 2CGEA 4G26A 1OWOA 3PZDA 4EBAA 5JHBA 4BX9A 3EG9A 4CDRA 2J9WA 3UNGC 4V3IA 4O6YA 2XCBA 5KYYB 4BFRA 3LS1A 2EIKC 2A4ZA 4DOZA 4E85A 3D9NA 3FH8A 4JHRA 1RJ9A 1OCCC 3I5PA 1LVKA 3SNXA 3D9IA 2Z15A 3EJNA 1TJFA 4P6IC 3E4BA 5EX3A 2VYIA 4HOQA 3JQ0A 2L0TB 3GZSA 3NKDA 4AEZC 2WXRA 4GA0A 3HVEA 2PZIA 3HHMA 4J8DA 4JA7A 2VSYA 4DVZA 3SGHA 4GEHA 3FTWA 2AXZA 1HG2A 4CSAA 3G2WA 2X6IA 3G2VA 4C3EA 4K0DA 4B89A 4HFFB 1J8MF 2KW3C 4IULA 3DPDA 3QKYA 1TWGA 2J9VA 3FTZA 4Y6WA 5CI9A 4UI9K 1D1AA 1OWLA 3D9PA 5LCWJ 3FUJA 4TUUA 4J30B 4Y6CA 4GYOA 4BT8A 3S7BA 4FJZA 3IV0A 4HFGA 4I1AA 4IRUA 3ZW3A 3HLZA 2Q7FA 3ZHEB 2KC7A 3K9IA 1NG1A 1SQMA 4D10C 3EGDB 4GB9A 4ACKA 2WXLA 3APDA 3RKVA 4U5EE 3L0IA 1FFHA 3VTXA 4BSXA 3CHPA 3FTXA 1N54A 3EPVA 2DYSC 3P2BA 3Q4AB 3QWPA 3U66A 4BEJA 2IYLD 3B0VC 3KS2A 4WAFA 2XGSA 2XRHA 3ITFA 1PAQA 3W2WA 4UQYA 3RJVA 1HG5A 2PL2A 4FESA 3RO2A 1NU9C 3FFLA 4RSYA 3CV0A 3DMDA 1FCHA 1Z3YA 5E76A 2CNWD 4J6IA 4WUYA 3ZYMA 5AENA 3B7RL 5FQ7A 4AM9A 4O79A 2WXQA 3SP1A 1ZBPA 3H65A 3FHEA 2PM7A 1M57C 2UY1B 4AV7A 4LRZA 3CQGB 4QFVA 1ST6A 3APCA 4O6FA 4JZAA 4AY5A 1QZXA 3W8HA 2AWIA 4BG0A 3O39A 4L1BA 4PDXA 2IXMA 5LOZA 1UG3A 4I43A 1OUVA 2QFCA 2CHXA 1Z6AA 2E2EA 2Y3DA 5FQ4A 4HLEA 3UX4A 4GCOA 4DLQA 4U5BE 4UI9C 3OXGA 4DK5A 4BTBA 2LAIA 4AK9A 3CQCB 3FU3A 4OVVA 3MEKA 4LCTA 2VGXB 1SF8A 3TXMA 4XLPF 4AP2A 2XXAA 3MKRA 1ZU5A 4AX2A 1QNFA 3NF1A 1IZMA 2NXPA 2DIWA 3QZCA 3EFOB 1QQEA 1V55C 4Q94A 4QI0A 5KJLA 4DJAA 3W8IA 3B9QA 4OYSA 3KEZA 3MX3A 4K03A 2E0IA 4G7ZF 2J4DA 2XPIA 4YT5A 2KM4A 4MLPA 2WXMA 4Q7CA 4Q96A 5D0QD 4DLOA 5DQZA 5T4YA 3UMKA 3QWVA 4CRWA 2I6HA 2BUGA 1SZ9A 1ELKA 3R7QA 5B1AC 5KJMA 3MKQA 4G1TA 5FQ6A 5FZQA 4AXHA 3K7DA 2W4BA 3ASGA 4U8HA 3DM9B 3SD5A 3K1IC 4PH4B 5ARGA 4JHJA 4WWPA 4ILHB 3Q7LA 4NURA 3U4TA 5D91A 3CQZA 1U3DA 2DCPA 5FT9A 5B1BC 1P5QA 2NG1A 3K33A 3G2SA 1L5JA 4UWHA 3L22A 1IHGA 3JCKC 2PF4E 3SI5A 4O7GA 3FU0A 3N71A 2Q3TA 4N2QA 2XGMA 2WQ7A 4U0SA 2Y69C 4HEAJ 1VDYA 3CGHA 2Q9CA 1S0PA 1OCZC 5F5HA 3NZUA 2WXPA 3DXJF 4JEHA 3T4RA 3NRHA 2Y4UA 3TGOA 3HDXA 5AYWD 4O6MA 3ZIBA 1KT1A 3RO3A 4U04A 4KNWA 2IOSA 2IU1A 1E7VA 3L16A 3TD7A 2XPYA 3LY8A 4WWNA 2W4MA 3ML8A 4OVUA 5G05C 3RYLA 2YHCA 3OTNA 4PFOA 2GRMA 2UWJG 5CI8A 3G2UA 2CFZA 4H7XA 1N1CA 1IQRA 4A1SA 1SMYF 4NRHB 3UT8A 3EDTB 4J8EA 3K6BA 5HI7A 2Y39A 4RG9A 3K66A 4A1GA 3SZRA 3BG1B 4N3CA 3FUHA 2WM9A 3FHDA 1OCRC 4N06A 3AS4A 2XHEA 3OEOA 5J90A 2A69F 5T3TA 1MMNA 3PUJA 2PX0A 5KYUB 4BJ6C 3B13A 2FO7A 3B7TA 3CHOA 3D9OA 1E8WA 2R59A 4F53A 2VH3A 3G2TA 2EQXA 5LP0A 2ZXWC 4FX5A 3L08A 4I3MA 2WMOA 3FEXA 3O6XA 2Y3GA 2BE5F 2PQNA 2YINA 4K7BA 5KYYA 2HV7A 2ZXOA 2J7PA 4GZDA 1D0YA 3P1UA 4FHJA 4BT9A 1E8YA 4FULA 1D1BA 2WXNA 2FULA 4N5CA 4I6EA 2R7WA 1Y8MA 1JPNA 5E33A 3LS8A 3O48A 1XGWA 3RFYA 4AY6A 3ASDA 4LLEA 3PUKA 4AVXA 5BV1A 1O87A 5BUZA 1PY1A 3MA5A 4BY6A 3CKCA 4XI9A 2B0JA 2Q9AA 4MQ9F 3HIZA 4CT0A 5IY5C 1HXIA 3NKEA 3SF4A 3KAEA 4UWLA 3FU5A 2J0XA 1B89A 4GA1A 3PS6A 3B0PA 5C1DA 4B8AA 3S2AA 2A1DD 4C7OB 5KYXB 3PEVB 2A68F 5LFAA 4W8KA 3RK6A 1E96B 1X5BA 4IN3B 1FFTC 2IQCA 3MGBA 4U63A 4JCHA 2YHSA 4NACA 2BF0X 3KH2A 2CHZA 3MCXA 2CFUA 5FJYA 3LLKA 3ZHEA 4PS7A 4JEUA 3L54A 4I6JA 4CS8A 3S7JA 4B6IA 4YWQA 4PJMA 4AIFA 4XKCA 1FVHA 1HE8A 4B94A 3GZ1A 5ANRA 4UWKA 4ANVA 2WMNA 4EZKA 5JJ6A 4EBAG 2Y4TA 3LEWA 3IKOB 2H7BA 3W2VA 4RVBA 3ASNC 3PH0C 3ZYLA 1VK5A 3CVNA 3GANA 4OIOF 2LSEA 2LSUA 2V5FA 3QJZA 3DD7A 3SEOA 1MQSA 3QNKA 4NY3A 4CS8C 1TR2A 1ZU2A 3ESKA 2P58C 3I4GA 2R7VA 4RD9A 4ILIA 5EKQD 3ZGQA 2PM6A 4C9BB 3SBTB 1W3BA 5DLJA 2WXIA 1KLXA 2UY1A 4U5GA 2WXGA 4HOSA 3FWVA 1IW7F 2QY9A 2R7QA 3OWTA 4BJ5C 2Y3BA 4Q4ZF 2RG8A 3JYHA 3UGOA 2EILC 4U07A 3UT4A 4U5HA 3LS0A 4UI9J 4FA6A 1Z63A 3OAWA 5EHHA 4GYTA 3D3MA 4LERA 2L9JA 1LF8A 4UWGA 4O6NA 2XEVA 4WJ0A 2ZU6B 3VLEA 3TL5A 3U64A 1ZU4A 3B0UX 5FZRA 2VGXA 3AU4A 1H0AA 4KVMA 5JJ7A 1MMAA 1INZA 1HU3A 2QTVA 4TV3A 2X3MA 2HR2A 3EFOA 2M63A 4OD5A 3MZLB 2FFHA 4WNEA 3MLGA 3ASOC 2OCCC 3NYLA 1TKNA 4KT6B 1NA0A 4RDAA 3DM5A 4C0EA 5M72A 3S0XA 3EQLF 1OKKA 5CCLA 4YVOA 5DS5A 2R7XA 2NC9A 2R7RA 3UPVA 4MNDA 3QC1A 3ABLC 1SZIA 3X1OA 3VTYA 5BV0A 2L81A 3EH1A 2LSVA 5AJLA 2X6JA 1MMDA 4G11A 1ZHTA 4KBQA 2AXUA 3UMVA 3LESA 1HZ4A 3E9VA 2X38A 2P7VA 2G3KA 1ELRA 3JT1A 5ANLA 2WVNA 1TWAA 3CLJA 3FP3A 4J8SA 2WVOA 1DNPA 3D9MA 2NUTB 3AG3C 4X0RA 3RIBA 2XGOA 2X51A 4GZ3A 2IF4A 1VYIA 4E7ZA 1M2OA 4FADA 4WNFA 1IQUA 2J45A 4OINF 3FH5A 2R7OA 5FZSA 1HS6A 2DYRC 2LNIA 1QLEC 4WNDA 2IONA 3JCUQ 4CS7A 4XKBA 3LVRE 3RU0A 1QZ2A 5B3SC 2J46A 4MKTA 1E8ZA 2R17C 4JJFA 5E75A 2I1JA 1FMVA 2GFHA 3GYZA 4FLHA 3B7SA 3SFZA 4BX8A 3TG5A 2WXHA 3ASFA 3LJ3A 1OWNA 4C3BA 4WNGA 2VJ8A 3MV2B 2VTBB 4GU5A 1ZHZA 4KNVA 2WPVA 3ASHA 4K0RA 3D9JA 2IXOA 4U0UA 4CEMA 4EBBA 2IFUA 2CW0F 3FUIA 3AG1C 5LCWC 2YQ8A 2W45A 3KKBA 2VSXE 4XI0A 3BEEA 1A17A 3EGXB 4MS6A 3GZ2A 3QAQA 3E70C 2J9UA 4FC8A 3ULQA 3PREA 4L7TA 2FF4A 4CCAA 3T5VA 3L34A 1ZHXA 3FH7A 2OVBA 4ANUA 4KYOB 3R9AB 3SBSA 1YA0A 3LAYA 2WXKA 5KYUA 4APOA 3DJNB 3K1HA 2MHKA 2ONDA 4JA9A 3ABMC 2J07A 3L13A 4HS2A 2KCVA 4CGWA 1G8XA 5G2NA 1EPUA 2I8BA 2J7PD 4A2NB 3T6BA 3ZPJA 4HOTA 4JVSA 1Y6IA 2MWQA 2Q9BA 4GMLA 1UN8A 1O5HA 3RKOF 2L0IA 3MJWA 3PE3A 4YVQC 3FUMA 4CDMA 2FI7A 2L9BA 3PNLB 1ZHWA 4DPRA 2ZXPA 2GRLA 3FY4A 3Q15A 3N2ZB 3NYJA 2CNWA 3Q6MA 5ARFA 2I1KA 4B0ZA 4YT2A 5DBKA 3F46A 2PX3A 2X6KA 3ZN3A 4A3VA 3ZC4A 4N39A 4JXTA 5J08A 4GPKA 4LUNU 3DZAA 2C0MA 3LDZA 3CVLA 3HYMB 1UW4B 3X2QC 2XSEA 3ZEFA 3CVVA 4XLNF 2PQRA 4QDLA 1VOMA 1E90A 3CVWA 3CHRA 3UR3C 4ME2A 2YHEA 3NQPA 4BJ6A 1FVFA 5JJTA 4NQ0A 4E7SA 1W2WA 2J08A 2WXFA 1HO8A 3FTYA 2EIJC 4A3TA 5ENNA 2VQ2A 1UN9A 2IXNA 4DI3A 3CSTA 2D5RB 4YN0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PUC A;  3LEW A;  3EJN A;  3CGH A;  3CK9 A;  3IV0 A;  3JYS A;  3CK7 A;  3MCX A;  3I4G A;  5T4Y A;  3P1U A;  4LER A;  3L22 A;  4Q69 A;  3JQ0 A;  3FDH A;  4MRU A;  3GZS A;  3CKC A;  5E76 A;  3EHN A;  4F53 A;  3MYV A;  4L7T A;  3CKB A;  3HDX A;  3NQP A;  3OTN A;  3JQ1 A;  5FQ6 A;  5FQ7 A;  5LX8 A;  4F7A A;  3KEZ A;  5E75 A;  3MX3 A;  5FQ8 A;  3SGH A;  3QNK A;  5FQ4 A;  5J90 A;  3EHM A;  3SNX A;  5T3R A;  3CK8 A; 
