4LERA

Crystal structure of a putative outer membrane protein, probably involved in nutrient binding (bvu_1254) from bacteroides vulgatus atcc 8482 at 1.42 a resolution
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
457
structure length
457
Chain Sequence
TNPSLLLTGVAYSAFNQTSSDACHAAKMLILTSGESKYQVYKWTRGDFDYYSNLRDVTKMSEEAGEGSAYQALAHFFRANYFYQLTLDFGSIPYTDALKAETDANYQPAYDSQEVVLAGILKELEEADKMLEGSDEIISGDIIYNGNLVNWRKLINAYRLRILMSLSGKEKVGDIDVKSEFSKIVADGPLMESLSDNGQLIYLDQQDNRYPYFNDSDFGSGRFMDSTYIAELATRQDPRLFAVATQTPNAEKAGKAINDFSSYDGGDPAVPYSLVNDKAVAGNCSKPAPRYYQTPTNEPMVLLGYVEQQLILAEAVVRGWIQGDDKIYYESAVKASFEFYQKYAVSVADYLTQDAAAEYLRNDKVAYSSSLSTDEKIERIIMQKYLPTFLQGSVWLPYYEALRTGYPDFRRAAGVSLPYRWMYPQDEYNNNATHVEAALNEQFGGSDKTSDKPWWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a putative outer membrane protein, probably involved in nutrient binding (BVU_1254) from Bacteroides vulgatus ATCC 8482 at 1.42 A resolution
rcsb
source organism Bacteroides vulgatus
molecule tags Sugar binding protein
molecule keywords Putative outer membrane protein, probably involved in nutrie
total genus 174
structure length 457
sequence length 457
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12771 SusD-like_2 Starch-binding associating with outer membrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4lerA03
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4lerA01
3EJNA 3IV0A 5FQ6A 3MX3A 5FQ4A 3SNXA 3GZSA 3CGHA 4MRUA 3P1UA 5E75A 5E76A 3JYSA 3L22A 3LEWA 3CK9A 3I4GA 3JQ1A 4F53A 3KEZA 5FQ7A 5T4YA 3EHNA 3MCXA 4PUCA 5LX8A 5FQ8A 4Q69A 4F7AA 3HDXA 3FDHA 3QNKA 5T3RA 4LERA 3CKBA 3CK7A 3EHMA 3CK8A 3MYVA 5J90A 3NQPA 3CKCA 3JQ0A 3SGHA 3OTNA 4L7TA
chains in the Genus database with same CATH superfamily
4HI9A 4KC9A 5LP0A 4X8QA 4HE8D 2WM9A 3S2AA 3E33A 3HHMA 1NP7A 2D5RB 4AE4A 4EBAA 3SZ7A 4FESA 4U5EE 4IYPA 3DPYA 1Y6DA 3ZGQA 1SA4A 1KPSB 2PNOA 3MYIA 1JCSA 3U8PA 4MNDA 4YT8A 4I44A 5D0QD 2RG8A 1ZHYA 3Q9NC 1TYQG 3QKYA 3BQOA 4U7EB 3UI2A 1MJ0A 1K05A 3BUAA 3FU0A 1Q0MA 3GANA 2YWAA 2ZXWC 2ZD9A 2C03A 3B7SA 3DSUA 4F6RD 1WTYA 1DCQA 4U07A 5AC4A 1G8XA 2NXPA 3ZG1A 3O48A 4TV3A 1XZPA 1A0BA 1YLMA 5JT4A 2IY0C 1Q0GA 4E0HA 1S70B 4DX5D 5A6BA 3SY2A 4B8CB 2KSFA 1WASA 4MW3A 3S7FA 1E7UA 2HJ3A 3C8GB 4YT2A 5CHEE 2R02A 3S9OA 3G2VA 4GA1A 5DS6A 4XTKA 3PZ2A 4N4WA 2ILRA 1Q2ZA 5HI7A 3G2UA 4UQXA 3MEKA 4AJWA 3AG4C 1CGME 2GRRB 4L1BA 2WZFA 5T3RA 3Q47B 1N4SA 3NF1A 2F8XK 4G7OF 5AQ9A 2YINA 1FNTc 2XGSA 3IQTA 3RQFA 4KI2A 3TULA 1MMDA 5GPGB 4JPSA 4MVRA 3ZN3A 3JTLO 5AN8A 3KSLA 1YAUO 1NZEA 5A69A 4NACA 4CEMA 1UJJA 3SHFA 1NFOA 4UI9J 3FXHA 3UXGA 1N54A 1Z5ZA 1X81A 1D1CA 4XI9A 4WNEA 2NC9A 5ARFA 4GYOA 4GTOA 2AVPA 1ELKA 2P9LG 3MKQA 4ZLCA 5KCMA 3HJCA 5L3VA 4JL0A 3RW0A 2QZAA 2LXMA 1OR3A 3Q15A 3SXKA 2YRFA 4KBQA 2X51A 1AWCB 3FEXA 2J4DA 5H7PA 3PZ3A 2DYSE 1SMYF 4DLQA 2CG2A 5BXUA 1PY1A 4DK5A 3SFZA 3RRNB 1SF8A 2YL7A 1BLXB 2P9IG 2KC3A 1Z6TA 4WWPA 4YT5A 3JCUQ 2CFUA 3PNLB 4XPWA 3HNIA 3KL4A 3U3BA 1FT1A 4LRZA 1DNPA 2HE0A 5ENTD 4OIPF 2FEZA 2B0JA 4BX9A 2R7WA 3K66A 1L7CA 3TD7A 1S0PA 2YL3A 4EHPA 2OJQA 3FH8A 3V31A 3Q49B 2P9KG 1M6TA 2BF0X 5JA4D 3B0VC 5BUZA 4WNFA 3S28A 2AJAA 1K1AA 3VTXA 5T8IA 3VYWA 2Y4TA 2AWCA 2JABA 2LFFA 5AJLA 1BR1A 1H6OA 4NURA 3FU3A 3L6AA 3ZVRA 2HFIA 2Z15A 3DMDA 3B9QA 4YWQA 2WXKA 3N0TA 4BEJA 4C3EA 5BV0A 4O7GA 2H7BA 1SR2A 5FZTA 3L82A 2XRZA 3UPVA 3L8JA 3FUEA 3QDNA 4BPMA 2FAPB 4CSAC 2NYJA 1BR2A 5AGFA 3G4ZA 2PL2A 3C8GA 2BL2A 3G2SA 3S29A 2MYOA 3EJNA 3ASOC 2VSNA 3CIAA 5ENOD 4RQIA 2JLBA 3NBNB 4V3IA 1K3ZD 1N94A 4C0EA 4GEHA 4G8LA 1ZU2A 2GRLA 5EHHA 4CBEA 3SFYA 3UIPC 3UMIA 3MJWA 1ZZPA 2IYLD 4A63B 3I4GA 3UKUG 1N9AA 3E4BA 2KXPC 3G4XA 4J7TA 4ACLA 1GM5A 4MTGA 3LVRE 3J5PA 1BBHA 2DYRE 4RDAA 5FZSA 2PP4A 3L0IA 4MVMA 3EHRA 4MS6A 4C3DA 2I9CA 3JSZA 3SFXA 3C62A 2KNHA 1TWCA 3UTMA 3AQCA 1O1RA 4U8VD 3B0UX 4XLNF 4HBDA 2I1KA 4BESA 4N5QA 1IZMA 3NMIA 3TXNA 2L6GA 1E8YA 2J9BA 3QVZA 4PK4A 2LSUA 4O6NA 4G24A 4PS7A 2E87A 3UMHA 4GTTA 4A4AA 3LY8A 3HXFA 4A55A 2XL8A 2V0PA 3FULA 2DVWA 4A2NB 1ZHZA 4MLPA 5FZRA 3T9KA 3ENEA 1FT2A 3T9OA 4MTOA 1W3BA 2IFUA 1JPJA 1KNYA 4U96D 2OG2A 4NY3A 2CG3A 3QMKA 2DWZA 5G05C 4HLLA 2LNIA 3OWTA 2A5EA 4ANXA 1RXQA 4I2WA 3TG5A 2YLDA 5TJ5E 2LIGA 3EHMA 4Z9IA 1OCOE 3E32A 3CSFA 3P2BA 2PBEA 3S7BA 1HE1A 1NG1A 3ZHEB 4FAPB 3RKOF 4DOZA 4KXKB 3T5VA 3D9OA 5AJDA 3SBSA 1VOMA 2R25A 1M56C 3ASHA 3Q73A 2XS1A 1FVFA 3Q7AA 5G2NA 3ML9A 1T01A 2IF4A 1ZU5A 2XLOA 2P61A 1EA8A 3U2MA 3UM2A 4OAVB 2PM6A 5DVWA 4O6FA 2VC9A 1TNBA 3PS6A 3SGHA 1LE2A 5EX0A 2OCCC 3DXKG 1V55C 1TWHA 3FTVA 1I5NA 4JTDB 1D0YA 4EZKA 1K04A 5CBOA 1BZ4A 1QPUA 4I43A 4PS8A 3TQOA 2QYUA 1HW2A 1TNZA 4N5CA 3B7BA 2AVKA 1E8WA 1YA0A 1N52A 3UT4A 1HU3A 2XEEA 2UUIA 2JX0A 4K0RA 4U0UA 4CT4A 4OVUA 2M64A 2MOWA 2GRNB 4Q4ZF 3KSQA 3ASNE 4KVOA 2L81A 3U2LA 1D8EA 2LK4A 4O60A 2LAIA 1OUVA 1OWNA 1CPRA 4YVOA 1NI1A 4FULA 3OXLA 1C02A 1E90A 3ZIBA 4U9EA 2KATA 3TWVA 3ABLE 5DS5A 4Q7CA 2XZTG 4FJZA 3K7DA 4BEPA 4FU3A 2XSEA 1BDJB 5AAOA 2R5SA 2P1AA 2X6KA 4FLHA 2DGJA 4BT9A 1APCA 3HTKC 1GGQA 1OXKA 4UDVA 3NYMA 1RKCA 1Z3IX 5B1AE 5KWDA 3TG4A 3CSKA 3ZQVA 2PQRA 4EZJA 1E84A 1TN6A 3I4UA 3EZHA 4NTAA 2Y39A 3SXMA 2IONA 2IXNA 1Y4CA 4CJGA 3VLEA 3LJ3A 4WABA 4Z9JA 2VCBA 3K6BA 2XZDG 3F6QA 5EYLA 5L0HA 2LSEA 4U5BE 2OU6A 2RFMA 4UQZA 5A23A 4CS7A 3PZ1A 3CQZA 1V54E 4I6EA 1MNDA 3PRZA 4KBLA 3PZ4A 3FUHA 4IB4A 2I2OA 4DX2A 1D0XA 2D4UA 2J7PA 3DEOA 2L6HA 4K7BA 2CDQA 3ESLA 5FINA 4OD4A 2KCLA 2IEJA 5AYWD 3ECSA 3ATPA 4MVZA 5AC5A 2QE9A 5T1DB 3MLGA 2TMVP 3JUIA 3L17A 4EBBA 2QYJA 3L16A 4UUCA 4EWCA 1FFHA 4M63A 3EU9A 1HH8A 4JJFA 3TOMA 5ENPD 5G55A 4K1OA 1OW6A 5F5HA 3CZ6A 4K5BA 3ZXPA 1RZ4A 2W9YA 1IYGA 3FTZA 1JWFA 2Y3BA 3Q7FA 5CERB 3C72A 1ZW2A 3SXYA 2PX3A 4GTVA 4C3BA 3PVLA 3MBGA 4AY6A 5T4YA 2LD6A 2CHWA 4UWGA 3URZA 1NA3A 2VQ2A 5LOZA 3A11A 4LERA 1OXJA 3ZYKA 3FUFA 1HMOA 2LO6A 3EH2A 5E75A 2XLEA 2H6IA 4PDXA 3T5XA 3CVVA 2WMNA 3CHOA 4J6IA 1DCEA 3RF3A 2VCCA 2UWJG 2F22A 3QARA 1OWOA 4J7WA 1NFIE 5T3TA 1OT8A 1TN8A 1H6GA 2XLWA 3EU5A 5LX8A 4L2YA 4B6IA 1ORJA 3EH1A 4RBNA 5HQ8A 3ITFA 4U5CE 3UM1A 3B13A 1MNEA 4U04A 1YA9A 4G0HA 4BERA 2I1JA 1EPUA 2A6EF 4IWBA 2PM7A 1K40A 3QAQA 3VAYA 1UN8A 2WZLA 2XS8A 2HUJA 3HXCA 4AE4B 4TUMA 2PZIA 4GCNA 3FVYA 4APFA 4J8FA 2VTBA 4GZ6A 3S84A 3FAPB 3ZWIA 1KZOA 2HZ8A 5A6JA 4ME2A 4G2VA 3B7TA 4CRWA 2FF4A 5CCLA 3W8IA 3V5XA 2J49A 3DSWA 3SF4A 3RVZA 3IHYA 2I8BA 1IHBA 1ORYA 2F37A 2WPVA 3D9IA 4GTPA 2C0LA 2FO1E 4HEAJ 2XEHA 2R59A 2OEWA 4BJ1A 2OJED 4E0IA 3U64A 4YJWA 4BJ6C 3RJVA 2VB6A 1O3UA 2J7PD 2J9VA 5JJ7A 3B71A 3FHDA 4B0ZA 1E8XA 3ZHEA 2WXRA 3FUKA 1VTMP 3DM9B 3AG3E 5KJLA 2IU1A 4GTSA 3LNMB 4MVQA 3ZPJA 4FA6A 2RSEB 3Q79A 3SI5A 2L6BA 2X38A 3LPZA 2LSVA 4XWJA 4A3TA 2HM8A 1TNYA 1JOGA 2ETBA 1YZCA 1TNOA 5AQ7A 1U89A 3NMKA 3JRMO 4XQ1A 5JUAA 3CVLA 4RG6A 2G3VA 1O1TA 3FDHA 2HMZA 1YVIA 1FFTC 4JTCB 1LS1A 1D0ZA 1AEPA 4XX5A 3PCVA 3U5SA 2BE5F 2VGXA 3N2ZB 3C8GD 3RK6A 4U0SA 4TXQA 5FQ6A 4XZ4A 3T8MA 2KJGA 1R4TA 3UGPA 4I2ZA 3TWWA 3HG0D 4CGWA 3L34A 1OXBA 3V5YA 2R05A 3QC1A 2VJ8A 5FQ7A 2WXMA 4PJJA 3SD5A 256BA 3DKAA 1UG7A 3N24A 4E7SA 4OD5A 2QTVA 4YDWA 2Q9BA 3PE3A 4JC8A 1ZU4A 1I4YA 4ZLDA 3QB2A 3AG2C 1H19A 3NKEA 3PREA 3RRMB 4CT0A 4PJLA 1L3PA 1DVPA 2KBXA 1SZIA 2ZGGA 4ULWA 5D0OD 3U66A 4H7XA 4GMLA 1TWGA 3ULYA 1MQVA 4H4KC 4B89A 2OVBA 1N4QA 2J0WA 1JUQA 2IJGX 2ICWG 4RD9A 4DLOA 5B3SC 3DSVA 4PUCA 3FH7A 2R7OA 3S7JA 2MYSA 4N2QA 4BSZB 4EUKB 1PAQA 4RLYA 4XEIG 3EQLF 1UFBA 3T6GB 3JQ0A 2Y3GA 3GORA 5T3WA 4JA9A 1FCHA 3K1IC 3C63A 3KEAA 1MMAA 4LNUD 4OYSA 3LJBA 2WXPA 5DS4A 3Q78A 5E76A 1T6QA 2CHXA 1WN0A 4N6HA 3NG1A 1RKEA 5F28E 3DWWA 3BG1B 3V5ZA 2HYZA 2WXFA 2O9XA 4N6CA 3CQGB 1MZCA 2H7VC 2VASA 3QJZA 4N3AA 2FULA 3PEVB 4YL0A 4MTFA 3F46A 3RQEA 1YDIA 1JWGA 2XLDA 2LXLA 3DSXA 4G8KA 1O5HA 3KYIA 1Q0FA 3QWPA 3WODF 4RSYA 1BR4A 2XM4A 1OKKA 1LIHA 2BC5A 5DLJA 3NB2A 3CVYA 3DAFA 3TXMA 1OCZE 2CNWD 4O6YA 2WXNA 4YNDA 4IRUA 2WXHA 2KYHA 4JTAB 4HRLA 4A1GA 4G78A 1UOHA 1E96B 3W9FA 2P58C 1H6PA 5A6CA 2HO1A 1FTSA 1CGNA 3JT1A 2AWIA 5FCLA 3AG1C 3S90A 3DD7A 3V7OA 2Y3AA 3ZIMA 2P2CP 3FUNA 1Z6AA 3IEGA 2P9SG 4AL1A 1JPLA 5HRYA 2C04A 3MA5A 3AG4E 3WG7E 1MYOA 3HVEB 1OCCE 4G26A 2YZSA 2E2EA 1JRAA 1NSGB 2VSXE 1G4WR 4HQDA 4XKBA 4LLCA 2X6FA 1OCZC 3CHMA 1FAPB 2OOCA 3MYVA 2G3KA 1UJKA 3TGOA 1ZHWA 5EYPF 