3WAQA

Hemerythrin-like domain of dcrh i119e mutant (met)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
134
structure length
134
Chain Sequence
b'ADVLVKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHEMKEDKKYEAYLRERGVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemerythrin-like domain protein DcrH
publication title Crystal structure, exogenous ligand binding, and redox properties of an engineered diiron active site in a bacterial hemerythrin
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Metal binding protein
total genus 59
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 3waqA00
2AVKA 4XPYA 3WAQA 3AGTA 4XPXA 1I4YA 4XQ1A 2MHRA 2AWYA 2AWCA 1A7EA 4XPWA 1A7DA 3AGUA 1I4ZA 2HMZA 2HMQA 1HMOA 1HMDA 3WHNA
chains in the Genus database with same CATH superfamily
1OCCC 2HS5A 2XM0A 1OCOC 4XEKA 4H54A 3U2MA 1U0BB 2CCYA 4DRJB 1Z23A 3C8ZA 1SMYF 3US6A 2P0NA 1GQAA 3JZ0A 3LAYA 1LKXA 4WJ0A 5HV9A 1QZXA 1Y4CA 4J7YA 4CS9A 1G4US 2XL6A 3GWLA 2LFDA 4CS8A 4NCQA 1WOLA 4RDAA 4OIRF 3W2VA 3FAPB 3JSZA 4KC9A 1T6QA 3L0IA 5KYXB 2HV7A 2NSFA 3S84A 1Q0MA 4CS9C 3G50A 1NLXA 3B29A 3G4ZA 4W8KA 3CAXA 5COFA 4CS8C 3DD7A 2YQYA 1C03A 3MBGA 1O3UA 1QSPA 3JSEO 4NY3A 5A6BA 2G3VA 3C8GA 2YL1A 1TFOB 5B1AC 4BEMJ 2PP4A 4MS2A 3AJMA 4CIPA 1BR1A 5CIVA 1NFNA 2CW0F 2MHRA 2ZXWC 3SXZA 1LE4A 1Z3IX 1YDIA 2L6GA 2QTVA 2YWAA 1WATA 4NC3A 2PX0A 2R7VA 1BR4A 1MMDA 5CI8A 2NSGA 2OQMA 1G4WR 3CQZA 1FMVA 3Q7GA 2D4UA 1MMGA 1RCPA 4J7TA 4LLCA 2W4MA 3EH2A 4MNDA 3T6JA 3VRCA 1ST6A 4Q5SF 3LJBA 1TWGA 3JRMO 5DLJA 5L0FA 2ZXOA 1QKRA 3EG9B 3NKDA 2IYLD 3EZHA 1TFKB 4GQHA 2H7VC 4YK5A 5A6BD 5JUAA 4N4WA 3C8GD 1WWPA 1NU7D 2QUPA 2WL8A 1NU9C 1O5HA 1SZIA 2KK1A 2FGYA 1S7ZA 1SF8A 3FAJA 2VH3A 3SYNA 2XSEA 1RKCA 3AQBA 1JPNA 2KGOA 2L7AA 2OEXA 3IQTA 3IQ5A 1SYQA 3WAQA 4U9EA 1VOMA 4I1OB 2W45A 2EILC 5FCLA 5JS5A 