#chains in the Genus database with same CATH topology
 3ECS A;  4JE9 A;  1OXJ A;  2G3V A;  3BEH A;  3HNI A;  4I1O B;  3FDQ A;  1KTM A;  4KMO A;  3KYI A;  3JSZ A;  5EX0 A;  2OQM A;  1JPJ A;  5BT1 A;  4DXW A;  2XEH A;  2AVP A;  2GW1 A;  3I4R B;  3ZRH A;  4JL0 A;  4FJY A;  4O1O A;  4ATG A;  3CHS A;  1FNT c;  1VLT A;  2MOW A;  3NOG D;  4URK A;  3IEE A;  3FUE A;  3NMJ A;  3S29 A;  2DWZ A;  3M15 A;  1MND A;  2DBA A;  2IM8 A;  3LJN A;  1J8Y F;  1EKY A;  2F22 A;  4U0Z A;  3TJ5 A;  3MFN A;  3U2M A;  2HS5 A;  3AGU A;  3V7O A;  4BJ1 A;  4J0U A;  1VYK A;  4JC8 A;  3UQ3 A;  3AQB A;  2WZL A;  4YJW A;  3ML9 A;  1QQ3 A;  2VCB A;  2IY0 C;  5EIL A;  1H2U A;  1QPU A;  3ZYQ A;  2KJG A;  3A9C A;  4KI2 A;  1ZYR F;  2PP4 A;  4X8Q A;  5JSL A;  3Q78 A;  2AWY A;  4HB5 A;  2H7V C;  2J9Q A;  3B7U X;  3O4Z A;  2BKG A;  1S7Z A;  1JUQ A;  4KZC A;  1UJJ A;  1Z5Z A;  1OXB A;  2I2O A;  3J5Q B;  2XLW A;  3LLI A;  4C3D A;  4GMJ A;  2OEV A;  1HFA A;  3S28 A;  4H54 A;  1PD1 A;  2WVI A;  1E86 A;  3EHN A;  3MYV A;  5JA4 D;  5FIN A;  1NFI E;  2WQ6 A;  2KGO A;  5E3A A;  4AE4 B;  2OV8 A;  5HRY A;  3UUX A;  3TWU A;  4I9E A;  4DI4 A;  4DX5 D;  2RD0 A;  3OXF A;  2VSO E;  4XTK A;  4M3O A;  3ZVV A;  2HMQ A;  5ENP D;  2M4E A;  4J7T A;  1MQV A;  3NYM A;  4EWC A;  3ASN E;  2X6H A;  4PAC A;  1ZZP A;  2KQ9 A;  3CKB A;  2CG3 A;  5EGY A;  2WVQ A;  4IAQ A;  4I17 A;  4Z9I A;  2AXV A;  1DCQ A;  4H7Y A;  4LEU A;  1YYX A;  4N6H A;  4L2L A;  3QDN A;  3DE9 A;  1WWP A;  4EQF A;  3B71 A;  4ABN A;  4BJT A;  2RKK A;  3U3W A;  3VYW A;  1DOV A;  5D92 A;  3A11 A;  2KAT A;  2FAP B;  5DS4 A;  5G04 C;  4L2Y A;  3M79 A;  1TN7 A;  3EGD A;  2IOL A;  1F1M A;  1G4W R;  1FMW A;  3UM0 A;  1SZA A;  3IBE A;  3NG1 A;  2MRI A;  3T8M A;  2YZS A;  1DOW A;  4U9E A;  2VGY A;  4GZ6 A;  4PS8 A;  2Y3H A;  5E2Q A;  2GDC A;  4G7H F;  3GW4 A;  3B7B A;  3HRA A;  4U5C E;  3W4Y A;  3PNT B;  3FEY A;  4N3B A;  4UQZ A;  3PHF 2;  1RXQ A;  2HE0 A;  2ZXR A;  3URZ A;  4EZJ A;  2EIM C;  2Y3A A;  3QK0 A;  5A6C A;  3RH3 A;  3VLD A;  4PFP A;  4U5F E;  2XCC A;  2KZT B;  5FWQ A;  4ILG A;  1Q2Z A;  1BR1 A;  2A6E F;  1N4R A;  1BR4 A;  4C48 B;  1QKR A;  2GRQ B;  1RKE B;  4JCZ A;  2A5U A;  2P9I G;  3ZG1 A;  1WGW A;  4YT4 A;  4GPM A;  4IGG A;  5CRU A;  2EIL E;  3TXN A;  1K8K G;  2JAB A;  2QY7 A;  5CMY A;  5AQ7 A;  5KJK A;  2LP4 A;  3TWV A;  4APF A;  3DSX A;  1TQG A;  3EHM A;  2WZF A;  2KYH A;  4BJ5 A;  2IXP A;  1IHB A;  1SR2 A;  4KVO A;  4EZL A;  3N0T A;  3ZVR A;  4G23 A;  4O60 A;  5AJD A;  1D9S A;  1MNE A;  1Z3I X;  2R7U A;  4KBL A;  2JX0 A;  3FOO A;  3QWW A;  1Z5S C;  3GOD A;  3R2P A;  1D0X A;  1MZC A;  4E0H A;  4WGY A;  3EZH A;  1LD7 A;  1A7D A;  4DX7 D;  3CHQ A;  1JCQ A;  1LKX A;  2NUT A;  4F4B A;  3TG4 A;  5AQB A;  2OOE A;  4I2Z A;  3FAJ A;  2FGY A;  5L0J A;  4JKV A;  3PRZ A;  1ZHY A;  1EA8 A;  2Q00 A;  3LNR A;  1HH8 A;  4OD4 A;  2NSZ A;  2OVF A;  3HXD A;  4TRQ A;  5CMW A;  2WQH A;  3FOP A;  4LAC B;  2XL4 A;  4OIR F;  2PFD A;  1BZ4 A;  1D1C A;  2L7A A;  2ZPA A;  4DRX E;  1TEZ A;  3UGP A;  1H9G A;  1D0Z A;  3ASO E;  5A7D B;  3IHY A;  1YAU O;  2PNN A;  1H2V C;  2OCC E;  3CVQ A;  5CER B;  1JRA A;  2WL8 A;  2OG2 A;  3U9W A;  3APF A;  2ILR A;  3I5Q A;  2ZD9 A;  5FCL A;  1R4T A;  4XEF A;  2J8S D;  3QOU A;  4G25 A;  1OCO C;  2JD3 A;  3POV A;  3CK9 A;  1BR2 A;  4KXK B;  4LLC A;  4M63 A;  4M7C A;  5C2Y A;  4UQX A;  2XQ0 A;  4YL1 A;  1SA4 A;  1NZE A;  5T8I A;  4IAO A;  1V54 E;  4NQF A;  1TWC A;  3PZ1 A;  1M2V B;  4J32 B;  2F8X K;  3ABL E;  3TAX A;  3L17 A;  4G7O F;  1HE9 A;  3SXK A;  1PD0 A;  2C0L A;  3Q7F A;  4ONS A;  2ZIS A;  1XWJ A;  3ONK A;  3CK8 A;  3QAR A;  3MYI A;  3C7J A;  4KC9 A;  3LY7 A;  4NTB A;  1JWF A;  3PZ4 A;  2LD6 A;  1TJC A;  4PJL A;  1OY3 D;  4XZ4 A;  5CEA A;  1K05 A;  1NBB A;  2VTB A;  5KYW B;  4CT4 A;  3CSF A;  5T1D B;  3IQ5 A;  3AQC A;  3KD7 A;  3KEA A;  4YDW A;  2BC5 A;  5H7P A;  2GRN B;  4RBN A;  2P6V A;  1WM5 A;  3SNH A;  3AG3 E;  3HXB A;  4FHK A;  4IAR A;  4MVO A;  3EIQ C;  1FTS A;  3PDN A;  4HOR A;  1GW6 A;  2R02 A;  4CDA A;  2B0O E;  3FTU A;  3L6A A;  2OEW A;  5L0C A;  2XLD A;  2NUP B;  3FTS A;  2CG2 A;  3EGX A;  4I6G A;  3DPY A;  2H7O A;  4ANW A;  3BG0 B;  2DGJ A;  1TYQ G;  4OIP F;  4XIF A;  3TWR A;  4CSA C;  1TR4 A;  3SYN A;  5TJ5 E;  3SZ7 A;  1V54 C;  3U2L A;  2J49 A;  2H8A A;  4XPY A;  3UMH A;  2WXO A;  3FVY A;  3WG7 C;  5CBO A;  2DYR E;  3Q73 A;  3PMR A;  2J0W A;  2WZG A;  4ZFH A;  3FXH A;  4MVZ A;  1OWM A;  3FAP B;  4B8C B;  1JPL A;  4N3A A;  4TXR A;  3JRT A;  3PZ2 A;  5EID A;  2XEN A;  3T8K A;  3HJC A;  5JHA A;  4TXP A;  3TWW A;  4XPX A;  5B3S E;  3UT7 A;  4I2W A;  4FWV A;  5KBA A;  5K0I A;  1LPE A;  2YNQ A;  4GYW A;  2HKV A;  2XL8 A;  3NDB B;  3S7F A;  4F7A A;  2J4B A;  5FQ8 A;  3QMK A;  1BD8 A;  4GTM A;  2YLI A;  1UG7 A;  2ETB A;  2J09 A;  3EG9 B;  5EK0 A;  5KCM A;  2QLA A;  1FT2 A;  1Q0K A;  3RQF A;  2AWC A;  1E85 A;  3LCA A;  1HMO A;  5L0I A;  2KCL