2ZIRA 1TR4A 1ZBPA 2YL1A 5B1BC 4JJGA 5A6AA 3BRJA 1LF8A 3K1IA 3AOUA 5JSLA 2BKGA 4U8HA 5DBKA 4GAAA 4TXRA 1G3NB 3QTHA 1EF1C 3CVNA 2WB7A 3TJPA 2C0MA 3IQCA 4KMOA 2GRPB 2DB4A 5JHBA 1YMPA 1UN9A 3HRAA 4AIFA 2EPOA 3US6A 1T6UA 4HNAD 1V54C 2M4EA 1U2VG 1KTMA 3FUIA 5BPPA 5LCWC 2GWWA 1NA0A 2E0IA 4L23A 2VSYA 3Q7GA 4YDEA 4FC8A 3GZ1A 2RFAA 1I4ZA 4AV7A 4EBAG 1LM3B 2QFCA 4NTBA 4A1SA 4ANJA 3RSEG 2A0UA 4FP7A 4HB5A 2CW0F 4C9BB 1A7DA 2YNQA 5J90A 4BT8A 3IHUA 4DI4A 4NC3A 1RMVA 4L9PA 1S05A 2J46A 4E18A 2BEDA 2XRHA 5JRAA 3NZUA 4DRHB 5BQHA 2Y0BG 3NYJA 4BFRA 4D4XA 5EN5D 2R7VA 2ZXWE 1ST6A 3B0PA 3EG9B 4CS8A 1EYHA 2WXGA 1E8ZA 4GZ3A 2BTDA 4NQ0A 2G62A 5A6KA 3ULEG 4RG9A 4RVBA 2J09A 1O1SA 3R7QA 1E7VA 1OKKD 3M4BA 1FMWA 5DQTA 4LLEA 1SW6A 4KT6B 4WWOA 1M57C 3UR3C 4CS8C 5BQGA 2Q4FA 1KU2A 3SNXA 3KAEA 2WZGA 3G2TA 1HX8A 4L6RA 2ETAA 2R7QA 1INZA 5KYYA 3I5QA 2OVFA 1P5QA 3AJIA 4GYWA 4LCTA 2XGMA 3UMKA 5B3IA 4MVSA 3EFOA 1WY6A 2IQCA 1RW2A 3FY4A 1AUEA 1C03A 4UQYA 1MX6A 3H2VA 1ZYRF 2XXAB 1IKND 4FHKA 2J45A 2R9RB 3T6JA 4J8EA 2XLVA 5E33A 3CVWA 3UNGC 3HVEA 1VK5A 2HR2A 3D3MA 3NAWA 2EINC 3TL5A 2VGYA 3D9PA 4DX1A 3KEZA 1EQ1A 1B89A 4O1PA 3B7UX 3PDNA 3U3FA 3NYLA 3I3NA 3SYNA 3RU0A 4A3VA 4AK9A 4CGVA 3APDA 2QLAA 4GMRA 3E70C 4JEAA 2EQXA 3KPHA 4LG6A 4UI9K 4AEZC 2WQ6A 4C48B 2EIJC 1T9KA 4CCAA 1ZHTA 4I9EA 2QNLA 1Y6IA 2F8YA 4ATGA 1XWJA 2X6HA 2AWYA 2NSGA 1XGWA 3ABMC 4P9TA 1QNFA 2QC9A 3ZSUA 4IAOA 5JVEA 3ABKE 5LFAA 4ILHB 1HG5A 3RO3A 1HW1A 3MZLB 4HLEA 2J07A 4J32B 4I6JA 2QUPA 1PD0A 3RVYA 3RAUA 2XLHA 3JRTA 5ENSD 3Q4AB 5IY5C 1MMGA 3KYJA 5EIBE 1TWAA 3WG7C 4BSXA 2LCHA 3LS0A 4CZ2D 1UG3A 1N4RA 2NUPB 3LS8A 5EILA 4PJNA 4JRZA 5KYXB 1U0BB 3IHVA 2VCAA 4DXWA 3MGBA 5KYNA 5CIVA 2FO7A 1SQMA 2YHSA 1H0AA 2EPNA 4HOQA 2FGYA 5KYWB 2ONDA 5CEDB 2VSOE 2HKVA 3LUTB 4MW8A 4KZCA 2PFDA 4YL1A 2EPKX 1Z3YA 4LNBA 4WWNA 3I5PA 3Q5MA 2W45A 2KC7A 4OIRF 2EILC 4BTBA 1BI8B 3JXJA 1WOLA 5CI9A 1IQRA 3EGDB 3RFYA 5KYUB 1KT1A 4JC7A 4JVSA 3L08A 3FDQA 3ZYMA 3QWVA 3AU5A 3WXXA 5ENRD 2Y69C 1BD8A 4JEHA 3ML8A 3TWTA 3QNKA 5ENQD 1MX2A 3CK7A 1G5ZA 5IY5E 1E85A 1WGWA 4YK5A 2MHRA 4C7OA 3DEPA 4HOTA 3ASNC 3JCKC 1H2VC 1OR2A 5EGYA 3UT8A 3O39A 1HY5A 3V2OA 1FVHA 4DJAA 3OEOA 3E9VA 2VGXB 3CSTA 2H7OA 4B93B 2AXUA 2XCBA 1TEZA 4GYYA 3C5RA 1VDYA 1ELWA 3LESA 4G7HF 2Y69E 1A7EA 3TAXA 3JYYA 2QY7A 4C7OB 1K8KG 5FWQA 4BY6A 2XQ0A 4Y6WA 2X0CA 2M63A 2C2LA 2UY1A 2IO3C 3ZEFA 3AGTA 4F4BA 3JXIA 4IAQA 1HE9A 3APCA 3IQ5A 2I6HA 5CECB 3N71A 3X1OA 2Q7RA 1HF8A 3TK0A 3ZUVB 5KBAA 3NKDA 3MKQB 3U9WA 3LDZA 4Q96A 3OXFA 1G4US 4ANUA 4OIOF 2B6CA 3AS8A 2Q00A 2P9PG 4GPKA 4M7CA 4BJ5A 2R17C 1S7ZA 1HZ4A 1EDUA 4OVVA 3K9IA 3AG1E 2OEXA 3MX3A 3RO2A 2EIMC 3FTXA 3VLDA 4NIKA 3C18A 1OCRE 5KNGA 2VTBB 1H7IA 4PH4B 4G7ZF 2R7UA 3AU4A 1V4AA 4URKA 5B1AC 4D4NA 2J8SD 3HIZA 1JPNA 3UINC 2KQ9A 2P9NG 4D10C 3APFA 4CDVA 4LDQA 5JJ6A 3ZFWA 2B0OE 3HYMB 5EKQD 3NOCD 1EI7A 3FEYA 2H8AA 3G2WA 3EPVA 3VTYA 2V5FA 3S7DA 2WVNA 2X6JA 3LAYA 3HNJA 4C0MA 4DUIA 4CJOA 4JE9A 3C3OA 2JPUA 4QI0A 1A7VA 5FJYA 3Q6MA 3C98A 2EIME 4U5GA 3RH3A 2BKKB 3ASGA 4M3OA 4IULA 2P9UG 4WGYA 4QI2A 3FUDA 3RYLA 4J0UA 4WNGA 4CS9C 2A1DD 4BJ6A 2XXAA 3CVUA 3JZ0A 3GEHA 5ARGA 3VRCA 3FTUA 3SQVA 2Y4UA 4HFFB 3FP3A 3B95A 3GODA 2ASRA 3FTSA 5D2MC 2OCCE 2L0TB 4K0DA 5EX3A 4G23A 3O6XA 3FAJA 3KS2A 3VM6A 3R9MA 3QW0A 3MV3B 4AL0A 4TUUA 3RKVA 3ZKJA 4G25A 4FWVA 4GA2A 4HS2A 4HORA 2KM4A 4GPMA 4CDRA 1OQCA 1YYJA 3L54A 2F0YA 2LAHA 4Q94A 4Z68A 3D9JA 5JP7A 3CHRA 3QOUA 2Y1LE 4AVXA 3SXZA 3DXJF 2DI3A 3GEIA 3IEEA 3MV2B 4HXIA 2V3CC 5G04J 4YL3A 3CGHA 4W8KA 3EUVA 4AP2A 3D9NA 4P6IC 3T6BA 4EBJA 3LNRA 1Q0DA 3UX4A 1J8YF 3CK9A 2NUTB 1Q0KA 2AW6A 4DRXE 1YA7O 3GM3A 1S63A 3TWXA 3QW1A 4WAFA 3D9HA 2L6FA 1QSPA 5JS5A 2IXOA 3UGOA 3QVYA 3NQPA 1T6IA 3Q75A 1GW6A 3TWSA 1YYXA 3DI5A 2WMOA 4UWHA 3L8IA 3CV0A 4I3MA 4CX9A 2NG1A 3GZSA 5D92A 5ANRA 3FWVA 2XPIA 1LVKA 3GEEA 3CEQA 5FTPA 3JYSA 2J9QA 4ER9A 3IBEA 4GTMA 3M4CA 4ULVA 4HFGA 3GWNA 2GRQB 2V26A 4Q69A 2EIKC 1NU9C 5JHAA 2KGOA 1ELRA 5JLIA 1LI7A 5COFA 1TR2A 3M15A 4BTAA 1JAFA 4YN0B 2J9UA 2WXLA 1H2TC 1VLTA 4LACB 2FFHA 3I4RB 3VF0A 3O55A 3FUMA 1JCQA 3L22A 4JCZA 3TJ6A 5M72A 3V30A 3DSSA 3ZC4A 4JD2G 4JB8P 4DBQA 1TQGA 2V5QC 1D8DA 5CBNA 5C2YA 4HI8A 5E3AA 2YVKA 1WDYA 4OINF 1M2OA 1NZNA 3PNTB 1VLSA 3FUJA 4FX5A 3FH5A 3L1MA 5CEAA 3BU8A 2A0BA 4LSZE 3K1HA 1FPPA 1QVXA 1KT0A 1OWMA 3BEEA 4NTFA 3GWLA 2IOLA 2LUHA 2V4HC 1WM5A 1Z3XA 4G1TA 4NCQA 2ZPAA 3P1UA 2GFHA 4QFVA 4MVOA 2WXJA 5BNWA 3AQBA 4XPXA 4R32A 2V4LA 1K1BA 3ONKA 3MCXA 2XLMA 2ZXOA 5A7DB 3DJNB 4JKVA 1OWLA 3AJMA 2WXOA 2J9WA 5BXOA 1SVXA 3UIOC 4K5CA 3DJUB 4WUYA 3BG0B 1AVOB 1AP7A 2GGFA 2WVQA 4I1OB 2JD3A 4DX7D 1QKRA 3ABKC 4EBKA 1E86A 4I17A 3TWQA 2NUTA 4GTRA 3JYHA 1Z23A 4BJ5C 2MRIA 3D9LA 4U5HA 3UKRG 4F53A 2KZTA 3R7CA 5J08A 4LDRA 4PFPA 4I6GA 2J4BA 1N0QA 4LEUA 5JJTA 3KH2A 1GQAA 2MWQA 4I1MA 1MHQA 4L2LA 1GS9A 5JMND 4W8PA 3SZRA 3IXEA 4U95D 4AXHA 1ZW3A 4K03A 4L7TA 3ULQA 4N3CA 3L13A 4YDOA 1WG0A 4EKWA 3ABME 3KKBA 2J8WA 1IW7F 3WAQA 2Y3DA 1OWPA 4IN3B 4GZCA 5CRUA 3ZW3A 2YHCA 3Q9UC 4BEMJ 3SP1A 1B68A 5CMWA 2Y3HA 2LQGA 3LEOA 4J8DA 2GDCA 3CKBA 2GA0A 4PFOA 1IHGA 4AX2A 4MBGA 3E34A 4N2SA 4DVZA 1HS6A 3W8HA 3PEUB 5ANLA 3QK0A 4R7LA 2OKUA 1ZB1A 2XCCA 2V8SE 2KK1A 2A5UA 4JA7A 4XEVA 2PX0A 4FJYA 4CSAA 2OQMA 3J5QB 2R7RA 2MHKA 1RJ9B 4HVBA 1O5MA 1RKEB 2LFDA 4GZDA 5F5FA 4O6MA 5BQIA 3HXBA 1WAO1 2OEVA 1H9TA 2CFZA 4J7YA 1ZHXA 1PV3A 2CCYA 3J06A 2I15A 3CVQA 4XEKA 2WQ7A 1SYQA 1NLXA 4DVYP 1A41A 1F1MA 1YARO 2KW3C 1QBQA 2XPZA 4LUNU 5A6BD 2XEVA 2WXQA 4UI9C 4ONSA 3LLIA 4I1AA 1N11A 4HRNA 3O10A 2B0HA 1TJFA 4EECA 4TRQA 3W2VA 4WNDA 3SBTB 2CHZA 4DRJB 3HDXA 4G11A 2IXPA 1LE4A 1L5JA 4MKTA 3ZVVA 3NRHA 4O79A 2GRMA 2DZNA 2OV8A 3CHQA 3OTNA 4N39A 3QZCA 3RRUA 2FI7A 3PUKA 4XI0A 1W2WA 3PH0C 3K33A 1OCRC 5E2QA 4KNVA 5DIZA 4JZYA 2EIKE 3CQCB 3CEXA 2A4ZA 3NZSA 4GYTA 4XEFA 3HXDA 4J8SA 3GYZA 5BV1A 2XGOA 4CDMA 1YZAA 1XNFA 2W4MA 1H6KA 4MQ9F 2XRYA 4U8YD 4JW1A 1U6HA 3TWRA 4AM9A 3ZQYA 4AOFA 3IV0A 4HRMB 2WQHA 3ZRHA 4PJMA 1S64A 5EDSA 3CVXA 1SA5A 5KYXA 5AARA 4H7YA 2HJMA 4JURI 4JCHA 3FOOA 2P0NA 4YDYA 1O87A 3OXGA 2XENA 2A6HF 3MYFA 4W9RA 3GZ2A 3TWUA 3EHNA 3UMVA 3ABLC 3B7RL 2L9JA 3O4ZA 2GROB 4E85A 3ZYLA 2EIJE 1LI5A 5E3CA 1U3DA 3DE8A 1JCRA 4DBRA 3C8ZA 1IQUA 4HOSA 4GU5A 3W2WA 1BU9A 4KZ0A 2CGEA 3SO8A 1NFNA 3EZIA 2NSFA 4MS2A 4GA0A 4JXTA 4K5AB 3EDTB 3ZDLA 4IGGA 3DWLG 3UT7A 2L0IA 4B94A 3CR3A 3W4YA 4DJ9A 4EPZA 5KJKA 1WATA 1TNUA 3CHPA 1TFOB 4OAUC 2DZOA 1QZXA 4XIFA 3HXEA 3ONLA 5ENNA 4B8AA 2EILE 4WGZA 2BUGA 3D9KA 3EIQC 4U9DA 5KJNA 4CDYA 2H6GA 3NMJA 4ATZD 2NUPA 1YCSB 2J08A 2GAQA 3LCAA 5HKPA 5EIDA 2AU5A 3DRAA 3C7JA 4FADA 5L3QA 2EPMX 5FZQA 1M2VB 3V2XA 1TFKB 3HKKA 1NU7D 2KCVA 2EPLX 2A69F 1E83A 2AXVA 4IJJA 3LXUX 4EIYA 4Z9HA 2L9BA 2ZXPA 2YLIA 4BJTA 5EK0A 5L0DA 3LLKA 1VYKA 3PMRA 5HV9A 4J30B 2XPYA 2YKZA 3LJNA 2HMQA 4CIHA 3BEHA 4LNGA 5G04C 1Z63A 3IKOB 3CVPA 1MX4A 4BETA 3A9CA 2XL6A 3LS1A 5C1DA 4ABNA 3H2UA 4GQHA 2R2LA 1T5OA 2R03A 5L0IA 1N95A 3JQ1A 3FMSA 3AS5A 3PE4A 3ASFA 4FLBA 3GM1A 4KNWA 1H9GA 4JHRA 4U5DE 4JHKA 1HFAA 4E6HA 1VB5A 4U63A 4O1OA 3TOLA 5CI8A 5ITZF 2QY9A 3EGXB 1D1BA 4EZLA 1LPEA 1Y8MA 3ZYQA 2EINE 3E30A 4ZFHA 1KLXA 3SEOA 2HSQA 2IO2C 2R7TA 3EG9A 2RD0A 4LDKA 3S0XA 3W9GA 2WVIA 3FOPA 4QQIA 1DOVA 4H54A 3X2QC 1HE8A 4NRHB 4DPRA 3R2PA 3JSEO 3R7RA 3ASOE 3POVA 4UWLA 4JEUA 1HO8A 1Z5SC 3AS4A 1CGOA 2ETSA 4E7ZA 3NDBB 1FR0A 3FTYA 1LD7A 3PHF2 5CRVA 5AENA 3ISMC 2KZTB 1N4PA 3U9MA 1CPQA 2IOSA 5CCMA 1EKYA 1A17A 3NOGD 3OAWA 1X5BA 4BWRA 4E17A 5FIOA 2IOQA 4N3BA 4GTQA 2ZISA 4OIQF 1NL4A 1QQ3A 3E37A 3AGUA 4ZHBA 2HSBA 2XHEA 1MMNA 2YHEA 4I9CA 4JZAA 1J8MF 4AY5A 4F1SA 2YL0A 3B29A 1D1AA 2L7AA 3V79K 5L0JA 1PD1A 4FHJA 3QWWA 2VH3A 2IM8A 1R5ID 4UWFA 4GCOA 2DIWA 4J8YA 4ACKA 5BT1A 2DYSC 1KZPA 3F47A 2AXZA 3DM5A 1LD8A 1E2XA 1OCOC 2Q9AA 1SZ9A 1QLEC 3X2QE 2W4BA 1QZ2A 1YJGA 4CDAA 4PR9A 4BG0A 3KMIA 3ZTZA 4CYMD 2WVOA 4DRIB 2R7SA 2UUHA 2CYDA 4ANWA 3FHEA 5AQBA 3R9AB 4IARA 4DX6D 3Q6NA 3HLZA 3DE9A 3LY7A 4MRUA 3ZU7B 3DZAA 3AAAC 3UM0A 1OW8A 2UY1B 4U0ZA 4KYOB 1LTXA 3T8KA 4YT4A 4GZ5A 3DBSA 5L0CA 3MFNA 5K0IA 4NQFA 3SNHA 5BUOA 3C3QA 2IBFA 3ZNGA 2YQ8A 4WJ0A 3LYAA 5D66A 3CHSA 4EHMA 2WL8A 2NSZA 1JR8A 1IXVA 5B3SE 2P6VA 2ZGDA 3S27A 3LEWA 3DPDA 5AIJA 1BPOA 4JEBA 3IPMO 3C3RA 2YEVA 2YQYA 3FU5A 3UUXA 4MVUA 3RIPA 2R7XA 3CAXA 