5KYWB 3RQGA 1LM3B 3DM5A 2NPUA 2HV6A 1T9KA 1R5ID 3W2WA 3UMKA 3IQ6A 3MLGA 2CDQA 2IOQA 4O7GA 3I4UA 1K04A 1KNYA 3RF3A 3S0XA 1JOGA 4B6IA 4ER9A 1JAFA 2AU5A 4G0HA 2Q00A 1O87A 3AG4C 1OXKA 1ZHZA 3RQFA 4WABA 2X51A 3QVYA 4JW1A 4D4XA 3NYJA 4YWQA 3WODF 1HW1A 2CYDA 3OA1A 3X1OA 2R7TA 3HNLA 5A6AA 1TR2A 2P7VA 1RJ9A 3AGTA 3DE9A 2HUJA 4FESA 1VYIA 3JTLO 2Y3GA 1DOVA 1YA9A 3UMIA 3L1MA 1H6GA 2Q9AA 5TJ5E 4MTFA 1OXBA 2PX3A 1R4TA 1T6UA 2RSEB 5AC5A 5L3QA 2I8BA 2R03A 2J9WA 2VC9A 3AGUA 3EFOB 2HJ3A 4O6YA 4QI0A 5DQZA 4EHPA 1FTSA 1WN0A 3C62A 3LESA 4CIHA 3DAGA 2HMZA 4EIYA 5JVEA 3CZ6A 4H4KC 1D0ZA 2Q3TA 4QI2A 4DVZA 1M2VB 3UGPA 2Y3HA 4YN0B 1FFHA 1T01A 1YJGA 1AVOB 4JE9A 1VK5A 1OKKA 2H7BA 4MW8A 3U3BA 4KNWA 4LDQA 3TK0A 3O39A 4DRIB 1QLEC 3FMSA 4NQFA 1OW7A 3TD7A 2XLHA 1H9GA 4IARA 4MTOA 5JP7A 5BQIA 2NUPB 4GYTA 4MTGA 4HFKB 1YZCA 3GM1A 4EBKA 1HY5A 4O79A 3GEEA 3M1CB 2DYSC 3CEXA 1ZZPA 2AWCA 2LFFA 1MMNA 4O6NA 4CJOA 2HZ8A 2KNHA 1LI7A 2OU6A 2YL7A 3ASNC 2GDCA 2KYHA 1JPJA 3ECSA 4Q7CA 5L0CA 1JMWA 4XLNF 5L3VA 2HSBA 5EK0A 1OKKD 3W4YA 4OIOF 2XLEA 2YEVA 3JT1A 4MVQA 3NYMA 2NUTA 5T3TA 3R7CA 4RBNA 2XXAB 4PK4A 3DWWA 4YL3A 4AE4B 5KYXA 3ZVRA 3HKKA 3L8IA 3EGXA 4OIPF 1J8MF 3L8JA 5L0HA 4HFFB 3NKEA 3U9JA 2WZGA 3BRJA 1HW2A 4NTFA 1NZEA 3E70C 3PMRA 1HE9A 1YVIA 1E86A 2XS8A 1M57C 3M4BA 4U5HA 5BUOA 2C04A 2ASRA 1BR2A 1FR0A 1FFTC 2OKUA 4K1OA 1ZHYA 2GWWA 3GORA 4A2NB 3KKBA 2PBEA 3I5QA 4OD4A 1Q0DA 2J7PA 1A7DA 3K1IA 5KYUA 2Y69C 3DMDA 4JURI 2KW3C 1M56C 2EIMC 3ABLC 3JCUQ 3V5ZA 2LCHA 1QQ3A 1Z63A 3TJ6A 4BG0A 4ANJA 3N2ZB 4FX5A 4JC7A 3EQLF 2YKZA 3EPVA 3S27A 4AX2A 3K1IC 5DS4A 3EJNA 4JTDB 3HNIA 3GEHA 3RYLA 2NG1A 3RH3A 1HMDA 4NTAA 4GEHA 3EGDB 1KTMA 2CNWD 1V74B 4EWCA 3U8VA 1AEPA 4C3DA 3U9MA 3RQEA 5COGA 3WHNA 2ZPAA 1I5NA 1V55C 4IWBA 3LLIA 3IQCA 3NMJA 1LI5A 1VB5A 3T9OA 1RMVA 4PJMA 4M63A 2JPUA 2LQGA 2J7PD 2JD3A 4J30B 2WZFA 3KYIA 