A;  1DC2 A;  4N2S A;  3TJP A;  2AVK A;  4G24 A;  4R7L A;  3CZ6 A;  3ZQV A;  4DVY P;  2V4L A;  1H19 A;  2YEV A;  5BW8 C;  4Q5S F;  2XRZ A;  1YYJ A;  3ZXS A;  3H2V A;  4MS2 A;  3ZYK A;  5FIO A;  5E3C A;  4PK4 A;  2NPU A;  2W9Y A;  5HS0 A;  1RJ9 B;  3AG4 E;  2YVK A;  3VAY A;  2HYZ A;  5L3Q A;  2VB6 A;  3VLF A;  3JYS A;  4I9C A;  3U9J A;  3EH2 A;  1NZN A;  4LG6 A;  4UUC A;  3TWQ A;  3FDH A;  4L9P A;  4ACL A;  4LSZ E;  3H2U A;  2J9B A;  1WOL A;  4BTA A;  3LVQ E;  4H4K C;  3VM6 A;  3CVX A;  3HVE B;  4QI2 A;  3DSS A;  2JPU A;  1LS1 A;  3T6J A;  1H6K A;  3LXU X;  1CGO A;  2A6H F;  3CHM A;  4EHM A;  2HV6 A;  4XE0 A;  3TOL A;  3T9K A;  3KL4 A;  4BEP A;  3CVU A;  4J8F A;  1YJG A;  3ABM E;  5G05 J;  5EDS A;  4E6H A;  2IJG X;  3S7D A;  1Z23 A;  4HRL A;  3GWN A;  4P29 A;  3C98 A;  3R7R A;  3VF0 A;  3KMI A;  4YDO A;  2LCH A;  5LX8 A;  1WY6 A;  1H9T A;  4XEV A;  4F1S A;  3E37 A;  5KNH D;  3DST A;  3DBS A;  3AG4 C;  3Q7A A;  3CEQ A;  2HO1 A;  4G8K A;  3FUN A;  2XZT G;  2QYJ A;  2FBN A;  3C8G D;  5BQI A;  4IWB A;  4AOF A;  1E7U A;  4YND A;  5AIJ A;  5CIV A;  4HXI A;  3LY9 A;  5A6K A;  2BTD A;  2C03 A;  3D9L A;  1OWP A;  5HQ8 A;  1PC2 A;  5AAR A;  1BPO A;  2QZA A;  3JQ1 A;  4OIQ F;  1BBH A;  3WXX A;  3JYY A;  2G62 A;  4U95 D;  1EQ1 A;  5D0O D;  1MX4 A;  2EIN C;  4L23 A;  1E8X A;  3Q49 B;  1MMG A;  3Q9U C;  4YT8 A;  1KPS B;  3UMI A;  3CK7 A;  1N52 A;  4GCN A;  4W9R A;  4F3V A;  1WDY A;  3ZSU A;  3J5P A;  2V26 A;  3EHR A;  2C2L A;  4KZ0 A;  4HOU A;  4UDV A;  2BL2 A;  5DS6 A;  3L1M A;  3HXF A;  3LJB A;  4CIH A;  2VSN A;  2CHW A;  3EZI A;  2EPL X;  1BI7 B;  1TWH A;  4D4X A;  4UWF A;  5BNW A;  3Q47 B;  2RFA A;  5CCM A;  4A4A A;  3PEU B;  5JRA A;  2FEZ A;  3X2Q E;  4GTT A;  4JIO A;  5DQT A;  1E83 A;  1MHQ A;  4J8Y A;  1VMA A;  4LDQ A;  3M4C A;  4LDK A;  3I3N A;  2RD9 A;  1Z3X A;  3DXK G;  3RRN B;  5KWD A;  2LAH A;  1C17 M;  1XNF A;  1OR3 A;  4ZLD A;  3C3Q A;  3CVP A;  3MV3 B;  3DAF A;  2C04 A;  3CR3 A;  3GWL A;  2L6J A;  3Q5M A;  4F1P A;  4E18 A;  4ZLC A;  4JZY A;  3AU5 A;  4CBE A;  2EPM X;  3DJU B;  3HKK A;  2Q4F A;  2FO1 E;  3AS8 A;  5DIZ A;  2KCK A;  2R7T A;  3G50 A;  4I44 A;  2EIJ E;  3U8V A;  3ZDL A;  4MRU A;  5B3I A;  3IEG A;  3RRU A;  4DBR A;  3D9K A;  3OXL A;  2DVW A;  2CDQ A;  3LPZ A;  3NZS A;  3FU6 A;  1QSP A;  4AE4 A;  5BQG A;  3HTK C;  5BUO A;  2JEK A;  4GAA A;  4JW1 A;  2HM8 A;  2JLB A;  1UOH A;  5ENS D;  3NMI A;  2ETA A;  4G0H A;  5G55 A;  4GZC A;  2V8S E;  2OJE D;  4PJJ A;  4DX1 A;  3L8J A;  4C7O A;  5BQH A;  5KYX A;  5BXU A;  3OA1 A;  3PE4 A;  1M56 C;  3ZU7 B;  3LKU A;  3UTM A;  5DVW A;  2YL0 A;  3BUA A;  4Z9H A;  2XRY A;  2XXA B;  1LIH A;  5G04 J;  3BRJ A;  4ANX A;  2KNH A;  4I1M A;  3V79 K;  4Q69 A;  4C0M A;  4AL0 A;  1HF8 A;  5FTP A;  2LUH A;  3QW0 A;  1U3C A;  1Y4C A;  1H6P A;  1H2T C;  4L6R A;  3RRM B;  2MYS A;  3GEE A;  4DBQ A;  5F5F A;  1DVP A;  3RQG A;  4RG6 A;  3C5R A;  4CS9 A;  4GYY A;  2ZGD A;  4WWO A;  4BSZ B;  1EYH A;  5BPP A;  3WOD F;  5T3R A;  2XPZ A;  4MVM A;  2V0P A;  3VRC A;  3FUD A;  1JOG A;  1PCX A;  5KJN A;  3ABK C;  2KZT A;  5A23 A;  3M1C B;  3U8P A;  2IO3 C;  1RKE A;  1H7I A;  4K5A B;  3DEP A;  2CCY A;  1RMV A;  2A0B A;  3RVZ A;  3MKQ B;  1G5Z A;  3ENE A;  2E87 A;  1JWG A;  4XEK A;  4YL3 A;  5L3V A;  2D4U A;  3IHV A;  3UM1 A;  3CIA A;  3AG2 C;  3LYA A;  4EPZ A;  3IQC A;  4FLB A;  4GTQ A;  1LI5 A;  3CEX A;  1FT1 A;  4CS9 C;  3DAG A;  3FUL A;  3RIP A;  3F47 A;  4N4W A;  3R9M A;  3TQO A;  3AS5 A;  1VLS A;  4PR9 A;  4JPS A;  3ZIM A;  5ITZ F;  5JMN D;  1KU2 A;  2DZO A;  1K04 A;  2H6G A;  2R25 A;  1EDU A;  4CGV A;  4XWJ A;  4JTC B;  5JUA A;  3EU9 A;  4U9D A;  4G2V A;  1NA3 A;  3ONL A;  4GA2 A;  5D2M C;  1AWC B;  4BWR A;  4AJW A;  4HVB A;  4ANJ A;  3JRM O;  4PS3 A;  4JTD B;  3ESL A;  2EIM E;  3SFY A;  1WAS A;  3RAU A;  3FTV A;  3U0C A;  3SXM A;  4HFK B;  4YK5 A;  3N24 A;  2WXJ A;  4ATZ D;  3CSK A;  1C03 A;  5A6B D;  2LO6 A;  1WAO 1;  3I4U A;  4CDN A;  1HX8 A;  3Q7G A;  4GTS A;  1LM3 B;  1I5N A;  1M2V A;  2Q7R A;  2R5S A;  2WB2 A;  1ELW A;  3S90 A;  5CEC B;  2V3C C;  4WGZ A;  4MVQ A;  1KT0 A;  1I4Z A;  3G4X A;  4JJG A;  1EF1 C;  1IKN D;  4PUC A;  5HSW A;  3FUF A;  3AJM A;  2VAS A;  5CHE E;  2B0H A;  1FPP A;  4ULW A;  2R7S A;  5KYW A;  4K5B A;  4IYP A;  2IOQ A;  2HSB A;  4W8P A;  3EIJ A;  4XX5 A;  4FU3 A;  3LEV A;  1HE1 A;  1A5E A;  2O9X A;  3PVL A;  1BU9 A;  2MYO A;  4PJN A;  4IJJ A;  3ZFW A;  3T5X A;  2I9C A;  1S05 A;  1QYM A;  4G8L A;  1OKK D;  5T3W A;  2NUP A;  3FUK A;  1U89 A;  3DSV A;  3CVY A;  3KYJ A;  4EEC A;  1UJK A;  5KYN A;  3JUI A;  2AW6 A;  1NP7 A;  1S70 B;  3SHF A;  2YL1 A;  3NMK A;  1DCE A;  1TNB A;  1IYG A;  3V31 A;  2ZGG A;  2X6F A;  3C8G B;  1N0Q A;  1ZW3 A;  2WB7 A;  4HE8 D;  1HMD A;  1NU7 D;  3ZTZ A;  4U5D E;  1IXV A;  1Z6T A;  1OCO E;  4A55 A;  3Q6N A;  4JUR I;  4JHK A;  3S27 A;  2M64 A;  4FP7 A;  4GZ5 A;  2GGF A;  4NIK A;  3QB2 A;  1T6U A;  5EYL A;  1U2V G;  2XLV A;  2CGE A;  4G26 A;  1OWO A;  1JCR A;  3PZD A;  4EBA A;  1BDJ B;  5JHB A;  3S9O A;  2F0Y A;  4FAP B;  4BX9 A;  1Z7Q c;  3EG9 A;  4E17 A;  4CDR A;  2J9W A;  3UNG C;  4V3I A;  1Q0M A;  4O6Y A;  2XCB A;  5D66 A;  5KYY B;  2VC9 A;  4BFR A;  3ZQY A;  4D4N A;  3LS1 A;  4HQD A;  2EIK C;  2A4Z A;  4DOZ A;  3GM2 A;  4E85 A;  2GWW A;  2GA0 A;  4N5Q A;  3D9N A;  3FH8 A;  2KBX A;  5EYP F;  3B29 A;  4JHR A;  4CJG A;  1RJ9 A;  1OCC C;  3I5P A;  2P9S G;  1LVK A;  