1M2VA 1ZVZA 2Q7FA 3CK8A 4X0RA 3MKRA 2IXMA 4HFKB 3TJ5A 5AQAA 1H2UA 1DC2A 4JHJA 3Q7LA 2CNWA 3H65A 3VLFA 1OW7A 2PF4E 5FT9A 3IQ6A 4Q5SF 4XKCA 4N06A 2Q9CA 3G50A 3GM2A 1LKXA 3RIBA 3RQGA 2ETCA 1HG2A 4GMJA 5G05J 1A5EA 3LVQE 3WHNA 5FQ8A 3EHQA 4F7AA 3PUJA 4CS9A 4U5FE 2RKKA 4XPYA 3UM3A 1XZQA 1N1CA 5L0GA 2H6HA 2J0XA 3CKCA 2FBNA 1HMDA 3AG2E 2X3MA 2LP4A 1BI7B 4YVQC 1WWPA 2OOEA 1QYMA 4CIPA 3FFLA 4PS3A 3UQ3A 5HSWA 2GW1A 2XL4A 4ILIA 1RJ9A 3ZTMA 4XLPF 3EGDA 2L6JA 4KVMA 5LCWJ 2HV6A 2DCPA 5KYUA 3LKUA 1NBBA 1TKNA 2DYRC 2RD9A 2WB2A 1JMWA 3JUEA 3ZXSA 3LY9A 5KJMA 1VYIA 5KYWA 1SZAA 2Q3TA 2KCKA 4Y6CA 5FQ4A 3AG3C 2PNNA 1C17M 4BX8A 4UWKA 1N0RA 1TN7A 2PQNA 5DQZA 4P9FA 1QQEA 3U4TA 5KNHD 2AP3A 2HS5A 4GB9A 3M79A 2JEKA 4XE0A 4P29A 2YLGA 2ZXRA 5CMYA 1OCCC 1U3CA 2ZU6B 1DOWA 2NPUA 1D9SA 1PCXA 3DAGA 5COGA 1RCPA 4PACA 3ESKA 3EFOB 3DXMG 3U8VA 1V74B 1TJCA 3FTWA 3OA1A 1YYHA 5KYYB 4ILGA 2H6FA 2VGEA 3D9MA 4ANVA 1UW4B 1Z7Qc 1LS4A 2P7VA 3U3WA 3HNKA 4F3VA 4DI3A 3EIJA 3L9TA 4JIOA 5L0FA 1MQSA 3LEVA 4APOA 3EGXA 2VYIA 3T4RA 1HXIA 1OY3D 2DBAA 2WXIA 2A68F 5D91A 3U0CA 4QDLA 4EQFA 2X6IA 5B1BE 2HV7A 3HNLA 4F1PA 3PDMP 1V55E 4TXPA 3CLJA 5COMA 3FU6A 1FMVA 3KD7A 4CDNA 2XM0A 3M1CB 1ORSC 4HOUA 3U9JA 1PC2A 5BW8C 3ASDA 3GW4A 5HS0A 1VMAA 3PZDA 3DSTA
chains in the Genus database with same CATH topology
4KC9A 5LP0A 4HE8D 2WM9A 3S2AA 3HHMA 1NP7A 2D5RB 4AE4A 4EBAA 3SZ7A 4FESA 4U5EE 4IYPA 3ZGQA 4MNDA 4YT8A 4I44A 5D0QD 2RG8A 1ZHYA 3QKYA 3FU0A 3GANA 2ZXWC 2C03A 3B7SA 4U07A 1G8XA 2NXPA 3ZG1A 3O48A 4TV3A 4B8CB 3S7FA 1E7UA 4YT2A 5CHEE 3G2VA 4GA1A 5DS6A 4XTKA 2ILRA 5HI7A 3G2UA 4UQXA 3MEKA 4AJWA 3AG4C 4L1BA 2WZFA 5T3RA 3Q47B 3NF1A 4G7OF 2YINA 2XGSA 4KI2A 1MMDA 4JPSA 3ZN3A 1NZEA 4NACA 4CEMA 1UJJA 3SHFA 4UI9J 1N54A 1Z5ZA 1D1CA 4XI9A 4WNEA 2NC9A 5ARFA 4GYOA 2AVPA 1ELKA 3MKQA 4ZLCA 5KCMA 3HJCA 5L3VA 4JL0A 3Q15A 4KBQA 2X51A 3FEXA 2J4DA 1SMYF 4DLQA 2CG2A 1PY1A 4DK5A 3SFZA 3RRNB 1SF8A 1Z6TA 4WWPA 4YT5A 3JCUQ 2CFUA 3PNLB 3KL4A 4LRZA 1DNPA 4OIPF 2FEZA 2B0JA 4BX9A 2R7WA 3K66A 3TD7A 1S0PA 3FH8A 3Q49B 2BF0X 3B0VC 5BUZA 4WNFA 3S28A 3VTXA 5T8IA 3VYWA 2Y4TA 5AJLA 1BR1A 4NURA 3FU3A 3L6AA 3ZVRA 2Z15A 3DMDA 3B9QA 4YWQA 2WXKA 3N0TA 4BEJA 4C3EA 5BV0A 4O7GA 2H7BA 2XRZA 3UPVA 3FUEA 3QDNA 4CSAC 1BR2A 2PL2A 3G2SA 3S29A 3CIAA 3EJNA 3ASOC 2VSNA 2JLBA 4V3IA 4C0EA 4GEHA 1ZU2A 2GRLA 5EHHA 4CBEA 3UMIA 3MJWA 2IYLD 3I4GA 3E4BA 4ACLA 3LVRE 4RDAA 5FZSA 2PP4A 3L0IA 4MS6A 4C3DA 2I9CA 3JSZA 2KNHA 1TWCA 3AQCA 3B0UX 4XLNF 2I1KA 1IZMA 3TXNA 1E8YA 4PK4A 4G24A 2LSUA 4O6NA 4PS7A 2E87A 3UMHA 3LY8A 4A55A 2V0PA 3FULA 4A2NB 1ZHZA 4MLPA 5FZRA 3ENEA 1W3BA 2IFUA 1JPJA 2OG2A 4NY3A 2CG3A 3QMKA 5G05C 2LNIA 3OWTA 4ANXA 4I2WA 3TG5A 3EHMA 3CSFA 3P2BA 3S7BA 1NG1A 3ZHEB 3RKOF 4DOZA 4KXKB 3T5VA 3D9OA 5AJDA 3SBSA 1VOMA 1M56C 3ASHA 1FVFA 5G2NA 3ML9A 2IF4A 1ZU5A 2PM6A 5DVWA 4O6FA 3PS6A 3SGHA 5EX0A 2OCCC 1V55C 1TWHA 3FTVA 1D0YA 4EZKA 4I43A 4PS8A 4N5CA 1E8WA 1YA0A 1N52A 3UT4A 1HU3A 4K0RA 4U0UA 4CT4A 4OVUA 2MOWA 4Q4ZF 4KVOA 2L81A 2LAIA 1OUVA 1OWNA 4YVOA 4FULA 3OXLA 1E90A 3ZIBA 2KATA 5DS5A 4FJZA 4Q7CA 3K7DA 4FU3A 2XSEA 2R5SA 2X6KA 4FLHA 2DGJA 4BT9A 3HTKC 3NYMA 1Z3IX 3TG4A 3CSKA 2PQRA 4EZJA 3I4UA 3EZHA 2Y39A 2IONA 2IXNA 3VLEA 3LJ3A 3K6BA 2LSEA 4U5BE 4UQZA 5A23A 4CS7A 4I6EA 3CQZA 1MNDA 3PRZA 4KBLA 3FUHA 2I2OA 1D0XA 2J7PA 4K7BA 2CDQA 3ESLA 4OD4A 2KCLA 5AYWD 3ECSA 5T1DB 3MLGA 3JUIA 3L17A 4EBBA 3L16A 4EWCA 1FFHA 4M63A 1HH8A 4JJFA 5G55A 5F5HA 3CZ6A 2W9YA 1IYGA 3FTZA 1JWFA 2Y3BA 2PX3A 4C3BA 3PVLA 4AY6A 5T4YA 2CHWA 4UWGA 3URZA 1NA3A 2VQ2A 5LOZA 4LERA 3ZYKA 3FUFA 2LO6A 3EH2A 5E75A 4PDXA 3T5XA 3CVVA 2WMNA 3CHOA 4J6IA 2UWJG 3QARA 1OWOA 5T3TA 5LX8A 4L2YA 4B6IA 3EH1A 4RBNA 5HQ8A 3ITFA 4U5CE 3B13A 1MNEA 4U04A 4G0HA 2I1JA 1EPUA 2A6EF 4IWBA 2PM7A 3QAQA 3VAYA 1UN8A 2WZLA 4AE4B 2PZIA 4GCNA 3FVYA 4APFA 4J8FA 2VTBA 4GZ6A 4ME2A 4G2VA 3B7TA 4CRWA 2FF4A 5CCLA 3W8IA 2J49A 3SF4A 3IHYA 2I8BA 2WPVA 3D9IA 2C0LA 4HEAJ 2R59A 4BJ1A 3U64A 4YJWA 4BJ6C 3RJVA 2VB6A 2J7PD 2J9VA 5JJ7A 3FHDA 4B0ZA 1E8XA 3ZHEA 2WXRA 3FUKA 3DM9B 5KJLA 2IU1A 3ZPJA 4FA6A 3SI5A 2X38A 3LPZA 2LSVA 4XWJA 4A3TA 2HM8A 3CVLA 4RG6A 2G3VA 3FDHA 1FFTC 1LS1A 1D0ZA 4XX5A 2BE5F 2VGXA 3RK6A 3N2ZB 4U0SA 5FQ6A 4XZ4A 3T8MA 2KJGA 3UGPA 4I2ZA 4CGWA 3L34A 3QC1A 2VJ8A 5FQ7A 2WXMA 4PJJA 3SD5A 3N24A 4E7SA 4OD5A 2QTVA 2Q9BA 3PE3A 4JC8A 1ZU4A 4ZLDA 3QB2A 3AG2C 1H19A 3NKEA 3PREA 3RRMB 4CT0A 4PJLA 1DVPA 1SZIA 4ULWA 5D0OD 3U66A 4H7XA 4GMLA 1TWGA 4B89A 4H4KC 2OVBA 2J0WA 1JUQA 2IJGX 4RD9A 4DLOA 5B3SC 4PUCA 3FH7A 2R7OA 3S7JA 2MYSA 4N2QA 1PAQA 3EQLF 3JQ0A 2Y3GA 4JA9A 5T3WA 1FCHA 3K1IC 1MMAA 4OYSA 3LJBA 2WXPA 5DS4A 5E76A 2CHXA 3NG1A 3BG1B 2HYZA 2WXFA 2O9XA 3CQGB 2H7VC 2VASA 3QJZA 4N3AA 2FULA 3PEVB 3F46A 1JWGA 1O5HA 3QWPA 3WODF 4RSYA 1BR4A 1OKKA 5DLJA 3CVYA 3DAFA 3TXMA 2CNWD 4O6YA 2WXNA 4YNDA 4IRUA 2WXHA 4A1GA 1E96B 2P58C 5A6CA 2HO1A 1FTSA 3JT1A 2AWIA 5FCLA 3AG1C 2Y3AA 3DD7A 3V7OA 3ZIMA 3FUNA 1Z6AA 3IEGA 1JPLA 2C04A 3MA5A 3HVEB 4G26A 2YZSA 2E2EA 2VSXE 4XKBA 4LLCA 2X6FA 1OCZC 3CHMA 3MYVA 2G3KA 1UJKA 3TGOA 1ZHWA 1ZBPA 5B1BC 4JJGA 1LF8A 4U8HA 5DBKA 4GAAA 3TJPA 1EF1C 3CVNA 2WB7A 2C0MA 4KMOA 5JHBA 1UN9A 4AIFA 1V54C 2M4EA 3FUIA 5BPPA 5LCWC 1NA0A 2E0IA 4L23A 2VSYA 3Q7GA 4FC8A 3GZ1A 4AV7A 4EBAG 2QFCA 4A1SA 4ANJA 4FP7A 2CW0F 4C9BB 5J90A 2YNQA 4BT8A 4DI4A 2J46A 2XRHA 3NZUA 3NYJA 4BFRA 2R7VA 1ST6A 3B0PA 3EG9B 4CS8A 1EYHA 2WXGA 1E8ZA 4GZ3A 2BTDA 4NQ0A 2G62A 4RG9A 4RVBA 2J09A 3R7QA 1E7VA 1OKKD 1FMWA 5DQTA 4LLEA 4KT6B 4WWOA 1M57C 3UR3C 4CS8C 1KU2A 3SNXA 3KAEA 2WZGA 3G2TA 1HX8A 2R7QA 1INZA 5KYYA 3I5QA 2OVFA 1P5QA 4GYWA 4LCTA 2XGMA 3UMKA 3EFOA 1WY6A 2IQCA 3FY4A 4UQYA 1ZYRF 2XXAB 4FHKA 2J45A 3T6JA 4J8EA 5E33A 3CVWA 3UNGC 3HVEA 1VK5A 2HR2A 3D3MA 3TL5A 2EINC 2VGYA 3D9PA 3KEZA 1B89A 3PDNA 3B7UX 4A3VA 3I3NA 3NYLA 3SYNA 3RU0A 4CGVA 4AK9A 3APDA 3E70C 2EQXA 4UI9K 4AEZC 2WQ6A 2EIJC 4CCAA 1ZHTA 4I9EA 1Y6IA 4ATGA 2X6HA 1XGWA 3ABMC 1QNFA 3ZSUA 4IAOA 5LFAA 4ILHB 1HG5A 3RO3A 3MZLB 4HLEA 2J07A 4J32B 4I6JA 1PD0A 3JRTA 3Q4AB 5IY5C 1MMGA 1TWAA 3WG7C 4BSXA 3LS0A 1UG3A 2NUPB 3LS8A 4PJNA 5KYXB 3IHVA 3MGBA 5KYNA 2FO7A 1SQMA 2YHSA 1H0AA 4HOQA 2FGYA 5KYWB 2ONDA 2VSOE 4KZCA 2PFDA 1Z3YA 4WWNA 3I5PA 3Q5MA 2W45A 2KC7A 4OIRF 2EILC 4BTBA 1IQRA 5CI9A 3EGDB 3RFYA 5KYUB 1KT1A 4JVSA 3L08A 3FDQA 3ZYMA 3QWVA 3AU5A 3WXXA 2Y69C 4JEHA 3ML8A 3QNKA 3CK7A 1WGWA 4C7OA 4HOTA 3ASNC 3JCKC 1H2VC 5EGYA 3UT8A 3O39A 4DJAA 1FVHA 3OEOA 3E9VA 2VGXB 3CSTA 2H7OA 2AXUA 2XCBA 1TEZA 4GYYA 1VDYA 1ELWA 3LESA 4G7HF 3TAXA 2QY7A 4C7OB 5FWQA 4BY6A 2XQ0A 4Y6WA 2M63A 2C2LA 2UY1A 3ZEFA 4F4BA 3APCA 2I6HA 3N71A 3X1OA 1HF8A 3NKDA 3MKQB 3U9WA 3LDZA 4Q96A 3OXFA 4ANUA 4OIOF 3AS8A 4GPKA 4BJ5A 2R17C 1S7ZA 1HZ4A 1EDUA 4OVVA 3K9IA 3MX3A 3RO2A 2EIMC 3FTXA 3VLDA 2VTBB 4PH4B 4G7ZF 2R7UA 3AU4A 4URKA 5B1AC 3HIZA 1JPNA 2KQ9A 4D10C 3APFA 5JJ6A 3ZFWA 3HYMB 5EKQD 3FEYA 3G2WA 3EPVA 3VTYA 2V5FA 3S7DA 2WVNA 2X6JA 3LAYA 4C0MA 4QI0A 5FJYA 3Q6MA 3C98A 4U5GA 3RH3A 3ASGA 4M3OA 4IULA 4QI2A 3FUDA 3RYLA 4J0UA 4WNGA 4CS9C 2A1DD 4BJ6A 2XXAA 3CVUA 5ARGA 3FTUA 2Y4UA 4HFFB 3FP3A 3GODA 3FTSA 2L0TB 4K0DA 5EX3A 4G23A 3O6XA 3FAJA 3KS2A 3MV3B 4TUUA 3RKVA 4G25A 4FWVA 4GA2A 4HS2A 4HORA 2KM4A 4CDRA 3L54A 2LAHA 4Q94A 3D9JA 3CHRA 3QOUA 4AVXA 3DXJF 3IEEA 3MV2B 4HXIA 2V3CC 5G04J 3CGHA 4W8KA 4AP2A 3D9NA 4P6IC 3T6BA 3LNRA 3UX4A 1J8YF 3CK9A 2NUTB 2AW6A 4WAFA 2IXOA 3UGOA 3NQPA 1GW6A 2WMOA 4UWHA 3CV0A 4I3MA 3GZSA 2NG1A 5ANRA 5D92A 3FWVA 2XPIA 1LVKA 3CEQA 5FTPA 3JYSA 2J9QA 3IBEA 4HFGA 2V26A 4Q69A 2EIKC 1NU9C 5JHAA 2KGOA 1ELRA 1TR2A 4BTAA 4YN0B 2J9UA 2WXLA 1H2TC 4LACB 2FFHA 3I4RB 3FUMA 3L22A 5M72A 3ZC4A 4DBQA 5C2YA 5E3AA 4OINF 1M2OA 1NZNA 3PNTB 3FUJA 4FX5A 3FH5A 3K1HA 1KT0A 1OWMA 3BEEA 2IOLA 1WM5A 1Z3XA 4G1TA 2ZPAA 3P1UA 2GFHA 4QFVA 5BNWA 2WXJA 3AQBA 2V4LA 3ONKA 3MCXA 2ZXOA 5A7DB 3DJNB 1OWLA 2WXOA 2J9WA 3DJUB 4WUYA 3BG0B 2GGFA 4I1OB 2WVQA 2JD3A 3ABKC 4I17A 2NUTA 3JYHA 1Z23A 4BJ5C 2MRIA 3D9LA 4U5HA 4F53A 2KZTA 5J08A 4PFPA 4I6GA 2J4BA 4LEUA 5JJTA 3KH2A 4I1MA 2MWQA 1MHQA 4L2LA 3SZRA 4AXHA 4K03A 3ULQA 4L7TA 4N3CA 3L13A 3KKBA 1IW7F 2Y3DA 4IN3B 1OWPA 4GZCA 3ZW3A 2YHCA 3SP1A 5CMWA 2Y3HA 4J8DA 3CKBA 1IHGA 4PFOA 4AX2A 4N2SA 4DVZA 1HS6A 3W8HA 3PEUB 5ANLA 3QK0A 4R7LA 2XCCA 2V8SE 2A5UA 4JA7A 2PX0A 4FJYA 4CSAA 2R7RA 2MHKA 1RJ9B 