3U8PA 2Q4FA 3ZDLA 2J45A 3NYLA 1BDJB 3TOLA 5KYYB 5BQHA 5KYWA 1EKYA 1YYXA 3EZIA 1A7VA 1VMAA 4JEAA 2FFHA 4U5FE 5CI9A 4I44A 1G5ZA 2PF4E 4C3BA 3QZCA 1T5OA 5B1BC 5T3WA 4L6RA 5IY5C 2HMQA 5JRAA 1ZHWA 1A41A 1ZU4A 4EKWA 3KYJA 3IPMO 1WGWA 3ZQVA 3KMIA 5B3IA 5A69A 1BZ4A 2OG2A 2YL3A 1ZVZA 3A9CA 2A0UA 3U3FA 2EIJC 2ICWG 3RIPA 2HSQA 3TJ5A 4CBEA 5A6KA 3RFYA 5EHHA 4UDVA 4CSAA 4G7OF 3G4XA 1OCZC 5L0IA 1CGME 3Q6MA 1PV3A 3NG1A 4IAOA 1PD0A 2XLWA 4YT8A 5T1DB 4EBJA 4R32A 2R7SA 2Q9CA 1QPUA 3KH2A 4JKVA 4OIQF 2R7UA 5DQTA 2A6EF 2ZD9A 4CSAC 3HNKA 1ZYRF 3H2UA 5JT4A 2Z15A 3CSKA 5D92A 1I4ZA 2J9BA 3DJNB 3ZG1A 3HJCA 1YLMA 2VB6A 1K40A 1TWHA 4G78A 3VAYA 2WVQA 3FDQA 3C8GB 3BEHA 1UFBA 2KQ9A 3KPHA 4JRZA 2J0WA 3QTHA 2H7OA 3FOPA 4Q4ZF 2Q9BA 2XLVA 1WASA 1D0XA 4U5BE 3WG7C 2IXNA 2EPNA 2J9UA 3DJUB 2BE5F 3M4CA 4AL1A 2YZSA 2GAQA 1YA7O 1T6IA 3T6GB 3B9QA 3V5YA 3VYWA 3UNGC 4C7OA 1NG1A 3SXKA 1RXQA 2A68F 3O10A 5BQGA 4PR9A 1CPQA 1CGOA 3FHDA 1C17M 4Z9JA 1M2OA 4IB4A 3FVYA 1RKEA 3K66A 2X0CA 3GM3A 4N6CA 2YLGA 3W8IA 4BJ5A 3Q6NA 5L0JA 2Y3DA 1LS4A 1VLSA 4XTKA 3S9OA 3ZSUA 1LS1A 1EI7A 1LPEA 2DGJA 2VCAA 3DXJF 3MYIA 4RD9A 1OR3A 3UGOA 4KI2A 1GGQA 1ORJA 3L34A 2G62A 4HEAJ 2A69F 1YAUO 3GEIA 4IAQA 4IJJA 2VCCA 2LSEA 4LLEA 4ONSA 4BJ5C 3POVA 4LDKA 3NMKA 2C03A 3SXMA 3NRHA 4WGZA 4PJJA 4YL1A 2YLDA 3U0CA 2Y39A 3MX3A 3PDMP 2L9JA 4O6MA 4XEFA 1FAPB 3AOUA 2R05A 4JVSA 3QW1A 1KU2A 3E9VA 3Q7LA 4K7BA 2A0BA 1A7EA 1D0YA 2AP3A 3GM2A 1F1MA 1UG7A 2EINC 1VLTA 2EPKX 4KNVA 3H2VA 5DVWA 3X2QC 1GM5A 3B71A 2YVKA 2YLIA 1U6HA 4WGYA 1Q0KA 3MFNA 3B0VC 2YL0A 1RJ9B 2R7RA 3ABMC 2IBFA 1YYJA 2YRFA 2LK4A 4JCHA 1SR2A 1EQ1A 3IHUA 3T6BA 4YT2A 3SNHA 3U2LA 1ZHTA 3JYHA 3LS1A 2BC5A 2AVKA 1JRAA 4XPXA 4BJ6A 1HE1A 2EPOA 3W8HA 1BBHA 4N6HA 5E3CA 1H9TA 2LD6A 4Z9HA 4PACA 3S90A 1Z5ZA 4W8PA 4LERA 5JSLA 2IM8A 3F46A 3S29A 4I3MA 4BEJA 2Y3BA 2WZLA 1VYKA 2GFHA 