1G3N B;  5AN8 A;  3SNX A;  3D9I A;  2Z15 A;  3EJN A;  1TJF A;  4P6I C;  1ZVZ A;  3E4B A;  5EX3 A;  2VYI A;  4HOQ A;  3JUE A;  3JQ0 A;  1H6G A;  2L0T B;  3EUV A;  3NKD A;  3GZS A;  4AEZ C;  1TNY A;  4XQ1 A;  2WXR A;  3TUL A;  5COF A;  4GA0 A;  3HVE A;  3QTH A;  2PZI A;  3HHM A;  4J8D A;  3EHQ A;  4F6R D;  4JA7 A;  2VSY A;  4DVZ A;  3SGH A;  4GEH A;  3WG7 E;  3FTW A;  2AXZ A;  1HG2 A;  2GRO B;  4CSA A;  3G2W A;  1MJ0 A;  5A6J A;  2X6I A;  3G2V A;  4C3E A;  4K5C A;  4K0D A;  1T5O A;  3IPM O;  5BXO A;  4B89 A;  4HFF B;  3DSW A;  1D8D A;  1J8M F;  2KW3 C;  3C3O A;  1AEP A;  2QE9 A;  4LDR A;  1K1B A;  3DPD A;  3QKY A;  4N6C A;  2L6F A;  4IUL A;  1TWG A;  2J9V A;  3FTZ A;  4Y6W A;  2XM4 A;  5CI9 A;  4UI9 K;  1D1A A;  1OWL A;  3D9P A;  5LCW J;  3FUJ A;  4TUU A;  5ENO D;  2R9R B;  2EPN A;  4J30 B;  4Y6C A;  4GYO A;  1SA5 A;  3EU5 A;  4BT8 A;  3S7B A;  4ULV A;  4FJZ A;  3HG0 D;  3IV0 A;  4HFG A;  3HNK A;  4I1A A;  2RSE B;  1S63 A;  4IRU A;  3ZW3 A;  3TWS A;  3HLZ A;  2Q7F A;  3ZHE B;  2KC7 A;  3K9I A;  5L0G A;  1YVI A;  1NG1 A;  1A7V A;  1SQM A;  4D10 C;  3EGD B;  5EN5 D;  4GB9 A;  2QYU A;  2WXL A;  4U8Y D;  4ACK A;  1N94 A;  3APD A;  3RKV A;  5L0H A;  1R5I D;  3ULE G;  4U5E E;  3L0I A;  2H6I A;  1FFH A;  3VTX A;  4BSX A;  3CHP A;  3FTX A;  4NTF A;  5COM A;  1N54 A;  2GAQ A;  3EPV A;  2DYS C;  3P2B A;  3Q4A B;  3QWP A;  3U66 A;  2XL6 A;  4BEJ A;  2CYD A;  2IYL D;  3RF3 A;  3AGT A;  3DE8 A;  3B0V C;  1YYH A;  3KS2 A;  4WAF A;  2XGS A;  2XRH A;  3ITF A;  3TOM A;  1PAQ A;  4XPW A;  3W2W A;  4UQY A;  3RJV A;  4BET A;  2V5Q C;  2AU5 A;  1HG5 A;  1ZW2 A;  2PL2 A;  4FES A;  3RO2 A;  1NU9 C;  3FFL A;  1T6Q A;  3NBN B;  2R05 A;  3Q75 A;  4RSY A;  3CV0 A;  3DMD A;  1FCH A;  1Z3Y A;  1N9A A;  2ETC A;  5E76 A;  3PDM P;  2CNW D;  2YL7 A;  4J6I A;  4WUY A;  4ER9 A;  3ISM C;  3ZYM A;  4BPM A;  5ENQ D;  5AEN A;  3B7R L;  4P9F A;  5FQ7 A;  4AM9 A;  4O79 A;  2WXQ A;  3SP1 A;  1ZBP A;  3H65 A;  3FHE A;  2YRF A;  2PM7 A;  1M57 C;  2UY1 B;  4AV7 A;  4LRZ A;  3U5S A;  3CQG B;  4QFV A;  1ST6 A;  4CDY A;  3APC A;  3C72 A;  4O6F A;  4JZA A;  4AY5 A;  1V4A A;  4BEM J;  1YZC A;  1Q0G A;  1QZX A;  3W8H A;  5HV9 A;  2AWI A;  2HSQ A;  4DX6 D;  4BG0 A;  3O39 A;  1KZP A;  4L1B A;  4PDX A;  2IXM A;  3NAW A;  5LOZ A;  1UG3 A;  4I43 A;  1OUV A;  2QFC A;  2CHX A;  2I15 A;  1Z6A A;  2E2E A;  2Y3D A;  3GOR A;  1OQC A;  5FQ4 A;  2EIN E;  4HLE A;  3UX4 A;  4GCO A;  4DLQ A;  3PZ3 A;  4U5B E;  4IB4 A;  3OXG A;  4UI9 C;  3C62 A;  4DK5 A;  4BTB A;  1JMW A;  4GTV A;  3DSU A;  2LAI A;  4AK9 A;  3CQC B;  2LXM A;  3V2X A;  2F37 A;  3FU3 A;  4OVV A;  1LE2 A;  3U3F A;  3ZXP A;  3MEK A;  4LCT A;  3J06 A;  2VGX B;  1SF8 A;  4GTO A;  3TXM A;  4XLP F;  1ORJ A;  4AP2 A;  2XXA A;  4CIP A;  3MKR A;  1ZU5 A;  1AP7 A;  4AX2 A;  1QNF A;  3NF1 A;  3FMS A;  1IZM A;  2KC3 A;  1TFK B;  2EPO A;  4NCQ A;  2ICW G;  2NXP A;  2DIW A;  1MX2 A;  3QZC A;  3EFO B;  1QQE A;  1V55 C;  3GEH A;  4QQI A;  4Q94 A;  3Q9N C;  4QI0 A;  5KJL A;  4DJA A;  3W8I A;  4DRJ B;  4BES A;  3B9Q A;  4OYS A;  3KEZ A;  3MX3 A;  2P9N G;  4K03 A;  2E0I A;  4G7Z F;  1NL4 A;  2J4D A;  2P9P G;  4CX9 A;  2XPI A;  4YT5 A;  1PV3 A;  1H6O A;  2KM4 A;  1YDI A;  2TMV P;  4MLP A;  2WXM A;  1T6I A;  4Q7C A;  4GTP A;  4Q96 A;  5D0Q D;  4DLO A;  5DQZ A;  1N95 A;  5T4Y A;  3UMK A;  3QWV A;  4CRW A;  3KSQ A;  2I6H A;  2BUG A;  1SZ9 A;  3KPH A;  1ELK A;  2Y0B G;  3R7Q A;  5B1A C;  5KJM A;  3MKQ A;  4G1T A;  5FQ6 A;  5FZQ A;  4AXH A;  3K7D A;  2W4B A;  3C3R A;  3ASG A;  4U8H A;  3DM9 B;  4GMR A;  3SD5 A;  1AUE A;  3GEI A;  3K1I C;  4PH4 B;  5ARG A;  1LE4 A;  4JHJ A;  4TUM A;  3IQ6 A;  1N4Q A;  4WWP A;  4ILH B;  3AAA C;  3Q7L A;  3C8Z A;  4NUR A;  1T01 A;  3QVZ A;  3U4T A;  5D91 A;  3RSE G;  3CQZ A;  1U3D A;  2DCP A;  4MVS A;  2BKK B;  5FT9 A;  2XLO A;  3DEO A;  1APC A;  5B1B C;  3F6Q A;  1P5Q A;  2NG1 A;  3K33 A;  1LS4 A;  5CED B;  3G2S A;  1L5J A;  4K1O A;  2MHR A;  4UWH A;  3L22 A;  1IHG A;  3JCK C;  2DZN A;  1YA7 O;  2PF4 E;  3SI5 A;  4O7G A;  1LTX A;  4JB8 P;  3FU0 A;  3N71 A;  4EKW A;  2Q3T A;  4N2Q A;  2XGM A;  2WQ7 A;  1TFO B;  1WG0 A;  1SVX A;  4U0S A;  3ZNG A;  3O10 A;  2Y69 C;  4HEA J;  1N11 A;  1VDY A;  1NI1 A;  3IQT A;  3CGH A;  2P9U G;  1G4U S;  2Q9C A;  1OCZ C;  3ZWI A;  1S0P A;  3JXJ A;  3ABK E;  5F5H A;  3NB2 A;  3NZU A;  2WXP A;  3DXJ F;  5FZT A;  4JEH A;  4RLY A;  3T4R A;  4EBJ A;  3NRH A;  2Y4U A;  2ZIR A;  3HDX A;  5AYW D;  3TGO A;  3AOU A;  3LUT B;  2H6H A;  4O6M A;  3ZIB A;  4EIY A;  2HMZ A;  3TK0 A;  2H6F A;  1KT1 A;  3RO3 A;  4U04 A;  4KNW A;  2IOS A;  1TNO A;  2IU1 A;  2NYJ A;  3AG2 E;  1E7V A;  1N0R A;  1NSG B;  4B93 B;  3L16 A;  5JT4 A;  3TD7 A;  4MVU A;  4HLL A;  2XPY A;  3LY8 A;  4WWN A;  3JTL O;  3HXE A;  1CGN A;  5L0F A;  2W4M A;  3ML8 A;  4JTA B;  4JEA A;  1BLX B;  1L3P A;  4OVU A;  5G05 C;  3RYL A;  2HUJ A;  2BED A;  2YHC A;  3OTN A;  3E30 A;  2EPK X;  4PFO A;  2GRM A;  2UWJ G;  5CI8 A;  4OAV B;  3G2U A;  2CFZ A;  4H7X A;  1N1C A;  1M6T A;  1IQR A;  4A1S A;  1SMY F;  4NRH B;  3UT8 A;  3EDT B;  3IXE A;  4J8E A;  4HNA D;  1OT8 A;  4LNU D;  4TXQ A;  1I4Y A;  3K6B A;  2IO2 C;  5HI7 A;  3S84 A;  4DJ9 A;  1B68 A;  2Y39 A;  4RG9 A;  3K66 A;  4A1G A;  4GQH A;  3SZR A;  3BG1 B;  4N3C A;  3FUH A;  2WM9 A;  4GTR A;  3FHD A;  1OCR C;  2ASR A;  3C8G A;  4N06 A;  3AS4 A;  2XHE A;  5JP7 A;  4BER A;  2L6B A;  3OEO A;  5J90 A;  2A69 F;  5T3T