4HVBA 4GZDA 5F5FA 4O6MA 1WAO1 2CFZA 1ZHXA 3CVQA 2WQ7A 4DVYP 2KW3C 2XPZA 4LUNU 4UI9C 2XEVA 2WXQA 3LLIA 4I1AA 1TJFA 4EECA 4WNDA 3SBTB 4TRQA 3W2VA 2CHZA 3HDXA 4G11A 2IXPA 1L5JA 4MKTA 3ZVVA 3NRHA 4O79A 2GRMA 2OV8A 3CHQA 3OTNA 4N39A 3QZCA 3RRUA 2FI7A 3PUKA 4XI0A 1W2WA 3PH0C 3K33A 1OCRC 5E2QA 4KNVA 5DIZA 4JZYA 3CQCB 2A4ZA 3NZSA 4GYTA 4J8SA 3GYZA 5BV1A 2XGOA 4CDMA 1XNFA 2W4MA 1H6KA 4MQ9F 2XRYA 4JW1A 4AM9A 4AOFA 3IV0A 2WQHA 3ZRHA 4PJMA 5EDSA 3CVXA 5KYXA 4H7YA 4JURI 4JCHA 1O87A 3OXGA 2A6HF 4W9RA 3GZ2A 3EHNA 3UMVA 3ABLC 3B7RL 2L9JA 3O4ZA 4E85A 3ZYLA 1U3DA 5E3CA 4DBRA 1IQUA 4HOSA 4GU5A 3W2WA 4KZ0A 2CGEA 3EZIA 4GA0A 4JXTA 3EDTB 3UT7A 2L0IA 4B94A 3CR3A 4EPZA 5KJKA 3CHPA 1QZXA 4XIFA 3ONLA 5ENNA 4B8AA 2BUGA 3D9KA 3EIQC 5KJNA 2NUPA 2J08A 3LCAA 4FADA 5L3QA 5FZQA 1M2VB 1NU7D 2KCVA 2A69F 2AXVA 4IJJA 3LXUX 2L9BA 2ZXPA 4BJTA 3LLKA 1VYKA 3PMRA 4J30B 2XPYA 4CIHA 5G04C 1Z63A 3IKOB 3CVPA 3LS1A 5C1DA 4ABNA 3JQ1A 3AS5A 3PE4A 3ASFA 4FLBA 4KNWA 4JHRA 4U5DE 4JHKA 1HFAA 4E6HA 4U63A 5CI8A 2QY9A 3EGXB 1D1BA 4EZLA 1Y8MA 3ZYQA 1KLXA 3SEOA 2R7TA 3EG9A 2RD0A 3S0XA 2WVIA 3X2QC 1HE8A 4NRHB 4DPRA 3R7RA 3POVA 4UWLA 4JEUA 1HO8A 3AS4A 4E7ZA 3NDBB 3FTYA 3PHF2 5AENA 2KZTB 2IOSA 5CCMA 1A17A 3OAWA 1X5BA 4BWRA 2IOQA 4N3BA 4OIQF 2XHEA 1MMNA 2YHEA 4I9CA 4JZAA 1J8MF 4AY5A 4F1SA 1D1AA 4FHJA 1PD1A 3QWWA 2VH3A 4UWFA 4GCOA 2DIWA 4ACKA 5BT1A 2DYSC 3F47A 2AXZA 3DM5A 1OCOC 2Q9AA 1SZ9A 1QLEC 2W4BA 1QZ2A 4BG0A 3KMIA 2WVOA 2R7SA 4ANWA 3FHEA 3R9AB 3Q6NA 3HLZA 3LY7A 4MRUA 3DZAA 2UY1B 4U0ZA 4KYOB 4YT4A 4GZ5A 3DBSA 3SNHA 5BUOA 2YQ8A 4WJ0A 3LYAA 3CHSA 2WL8A 2NSZA 2P6VA 3S27A 3LEWA 3DPDA 5AIJA 1BPOA 2YEVA 3FU5A 3UUXA 3RIPA 2R7XA 1M2VA 2Q7FA 3CK8A 4X0RA 3MKRA 2IXMA 4HFKB 1H2UA 4JHJA 3Q7LA 2CNWA 3H65A 3VLFA 2PF4E 5FT9A 4Q5SF 4XKCA 4N06A 2Q9CA 1LKXA 3RIBA 1HG2A 4GMJA 5G05J 3LVQE 5FQ8A 4F7AA 3PUJA 4CS9A 4U5FE 1N1CA 2J0XA 3CKCA 2FBNA 2X3MA 4YVQC 2OOEA 4PS3A 3FFLA 3UQ3A 5HSWA 2GW1A 2XL4A 4ILIA 1RJ9A 4XLPF 3EGDA 2L6JA 4KVMA 5LCWJ 2HV6A 2DCPA 5KYUA 3LKUA 1TKNA 2DYRC 2WB2A 3ZXSA 3LY9A 5KJMA 1VYIA 5KYWA 1SZAA 2Q3TA 2KCKA 4Y6CA 5FQ4A 3AG3C 4BX8A 4UWKA 2PQNA 5DQZA 1QQEA 3U4TA 4GB9A 2JEKA 4XE0A 4P29A 2ZXRA 5CMYA 1OCCC 1U3CA 2ZU6B 1PCXA 3DAGA 3ESKA 3EFOB 1TJCA 3FTWA 3OA1A 5KYYB 4ILGA 3D9MA 4ANVA 1UW4B 2P7VA 3U3WA 4F3VA 4DI3A 3EIJA 1MQSA 4APOA 3LEVA 3EGXA 2VYIA 3T4RA 1HXIA 2DBAA 2WXIA 2A68F 5D91A 4QDLA 4EQFA 2X6IA 2HV7A 3CLJA 3FU6A 1FMVA 3KD7A 4CDNA 3M1CB 4HOUA 5BW8C 1PC2A 3ASDA 3GW4A 1VMAA 3PZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJN A;  3IV0 A;  5FQ6 A;  3MX3 A;  5FQ4 A;  3SNX A;  3GZS A;  3CGH A;  4MRU A;  3P1U A;  5E75 A;  5E76 A;  3JYS A;  3L22 A;  3LEW A;  3CK9 A;  3I4G A;  3JQ1 A;  4F53 A;  3KEZ A;  5FQ7 A;  5T4Y A;  3EHN A;  3MCX A;  4PUC A;  5LX8 A;  5FQ8 A;  4Q69 A;  4F7A A;  3HDX A;  3FDH A;  3QNK A;  5T3R A;  4LER A;  3CKB A;  3CK7 A;  3EHM A;  3CK8 A;  3MYV A;  5J90 A;  3NQP A;  3CKC A;  3JQ0 A;  3SGH A;  3OTN A;  4L7T A; 
#chains in the Genus database with same CATH topology
 4HI9 A;  4KC9 A;  5LP0 A;  4X8Q A;  4HE8 D;  2WM9 A;  3S2A A;  3E33 A;  3HHM A;  1NP7 A;  2D5R B;  4AE4 A;  4EBA A;  3SZ7 A;  4FES A;  4U5E E;  4IYP A;  3DPY A;  1Y6D A;  3ZGQ A;  1SA4 A;  1KPS B;  2PNO A;  3MYI A;  1JCS A;  3U8P A;  4MND A;  4YT8 A;  4I44 A;  5D0Q D;  2RG8 A;  1ZHY A;  3Q9N C;  1TYQ G;  3QKY A;  3BQO A;  4U7E B;  3UI2 A;  1MJ0 A;  1K05 A;  3BUA A;  3FU0 A;  1Q0M A;  3GAN A;  2YWA A;  2ZXW C;  2ZD9 A;  2C03 A;  3B7S A;  3DSU A;  4F6R D;  1WTY A;  1DCQ A;  4U07 A;  5AC4 A;  1G8X A;  2NXP A;  3ZG1 A;  3O48 A;  4TV3 A;  1XZP A;  1A0B A;  1YLM A;  5JT4 A;  2IY0 C;  1Q0G A;  4E0H A;  1S70 B;  4DX5 D;  5A6B A;  3SY2 A;  4B8C B;  2KSF A;  1WAS A;  4MW3 A;  3S7F A;  1E7U A;  2HJ3 A;  3C8G B;  4YT2 A;  5CHE E;  2R02 A;  3S9O A;  3G2V A;  4GA1 A;  5DS6 A;  4XTK A;  3PZ2 A;  4N4W A;  2ILR A;  1Q2Z A;  5HI7 A;  3G2U A;  4UQX A;  3MEK A;  4AJW A;  3AG4 C;  1CGM E;  2GRR B;  4L1B A;  2WZF A;  5T3R A;  3Q47 B;  1N4S A;  3NF1 A;  2F8X K;  4G7O F;  5AQ9 A;  2YIN A;  1FNT c;  2XGS A;  3IQT A;  3RQF A;  4KI2 A;  3TUL A;  1MMD A;  5GPG B;  4JPS A;  4MVR A;  3ZN3 A;  3JTL O;  5AN8 A;  3KSL A;  1YAU O;  1NZE A;  5A69 A;  4NAC A;  4CEM A;  1UJJ A;  3SHF A;  1NFO A;  4UI9 J;  3FXH A;  3UXG A;  1N54 A;  1Z5Z A;  1X81 A;  1D1C A;  4XI9 A;  4WNE A;  2NC9 A;  5ARF A;  4GYO A;  4GTO A;  2AVP A;  1ELK A;  2P9L G;  3MKQ A;  4ZLC A;  5KCM A;  3HJC A;  5L3V A;  4JL0 A;  3RW0 A;  2QZA A;  2LXM A;  1OR3 A;  3Q15 A;  3SXK A;  2YRF A;  4KBQ A;  2X51 A;  1AWC B;  3FEX A;  2J4D A;  5H7P A;  3PZ3 A;  2DYS E;  1SMY F;  4DLQ A;  2CG2 A;  5BXU A;  1PY1 A;  4DK5 A;  3SFZ A;  3RRN B;  1SF8 A;  2YL7 A;  1BLX B;  2P9I G;  2KC3 A;  1Z6T A;  4WWP A;  4YT5 A;  3JCU Q;  2CFU A;  3PNL B;  4XPW A;  3HNI A;  3KL4 A;  3U3B A;  1FT1 A;  4LRZ A;  1DNP A;  2HE0 A;  5ENT D;  4OIP F;  2FEZ A;  2B0J A;  4BX9 A;  2R7W A;  3K66 A;  1L7C A;  3TD7 A;  1S0P A;  2YL3 A;  4EHP A;  2OJQ A;  3FH8 A;  3V31 A;  3Q49 B;  2P9K G;  1M6T A;  2BF0 X;  5JA4 D;  3B0V C;  5BUZ A;  4WNF A;  3S28 A;  2AJA A;  1K1A A;  3VTX A;  5T8I A;  3VYW A;  2Y4T A;  2AWC A;  2JAB A;  2LFF A;  5AJL A;  1BR1 A;  1H6O A;  4NUR A;  3FU3 A;  3L6A A;  3ZVR A;  2HFI A;  2Z15 A;  3DMD A;  3B9Q A;  4YWQ A;  2WXK A;  3N0T A;  4BEJ A;  4C3E A;  5BV0 A;  4O7G A;  2H7B A;  1SR2 A;  5FZT A;  3L82 A;  2XRZ A;  3UPV A;  3L8J A;  3FUE A;  3QDN A;  4BPM A;  2FAP B;  4CSA C;  2NYJ A;  1BR2 A;  5AGF A;  3G4Z A;  2PL2 A;  3C8G A;  2BL2 A;  3G2S A;  3S29 A;  2MYO A;  3EJN A;  3ASO C;  2VSN A;  3CIA A;  5ENO D;  4RQI A;  2JLB A;  3NBN B;  4V3I A;  1K3Z D;  1N94 A;  4C0E A;  4GEH A;  4G8L A;  1ZU2 A;  2GRL A;  5EHH A;  4CBE A;  3SFY A;  3UIP C;  3UMI A;  3MJW A;  1ZZP A;  2IYL D;  4A63 B;  3I4G A;  3UKU G;  1N9A A;  3E4B A;  2KXP C;  3G4X A;  4J7T A;  4ACL A;  1GM5 A;  4MTG A;  3LVR E;  3J5P A;  1BBH A;  2DYR E;  4RDA A;  5FZS A;  2PP4 A;  3L0I A;  4MVM A;  3EHR A;  4MS6 A;  4C3D A;  2I9C A;  3JSZ A;  3SFX A;  3C62 A;  2KNH A;  1TWC A;  3UTM A;  3AQC A;  1O1R A;  4U8V D;  3B0U X;  4XLN F;  4HBD A;  2I1K A;  4BES A;  4N5Q A;  1IZM A;  3NMI A;  3TXN A;  2L6G A;  1E8Y A;  2J9B A;  3QVZ A;  4PK4 A;  2LSU A;  4O6N A;  4G24 A;  4PS7 A;  2E87 A;  3UMH A;  4GTT A;  4A4A A;  3LY8 A;  3HXF A;  4A55 A;  2XL8 A;  2V0P A;  3FUL A;  2DVW A;  4A2N B;  1ZHZ A;  4MLP A;  5FZR A;  3T9K A;  3ENE A;  1FT2 A;  3T9O A;  4MTO A;  1W3B A;  2IFU A;  1JPJ A;  1KNY A;  4U96 D;  2OG2 A;  4NY3 A;  2CG3 A;  3QMK A;  2DWZ A;  5G05 C;  4HLL A;  2LNI A;  3OWT A;  2A5E A;  4ANX A;  1RXQ A;  4I2W A;  3TG5 A;  2YLD A;  5TJ5 E;  2LIG A;  3EHM A;  4Z9I A;  1OCO E;  3E32 A;  3CSF A;  3P2B A;  2PBE A;  3S7B A;  1HE1 A;  1NG1 A;  3ZHE B;  4FAP B;  3RKO F;  4DOZ A;  4KXK B;  3T5V A;  3D9O A;  5AJD A;  3SBS A;  1VOM A;  2R25 A;  1M56 C;  3ASH A;  3Q73 A;  2XS1 A;  1FVF A;  3Q7A A;  5G2N A;  3ML9 A;  1T01 A;  2IF4 A;  1ZU5 A;  2XLO A;  2P61 A;  1EA8 A;  3U2M A;  3UM2 A;  4OAV B;  2PM6 A;  5DVW A;  4O6F A;  2VC9 A;  1TNB A;  3PS6 A;  3SGH A;  1LE2 A;  5EX0 A;  2OCC C;  3DXK G;  1V55 C;  1TWH A;  3FTV A;  1I5N A;  4JTD B;  1D0Y A;  4EZK A;  1K04 A;  5CBO A;  1BZ4 A;  1QPU A;  4I43 A;  4PS8 A;  3TQO A;  2QYU A;  1HW2 A;  1TNZ A;  4N5C A;  3B7B A;  2AVK A;  1E8W A;  1YA0 A;  1N52 A;  3UT4 A;  1HU3 A;  2XEE A;  2UUI A;  2JX0 A;  4K0R A;  4U0U A;  4CT4 A;  4OVU A;  2M64 A;  2MOW A;  2GRN B;  4Q4Z F;  3KSQ A;  3ASN E;  4KVO A;  2L81 A;  3U2L A;  1D8E A;  2LK4 A;  4O60 A;  2LAI A;  1OUV A;  1OWN A;  1CPR A;  4YVO A;  1NI1 A;  4FUL A;  3OXL A;  1C02 A;  1E90 A;  3ZIB A;  4U9E A;  2KAT A;  3TWV A;  3ABL E;  5DS5 A;  4Q7C A;  2XZT G;  4FJZ A;  3K7D A;  4BEP A;  4FU3 A;  2XSE A;  1BDJ B;  5AAO A;  2R5S A;  2P1A A;  2X6K A;  4FLH A;  2DGJ A;  4BT9 A;  1APC A;  3HTK C;  1GGQ A;  1OXK A;  4UDV A;  3NYM A;  1RKC A;  1Z3I X;  5B1A E;  5KWD A;  3TG4 A;  3CSK A;  3ZQV A;  2PQR A;  4EZJ A;  1E84 A;  1TN6 A;  3I4U A;  3EZH A;  4NTA A;  2Y39 A;  3SXM A;  2ION A;  2IXN A;  1Y4C A;  4CJG A;  3VLE A;  3LJ3 A;  4WAB A;  4Z9J A;  2VCB A;  3K6B A;  2XZD G;  3F6Q A;  5EYL A;  5L0H A;  2LSE A;  4U5B