2R7XA 2IXOA 2O9XA 1PD1A 4BJTA 4E0HA 3RVYA 1ZU5A 2KJGA 2GA0A 3DAFA 3T4RA 1FNTc 1N1CA 2XM4A 5F28E 1M6TA 1GS9A 2JX0A 2OCCC 4EBBA 3DE8A 5JLIA 4E17A 1LE2A 3ZC4A 2V26A 3LUTB 1AUEA 1Z6AA 3EHMA 1D1BA 1ORSC 4IRUA 1YARO 3H65A 2KC3A 5A6JA 3EG9A 4CJGA 1XZPA 3QW0A 2YHSA 1NSGB 3HTKC 2L6HA 2RD9A 3AG3C 4XEVA 4YJWA 3RKOF 3KL4A 1OCRC 5COMA 1APCA 2P6VA 2XL4A 2A6HF 4P9FA 3SZRA 3M79A 4D4NA 2AWYA 4AK9A 1CPRA 4AL0A 3RW0A 2P61A 1TWCA 3K33A 2NUTB 3O55A 1LIHA 4JIOA 3ZTZA 3ASOC 2P1AA 3C18A 2BL2A 3DM9B 2R9RB 5HSWA 3EGXB 1ZHXA 2R02A 3HNJA 2XLDA 3SP1A 2M64A 3S28A 4G7HF 1G8XA 4J32B 1XWJA 5KYNA 1YZAA 4Z9IA 4OINF 3A11A 3I5PA 2MYSA 2R7QA 2A1DD 3N0TA 1OW6A 2XLMA 3K1HA 4PFOA 4JZAA 3ITFA 4YT5A 3ZQYA 3EH1A 4E18A 1XZQA 2R25A 3U5SA 4E7ZA 5KYUB 2Q7RA 2VASA 4XQ1A 1LVKA 3GWNA 2UUHA 2DB4A 3ZIBA 1JR8A 2R7OA 2OJQA 3C7JA 4MVOA 2W9YA 1C02A 2W4BA 3DKAA 4JTCB 2OOCA 5F5HA 1B68A 1MQVA 4EUKB 3DI5A 4JJGA 1E2XA 1H7IA 4U5GA 3LNRA 5DS6A 1U89A 5E3AA 5EGYA 4MQ9F 4DJ9A 4PFPA 3AG1C 4LDRA 3ATPA 2HFIA 4BPMA 3OEOA 2HKVA 4JJFA 1W2WA 2L6FA 1L7CA 3LEVA 256BA 3EFOA 4DBQA 1E84A 2QY9A 1K05A 2H8AA 3GODA 3V5XA 1TKNA 2DYRC 4QDLA 3ZWIA 5B3SC 2J9VA 1EA8A 2LP4A 1J8YF 2IXPA 4CDYA 4XPYA 2OEVA 3VF0A 1M2VA 4JTAB 4E0IA 2XLOA 1E83A 1ZW3A 1I4YA 1E85A 2G3KA 4IGGA 1MNDA 3B0PA 4OD5A 4YT4A 5GPGB 3UR3C 3LNMB 1PCXA 3C63A 3JRTA 4YL0A 3QVZA 5FZTA 2NUPA 1VTMP 1TWAA 2M4EA 3K6BA 4PJLA 4BJ1A 3SEOA 4E7SA 3ABKC 3UMHA 2MWQA 2I15A 1L3PA 1Q0GA 2QE9A 4MVUA 3K7DA 2V3CC 3V7OA 4F4BA 2B0HA 4ULWA 4MW3A 4ZLDA 2IXMA 2HJMA 2FAPB 5E2QA 1NBBA 1S05A 2D5RB 1ZW2A 4DRHB 5DS5A 3MYFA 4DVYP 1TQGA 4XWJA 1Z7Qc 3J06A 4U9DA 3PCVA 2ETSA 2QLAA 4DOZA 4CX9A 4P6IC 2WVOA 2CGEA 2XXAA 3TOMA 4A4AA 3SXYA 4AE4A 3FXHA 3HLZA 3TULA 3M15A 4MVRA 1DOWA 1MMAA 2XS1A 5AGFA 4KBLA 2J8WA 5F5FA 3B0UX 3FOOA 4XPWA 4DXWA 4FWVA 1OQCA 3LLKA 4HE8D 4X0RA 3IEEA 5K0IA 2L81A 4U5EE 5E33A 3ZTMA 