A;  1MMN A;  5A6A A;  3PUJ A;  1OW6 A;  2PX0 A;  5KYU B;  4BJ6 C;  3UI2 A;  3B13 A;  1RCP A;  2FO7 A;  3B7T A;  3CHO A;  5IY5 E;  3D9O A;  2OJQ A;  1E8W A;  2R59 A;  2YKZ A;  3ZUV B;  2VH3 A;  3G2T A;  2EQX A;  4F53 A;  5LP0 A;  3RW0 A;  2ZXW C;  4FX5 A;  3L08 A;  2DB4 A;  4I3M A;  1D8E A;  2WMO A;  3FEX A;  3O6X A;  5L0D A;  2BE5 F;  2Y3G A;  4HRN A;  2PQN A;  2YIN A;  4YDE A;  4CYM D;  4K7B A;  1O1S A;  1A0B A;  5KYY A;  3MBG A;  3MYF A;  2HV7 A;  2ZXO A;  1RZ4 A;  2J7P A;  4GZD A;  1D0Y A;  3P1U A;  4FHJ A;  4BT9 A;  2UUI A;  1GQA A;  1E8Y A;  2R03 A;  3UIO C;  4ZHB A;  4FUL A;  1D1B A;  2WXN A;  1GM5 A;  2FUL A;  4N5C A;  5A69 A;  4I6E A;  2R7W A;  1Y8M A;  1JPN A;  5E33 A;  2A5E A;  3LS8 A;  3O48 A;  1XGW A;  4CDV A;  3RFY A;  4AY6 A;  3ASD A;  4LLE A;  3PUK A;  4AVX A;  1L7C A;  1ZB1 A;  5BV1 A;  1O87 A;  3SY2 A;  4WAB A;  2HJ3 A;  2KK1 A;  4YL0 A;  3CAX A;  5BUZ A;  4HBD A;  1PY1 A;  3MA5 A;  4BY6 A;  3CKC A;  4XI9 A;  2B0J A;  2Q9A A;  4MQ9 F;  3HIZ A;  4CT0 A;  5IY5 C;  1HXI A;  2LIG A;  3M4B A;  1O5M A;  2R2L A;  3NKE A;  3B95 A;  3SF4 A;  2LFD A;  3UKR G;  3KAE A;  3E33 A;  2P9L G;  4UWL A;  3FU5 A;  2LXL A;  2J0X A;  2QNL A;  1A7E A;  1B89 A;  2YL3 A;  3DI5 A;  4GA1 A;  3PS6 A;  3B0P A;  5C1D A;  4B8A A;  4JC7 A;  3S2A A;  256B A;  4LNB A;  2A1D D;  4C7O B;  5KYX B;  3PEV B;  3JXI A;  2A68 F;  5LFA A;  2OOC A;  3GM3 A;  4W8K A;  3UKU G;  3RK6 A;  1E96 B;  1X5B A;  4IN3 B;  1EI7 A;  1FFT C;  2IQC A;  3MGB A;  1K3Z D;  3TWX A;  4U63 A;  4JCH A;  2P9K G;  1JCS A;  2YHS A;  4A63 B;  2YQY A;  4NAC A;  3UM3 A;  2BF0 X;  4HI8 A;  3KH2 A;  2CHZ A;  3MCX A;  1SW6 A;  2LFF A;  2CFU A;  5FJY A;  3LLK A;  3ZHE A;  2EIK E;  4PS7 A;  4JEU A;  3L54 A;  4I6J A;  4CS8 A;  3S7J A;  1QBQ A;  4B6I A;  2GRR B;  2OKU A;  2KXP C;  4YWQ A;  4PJM A;  1S64 A;  3E32 A;  4XKC A;  4AIF A;  1FVH A;  2X0C A;  3JZ0 A;  1HE8 A;  4B94 A;  3GZ1 A;  5ANR A;  4MTG A;  1OCC E;  4UWK A;  4ANV A;  2WMN A;  4EZK A;  2F8Y A;  3T6G B;  5JJ6 A;  1GGQ A;  2Y4T A;  3LEW A;  4EBA G;  2PNO A;  1YZA A;  3IKO B;  2XLE A;  3ATP A;  2H7B A;  3W2V A;  1YMP A;  2L6H A;  4RVB A;  2P2C P;  3ASN C;  4E0I A;  3PH0 C;  4HRM B;  2VGE A;  3ZYL A;  1OR2 A;  1VK5 A;  4Z68 A;  3CVN A;  3L8I A;  3GAN A;  4OIO F;  2LSE A;  3HNJ A;  2LSU A;  2V5F A;  3QJZ A;  3Q79 A;  3DD7 A;  3SEO A;  1MQS A;  1TNU A;  3QNK A;  5HKP A;  4NY3 A;  3TJ6 A;  4CS8 C;  2UUH A;  1TR2 A;  5AGF A;  1ZU2 A;  3HXC A;  3BU8 A;  2P58 C;  3ESK A;  3I4G A;  2YLG A;  3HNL A;  2R7V A;  4EUK B;  5JVE A;  2XLM A;  4MTO A;  1ORS C;  4RD9 A;  1WAT A;  4ILI A;  4CZ2 D;  5EKQ D;  1VTM P;  1A41 A;  3ZTM A;  3ZGQ A;  2PM6 A;  4C9B B;  2GRP B;  2B6C A;  3SBT B;  1W3B A;  5DLJ A;  1NFN A;  2WXI A;  3E34 A;  1ORY A;  1KLX A;  4U5G A;  2UY1 A;  2WXG A;  4HOS A;  3FWV A;  1IW7 F;  2QY9 A;  2R7Q A;  3KSL A;  1FAP B;  4EHP A;  3DRA A;  3V30 A;  3OWT A;  4BJ5 C;  2Y3B A;  4Q4Z F;  2RG8 A;  3JYH A;  5AAO A;  3UGO A;  2EIL C;  4U07 A;  3UT4 A;  2HJM A;  1MX6 A;  4U5H A;  3LS0 A;  4UI9 J;  3SQV A;  4FA6 A;  1Z63 A;  3R7C A;  3OAW A;  3V5Z A;  2DYS E;  1WTY A;  5EHH A;  4GYT A;  3D3M A;  4LER A;  4MBG A;  2L9J A;  1LF8 A;  4UWG A;  5ENT D;  4O6N A;  2XEV A;  4WJ0 A;  2ZU6 B;  3VLE A;  3TL5 A;  3SFX A;  3ZKJ A;  4CJO A;  1ZU4 A;  2LK4 A;  3U64 A;  3B0U X;  5FZR A;  2VGX A;  5A6B A;  4G78 A;  3AU4 A;  1H0A A;  4KVM A;  1Q0F A;  1LI7 A;  1MMA A;  5JJ7 A;  1INZ A;  1HU3 A;  1OW8 A;  3L82 A;  4U8V D;  2QTV A;  4MW3 A;  4TV3 A;  2X3M A;  2HR2 A;  3EFO A;  2M63 A;  2VCC A;  4OD5 A;  3MZL B;  2FFH A;  4WNE A;  3MLG A;  3DXM G;  3UIP C;  3ASO C;  1VB5 A;  1WN0 A;  2ETS A;  5JLI A;  1NLX A;  2OCC C;  1YCS B;  1O3U A;  2XLH A;  3NYL A;  1TKN A;  4KT6 B;  1NA0 A;  4RDA A;  1T9K A;  3G4Z A;  3DM5 A;  2XS1 A;  4DRH B;  3WAQ A;  1HW2 A;  3D9H A;  4C0E A;  5M72 A;  5AC5 A;  2IBF A;  1CPQ A;  3S0X A;  3EQL F;  5GPG B;  1U0B B;  2PBE A;  1OKK A;  1GS9 A;  2NSG A;  5CCL A;  5COG A;  4YVO A;  5DS5 A;  2R7X A;  2NC9 A;  2R7R A;  3C18 A;  3GM1 A;  3UPV A;  4MND A;  3QC1 A;  3ABL C;  1SZI A;  3X1O A;  3VTY A;  5BV0 A;  4NC3 A;  2L81 A;  3EH1 A;  4XEI G;  2LSV A;  5AJL A;  2X6J A;  1MMD A;  4G11 A;  1ZHT A;  4KBQ A;  4MTF A;  2AXU A;  1YA9 A;  1V74 B;  3UMV A;  3LEO A;  2NSF A;  3LES A;  2P0N A;  3E9V A;  1HZ4 A;  2X38 A;  2P7V A;  2G3K A;  2RFM A;  1ELR A;  3JT1 A;  5ANL A;  2WVN A;  1TWA A;  1X81 A;  4OAU C;  3CLJ A;  3FP3 A;  4J8S A;  2WVO A;  1DNP A;  2Y1L E;  3D9M A;  2NUT B;  3AG3 C;  4X0R A;  5CRV A;  2J8W A;  3RIB A;  2HFI A;  1FR0 A;  1OXK A;  2XGO A;  4JD2 G;  2X51 A;  4GZ3 A;  5JS5 A;  2IF4 A;  1VYI A;  4E7Z A;  1M2O A;  1V55 E;  2KSF A;  4FAD A;  3LNM B;  4WNF A;  2XZD G;  1IQU A;  2J45 A;  1NFO A;  3DWW A;  4OIN F;  3FH5 A;  2R7O A;  5FZS A;  3AG1 E;  1JAF A;  4P9T A;  2XS8 A;  1HS6 A;  2DYR C;  2LNI A;  1QLE C;  4WND A;  2P1A A;  2ION A;  3JCU Q;  1N4P A;  3JSE O;  4CS7 A;  4XKB A;  3LVR E;  3RU0 A;  1QZ2 A;  5B3S C;  5B1A E;  1BI8 B;  2J46 A;  4MKT A;  1E8Z A;  2R17 C;  2HZ8 A;  4JJF A;  5E75 A;  2XEE A;  1KNY A;  2I1J A;  1O1T A;  1O1R A;  1FMV A;  2GFH A;  3GYZ A;  3SXZ A;  2YWA A;  2P61 A;  1C02 A;  4EBK A;  3W9F A;  4FLH A;  3B7S A;  3SFZ A;  4BX8 A;  3TG5 A;  2WXH A;  3ASF A;  3LJ3 A;  3K1I A;  1HW1 A;  1OWN A;  1UFB A;  4C3B A;  1CGM E;  4WNG A;  2VJ8 A;  3MV2 B;  2VTB B;  2LQG A;  4DRI B;  1ZHZ A;  2L6G A;  4KNV A;  4GU5 A;  2WPV A;  3ASH A;  