E;  2OU6 A;  2RFM A;  4UQZ A;  5A23 A;  4CS7 A;  3PZ1 A;  3CQZ A;  1V54 E;  4I6E A;  1MND A;  3PRZ A;  4KBL A;  3PZ4 A;  3FUH A;  4IB4 A;  2I2O A;  4DX2 A;  1D0X A;  2D4U A;  2J7P A;  3DEO A;  2L6H A;  4K7B A;  2CDQ A;  3ESL A;  5FIN A;  4OD4 A;  2KCL A;  2IEJ A;  5AYW D;  3ECS A;  3ATP A;  4MVZ A;  5AC5 A;  2QE9 A;  5T1D B;  3MLG A;  2TMV P;  3JUI A;  3L17 A;  4EBB A;  2QYJ A;  3L16 A;  4UUC A;  4EWC A;  1FFH A;  4M63 A;  3EU9 A;  1HH8 A;  4JJF A;  3TOM A;  5ENP D;  5G55 A;  4K1O A;  1OW6 A;  5F5H A;  3CZ6 A;  4K5B A;  3ZXP A;  1RZ4 A;  2W9Y A;  1IYG A;  3FTZ A;  1JWF A;  2Y3B A;  3Q7F A;  5CER B;  3C72 A;  1ZW2 A;  3SXY A;  2PX3 A;  4GTV A;  4C3B A;  3PVL A;  3MBG A;  4AY6 A;  5T4Y A;  2LD6 A;  2CHW A;  4UWG A;  3URZ A;  1NA3 A;  2VQ2 A;  5LOZ A;  3A11 A;  4LER A;  1OXJ A;  3ZYK A;  3FUF A;  1HMO A;  2LO6 A;  3EH2 A;  5E75 A;  2XLE A;  2H6I A;  4PDX A;  3T5X A;  3CVV A;  2WMN A;  3CHO A;  4J6I A;  1DCE A;  3RF3 A;  2VCC A;  2UWJ G;  2F22 A;  3QAR A;  1OWO A;  4J7W A;  1NFI E;  5T3T A;  1OT8 A;  1TN8 A;  1H6G A;  2XLW A;  3EU5 A;  5LX8 A;  4L2Y A;  4B6I A;  1ORJ A;  3EH1 A;  4RBN A;  5HQ8 A;  3ITF A;  4U5C E;  3UM1 A;  3B13 A;  1MNE A;  4U04 A;  1YA9 A;  4G0H A;  4BER A;  2I1J A;  1EPU A;  2A6E F;  4IWB A;  2PM7 A;  1K40 A;  3QAQ A;  3VAY A;  1UN8 A;  2WZL A;  2XS8 A;  2HUJ A;  3HXC A;  4AE4 B;  4TUM A;  2PZI A;  4GCN A;  3FVY A;  4APF A;  4J8F A;  2VTB A;  4GZ6 A;  3S84 A;  3FAP B;  3ZWI A;  1KZO A;  2HZ8 A;  5A6J A;  4ME2 A;  4G2V A;  3B7T A;  4CRW A;  2FF4 A;  5CCL A;  3W8I A;  3V5X A;  2J49 A;  3DSW A;  3SF4 A;  3RVZ A;  3IHY A;  2I8B A;  1IHB A;  1ORY A;  2F37 A;  2WPV A;  3D9I A;  4GTP A;  2C0L A;  2FO1 E;  4HEA J;  2XEH A;  2R59 A;  2OEW A;  4BJ1 A;  2OJE D;  4E0I A;  3U64 A;  4YJW A;  4BJ6 C;  3RJV A;  2VB6 A;  1O3U A;  2J7P D;  2J9V A;  5JJ7 A;  3B71 A;  3FHD A;  4B0Z A;  1E8X A;  3ZHE A;  2WXR A;  3FUK A;  1VTM P;  3DM9 B;  3AG3 E;  5KJL A;  2IU1 A;  4GTS A;  3LNM B;  4MVQ A;  3ZPJ A;  4FA6 A;  2RSE B;  3Q79 A;  3SI5 A;  2L6B A;  2X38 A;  3LPZ A;  2LSV A;  4XWJ A;  4A3T A;  2HM8 A;  1TNY A;  1JOG A;  2ETB A;  1YZC A;  1TNO A;  5AQ7 A;  1U89 A;  3NMK A;  3JRM O;  4XQ1 A;  5JUA A;  3CVL A;  4RG6 A;  2G3V A;  1O1T A;  3FDH A;  2HMZ A;  1YVI A;  1FFT C;  4JTC B;  1LS1 A;  1D0Z A;  1AEP A;  4XX5 A;  3PCV A;  3U5S A;  2BE5 F;  2VGX A;  3N2Z B;  3C8G D;  3RK6 A;  4U0S A;  4TXQ A;  5FQ6 A;  4XZ4 A;  3T8M A;  2KJG A;  1R4T A;  3UGP A;  4I2Z A;  3TWW A;  3HG0 D;  4CGW A;  3L34 A;  1OXB A;  3V5Y A;  2R05 A;  3QC1 A;  2VJ8 A;  5FQ7 A;  2WXM A;  4PJJ A;  3SD5 A;  256B A;  3DKA A;  1UG7 A;  3N24 A;  4E7S A;  4OD5 A;  2QTV A;  4YDW A;  2Q9B A;  3PE3 A;  4JC8 A;  1ZU4 A;  1I4Y A;  4ZLD A;  3QB2 A;  3AG2 C;  1H19 A;  3NKE A;  3PRE A;  3RRM B;  4CT0 A;  4PJL A;  1L3P A;  1DVP A;  2KBX A;  1SZI A;  2ZGG A;  4ULW A;  5D0O D;  3U66 A;  4H7X A;  4GML A;  1TWG A;  3ULY A;  1MQV A;  4H4K C;  4B89 A;  2OVB A;  1N4Q A;  2J0W A;  1JUQ A;  2IJG X;  2ICW G;  4RD9 A;  4DLO A;  5B3S C;  3DSV A;  4PUC A;  3FH7 A;  2R7O A;  3S7J A;  2MYS A;  4N2Q A;  4BSZ B;  4EUK B;  1PAQ A;  4RLY A;  4XEI G;  3EQL F;  1UFB A;  3T6G B;  3JQ0 A;  2Y3G A;  3GOR A;  5T3W A;  4JA9 A;  1FCH A;  3K1I C;  3C63 A;  3KEA A;  1MMA A;  4LNU D;  4OYS A;  3LJB A;  2WXP A;  5DS4 A;  3Q78 A;  5E76 A;  1T6Q A;  2CHX A;  1WN0 A;  4N6H A;  3NG1 A;  1RKE A;  5F28 E;  3DWW A;  3BG1 B;  3V5Z A;  2HYZ A;  2WXF A;  2O9X A;  4N6C A;  3CQG B;  1MZC A;  2H7V C;  2VAS A;  3QJZ A;  4N3A A;  2FUL A;  3PEV B;  4YL0 A;  4MTF A;  3F46 A;  3RQE A;  1YDI A;  1JWG A;  2XLD A;  2LXL A;  3DSX A;  4G8K A;  1O5H A;  3KYI A;  1Q0F A;  3QWP A;  3WOD F;  4RSY A;  1BR4 A;  2XM4 A;  1OKK A;  1LIH A;  2BC5 A;  5DLJ A;  3NB2 A;  3CVY A;  3DAF A;  3TXM A;  1OCZ E;  2CNW D;  4O6Y A;  2WXN A;  4YND A;  4IRU A;  2WXH A;  2KYH A;  4JTA B;  4HRL A;  4A1G A;  4G78 A;  1UOH A;  1E96 B;  3W9F A;  2P58 C;  1H6P A;  5A6C A;  2HO1 A;  1FTS A;  1CGN A;  3JT1 A;  2AWI A;  5FCL A;  3AG1 C;  3S90 A;  3DD7 A;  3V7O A;  2Y3A A;  3ZIM A;  2P2C P;  3FUN A;  1Z6A A;  3IEG A;  2P9S G;  4AL1 A;  1JPL A;  5HRY A;  2C04 A;  3MA5 A;  3AG4 E;  3WG7 E;  1MYO A;  3HVE B;  1OCC E;  4G26 A;  2YZS A;  2E2E A;  1JRA A;  1NSG B;  2VSX E;  1G4W R;  4HQD A;  4XKB A;  4LLC A;  2X6F A;  1OCZ C;  3CHM A;  1FAP B;  2OOC A;  3MYV A;  2G3K A;  1UJK A;  3TGO A;  1ZHW A;  5EYP F;  2ZIR A;  1TR4 A;  1ZBP A;  2YL1 A;  5B1B C;  4JJG A;  5A6A A;  3BRJ A;  1LF8 A;  3K1I A;  3AOU A;  5JSL A;  2BKG A;  4U8H A;  5DBK A;  4GAA A;  4TXR A;  1G3N B;  3QTH A;  1EF1 C;  3CVN A;  2WB7 A;  3TJP A;  2C0M A;  3IQC A;  4KMO A;  2GRP B;  2DB4 A;  5JHB A;  1YMP A;  1UN9 A;  3HRA A;  4AIF A;  2EPO A;  3US6 A;  1T6U A;  4HNA D;  1V54 C;  2M4E A;  1U2V G;  1KTM A;  3FUI A;  5BPP A;  5LCW C;  2GWW A;  1NA0 A;  2E0I A;  4L23 A;  2VSY A;  3Q7G A;  4YDE A;  4FC8 A;  3GZ1 A;  2RFA A;  1I4Z A;  4AV7 A;  4EBA G;  1LM3 B;  2QFC A;  4NTB A;  4A1S A;  4ANJ A;  3RSE G;  2A0U A;  4FP7 A;  4HB5 A;  2CW0 F;  4C9B B;  1A7D A;  2YNQ A;  5J90 A;  4BT8 A;  3IHU A;  4DI4 A;  4NC3 A;  1RMV A;  4L9P A;  1S05 A;  2J46 A;  4E18 A;  2BED A;  2XRH A;  5JRA A;  3NZU A;  4DRH B;  5BQH A;  2Y0B G;  3NYJ A;  4BFR A;  4D4X A;  5EN5 D;  2R7V A;  2ZXW E;  1ST6 A;  3B0P A;  3EG9 B;  4CS8 A;  1EYH A;  2WXG A;  1E8Z A;  4GZ3 A;  2BTD A;  4NQ0 A;  2G62 A;  5A6K A;  3ULE G;  4RG9 A;  4RVB A;  2J09 A;  1O1S A;  3R7Q A;  1E7V A;  1OKK D;  3M4B A;  1FMW A;  5DQT A;  4LLE A;  1SW6 A;  4KT6 B;  4WWO A;  1M57 C;  3UR3 C;  4CS8 C;  5BQG A;  2Q4F A;  1KU2 A;  3SNX A;  3KAE A;  2WZG A;  3G2T A;  1HX8 A;  4L6R A;  2ETA A;  2R7Q A;  1INZ A;  5KYY A;  3I5Q A;  2OVF A;  1P5Q A;  3AJI A;  4GYW A;  4LCT A;  2XGM A;  3UMK A;  5B3I A;  4MVS A;  3EFO A;  1WY6 A;  2IQC A;  1RW2 A;  3FY4 A;  1AUE A;  1C03 A;  4UQY A;  1MX6 A;  3H2V A;  1ZYR F;  2XXA B;  1IKN D;  4FHK A;  2J45 A;  2R9R B;  3T6J A;  4J8E A;  2XLV A;  5E33 A;  3CVW A;  3UNG C;  3HVE A;  1VK5 A;  2HR2 A;  3D3M A;  3NAW A;  2EIN C;  3TL5 A;  2VGY A;  3D9P A;  4DX1 A;  3KEZ A;  1EQ1 A;  1B89 A;  4O1P A;  3B7U X;  3PDN A;  3U3F A;  3NYL A;  3I3N A;  3SYN A;  3RU0 A;  4A3V A;  4AK9 A;  4CGV A;  3APD A;  2QLA A;  4GMR A;  3E70 C;  4JEA A;  2EQX A;  3KPH A;  4LG6 A;  4UI9 K;  4AEZ C;  2WQ6 A;  4C48 B;  2EIJ C;  1T9K A;  4CCA A;  1ZHT A;  4I9E A;  2QNL A;  1Y6I A;  2F8Y A;  4ATG A;  1XWJ A;  2X6H A;  2AWY A;  2NSG A;  1XGW A;  3ABM C;  4P9T A;  1QNF A;  2QC9 A;  3ZSU A;  4IAO A;  5JVE A;  3ABK E;  5LFA A;  4ILH B;  1HG5 A;  3RO3 A;  1HW1 A;  3MZL B;  4HLE A;  2J07 A;  4J32 B;  4I6J A;  2QUP A;  1PD0 A;  3RVY A;  3RAU A;  2XLH A;  3JRT A;  5ENS D;  3Q4A B;  5IY5 C;  1MMG A;  3KYJ A;  5EIB E;  1TWA A;  3WG7 C;  4BSX A;  2LCH A;  3LS0 A;  4CZ2 D;  1UG3 A;  1N4R A;  2NUP B;  3LS8 A;  5EIL A;  4PJN A;  4JRZ A;  5KYX B;  1U0B B;  3IHV A;  2VCA A;  4DXW A;  3MGB A;  5KYN A;  5CIV A;  2FO7 A;  1SQM A;  2YHS A;  1H0A A;  2EPN A;  4HOQ A;  2FGY A;  5KYW B;  2OND A;  5CED B;  2VSO E;  2HKV A;  3LUT B;  4MW8 A;  4KZC A;  2PFD A;  4YL1 A;  2EPK X;  1Z3Y A;  4LNB A;  4WWN A;  3I5P A;  3Q5M A;  2W45 A;  2KC7 A;  4OIR F;  2EIL C;  4BTB A;  1BI8 B;  3JXJ A;  1WOL A;  5CI9 A;  1IQR A;  3EGD B;  3RFY A;  5KYU B;  1KT1 A;  4JC7 A;  4JVS A;  3L08 A;  3FDQ A;  3ZYM A;  3QWV A;  3AU5 A;  3WXX A;  5ENR D;  2Y69 C;  1BD8 A;  4JEH A;  3ML8 A;  3TWT A;  3QNK A;  5ENQ D;  1MX2 A;  3CK7 A;  1G5Z A;  5IY5 E;  1E85 A;  1WGW A;  4YK5 A;  2MHR A;  4C7O A;  3DEP A;  4HOT A;  3ASN C;  3JCK C;  1H2V C;  1OR2 A;  5EGY A;  3UT8 A;  3O39 A;  1HY5 A;  3V2O A;  1FVH A;  4DJA A;  3OEO A;  3E9V A;  2VGX B;  3CST A;  2H7O A;  4B93 B;  2AXU A;  2XCB A;  1TEZ A;  4GYY A;  3C5R A;  1VDY A;  1ELW A;  3LES A;  4G7H F;  2Y69 E;  1A7E A;  3TAX A;  3JYY A;  2QY7 A;  4C7O B;  1K8K G;  5FWQ A;  4BY6 A;  2XQ0 A;  4Y6W A;  2X0C A;  2M63 A;  2C2L A;  2UY1 A;  2IO3 C;  3ZEF A;  3AGT A;  4F4B A;  3JXI A;  4IAQ A;  1HE9 A;  3APC A;  3IQ5 A;  2I6H A;  5CEC B;  3N71 A;  3X1O A;  2Q7R A;  1HF8 A;  3TK0 A;  3ZUV B;  5KBA A;  3NKD A;  3MKQ B;  3U9W A;  3LDZ A;  