4K0DA 1IW7F 4U5DE 1D1AA 2OJED 3NMIA 4PJNA 4C3EA 4FAPB 3AQCA 3EHNA 4JCZA 1OR2A 3PHF2 4C7OB 1WTYA 1OW8A 4MVSA 4JEBA 3F47A 3TQOA 2R7WA 2J0XA 2WVNA 3QMKA 1NFOA 1D1CA 2ZXRA 3AG2C 3DZAA 4CDVA 4XLPF 3NDBB 2E87A 1RKEB 2J46A 1CGNA 1Q0FA 2F22A 3EGDA 4N06A 1V4AA 2XL8A 4ULVA 2XRHA 4ZLCA 2KSFA 4CDAA 1FMWA 3O6XA 2ZXPA 1V54C 3OWTA 4DBRA 3GANA 2UUIA 4I1MA 5L0DA 1IZMA 3RVZA 3VM6A 4BJ6C 3LS0A 2VCBA 4U5CE 3N24A 2LIGA 4G7ZF 2TMVP 1Y6DA 4LACB 3LEOA 2PFDA 1ORYA 5D91A 2DI3A 5KYYA 3JYYA 2WB7A 2B0JA 4NTBA 5L0GA 1HMOA 3R2PA 1MNEA 2EIKC 4MVZA 1QVXA 2PNOA 5AC4A 4MVMA 2QNLA 1A0BA 2EPMX 4P9TA 2CNWA 2EPLX 4CS7A
chains in the Genus database with same CATH topology
2AVKA 4XPYA 3WAQA 3AGTA 4XPXA 1I4YA 4XQ1A 2MHRA 2AWYA 2AWCA 1A7EA 4XPWA 1A7DA 3AGUA 1I4ZA 2HMZA 2HMQA 1HMOA 1HMDA 3WHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AVK A;  4XPY A;  3WAQ A;  3AGT A;  4XPX A;  1I4Y A;  4XQ1 A;  2MHR A;  2AWY A;  2AWC A;  1A7E A;  4XPW A;  1A7D A;  3AGU A;  1I4Z A;  2HMZ A;  2HMQ A;  1HMO A;  1HMD A;  3WHN A; 
#chains in the Genus database with same CATH topology
 1OCC C;  2HS5 A;  2XM0 A;  1OCO C;  4XEK A;  4H54 A;  3U2M A;  1U0B B;  2CCY A;  4DRJ B;  1Z23 A;  3C8Z A;  1SMY F;  3US6 A;  2P0N A;  1GQA A;  3JZ0 A;  3LAY A;  1LKX A;  4WJ0 A;  5HV9 A;  1QZX A;  1Y4C A;  4J7Y A;  4CS9 A;  1G4U S;  2XL6 A;  3GWL A;  2LFD A;  4CS8 A;  4NCQ A;  1WOL A;  4RDA A;  4OIR F;  3W2V A;  3FAP B;  3JSZ A;  4KC9 A;  1T6Q A;  3L0I A;  5KYX B;  2HV7 A;  2NSF A;  3S84 A;  1Q0M A;  4CS9 C;  3G50 A;  1NLX A;  3B29 A;  3G4Z A;  4W8K A;  3CAX A;  5COF A;  4CS8 C;  3DD7 A;  2YQY A;  1C03 A;  3MBG A;  1O3U A;  1QSP A;  3JSE O;  4NY3 A;  5A6B A;  2G3V A;  3C8G A;  2YL1 A;  1TFO B;  5B1A C;  4BEM J;  2PP4 A;  4MS2 A;  3AJM A;  4CIP A;  1BR1 A;  5CIV A;  1NFN A;  2CW0 F;  2MHR A;  2ZXW C;  3SXZ A;  