4K0R A;  2OEX A;  2IXO A;  3D9J A;  1Y6D A;  2OU6 A;  4U0U A;  4CEM A;  4EBB A;  2IFU A;  2CW0 F;  3UIN C;  3FUI A;  3AG1 C;  5B1B E;  5LCW C;  2YQ8 A;  2DI3 A;  2W45 A;  3KKB A;  2VSX E;  3WHN A;  4XI0 A;  3BEE A;  3UM2 A;  1RW2 A;  4U7E B;  4U96 D;  3T9O A;  1A17 A;  3EGX B;  4MS6 A;  3GZ2 A;  3QAQ A;  3E70 C;  4R32 A;  2J9U A;  4FC8 A;  3ULQ A;  3PRE A;  4L7T A;  2FF4 A;  4CCA A;  1HY5 A;  3T5V A;  4AL1 A;  1JR8 A;  3L34 A;  1ZHX A;  3FH7 A;  2OVB A;  4RQI A;  3AJI A;  3QW1 A;  2Y69 E;  4ANU A;  4KYO B;  3R9A B;  3QVY A;  3SBS A;  5CBN A;  1YA0 A;  3SXY A;  5AC4 A;  5KNG A;  3LAY A;  2WXK A;  4NTA A;  5KYU A;  5F28 E;  4APO A;  3DJN B;  1U6H A;  1OCZ E;  3K1H A;  2MHK A;  2OND A;  4JA9 A;  3ABM C;  2J07 A;  3L13 A;  4HS2 A;  3C63 A;  2KCV A;  3W9G A;  3V2O A;  2IEJ A;  3TWT A;  4CGW A;  3U9M A;  1G8X A;  5G2N A;  3U3B A;  1EPU A;  2I8B A;  2J7P D;  4A2N B;  3T6B A;  3ZPJ A;  3UXG A;  4HOT A;  4JVS A;  2V4H C;  1Y6I A;  2MWQ A;  2Q9B A;  4DUI A;  1UN8 A;  1O5H A;  3RKO F;  2L0I A;  3MJW A;  3PE3 A;  4GML A;  3ULY A;  2YLD A;  4YVQ C;  3FUM A;  4CDM A;  2FI7 A;  2L9B A;  3PNL B;  5EIB E;  1KZO A;  1ZHW A;  4DPR A;  2ZXP A;  2GRL A;  1CPR A;  3FY4 A;  3Q15 A;  3N2Z B;  5ENR D;  3NYJ A;  1OW7 A;  2CNW A;  3Q6M A;  4O1P A;  5AQA A;  3V5X A;  4LNG A;  5ARF A;  1QVX A;  2I1K A;  1SYQ A;  4B0Z A;  4YT2 A;  5DBK A;  1E84 A;  1N4S A;  3F46 A;  2A0U A;  1XZP A;  1TN6 A;  2PX3 A;  1YLM A;  2QUP A;  4JRZ A;  2X6K A;  3ZN3 A;  4A3V A;  1K40 A;  4YDY A;  4MVR A;  3ZC4 A;  4N39 A;  3O55 A;  4JXT A;  3RQE A;  4Z9J A;  4HI9 A;  1OCR E;  5AQ9 A;  5J08 A;  4GPK A;  4LUN U;  1LD8 A;  3DZA A;  2C0M A;  3LDZ A;  3CVL A;  3HYM B;  1E2X A;  1UW4 B;  3X2Q C;  3NOC D;  2XSE A;  3DWL G;  3ZEF A;  3CVV A;  3SO8 A;  4XLN F;  2PQR A;  4QDL A;  1VOM A;  1E90 A;  3CVW A;  3CHR A;  3UR3 C;  2QC9 A;  2VCA A;  3BQO A;  4ME2 A;  3V5Y A;  2YHE A;  2ZXW E;  3NQP A;  1Q0D A;  4BJ6 A;  1FVF A;  5JJT A;  1TN8 A;  4NQ0 A;  1K1A A;  1TNZ A;  4E7S A;  1W2W A;  4MW8 A;  4J7Y A;  1MYO A;  2J08 A;  3RVY A;  1YAR O;  1AVO B;  2WXF A;  1XZQ A;  1HO8 A;  3FTY A;  2EIJ C;  4J7W A;  3DKA A;  4A3T A;  5ENN A;  2VQ2 A;  1UN9 A;  3L9T A;  2XM0 A;  3US6 A;  1RKC A;  4DX2 A;  2AJA A;  2IXN A;  4JEB A;  4DI3 A;  3PCV A;  2AP3 A;  3CST A;  3IHU A;  2D5R B;  4YN0 B; 
#chains in the Genus database with same CATH homology
 3ECS A;  2G3V A;  4I1O B;  3FDQ A;  4KMO A;  3JSZ A;  5EX0 A;  1JPJ A;  5BT1 A;  2AVP A;  2GW1 A;  3I4R B;  3ZRH A;  4JL0 A;  4FJY A;  4ATG A;  3CHS A;  2MOW A;  4URK A;  3IEE A;  3FUE A;  3S29 A;  1MND A;  2DBA A;  1J8Y F;  4U0Z A;  3V7O A;  4BJ1 A;  4J0U A;  1VYK A;  4JC8 A;  3UQ3 A;  3AQB A;  2WZL A;  4YJW A;  3ML9 A;  1H2U A;  3ZYQ A;  2KJG A;  4KI2 A;  1ZYR F;  2PP4 A;  2H7V C;  2J9Q A;  3B7U X;  3O4Z A;  1S7Z A;  1JUQ A;  4KZC A;  1UJJ A;  1Z5Z A;  2I2O A;  4C3D A;  3LLI A;  4GMJ A;  1HFA A;  3S28 A;  1PD1 A;  2WVI A;  3EHN A;  3MYV A;  2WQ6 A;  2KGO A;  5E3A A;  4AE4 B;  2OV8 A;  3UUX A;  4I9E A;  4DI4 A;  2RD0 A;  3OXF A;  2VSO E;  4XTK A;  4M3O A;  3ZVV A;  2M4E A;  3NYM A;  4EWC A;  2X6H A;  2KQ9 A;  3CKB A;  2CG3 A;  5EGY A;  2WVQ A;  4I17 A;  2AXV A;  4H7Y A;  4LEU A;  4L2L A;  3QDN A;  4EQF A;  4ABN A;  4BJT A;  3U3W A;  3VYW A;  5D92 A;  2KAT A;  5DS4 A;  5G04 C;  4L2Y A;  3EGD A;  2IOL A;  1FMW A;  1SZA A;  3IBE A;  3NG1 A;  2MRI A;  3T8M A;  2YZS A;  2VGY A;  4GZ6 A;  4PS8 A;  2Y3H A;  5E2Q A;  4G7H F;  3GW4 A;  4U5C E;  3PNT B;  3FEY A;  4N3B A;  4UQZ A;  3PHF 2;  2ZXR A;  3URZ A;  4EZJ A;  2EIM C;  2Y3A A;  3QK0 A;  5A6C A;  3RH3 A;  3VLD A;  4PFP A;  4U5F E;  2XCC A;  2KZT B;  5FWQ A;  4ILG A;  1BR1 A;  2A6E F;  1BR4 A;  2A5U A;  3ZG1 A;  1WGW A;  4YT4 A;  3TXN A;  2QY7 A;  5CMY A;  5KJK A;  4APF A;  3EHM A;  2WZF A;  4BJ5 A;  2IXP A;  4KVO A;  4EZL A;  3N0T A;  3ZVR A;  4G23 A;  5AJD A;  1MNE A;  1Z3I X;  2R7U A;  4KBL A;  3QWW A;  3GOD A;  1D0X A;  3EZH A;  3CHQ A;  1LKX A;  2NUT A;  4F4B A;  3TG4 A;  2OOE A;  4I2Z A;  3FAJ A;  2FGY A;  3PRZ A;  1ZHY A;  1HH8 A;  3LNR A;  4OD4 A;  2NSZ A;  2OVF A;  4TRQ A;  5CMW A;  2WQH A;  4LAC B;  2XL4 A;  4OIR F;  2PFD A;  1D1C A;  2ZPA A;  1TEZ A;  3UGP A;  1D0Z A;  5A7D B;  3IHY A;  1H2V C;  3CVQ A;  2WL8 A;  2OG2 A;  3U9W A;  3APF A;  2ILR A;  3I5Q A;  5FCL A;  4G25 A;  3QOU A;  1OCO C;  2JD3 A;  3POV A;  3CK9 A;  1BR2 A;  4KXK B;  4LLC A;  4M63 A;  5C2Y A;  4UQX A;  2XQ0 A;  1NZE A;  5T8I A;  4IAO A;  1TWC A;  1M2V B;  4J32 B;  3TAX A;  3L17 A;  4G7O F;  1PD0 A;  2C0L A;  3ONK A;  3CK8 A;  3QAR A;  4KC9 A;  3LY7 A;  1JWF A;  1TJC A;  4PJL A;  4XZ4 A;  2VTB A;  5KYW B;  4CT4 A;  3CSF A;  5T1D B;  3AQC A;  3KD7 A;  4RBN A;  2P6V A;  1WM5 A;  3SNH A;  4FHK A;  3EIQ C;  1FTS A;  3PDN A;  4HOR A;  1GW6 A;  3FTU A;  3L6A A;  2NUP B;  3FTS A;  2CG2 A;  3EGX A;  4I6G A;  2H7O A;  4ANW A;  3BG0 B;  2DGJ A;  4OIP F;  4XIF A;  4CSA C;  3SYN A;  3SZ7 A;  1V54 C;  2J49 A;  3UMH A;  2WXO A;  3FVY A;  3WG7 C;  3PMR A;  2J0W A;  2WZG A;  1OWM A;  4B8C B;  1JPL A;  4N3A A;  3JRT A;  3HJC A;  5JHA A;  3UT7 A;  4I2W A;  4FWV A;  2YNQ A;  4GYW A;  3NDB B;  3S7F A;  4F7A A;  2J4B A;  5FQ8 A;  3QMK A;  2J09 A;  3EG9 B;  5KCM A;  3LCA A;  2KCL A;  4N2S A;  3TJP A;  4R7L A;  4G24 A;  3CZ6 A;  4DVY P;  2V4L A;  1H19 A;  2YEV A;  5BW8 C;  4Q5S F;  2XRZ A;  3ZXS A;  3ZYK A;  5E3C A;  4PK4 A;  2W9Y A;  1RJ9 B;  3VAY A;  2HYZ A;  5L3Q A;  2VB6 