4Q96 A;  3OXF A;  1G4U S;  4ANU A;  4OIO F;  2B6C A;  3AS8 A;  2Q00 A;  2P9P G;  4GPK A;  4M7C A;  4BJ5 A;  2R17 C;  1S7Z A;  1HZ4 A;  1EDU A;  4OVV A;  3K9I A;  3AG1 E;  2OEX A;  3MX3 A;  3RO2 A;  2EIM C;  3FTX A;  3VLD A;  4NIK A;  3C18 A;  1OCR E;  5KNG A;  2VTB B;  1H7I A;  4PH4 B;  4G7Z F;  2R7U A;  3AU4 A;  1V4A A;  4URK A;  5B1A C;  4D4N A;  2J8S D;  3HIZ A;  1JPN A;  3UIN C;  2KQ9 A;  2P9N G;  4D10 C;  3APF A;  4CDV A;  4LDQ A;  5JJ6 A;  3ZFW A;  2B0O E;  3HYM B;  5EKQ D;  3NOC D;  1EI7 A;  3FEY A;  2H8A A;  3G2W A;  3EPV A;  3VTY A;  2V5F A;  3S7D A;  2WVN A;  2X6J A;  3LAY A;  3HNJ A;  4C0M A;  4DUI A;  4CJO A;  4JE9 A;  3C3O A;  2JPU A;  4QI0 A;  1A7V A;  5FJY A;  3Q6M A;  3C98 A;  2EIM E;  4U5G A;  3RH3 A;  2BKK B;  3ASG A;  4M3O A;  4IUL A;  2P9U G;  4WGY A;  4QI2 A;  3FUD A;  3RYL A;  4J0U A;  4WNG A;  4CS9 C;  2A1D D;  4BJ6 A;  2XXA A;  3CVU A;  3JZ0 A;  3GEH A;  5ARG A;  3VRC A;  3FTU A;  3SQV A;  2Y4U A;  4HFF B;  3FP3 A;  3B95 A;  3GOD A;  2ASR A;  3FTS A;  5D2M C;  2OCC E;  2L0T B;  4K0D A;  5EX3 A;  4G23 A;  3O6X A;  3FAJ A;  3KS2 A;  3VM6 A;  3R9M A;  3QW0 A;  3MV3 B;  4AL0 A;  4TUU A;  3RKV A;  3ZKJ A;  4G25 A;  4FWV A;  4GA2 A;  4HS2 A;  4HOR A;  2KM4 A;  4GPM A;  4CDR A;  1OQC A;  1YYJ A;  3L54 A;  2F0Y A;  2LAH A;  4Q94 A;  4Z68 A;  3D9J A;  5JP7 A;  3CHR A;  3QOU A;  2Y1L E;  4AVX A;  3SXZ A;  3DXJ F;  2DI3 A;  3GEI A;  3IEE A;  3MV2 B;  4HXI A;  2V3C C;  5G04 J;  4YL3 A;  3CGH A;  4W8K A;  3EUV A;  4AP2 A;  3D9N A;  4P6I C;  3T6B A;  4EBJ A;  3LNR A;  1Q0D A;  3UX4 A;  1J8Y F;  3CK9 A;  2NUT B;  1Q0K A;  2AW6 A;  4DRX E;  1YA7 O;  3GM3 A;  1S63 A;  3TWX A;  3QW1 A;  4WAF A;  3D9H A;  2L6F A;  1QSP A;  5JS5 A;  2IXO A;  3UGO A;  3QVY A;  3NQP A;  1T6I A;  3Q75 A;  1GW6 A;  3TWS A;  1YYX A;  3DI5 A;  2WMO A;  4UWH A;  3L8I A;  3CV0 A;  4I3M A;  4CX9 A;  2NG1 A;  3GZS A;  5D92 A;  5ANR A;  3FWV A;  2XPI A;  1LVK A;  3GEE A;  3CEQ A;  5FTP A;  3JYS A;  2J9Q A;  4ER9 A;  3IBE A;  4GTM A;  3M4C A;  4ULV A;  4HFG A;  3GWN A;  2GRQ B;  2V26 A;  4Q69 A;  2EIK C;  1NU9 C;  5JHA A;  2KGO A;  1ELR A;  5JLI A;  1LI7 A;  5COF A;  1TR2 A;  3M15 A;  4BTA A;  1JAF A;  4YN0 B;  2J9U A;  2WXL A;  1H2T C;  1VLT A;  4LAC B;  2FFH A;  3I4R B;  3VF0 A;  3O55 A;  3FUM A;  1JCQ A;  3L22 A;  4JCZ A;  3TJ6 A;  5M72 A;  3V30 A;  3DSS A;  3ZC4 A;  4JD2 G;  4JB8 P;  4DBQ A;  1TQG A;  2V5Q C;  1D8D A;  5CBN A;  5C2Y A;  4HI8 A;  5E3A A;  2YVK A;  1WDY A;  4OIN F;  1M2O A;  1NZN A;  3PNT B;  1VLS A;  3FUJ A;  4FX5 A;  3FH5 A;  3L1M A;  5CEA A;  3BU8 A;  2A0B A;  4LSZ E;  3K1H A;  1FPP A;  1QVX A;  1KT0 A;  1OWM A;  3BEE A;  4NTF A;  3GWL A;  2IOL A;  2LUH A;  2V4H C;  1WM5 A;  1Z3X A;  4G1T A;  4NCQ A;  2ZPA A;  3P1U A;  2GFH A;  4QFV A;  4MVO A;  2WXJ A;  5BNW A;  3AQB A;  4XPX A;  4R32 A;  2V4L A;  1K1B A;  3ONK A;  3MCX A;  2XLM A;  2ZXO A;  5A7D B;  3DJN B;  4JKV A;  1OWL A;  3AJM A;  2WXO A;  2J9W A;  5BXO A;  1SVX A;  3UIO C;  4K5C A;  3DJU B;  4WUY A;  3BG0 B;  1AVO B;  1AP7 A;  2GGF A;  2WVQ A;  4I1O B;  2JD3 A;  4DX7 D;  1QKR A;  3ABK C;  4EBK A;  1E86 A;  4I17 A;  3TWQ A;  2NUT A;  4GTR A;  3JYH A;  1Z23 A;  4BJ5 C;  2MRI A;  3D9L A;  4U5H A;  3UKR G;  4F53 A;  2KZT A;  3R7C A;  5J08 A;  4LDR A;  4PFP A;  4I6G A;  2J4B A;  1N0Q A;  4LEU A;  5JJT A;  3KH2 A;  1GQA A;  2MWQ A;  4I1M A;  1MHQ A;  4L2L A;  1GS9 A;  5JMN D;  4W8P A;  3SZR A;  3IXE A;  4U95 D;  4AXH A;  1ZW3 A;  4K03 A;  4L7T A;  3ULQ A;  4N3C A;  3L13 A;  4YDO A;  1WG0 A;  4EKW A;  3ABM E;  3KKB A;  2J8W A;  1IW7 F;  3WAQ A;  2Y3D A;  1OWP A;  4IN3 B;  4GZC A;  5CRU A;  3ZW3 A;  2YHC A;  3Q9U C;  4BEM J;  3SP1 A;  1B68 A;  5CMW A;  2Y3H A;  2LQG A;  3LEO A;  4J8D A;  2GDC A;  3CKB A;  2GA0 A;  4PFO A;  1IHG A;  4AX2 A;  4MBG A;  3E34 A;  4N2S A;  4DVZ A;  1HS6 A;  3W8H A;  3PEU B;  5ANL A;  3QK0 A;  4R7L A;  2OKU A;  1ZB1 A;  2XCC A;  2V8S E;  2KK1 A;  2A5U A;  4JA7 A;  4XEV A;  2PX0 A;  4FJY A;  4CSA A;  2OQM A;  3J5Q B;  2R7R A;  2MHK A;  1RJ9 B;  4HVB A;  1O5M A;  1RKE B;  2LFD A;  4GZD A;  5F5F A;  4O6M A;  5BQI A;  3HXB A;  1WAO 1;  2OEV A;  1H9T A;  2CFZ A;  4J7Y A;  1ZHX A;  1PV3 A;  2CCY A;  3J06 A;  2I15 A;  3CVQ A;  4XEK A;  2WQ7 A;  1SYQ A;  1NLX A;  4DVY P;  1A41 A;  1F1M A;  1YAR O;  2KW3 C;  1QBQ A;  2XPZ A;  4LUN U;  5A6B D;  2XEV A;  2WXQ A;  4UI9 C;  4ONS A;  3LLI A;  4I1A A;  1N11 A;  4HRN A;  3O10 A;  2B0H A;  1TJF A;  4EEC A;  4TRQ A;  3W2V A;  4WND A;  3SBT B;  2CHZ A;  4DRJ B;  3HDX A;  4G11 A;  2IXP A;  1LE4 A;  1L5J A;  4MKT A;  3ZVV A;  3NRH A;  4O79 A;  2GRM A;  2DZN A;  2OV8 A;  3CHQ A;  3OTN A;  4N39 A;  3QZC A;  3RRU A;  2FI7 A;  3PUK A;  4XI0 A;  1W2W A;  3PH0 C;  3K33 A;  1OCR C;  5E2Q A;  4KNV A;  5DIZ A;  4JZY A;  2EIK E;  3CQC B;  3CEX A;  2A4Z A;  3NZS A;  4GYT A;  4XEF A;  3HXD A;  4J8S A;  3GYZ A;  5BV1 A;  2XGO A;  4CDM A;  1YZA A;  1XNF A;  2W4M A;  1H6K A;  4MQ9 F;  2XRY A;  4U8Y D;  4JW1 A;  1U6H A;  3TWR A;  4AM9 A;  3ZQY A;  4AOF A;  3IV0 A;  4HRM B;  2WQH A;  3ZRH A;  4PJM A;  1S64 A;  5EDS A;  3CVX A;  1SA5 A;  5KYX A;  5AAR A;  4H7Y A;  2HJM A;  4JUR I;  4JCH A;  3FOO A;  2P0N A;  4YDY A;  1O87 A;  3OXG A;  2XEN A;  2A6H F;  3MYF A;  4W9R A;  3GZ2 A;  3TWU A;  3EHN A;  3UMV A;  3ABL C;  3B7R L;  2L9J A;  3O4Z A;  2GRO B;  4E85 A;  3ZYL A;  2EIJ E;  1LI5 A;  5E3C A;  1U3D A;  3DE8 A;  1JCR A;  4DBR A;  3C8Z A;  1IQU A;  4HOS A;  4GU5 A;  3W2W A;  1BU9 A;  4KZ0 A;  2CGE A;  3SO8 A;  1NFN A;  3EZI A;  2NSF A;  4MS2 A;  4GA0 A;  4JXT A;  4K5A B;  3EDT B;  3ZDL A;  4IGG A;  3DWL G;  3UT7 A;  2L0I A;  4B94 A;  3CR3 A;  3W4Y A;  4DJ9 A;  4EPZ A;  5KJK A;  1WAT A;  1TNU A;  3CHP A;  1TFO B;  4OAU C;  2DZO A;  1QZX A;  4XIF A;  3HXE A;  3ONL A;  5ENN A;  4B8A A;  2EIL E;  4WGZ A;  2BUG A;  3D9K A;  3EIQ C;  4U9D A;  5KJN A;  4CDY A;  2H6G A;  3NMJ A;  4ATZ D;  2NUP A;  1YCS B;  2J08 A;  2GAQ A;  3LCA A;  5HKP A;  5EID A;  2AU5 A;  3DRA A;  3C7J A;  4FAD A;  5L3Q A;  2EPM X;  5FZQ A;  1M2V B;  3V2X A;  1TFK B;  3HKK A;  1NU7 D;  2KCV A;  2EPL X;  2A69 F;  1E83 A;  2AXV A;  4IJJ A;  3LXU X;  4EIY A;  4Z9H A;  2L9B A;  2ZXP A;  2YLI A;  4BJT A;  5EK0 A;  5L0D A;  3LLK A;  1VYK A;  3PMR A;  5HV9 A;  4J30 B;  2XPY A;  2YKZ A;  3LJN A;  2HMQ A;  4CIH A;  3BEH A;  4LNG A;  5G04 C;  1Z63 A;  3IKO B;  3CVP A;  1MX4 A;  4BET A;  3A9C A;  2XL6 A;  3LS1 A;  5C1D A;  4ABN A;  3H2U A;  4GQH A;  2R2L A;  1T5O A;  2R03 A;  5L0I A;  1N95 A;  3JQ1 A;  3FMS A;  3AS5 A;  3PE4 A;  3ASF A;  4FLB A;  3GM1 A;  4KNW A;  1H9G A;  4JHR A;  4U5D E;  4JHK A;  1HFA A;  4E6H A;  1VB5 A;  4U63 A;  4O1O A;  3TOL A;  5CI8 A;  5ITZ F;  2QY9 A;  3EGX B;  1D1B A;  4EZL A;  1LPE A;  1Y8M A;  3ZYQ A;  2EIN E;  3E30 A;  4ZFH A;  1KLX A;  3SEO A;  2HSQ A;  2IO2 C;  2R7T A;  3EG9 A;  2RD0 A;  4LDK A;  3S0X A;  3W9G A;  2WVI A;  3FOP A;  4QQI A;  1DOV A;  4H54 A;  3X2Q C;  1HE8 A;  4NRH B;  4DPR A;  3R2P A;  3JSE O;  3R7R A;  3ASO E;  3POV A;  4UWL A;  4JEU A;  1HO8 A;  1Z5S C;  3AS4 A;  1CGO A;  2ETS A;  4E7Z A;  3NDB B;  1FR0 A;  3FTY A;  1LD7 A;  3PHF 2;  5CRV A;  5AEN A;  3ISM C;  2KZT B;  1N4P A;  3U9M A;  1CPQ A;  2IOS A;  5CCM A;  1EKY A;  1A17 A;  3NOG D;  3OAW A;  1X5B A;  4BWR A;  4E17 A;  5FIO A;  2IOQ A;  4N3B A;  4GTQ A;  2ZIS A;  4OIQ F;  1NL4 A;  1QQ3 A;  3E37 A;  3AGU A;  4ZHB A;  2HSB A;  2XHE A;  1MMN A;  2YHE A;  4I9C A;  4JZA A;  1J8M F;  4AY5 A;  4F1S A;  2YL0 A;  3B29 A;  1D1A A;  2L7A A;  3V79 K;  5L0J A;  1PD1 A;  4FHJ A;  3QWW A;  2VH3 A;  2IM8 A;  1R5I D;  4UWF A;  4GCO A;  2DIW A;  4J8Y A;  4ACK A;  5BT1 A;  2DYS C;  1KZP A;  3F47 A;  2AXZ A;  3DM5 A;  1LD8 A;  1E2X A;  1OCO C;  2Q9A A;  1SZ9 A;  1QLE C;  3X2Q E;  2W4B A;  1QZ2 A;  1YJG A;  4CDA A;  4PR9 A;  4BG0 A;  3KMI A;  3ZTZ A;  4CYM D;  2WVO A;  4DRI B;  2R7S A;  2UUH A;  2CYD A;  4ANW A;  3FHE A;  5AQB A;  3R9A B;  4IAR A;  4DX6 D;  3Q6N A;  3HLZ A;  3DE9 A;  3LY7 A;  4MRU A;  3ZU7 B;  3DZA A;  3AAA C;  3UM0 A;  1OW8 A;  2UY1 B;  4U0Z A;  4KYO B;  1LTX A;  3T8K A;  4YT4 A;  4GZ5 A;  3DBS A;  5L0C A;  