1LE4 A;  1Z3I X;  1YDI A;  2L6G A;  2QTV A;  2YWA A;  1WAT A;  4NC3 A;  2PX0 A;  2R7V A;  1BR4 A;  1MMD A;  5CI8 A;  2NSG A;  2OQM A;  1G4W R;  3CQZ A;  1FMV A;  3Q7G A;  2D4U A;  1MMG A;  1RCP A;  4J7T A;  4LLC A;  2W4M A;  3EH2 A;  4MND A;  3T6J A;  3VRC A;  1ST6 A;  4Q5S F;  3LJB A;  1TWG A;  3JRM O;  5DLJ A;  5L0F A;  2ZXO A;  1QKR A;  3EG9 B;  3NKD A;  2IYL D;  3EZH A;  1TFK B;  4GQH A;  2H7V C;  4YK5 A;  5A6B D;  5JUA A;  4N4W A;  3C8G D;  1WWP A;  1NU7 D;  2QUP A;  2WL8 A;  1NU9 C;  1O5H A;  1SZI A;  2KK1 A;  2FGY A;  1S7Z A;  1SF8 A;  3FAJ A;  2VH3 A;  3SYN A;  2XSE A;  1RKC A;  3AQB A;  1JPN A;  2KGO A;  2L7A A;  2OEX A;  3IQT A;  3IQ5 A;  1SYQ A;  3WAQ A;  4U9E A;  1VOM A;  4I1O B;  2W45 A;  2EIL C;  5FCL A;  5JS5 A;  5KYW B;  3RQG A;  1LM3 B;  3DM5 A;  2NPU A;  2HV6 A;  1T9K A;  1R5I D;  3W2W A;  3UMK A;  3IQ6 A;  3MLG A;  2CDQ A;  2IOQ A;  4O7G A;  3I4U A;  1K04 A;  1KNY A;  3RF3 A;  3S0X A;  1JOG A;  4B6I A;  4ER9 A;  1JAF A;  2AU5 A;  4G0H A;  2Q00 A;  1O87 A;  3AG4 C;  1OXK A;  1ZHZ A;  3RQF A;  4WAB A;  2X51 A;  3QVY A;  4JW1 A;  4D4X A;  3NYJ A;  4YWQ A;  3WOD F;  1HW1 A;  2CYD A;  3OA1 A;  3X1O A;  2R7T A;  3HNL A;  5A6A A;  1TR2 A;  2P7V A;  1RJ9 A;  3AGT A;  3DE9 A;  2HUJ A;  4FES A;  1VYI A;  3JTL O;  2Y3G A;  1DOV A;  1YA9 A;  3UMI A;  3L1M A;  1H6G A;  2Q9A A;  5TJ5 E;  4MTF A;  1OXB A;  2PX3 A;  1R4T A;  1T6U A;  2RSE B;  5AC5 A;  5L3Q A;  2I8B A;  2R03 A;  2J9W A;  2VC9 A;  3AGU A;  3EFO B;  2HJ3 A;  4O6Y A;  4QI0 A;  5DQZ A;  4EHP A;  1FTS A;  1WN0 A;  3C62 A;  3LES A;  4CIH A;  3DAG A;  2HMZ A;  4EIY A;  5JVE A;  3CZ6 A;  4H4K C;  1D0Z A;  2Q3T A;  4QI2 A;  4DVZ A;  1M2V B;  3UGP A;  2Y3H A;  4YN0 B;  1FFH A;  1T01 A;  1YJG A;  1AVO B;  4JE9 A;  1VK5 A;  1OKK A;  2H7B A;  4MW8 A;  3U3B A;  4KNW A;  4LDQ A;  3TK0 