A;  3VLF A;  3JYS A;  4I9C A;  3EH2 A;  1NZN A;  3FDH A;  4ACL A;  4BTA A;  3LVQ E;  4H4K C;  3CVX A;  3HVE B;  4QI2 A;  1LS1 A;  3T6J A;  1H6K A;  3LXU X;  2A6H F;  3CHM A;  2HV6 A;  4XE0 A;  3KL4 A;  3CVU A;  4J8F A;  5G05 J;  5EDS A;  4E6H A;  2IJG X;  3S7D A;  1Z23 A;  4P29 A;  3C98 A;  3R7R A;  3KMI A;  5LX8 A;  1WY6 A;  4F1S A;  3DBS A;  3AG4 C;  3CEQ A;  2HO1 A;  3FUN A;  2FBN A;  4IWB A;  4AOF A;  1E7U A;  4YND A;  5AIJ A;  4HXI A;  3LY9 A;  2BTD A;  2C03 A;  3D9L A;  1OWP A;  5HQ8 A;  1PC2 A;  1BPO A;  3JQ1 A;  4OIQ F;  3WXX A;  2G62 A;  5D0O D;  2EIN C;  4L23 A;  3Q49 B;  1E8X A;  1MMG A;  4YT8 A;  3UMI A;  3CK7 A;  1N52 A;  4GCN A;  4W9R A;  4F3V A;  3ZSU A;  2V26 A;  2C2L A;  4KZ0 A;  4HOU A;  5DS6 A;  3LJB A;  4CIH A;  2VSN A;  2CHW A;  3EZI A;  1TWH A;  5BNW A;  4UWF A;  3Q47 B;  5CCM A;  3PEU B;  2FEZ A;  5DQT A;  1MHQ A;  1VMA A;  3I3N A;  1Z3X A;  3RRN B;  2LAH A;  1XNF A;  4ZLD A;  3CVP A;  3MV3 B;  3DAF A;  2C04 A;  3CR3 A;  2L6J A;  3Q5M A;  4ZLC A;  4JZY A;  3AU5 A;  4CBE A;  3DJU B;  3AS8 A;  5DIZ A;  2KCK A;  2R7T A;  4I44 A;  4MRU A;  3IEG A;  3RRU A;  4DBR A;  3D9K A;  3OXL A;  3LPZ A;  2CDQ A;  3NZS A;  3FU6 A;  4AE4 A;  3HTK C;  5BUO A;  2JEK A;  4GAA A;  4JW1 A;  2HM8 A;  2JLB A;  4G0H A;  5G55 A;  4GZC A;  2V8S E;  4PJJ A;  4C7O A;  5KYX A;  3OA1 A;  3PE4 A;  1M56 C;  3LKU A;  5DVW A;  2XRY A;  2XXA B;  5G04 J;  4ANX A;  2KNH A;  4I1M A;  4Q69 A;  4C0M A;  1HF8 A;  5FTP A;  1U3C A;  1H2T C;  3RRM B;  2MYS A;  4DBQ A;  5F5F A;  1DVP A;  4RG6 A;  4CS9 A;  4GYY A;  4WWO A;  1EYH A;  5BPP A;  3WOD F;  5T3R A;  2XPZ A;  2V0P A;  3FUD A;  1PCX A;  5KJN A;  3ABK C;  2KZT A;  5A23 A;  3M1C B;  3MKQ B;  3ENE A;  2E87 A;  1JWG A;  5L3V A;  3IHV A;  3CIA A;  3AG2 C;  3LYA A;  4EPZ A;  4FLB A;  4CS9 C;  3DAG A;  3FUL A;  3RIP A;  3F47 A;  3AS5 A;  4JPS A;  3ZIM A;  1KU2 A;  1EDU A;  4CGV A;  4XWJ A;  4G2V A;  1NA3 A;  3ONL A;  4GA2 A;  4BWR A;  4AJW A;  4HVB A;  4ANJ A;  4PS3 A;  3ESL A;  3FTV A;  4HFK B;  3N24 A;  2WXJ A;  3CSK A;  2LO6 A;  1WAO 1;  3I4U A;  4CDN A;  1HX8 A;  3Q7G A;  1M2V A;  2R5S A;  2WB2 A;  1ELW A;  2V3C C;  1KT0 A;  4JJG A;  1EF1 C;  4PUC A;  5HSW A;  3FUF A;  2VAS A;  5CHE E;  4ULW A;  2R7S A;  5KYW A;  4IYP A;  2IOQ A;  3EIJ A;  4XX5 A;  4FU3 A;  3LEV A;  2O9X A;  3PVL A;  4PJN A;  4IJJ A;  3ZFW A;  3T5X A;  2I9C A;  1OKK D;  5T3W A;  2NUP A;  3FUK A;  3CVY A;  4EEC A;  1UJK A;  5KYN A;  3JUI A;  2AW6 A;  1NP7 A;  3SHF A;  1IYG A;  2X6F A;  2WB7 A;  4HE8 D;  1NU7 D;  4U5D E;  1Z6T A;  4A55 A;  3Q6N A;  4JUR I;  4JHK A;  3S27 A;  4FP7 A;  4GZ5 A;  2GGF A;  3QB2 A;  2CGE A;  4G26 A;  1OWO A;  3PZD A;  4EBA A;  5JHB A;  4BX9 A;  3EG9 A;  4CDR A;  2J9W A;  3UNG C;  4V3I A;  4O6Y A;  2XCB A;  5KYY B;  4BFR A;  3LS1 A;  2EIK C;  2A4Z A;  4DOZ A;  4E85 A;  3D9N A;  3FH8 A;  4JHR A;  1RJ9 A;  1OCC C;  3I5P A;  1LVK A;  3SNX A;  3D9I A;  2Z15 A;  3EJN A;  1TJF A;  4P6I C;  3E4B A;  5EX3 A;  2VYI A;  4HOQ A;  3JQ0 A;  2L0T B;  3GZS A;  3NKD A;  4AEZ C;  2WXR A;  4GA0 A;  3HVE A;  2PZI A;  3HHM A;  4J8D A;  4JA7 A;  2VSY A;  4DVZ A;  3SGH A;  4GEH A;  3FTW A;  2AXZ A;  1HG2 A;  4CSA A;  3G2W A;  2X6I A;  3G2V A;  4C3E A;  4K0D A;  4B89 A;  4HFF B;  1J8M F;  2KW3 C;  4IUL A;  3DPD A;  3QKY A;  1TWG A;  2J9V A;  3FTZ A;  4Y6W A;  5CI9 A;  4UI9 K;  1D1A A;  1OWL A;  3D9P A;  5LCW J;  3FUJ A;  4TUU A;  4J30 B;  4Y6C A;  4GYO A;  4BT8 A;  3S7B A;  4FJZ A;  3IV0 A;  4HFG A;  4I1A A;  4IRU A;  3ZW3 A;  3HLZ A;  2Q7F A;  3ZHE B;  2KC7 A;  3K9I A;  1NG1 A;  1SQM A;  4D10 C;  3EGD B;  4GB9 A;  4ACK A;  2WXL A;  3APD A;  3RKV A;  4U5E E;  3L0I A;  1FFH A;  3VTX A;  4BSX A;  3CHP A;  3FTX A;  1N54 A;  3EPV A;  2DYS C;  3P2B A;  3Q4A B;  3QWP A;  3U66 A;  4BEJ A;  2IYL D;  3B0V C;  3KS2 A;  4WAF A;  2XGS A;  2XRH A;  3ITF A;  1PAQ A;  3W2W A;  4UQY A;  3RJV A;  1HG5 A;  2PL2 A;  4FES A;  3RO2 A;  1NU9 C;  3FFL A;  4RSY A;  3CV0 A;  3DMD A;  1FCH A;  1Z3Y A;  5E76 A;  2CNW D;  4J6I A;  4WUY A;  3ZYM A;  5AEN A;  3B7R L;  5FQ7 A;  4AM9 A;  4O79 A;  2WXQ A;  3SP1 A;  1ZBP A;  3H65 A;  3FHE A;  2PM7 A;  1M57 C;  2UY1 B;  4AV7 A;  4LRZ A;  3CQG B;  4QFV A;  1ST6 A;  3APC A;  4O6F A;  4JZA A;  4AY5 A;  1QZX A;  3W8H A;  2AWI A;  4BG0 A;  3O39 A;  4L1B A;  4PDX A;  2IXM A;  5LOZ A;  1UG3 A;  4I43 A;  1OUV A;  2QFC A;  2CHX A;  1Z6A A;  2E2E A;  2Y3D A;  5FQ4 A;  4HLE A;  3UX4 A;  4GCO A;  4DLQ A;  4U5B E;  4UI9 C;  3OXG A;  4DK5 A;  4BTB A;  2LAI A;  4AK9 A;  3CQC B;  3FU3 A;  4OVV A;  3MEK A;  4LCT A;  2VGX B;  1SF8 A;  3TXM A;  4XLP F;  4AP2 A;  2XXA A;  3MKR A;  1ZU5 A;  4AX2 A;  1QNF A;  3NF1 A;  1IZM A;  2NXP A;  2DIW A;  3QZC A;  3EFO B;  1QQE A;  1V55 C;  4Q94 A;  4QI0 A;  5KJL A;  4DJA A;  3W8I A;  3B9Q A;  4OYS A;  3KEZ A;  3MX3 A;  4K03 A;  2E0I A;  4G7Z F;  2J4D A;  2XPI A;  4YT5 A;  2KM4 A;  4MLP A;  2WXM A;  4Q7C A;  4Q96 A;  5D0Q D;  4DLO A;  5DQZ A;  5T4Y A;  3UMK A;  3QWV A;  4CRW A;  2I6H A;  2BUG A;  1SZ9 A;  1ELK A;  3R7Q A;  5B1A C;  5KJM A;  3MKQ A;  4G1T A;  5FQ6 A;  5FZQ A;  4AXH A;  3K7D A;  2W4B A;  3ASG A;  4U8H A;  3DM9 B;  3SD5 A;  3K1I C;  4PH4 B;  5ARG A;  4JHJ A;  4WWP A;  4ILH B;  3Q7L A;  4NUR A;  3U4T A;  5D91 A;  3CQZ A;  1U3D A;  2DCP A;  5FT9 A;  5B1B C;  1P5Q A;  2NG1 A;  3K33 A;  3G2S A;  1L5J A;  4UWH A;  3L22 A;  1IHG A;  3JCK C;  2PF4 E;  3SI5 A;  4O7G A;  3FU0 A;  3N71 A;  2Q3T A;  