3MFN A;  5K0I A;  4NQF A;  3SNH A;  5BUO A;  3C3Q A;  2IBF A;  3ZNG A;  2YQ8 A;  4WJ0 A;  3LYA A;  5D66 A;  3CHS A;  4EHM A;  2WL8 A;  2NSZ A;  1JR8 A;  1IXV A;  5B3S E;  2P6V A;  2ZGD A;  3S27 A;  3LEW A;  3DPD A;  5AIJ A;  1BPO A;  4JEB A;  3IPM O;  3C3R A;  2YEV A;  2YQY A;  3FU5 A;  3UUX A;  4MVU A;  3RIP A;  2R7X A;  3CAX A;  1M2V A;  1ZVZ A;  2Q7F A;  3CK8 A;  4X0R A;  3MKR A;  2IXM A;  4HFK B;  3TJ5 A;  5AQA A;  1H2U A;  1DC2 A;  4JHJ A;  3Q7L A;  2CNW A;  3H65 A;  3VLF A;  1OW7 A;  2PF4 E;  5FT9 A;  3IQ6 A;  4Q5S F;  4XKC A;  4N06 A;  2Q9C A;  3G50 A;  3GM2 A;  1LKX A;  3RIB A;  3RQG A;  2ETC A;  1HG2 A;  4GMJ A;  5G05 J;  1A5E A;  3LVQ E;  3WHN A;  5FQ8 A;  3EHQ A;  4F7A A;  3PUJ A;  4CS9 A;  4U5F E;  2RKK A;  4XPY A;  3UM3 A;  1XZQ A;  1N1C A;  5L0G A;  2H6H A;  2J0X A;  3CKC A;  2FBN A;  1HMD A;  3AG2 E;  2X3M A;  2LP4 A;  1BI7 B;  4YVQ C;  1WWP A;  2OOE A;  1QYM A;  4CIP A;  3FFL A;  4PS3 A;  3UQ3 A;  5HSW A;  2GW1 A;  2XL4 A;  4ILI A;  1RJ9 A;  3ZTM A;  4XLP F;  3EGD A;  2L6J A;  4KVM A;  5LCW J;  2HV6 A;  2DCP A;  5KYU A;  3LKU A;  1NBB A;  1TKN A;  2DYR C;  2RD9 A;  2WB2 A;  1JMW A;  3JUE A;  3ZXS A;  3LY9 A;  5KJM A;  1VYI A;  5KYW A;  1SZA A;  2Q3T A;  2KCK A;  4Y6C A;  5FQ4 A;  3AG3 C;  2PNN A;  1C17 M;  4BX8 A;  4UWK A;  1N0R A;  1TN7 A;  2PQN A;  5DQZ A;  4P9F A;  1QQE A;  3U4T A;  5KNH D;  2AP3 A;  2HS5 A;  4GB9 A;  3M79 A;  2JEK A;  4XE0 A;  4P29 A;  2YLG A;  2ZXR A;  5CMY A;  1OCC C;  1U3C A;  2ZU6 B;  1DOW A;  2NPU A;  1D9S A;  1PCX A;  3DAG A;  5COG A;  1RCP A;  4PAC A;  3ESK A;  3EFO B;  3DXM G;  3U8V A;  1V74 B;  1TJC A;  3FTW A;  3OA1 A;  1YYH A;  5KYY B;  4ILG A;  2H6F A;  2VGE A;  3D9M A;  4ANV A;  1UW4 B;  1Z7Q c;  1LS4 A;  2P7V A;  3U3W A;  3HNK A;  4F3V A;  4DI3 A;  3EIJ A;  3L9T A;  4JIO A;  5L0F A;  1MQS A;  3LEV A;  4APO A;  3EGX A;  2VYI A;  3T4R A;  1HXI A;  1OY3 D;  2DBA A;  2WXI A;  2A68 F;  5D91 A;  3U0C A;  4QDL A;  4EQF A;  2X6I A;  5B1B E;  2HV7 A;  3HNL A;  4F1P A;  3PDM P;  1V55 E;  4TXP A;  3CLJ A;  5COM A;  3FU6 A;  1FMV A;  3KD7 A;  4CDN A;  2XM0 A;  3M1C B;  1ORS C;  4HOU A;  3U9J A;  1PC2 A;  5BW8 C;  3ASD A;  3GW4 A;  5HS0 A;  1VMA A;  3PZD A;  3DST A; 
#chains in the Genus database with same CATH homology
 4KC9 A;  5LP0 A;  4HE8 D;  2WM9 A;  3S2A A;  3HHM A;  1NP7 A;  2D5R B;  4AE4 A;  4EBA A;  3SZ7 A;  4FES A;  4U5E E;  4IYP A;  3ZGQ A;  4MND A;  4YT8 A;  4I44 A;  5D0Q D;  2RG8 A;  1ZHY A;  3QKY A;  3FU0 A;  3GAN A;  2ZXW C;  2C03 A;  3B7S A;  4U07 A;  1G8X A;  2NXP A;  3ZG1 A;  3O48 A;  4TV3 A;  4B8C B;  3S7F A;  1E7U A;  4YT2 A;  5CHE E;  3G2V A;  4GA1 A;  5DS6 A;  4XTK A;  2ILR A;  5HI7 A;  3G2U A;  4UQX A;  3MEK A;  4AJW A;  3AG4 C;  4L1B A;  2WZF A;  5T3R A;  3Q47 B;  3NF1 A;  4G7O F;  2YIN A;  2XGS A;  4KI2 A;  1MMD A;  4JPS A;  3ZN3 A;  1NZE A;  4NAC A;  4CEM A;  1UJJ A;  3SHF A;  4UI9 J;  1N54 A;  1Z5Z A;  1D1C A;  4XI9 A;  4WNE A;  2NC9 A;  5ARF A;  4GYO A;  2AVP A;  1ELK A;  3MKQ A;  4ZLC A;  5KCM A;  3HJC A;  5L3V A;  4JL0 A;  3Q15 A;  4KBQ A;  2X51 A;  3FEX A;  2J4D A;  1SMY F;  4DLQ A;  2CG2 A;  1PY1 A;  4DK5 A;  3SFZ A;  3RRN B;  1SF8 A;  1Z6T A;  4WWP A;  4YT5 A;  3JCU Q;  2CFU A;  3PNL B;  3KL4 A;  4LRZ A;  1DNP A;  4OIP F;  2FEZ A;  2B0J A;  4BX9 A;  2R7W A;  3K66 A;  3TD7 A;  1S0P A;  3FH8 A;  3Q49 B;  2BF0 X;  3B0V C;  5BUZ A;  4WNF A;  3S28 A;  3VTX A;  5T8I A;  3VYW A;  2Y4T A;  5AJL A;  1BR1 A;  4NUR A;  3FU3 A;  3L6A A;  3ZVR A;  2Z15 A;  3DMD A;  3B9Q A;  4YWQ A;  2WXK A;  3N0T A;  4BEJ A;  4C3E A;  5BV0 A;  4O7G A;  2H7B A;  2XRZ A;  3UPV A;  3FUE A;  3QDN A;  4CSA C;  1BR2 A;  2PL2 A;  3G2S A;  3S29 A;  3CIA A;  3EJN A;  3ASO C;  2VSN A;  2JLB A;  4V3I A;  4C0E A;  4GEH A;  1ZU2 A;  2GRL A;  5EHH A;  4CBE A;  3UMI A;  3MJW A;  2IYL D;  3I4G A;  3E4B A;  4ACL A;  3LVR E;  4RDA A;  5FZS A;  2PP4 A;  3L0I A;  4MS6 A;  4C3D A;  2I9C A;  3JSZ A;  2KNH A;  1TWC A;  3AQC A;  3B0U X;  4XLN F;  2I1K A;  1IZM A;  3TXN A;  1E8Y A;  4PK4 A;  4G24 A;  2LSU A;  4O6N A;  4PS7 A;  2E87 A;  3UMH A;  3LY8 A;  4A55 A;  2V0P A;  3FUL A;  4A2N B;  1ZHZ A;  4MLP A;  5FZR A;  3ENE A;  1W3B A;  2IFU A;  1JPJ A;  2OG2 A;  4NY3 A;  2CG3 A;  3QMK A;  5G05 C;  2LNI A;  3OWT A;  4ANX A;  4I2W A;  3TG5 A;  3EHM A;  3CSF A;  3P2B A;  3S7B A;  1NG1 A;  3ZHE B;  3RKO F;  4DOZ A;  4KXK B;  3T5V A;  3D9O A;  5AJD A;  3SBS A;  1VOM A;  1M56 C;  3ASH A;  1FVF A;  5G2N A;  3ML9 A;  2IF4 A;  1ZU5 A;  2PM6 A;  5DVW A;  4O6F A;  3PS6 A;  3SGH A;  5EX0 A;  2OCC C;  1V55 C;  1TWH A;  3FTV A;  1D0Y A;  4EZK A;  4I43 A;  4PS8 A;  4N5C A;  1E8W A;  1YA0 A;  1N52 A;  3UT4 A;  1HU3 A;  4K0R A;  4U0U A;  4CT4 A;  4OVU A;  2MOW A;  4Q4Z F;  4KVO A;  2L81 A;  2LAI A;  1OUV A;  1OWN A;  4YVO A;  4FUL A;  3OXL A;  1E90 A;  3ZIB A;  2KAT A;  5DS5 A;  4FJZ A;  4Q7C A;  3K7D A;  4FU3 A;  2XSE A;  2R5S A;  2X6K A;  4FLH A;  2DGJ A;  4BT9 A;  3HTK C;  3NYM A;  1Z3I X;  3TG4 A;  3CSK A;  2PQR A;  4EZJ A;  3I4U A;  3EZH A;  2Y39 A;  2ION A;  2IXN A;  3VLE A;  3LJ3 A;  3K6B A;  2LSE A;  4U5B E;  4UQZ A;  5A23 A;  4CS7 A;  4I6E A;  3CQZ A;  1MND A;  3PRZ A;  4KBL A;  3FUH A;  2I2O A;  1D0X A;  2J7P A;  4K7B A;  2CDQ A;  3ESL A;  4OD4 A;  2KCL A;  5AYW D;  3ECS A;  5T1D B;  3MLG A;  3JUI A;  3L17 A;  4EBB A;  3L16 A;  4EWC A;  1FFH A;  4M63 A;  1HH8 A;  4JJF A;  5G55 A;  5F5H A;  3CZ6 A;  2W9Y A;  1IYG A;  3FTZ A;  1JWF A;  2Y3B A;  2PX3 A;  4C3B A;  3PVL A;  4AY6 A;  5T4Y A;  2CHW A;  4UWG A;  3URZ A;  1NA3 A;  2VQ2 A;  5LOZ A;  4LER A;  3ZYK A;  3FUF A;  2LO6 A;  3EH2 A;  5E75 A;  4PDX A;  3T5X A;  3CVV A;  2WMN A;  3CHO A;  4J6I A;  2UWJ G;  3QAR A;  1OWO A;  5T3T A;  5LX8 A;  4L2Y A;  4B6I A;  3EH1 A;  4RBN A;  5HQ8 A;  3ITF A;  4U5C E;  3B13 A;  1MNE A;  4U04 A;  4G0H A;  2I1J A;  1EPU A;  2A6E F;  4IWB A;  2PM7 A;  3QAQ A;  3VAY A;  1UN8 A;  2WZL A;  4AE4 B;  2PZI A;  4GCN A;  3FVY A;  4APF A;  4J8F A;  2VTB A;  4GZ6 A;  4ME2 A;  4G2V A;  3B7T A;  4CRW A;  2FF4 A;  5CCL A;  3W8I A;  2J49 A;  3SF4 A;  3IHY A;  2I8B A;  2WPV A;  3D9I A;  2C0L A;  4HEA J;  2R59 A;  4BJ1 A;  3U64 A;  4YJW A;  4BJ6 C;  3RJV A;  2VB6 A;  2J7P D;  2J9V A;  5JJ7 A;  3FHD A;  4B0Z A;  1E8X A;  3ZHE A;  2WXR A;  3FUK A;  3DM9 B;  5KJL A;  2IU1 A;  3ZPJ A;  4FA6 A;  3SI5 A;  2X38 A;  3LPZ A;  2LSV A;  4XWJ A;  4A3T A;  2HM8 A;  3CVL A;  4RG6 A;  2G3V A;  3FDH A;  1FFT C;  1LS1 A;  1D0Z A;  4XX5 A;  2BE5 F;  2VGX A;  3RK6 A;  3N2Z B;  4U0S A;  5FQ6 A;  4XZ4 A;  3T8M A;  2KJG A;  3UGP A;  4I2Z A;  4CGW A;  3L34 A;  3QC1 A;  2VJ8 A;  5FQ7 A;  2WXM A;  4PJJ A;  3SD5 A;  3N24 A;  4E7S A;  4OD5 A;  2QTV A;  2Q9B A;  3PE3 A;  4JC8 A;  1ZU4 A;  4ZLD A;  3QB2 A;  3AG2 C;  1H19 A;  3NKE A;  3PRE A;  3RRM B;  4CT0 A;  4PJL A;  1DVP A;  1SZI A;  4ULW A;  5D0O D;  3U66 A;  4H7X A;  4GML A;  1TWG A;  4B89 A;  4H4K C;  2OVB A;  2J0W A;  1JUQ A;  2IJG X;  4RD9 A;  4DLO A;  5B3S C;  4PUC A;  3FH7 A;  2R7O A;  3S7J A;  2MYS A;  4N2Q A;  1PAQ A;  3EQL F;  3JQ0 A;  2Y3G A;  4JA9 A;  5T3W A;  1FCH A;  3K1I C;  1MMA A;  4OYS A;  3LJB A;  2WXP A;  5DS4 A;  5E76 A;  2CHX A;  3NG1 A;  3BG1 B;  2HYZ A;  2WXF A;  2O9X A;  3CQG B;  2H7V C;  2VAS A;  3QJZ A;  4N3A A;  2FUL A;  3PEV B;  3F46 A;  1JWG A;  1O5H A;  3QWP A;  3WOD F;  4RSY A;  1BR4 A;  1OKK A;  5DLJ A;  3CVY A;  3DAF A;  3TXM A;  2CNW D;  4O6Y A;  2WXN A;  4YND A;  4IRU A;  2WXH A;  4A1G A;  1E96 B;  2P58 C;  5A6C A;  2HO1 A;  1FTS A;  3JT1 A;  2AWI A;  5FCL A;  3AG1 C;  2Y3A A;  3DD7 A;  3V7O A;  3ZIM A;  3FUN A;  1Z6A A;  3IEG A;  1JPL A;  2C04 A;  3MA5 A;  3HVE B;  4G26 A;  2YZS A;  2E2E A;  2VSX E;  4XKB A;  4LLC A;  2X6F A;  1OCZ C;  3CHM A;  3MYV A;  2G3K A;  1UJK A;  3TGO A;  1ZHW A;  1ZBP A;  5B1B C;  4JJG A;  1LF8 A;  4U8H A;  5DBK A;  4GAA A;  3TJP A;  1EF1 C;  3CVN A;  2WB7 A;  2C0M A;  4KMO A;  5JHB A;  1UN9 A;  4AIF A;  1V54 C;  2M4E A;  3FUI A;  5BPP A;  5LCW C;  1NA0 A;  2E0I A;  4L23 A;  2VSY A;  3Q7G A;  4FC8 A;  3GZ1 A;  4AV7 A;  4EBA G;  2QFC A;  4A1S A;  4ANJ A;  4FP7 A;  2CW0 F;  4C9B B;  5J90 A;  2YNQ A;  4BT8 A;  4DI4 A;  2J46 A;  2XRH A;  3NZU A;  3NYJ A;  4BFR A;  2R7V A;  1ST6 A;  3B0P A;  3EG9 B;  4CS8 A;  1EYH A;  2WXG A;  1E8Z A;  4GZ3 A;  2BTD A;  4NQ0 A;  2G62 A;  4RG9 A;  4RVB A;  2J09 A;  3R7Q A;  1E7V A;  1OKK D;  1FMW A;  5DQT A;  4LLE A;  4KT6 B;  4WWO A;  1M57 C;  3UR3 C;  4CS8 C;  1KU2 A;  3SNX A;  3KAE A;  2WZG A;  3G2T A;  1HX8 A;  2R7Q A;  1INZ A;  5KYY A;  3I5Q A;  2OVF A;  1P5Q A;  4GYW A;  4LCT A;  2XGM A;  3UMK A;  3EFO A;  1WY6 A;  2IQC A;  3FY4 A;  4UQY A;  1ZYR F;  2XXA B;  4FHK A;  2J45 A;  3T6J A;  4J8E A;  5E33 A;  3CVW A;  3UNG C;  3HVE A;  1VK5 A;  2HR2 A;  3D3M A;  3TL5 A;  2EIN C;  2VGY A;  3D9P A;  3KEZ A;  1B89 A;  3PDN A;  3B7U X;  4A3V A;  3I3N A;  3NYL A;  3SYN A;  3RU0 A;  4CGV A;  4AK9 A;  3APD A;  3E70 C;  2EQX A;  4UI9 K;  4AEZ C;  2WQ6 A;  2EIJ C;  4CCA A;  1ZHT A;  4I9E A;  1Y6I A;  4ATG A;  2X6H A;  1XGW A;  3ABM C;  1QNF A;  3ZSU A;  4IAO A;  5LFA A;  4ILH B;  1HG5 A;  3RO3 A;  3MZL B;  4HLE A;  2J07 A;  4J32 B;  4I6J A;  1PD0 A;  3JRT A;  3Q4A B;  5IY5 C;  1MMG A;  1TWA A;  3WG7 C;  4BSX A;  3LS0 A;  1UG3 A;  2NUP B;  3LS8 A;  4PJN A;  5KYX B;  3IHV A;  3MGB A;  5KYN A;  2FO7 A;  1SQM A;  2YHS A;  1H0A A;  4HOQ A;  2FGY A;  5KYW B;  2OND A;  2VSO E;  4KZC A;  2PFD A;  1Z3Y A;  4WWN A;  3I5P A;  3Q5M A;  2W45 A;  2KC7 A;  4OIR F;  2EIL C;  4BTB A;  1IQR A;  5CI9 A;  3EGD B;  3RFY A;  5KYU B;  1KT1 A;  4JVS A;  3L08 A;  3FDQ A;  3ZYM A;  3QWV A;  3AU5 A;  3WXX A;  2Y69 C;  4JEH A;  3ML8 A;  3QNK A;  3CK7 A;  1WGW A;  4C7O A;  4HOT A;  3ASN C;  3JCK C;  1H2V C;  5EGY A;  3UT8 A;  3O39 A;  4DJA A;  1FVH A;  3OEO A;  3E9V A;  2VGX B;  3CST A;  2H7O A;  2AXU A;  2XCB A;  1TEZ A;  4GYY A;  1VDY A;  1ELW A;  3LES A;  4G7H F;  3TAX A;  2QY7 A;  4C7O B;  5FWQ A;  4BY6 A;  2XQ0 A;  4Y6W A;  2M63 A;  2C2L A;  2UY1 A;  3ZEF A;  4F4B A;  3APC A;  2I6H A;  3N71 A;  3X1O A;  1HF8 A;  3NKD A;  3MKQ B;  3U9W A;  3LDZ A;  4Q96 A;  3OXF A;  4ANU A;  4OIO F;  3AS8 A;  4GPK A;  4BJ5 A;  2R17 C;  1S7Z A;  1HZ4 A;  1EDU A;  4OVV A;  3K9I A;  3MX3 A;  3RO2 A;  2EIM C;  3FTX A;  3VLD A;  2VTB B;  4PH4 B;  4G7Z F;  2R7U A;  3AU4 A;  4URK A;  5B1A C;  3HIZ A;  1JPN A;  2KQ9 A;  4D10 C;  3APF A;  5JJ6 A;  3ZFW A;  3HYM B;  5EKQ D;  3FEY A;  3G2W A;  3EPV A;  3VTY A;  2V5F A;  3S7D A;  2WVN A;  2X6J A;  3LAY A;  4C0M A;  4QI0 A;  5FJY A;  3Q6M A;  3C98 A;  4U5G A;  3RH3 A;  3ASG A;  4M3O A;  4IUL A;  4QI2 A;  3FUD A;  3RYL A;  4J0U A;  4WNG A;  4CS9 C;  2A1D D;  4BJ6 A;  2XXA A;  3CVU A;  5ARG A;  3FTU A;  2Y4U A;  4HFF B;  3FP3 A;  3GOD A;  3FTS A;  2L0T B;  4K0D A;  5EX3 A;  4G23 A;  3O6X A;  3FAJ A;  3KS2 A;  3MV3 B;  4TUU A;  3RKV A;  4G25 A;  4FWV A;  4GA2 A;  4HS2 A;  4HOR A;  2KM4 A;  4CDR A;  3L54 A;  2LAH A;  4Q94 A;  3D9J A;  3CHR A;  3QOU A;  4AVX A;  3DXJ F;  3IEE A;  3MV2 B;  4HXI A;  2V3C C;  5G04 J;  3CGH A;  4W8K A;  4AP2 A;  3D9N A;  4P6I C;  3T6B A;  3LNR A;  3UX4 A;  1J8Y F;  3CK9 A;  2NUT B;  2AW6 A;  4WAF A;  2IXO A;  3UGO A;  3NQP A;  1GW6 A;  2WMO A;  4UWH A;  3CV0 A;  4I3M A;  3GZS A;  2NG1 A;  5ANR A;  5D92 A;  3FWV A;  2XPI A;  1LVK A;  3CEQ A;  5FTP A;  3JYS A;  2J9Q A;  3IBE A;  4HFG A;  2V26 A;  4Q69 A;  2EIK C;  1NU9 C;  5JHA A;  2KGO A;  1ELR A;  1TR2 A;  4BTA A;  4YN0 B;  2J9U A;  2WXL A;  1H2T C;  4LAC B;  2FFH A;  3I4R B;  3FUM A;  3L22 A;  5M72 A;  3ZC4 A;  4DBQ A;  5C2Y A;  5E3A A;  4OIN F;  1M2O A;  1NZN A;  3PNT B;  3FUJ A;  4FX5 A;  3FH5 A;  3K1H A;  1KT0 A;  1OWM A;  3BEE A;  2IOL A;  1WM5 A;  1Z3X A;  4G1T A;  2ZPA A;  3P1U A;  2GFH A;  4QFV A;  5BNW A;  2WXJ A;  3AQB A;  2V4L A;  3ONK A;  3MCX A;  2ZXO A;  5A7D B;  3DJN B;  1OWL A;  2WXO A;  2J9W A;  3DJU B;  4WUY A;  3BG0 B;  2GGF A;  4I1O B;  2WVQ A;  2JD3 A;  3ABK C;  4I17 A;  2NUT A;  3JYH A;  1Z23 A;  4BJ5 C;  2MRI A;  3D9L A;  4U5H A;  4F53 A;  2KZT A;  5J08 A;  4PFP A;  4I6G A;  2J4B A;  4LEU A;  5JJT A;  3KH2 A;  4I1M A;  2MWQ A;  1MHQ A;  4L2L A;  3SZR A;  4AXH A;  4K03 A;  3ULQ A;  4L7T A;  4N3C A;  3L13 A;  3KKB A;  1IW7 F;  2Y3D A;  4IN3 B;  1OWP A;  4GZC A;  3ZW3 A;  2YHC A;  3SP1 A;  5CMW A;  2Y3H A;  4J8D A;  3CKB A;  1IHG A;  4PFO A;  4AX2 A;  4N2S A;  4DVZ A;  1HS6 A;  3W8H A;  3PEU B;  5ANL A;  3QK0 A;  4R7L A;  2XCC A;  2V8S E;  2A5U A;  4JA7 A;  2PX0 A;  4FJY A;  4CSA A;  2R7R A;  2MHK A;  1RJ9 B;  4HVB A;  4GZD A;  5F5F A;  4O6M A;  1WAO 1;  2CFZ A;  1ZHX A;  3CVQ A;  2WQ7 A;  4DVY P;  2KW3 C;  2XPZ A;  4LUN U;  4UI9 C;  2XEV A;  2WXQ A;  3LLI A;  4I1A A;  1TJF A;  4EEC A;  4WND A;  3SBT B;  4TRQ A;  3W2V A;  2CHZ A;  3HDX A;  4G11 A;  2IXP A;  1L5J A;  4MKT A;  3ZVV A;  3NRH A;  4O79 A;  2GRM A;  2OV8 A;  3CHQ A;  3OTN A;  4N39 A;  3QZC A;  3RRU A;  2FI7 A;  3PUK A;  4XI0 A;  1W2W A;  3PH0 C;  3K33 A;  1OCR C;  5E2Q A;  4KNV A;  5DIZ A;  4JZY A;  3CQC B;  2A4Z A;  3NZS A;  4GYT A;  4J8S A;  3GYZ A;  5BV1 A;  2XGO A;  4CDM A;  1XNF A;  2W4M A;  1H6K A;  4MQ9 F;  2XRY A;  4JW1 A;  4AM9 A;  4AOF A;  3IV0 A;  2WQH A;  3ZRH A;  4PJM A;  5EDS A;  3CVX A;  5KYX A;  4H7Y A;  4JUR I;  4JCH A;  1O87 A;  3OXG A;  2A6H F;  4W9R A;  3GZ2 A;  3EHN A;  3UMV A;  3ABL C;  3B7R L;  2L9J A;  3O4Z A;  4E85 A;  3ZYL A;  1U3D A;  5E3C A;  4DBR A;  1IQU A;  4HOS A;  4GU5 A;  3W2W A;  4KZ0 A;  2CGE A;  3EZI A;  4GA0 A;  4JXT A;  3EDT B;  3UT7 A;  2L0I A;  4B94 A;  3CR3 A;  4EPZ A;  5KJK A;  3CHP A;  1QZX A;  4XIF A;  3ONL A;  5ENN A;  4B8A A;  2BUG A;  3D9K A;  3EIQ C;  5KJN A;  2NUP A;  2J08 A;  3LCA A;  4FAD A;  5L3Q A;  5FZQ A;  1M2V B;  1NU7 D;  2KCV A;  2A69 F;  2AXV A;  4IJJ A;  3LXU X;  2L9B A;  2ZXP A;  4BJT A;  3LLK A;  1VYK A;  3PMR A;  4J30 B;  2XPY A;  4CIH A;  5G04 C;  1Z63 A;  3IKO B;  3CVP A;  3LS1 A;  5C1D A;  4ABN A;  3JQ1 A;  3AS5 A;  3PE4 A;  3ASF A;  4FLB A;  4KNW A;  4JHR A;  4U5D E;  4JHK A;  1HFA A;  4E6H A;  4U63 A;  5CI8 A;  2QY9 A;  3EGX B;  1D1B A;  4EZL A;  1Y8M A;  3ZYQ A;  1KLX A;  3SEO A;  2R7T A;  3EG9 A;  2RD0 A;  3S0X A;  2WVI A;  3X2Q C;  1HE8 A;  4NRH B;  4DPR A;  3R7R A;  3POV A;  4UWL A;  4JEU A;  1HO8 A;  3AS4 A;  4E7Z A;  3NDB B;  3FTY A;  3PHF 2;  5AEN A;  2KZT B;  2IOS A;  5CCM A;  1A17 A;  3OAW A;  1X5B A;  4BWR A;  2IOQ A;  4N3B A;  4OIQ F;  2XHE A;  1MMN A;  2YHE A;  4I9C A;  4JZA A;  1J8M F;  4AY5 A;  4F1S A;  1D1A A;  4FHJ A;  1PD1 A;  3QWW A;  2VH3 A;  4UWF A;  4GCO A;  2DIW A;  4ACK A;  5BT1 A;  2DYS C;  3F47 A;  2AXZ A;  3DM5 A;  1OCO C;  2Q9A A;  1SZ9 A;  1QLE C;  2W4B A;  1QZ2 A;  4BG0 A;  3KMI A;  2WVO A;  2R7S A;  4ANW A;  3FHE A;  3R9A B;  3Q6N A;  3HLZ A;  3LY7 A;  4MRU A;  3DZA A;  2UY1 B;  4U0Z A;  4KYO B;  4YT4 A;  4GZ5 A;  3DBS A;  3SNH A;  5BUO A;  2YQ8 A;  4WJ0 A;  3LYA A;  3CHS A;  2WL8 A;  2NSZ A;  2P6V A;  3S27 A;  3LEW A;  3DPD A;  5AIJ A;  1BPO A;  2YEV A;  3FU5 A;  3UUX A;  3RIP A;  2R7X A;  1M2V A;  2Q7F A;  3CK8 A;  4X0R A;  3MKR A;  2IXM A;  4HFK B;  1H2U A;  4JHJ A;  3Q7L A;  2CNW A;  3H65 A;  3VLF A;  2PF4 E;  5FT9 A;  4Q5S F;  4XKC A;  4N06 A;  2Q9C A;  1LKX A;  3RIB A;  1HG2 A;  4GMJ A;  5G05 J;  3LVQ E;  5FQ8 A;  4F7A A;  3PUJ A;  4CS9 A;  4U5F E;  1N1C A;  2J0X A;  3CKC A;  2FBN A;  2X3M A;  4YVQ C;  2OOE A;  4PS3 A;  3FFL A;  3UQ3 A;  5HSW A;  2GW1 A;  2XL4 A;  4ILI A;  1RJ9 A;  4XLP F;  3EGD A;  2L6J A;  4KVM A;  5LCW J;  2HV6 A;  2DCP A;  5KYU A;  3LKU A;  1TKN A;  2DYR C;  2WB2 A;  3ZXS A;  3LY9 A;  5KJM A;  1VYI A;  5KYW A;  1SZA A;  2Q3T A;  2KCK A;  4Y6C A;  5FQ4 A;  3AG3 C;  4BX8 A;  4UWK A;  2PQN A;  5DQZ A;  1QQE A;  3U4T A;  4GB9 A;  2JEK A;  4XE0 A;  4P29 A;  2ZXR A;  5CMY A;  1OCC C;  1U3C A;  2ZU6 B;  1PCX A;  3DAG A;  3ESK A;  3EFO B;  1TJC A;  3FTW A;  3OA1 A;  5KYY B;  4ILG A;  3D9M A;  4ANV A;  1UW4 B;  2P7V A;  3U3W A;  4F3V A;  4DI3 A;  3EIJ A;  1MQS A;  4APO A;  3LEV A;  3EGX A;  2VYI A;  3T4R A;  1HXI A;  2DBA A;  2WXI A;  2A68 F;  5D91 A;  4QDL A;  4EQF A;  2X6I A;  2HV7 A;  3CLJ A;  3FU6 A;  1FMV A;  3KD7 A;  4CDN A;  3M1C B;  4HOU A;  5BW8 C;  1PC2 A;  3ASD A;  3GW4 A;  1VMA A;  3PZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...