4N2Q A;  2XGM A;  2WQ7 A;  4U0S A;  2Y69 C;  4HEA J;  1VDY A;  3CGH A;  2Q9C A;  1S0P A;  1OCZ C;  5F5H A;  3NZU A;  2WXP A;  3DXJ F;  4JEH A;  3T4R A;  3NRH A;  2Y4U A;  3TGO A;  3HDX A;  5AYW D;  4O6M A;  3ZIB A;  1KT1 A;  3RO3 A;  4U04 A;  4KNW A;  2IOS A;  2IU1 A;  1E7V A;  3L16 A;  3TD7 A;  2XPY A;  3LY8 A;  4WWN A;  2W4M A;  3ML8 A;  4OVU A;  5G05 C;  3RYL A;  2YHC A;  3OTN A;  4PFO A;  2GRM A;  2UWJ G;  5CI8 A;  3G2U A;  2CFZ A;  4H7X A;  1N1C A;  1IQR A;  4A1S A;  1SMY F;  4NRH B;  3UT8 A;  3EDT B;  4J8E A;  3K6B A;  5HI7 A;  2Y39 A;  4RG9 A;  3K66 A;  4A1G A;  3SZR A;  3BG1 B;  4N3C A;  3FUH A;  2WM9 A;  3FHD A;  1OCR C;  4N06 A;  3AS4 A;  2XHE A;  3OEO A;  5J90 A;  2A69 F;  5T3T A;  1MMN A;  3PUJ A;  2PX0 A;  5KYU B;  4BJ6 C;  3B13 A;  2FO7 A;  3B7T A;  3CHO A;  3D9O A;  1E8W A;  2R59 A;  4F53 A;  2VH3 A;  3G2T A;  2EQX A;  5LP0 A;  2ZXW C;  4FX5 A;  3L08 A;  4I3M A;  2WMO A;  3FEX A;  3O6X A;  2Y3G A;  2BE5 F;  2PQN A;  2YIN A;  4K7B A;  5KYY A;  2HV7 A;  2ZXO A;  2J7P A;  4GZD A;  1D0Y A;  3P1U A;  4FHJ A;  4BT9 A;  1E8Y A;  4FUL A;  1D1B A;  2WXN A;  2FUL A;  4N5C A;  4I6E A;  2R7W A;  1Y8M A;  1JPN A;  5E33 A;  3LS8 A;  3O48 A;  1XGW A;  3RFY A;  4AY6 A;  3ASD A;  4LLE A;  3PUK A;  4AVX A;  5BV1 A;  1O87 A;  5BUZ A;  1PY1 A;  3MA5 A;  4BY6 A;  3CKC A;  4XI9 A;  2B0J A;  2Q9A A;  4MQ9 F;  3HIZ A;  4CT0 A;  5IY5 C;  1HXI A;  3NKE A;  3SF4 A;  3KAE A;  4UWL A;  3FU5 A;  2J0X A;  1B89 A;  4GA1 A;  3PS6 A;  3B0P A;  5C1D A;  4B8A A;  3S2A A;  2A1D D;  4C7O B;  5KYX B;  3PEV B;  2A68 F;  5LFA A;  4W8K A;  3RK6 A;  1E96 B;  1X5B A;  4IN3 B;  1FFT C;  2IQC A;  3MGB A;  4U63 A;  4JCH A;  2YHS A;  4NAC A;  2BF0 X;  3KH2 A;  2CHZ A;  3MCX A;  2CFU A;  5FJY A;  3LLK A;  3ZHE A;  4PS7 A;  4JEU A;  3L54 A;  4I6J A;  4CS8 A;  3S7J A;  4B6I A;  4YWQ A;  4PJM A;  4AIF A;  4XKC A;  1FVH A;  1HE8 A;  4B94 A;  3GZ1 A;  5ANR A;  4UWK A;  4ANV A;  2WMN A;  4EZK A;  5JJ6 A;  4EBA G;  2Y4T A;  3LEW A;  3IKO B;  2H7B A;  3W2V A;  4RVB A;  3ASN C;  3PH0 C;  3ZYL A;  1VK5 A;  3CVN A;  3GAN A;  4OIO F;  2LSE A;  2LSU A;  2V5F A;  3QJZ A;  3DD7 A;  3SEO A;  1MQS A;  3QNK A;  4NY3 A;  4CS8 C;  1TR2 A;  1ZU2 A;  3ESK A;  2P58 C;  3I4G A;  2R7V A;  4RD9 A;  4ILI A;  5EKQ D;  3ZGQ A;  2PM6 A;  4C9B B;  3SBT B;  1W3B A;  5DLJ A;  2WXI A;  1KLX A;  2UY1 A;  4U5G A;  2WXG A;  4HOS A;  3FWV A;  1IW7 F;  2QY9 A;  2R7Q A;  3OWT A;  4BJ5 C;  2Y3B A;  4Q4Z F;  2RG8 A;  3JYH A;  3UGO A;  2EIL C;  4U07 A;  3UT4 A;  4U5H A;  3LS0 A;  4UI9 J;  4FA6 A;  1Z63 A;  3OAW A;  5EHH A;  4GYT A;  3D3M A;  4LER A;  2L9J A;  1LF8 A;  4UWG A;  4O6N A;  2XEV A;  4WJ0 A;  2ZU6 B;  3VLE A;  3TL5 A;  3U64 A;  1ZU4 A;  3B0U X;  5FZR A;  2VGX A;  3AU4 A;  1H0A A;  4KVM A;  5JJ7 A;  1MMA A;  1INZ A;  1HU3 A;  2QTV A;  4TV3 A;  2X3M A;  2HR2 A;  3EFO A;  2M63 A;  4OD5 A;  3MZL B;  2FFH A;  4WNE A;  3MLG A;  3ASO C;  2OCC C;  3NYL A;  1TKN A;  4KT6 B;  1NA0 A;  4RDA A;  3DM5 A;  4C0E A;  5M72 A;  3S0X A;  3EQL F;  1OKK A;  5CCL A;  4YVO A;  5DS5 A;  2R7X A;  2NC9 A;  2R7R A;  3UPV A;  4MND A;  3QC1 A;  3ABL C;  1SZI A;  3X1O A;  3VTY A;  5BV0 A;  2L81 A;  3EH1 A;  2LSV A;  5AJL A;  2X6J A;  1MMD A;  4G11 A;  1ZHT A;  4KBQ A;  2AXU A;  3UMV A;  3LES A;  1HZ4 A;  3E9V A;  2X38 A;  2P7V A;  2G3K A;  1ELR A;  3JT1 A;  5ANL A;  2WVN A;  1TWA A;  3CLJ A;  3FP3 A;  4J8S A;  2WVO A;  1DNP A;  3D9M A;  2NUT B;  3AG3 C;  4X0R A;  3RIB A;  2XGO A;  2X51 A;  4GZ3 A;  2IF4 A;  1VYI A;  4E7Z A;  1M2O A;  4FAD A;  4WNF A;  1IQU A;  2J45 A;  4OIN F;  3FH5 A;  2R7O A;  5FZS A;  1HS6 A;  2DYR C;  2LNI A;  1QLE C;  4WND A;  2ION A;  3JCU Q;  4CS7 A;  4XKB A;  3LVR E;  3RU0 A;  1QZ2 A;  5B3S C;  2J46 A;  4MKT A;  1E8Z A;  2R17 C;  4JJF A;  5E75 A;  2I1J A;  1FMV A;  2GFH A;  3GYZ A;  4FLH A;  3B7S A;  3SFZ A;  4BX8 A;  3TG5 A;  2WXH A;  3ASF A;  3LJ3 A;  1OWN A;  4C3B A;  4WNG A;  2VJ8 A;  3MV2 B;  2VTB B;  4GU5 A;  1ZHZ A;  4KNV A;  2WPV A;  3ASH A;  4K0R A;  3D9J A;  2IXO A;  4U0U A;  4CEM A;  4EBB A;  2IFU A;  2CW0 F;  3FUI A;  3AG1 C;  5LCW C;  2YQ8 A;  2W45 A;  3KKB A;  2VSX E;  4XI0 A;  3BEE A;  1A17 A;  3EGX B;  4MS6 A;  3GZ2 A;  3QAQ A;  3E70 C;  2J9U A;  4FC8 A;  3ULQ A;  3PRE A;  4L7T A;  2FF4 A;  4CCA A;  3T5V A;  3L34 A;  1ZHX A;  3FH7 A;  2OVB A;  4ANU A;  4KYO B;  3R9A B;  3SBS A;  1YA0 A;  3LAY A;  2WXK A;  5KYU A;  4APO A;  3DJN B;  3K1H A;  2MHK A;  2OND A;  4JA9 A;  3ABM C;  2J07 A;  3L13 A;  4HS2 A;  2KCV A;  4CGW A;  1G8X A;  5G2N A;  1EPU A;  2I8B A;  2J7P D;  4A2N B;  3T6B A;  3ZPJ A;  4HOT A;  4JVS A;  1Y6I A;  2MWQ A;  2Q9B A;  4GML A;  1UN8 A;  1O5H A;  3RKO F;  2L0I A;  3MJW A;  3PE3 A;  4YVQ C;  3FUM A;  4CDM A;  2FI7 A;  2L9B A;  3PNL B;  1ZHW A;  4DPR A;  2ZXP A;  2GRL A;  3FY4 A;  3Q15 A;  3N2Z B;  3NYJ A;  2CNW A;  3Q6M A;  5ARF A;  2I1K A;  4B0Z A;  4YT2 A;  5DBK A;  3F46 A;  2PX3 A;  2X6K A;  3ZN3 A;  4A3V A;  3ZC4 A;  4N39 A;  4JXT A;  5J08 A;  4GPK A;  4LUN U;  3DZA A;  2C0M A;  3LDZ A;  3CVL A;  3HYM B;  1UW4 B;  3X2Q C;  2XSE A;  3ZEF A;  3CVV A;  4XLN F;  2PQR A;  4QDL A;  1VOM A;  1E90 A;  3CVW A;  3CHR A;  3UR3 C;  4ME2 A;  2YHE A;  3NQP A;  4BJ6 A;  1FVF A;  5JJT A;  4NQ0 A;  4E7S A;  1W2W A;  2J08 A;  2WXF A;  1HO8 A;  3FTY A;  2EIJ C;  4A3T A;  5ENN A;  2VQ2 A;  1UN9 A;  2IXN A;  4DI3 A;  3CST A;  2D5R B;  4YN0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...