A;  3O39 A;  4DRI B;  1QLE C;  3FMS A;  4NQF A;  1OW7 A;  3TD7 A;  2XLH A;  1H9G A;  4IAR A;  4MTO A;  5JP7 A;  5BQI A;  2NUP B;  4GYT A;  4MTG A;  4HFK B;  1YZC A;  3GM1 A;  4EBK A;  1HY5 A;  4O79 A;  3GEE A;  3M1C B;  2DYS C;  3CEX A;  1ZZP A;  2AWC A;  2LFF A;  1MMN A;  4O6N A;  4CJO A;  2HZ8 A;  2KNH A;  1LI7 A;  2OU6 A;  2YL7 A;  3ASN C;  2GDC A;  2KYH A;  1JPJ A;  3ECS A;  4Q7C A;  5L0C A;  1JMW A;  4XLN F;  5L3V A;  2HSB A;  5EK0 A;  1OKK D;  3W4Y A;  4OIO F;  2XLE A;  2YEV A;  3JT1 A;  4MVQ A;  3NYM A;  2NUT A;  5T3T A;  3R7C A;  4RBN A;  2XXA B;  4PK4 A;  3DWW A;  4YL3 A;  4AE4 B;  5KYX A;  3ZVR A;  3HKK A;  3L8I A;  3EGX A;  4OIP F;  1J8M F;  3L8J A;  5L0H A;  4HFF B;  3NKE A;  3U9J A;  2WZG A;  3BRJ A;  1HW2 A;  4NTF A;  1NZE A;  3E70 C;  3PMR A;  1HE9 A;  1YVI A;  1E86 A;  2XS8 A;  1M57 C;  3M4B A;  4U5H A;  5BUO A;  2C04 A;  2ASR A;  1BR2 A;  1FR0 A;  1FFT C;  2OKU A;  4K1O A;  1ZHY A;  2GWW A;  3GOR A;  4A2N B;  3KKB A;  2PBE A;  3I5Q A;  4OD4 A;  1Q0D A;  2J7P A;  1A7D A;  3K1I A;  5KYU A;  2Y69 C;  3DMD A;  4JUR I;  2KW3 C;  1M56 C;  2EIM C;  3ABL C;  3JCU Q;  3V5Z A;  2LCH A;  1QQ3 A;  1Z63 A;  3TJ6 A;  4BG0 A;  4ANJ A;  3N2Z B;  4FX5 A;  4JC7 A;  3EQL F;  2YKZ A;  3EPV A;  3S27 A;  4AX2 A;  3K1I C;  5DS4 A;  3EJN A;  4JTD B;  3HNI A;  3GEH A;  3RYL A;  2NG1 A;  3RH3 A;  1HMD A;  4NTA A;  4GEH A;  3EGD B;  1KTM A;  2CNW D;  1V74 B;  4EWC A;  3U8V A;  1AEP A;  4C3D A;  3U9M A;  3RQE A;  5COG A;  3WHN A;  2ZPA A;  1I5N A;  1V55 C;  4IWB A;  3LLI A;  3IQC A;  3NMJ A;  1LI5 A;  1VB5 A;  3T9O A;  1RMV A;  4PJM A;  4M63 A;  2JPU A;  2LQG A;  2J7P D;  2JD3 A;  4J30 B;  2WZF A;  3KYI A;  3U8P A;  2Q4F A;  3ZDL A;  2J45 A;  3NYL A;  1BDJ B;  3TOL A;  5KYY B;  5BQH A;  5KYW A;  1EKY A;  1YYX A;  3EZI A;  1A7V A;  1VMA A;  4JEA A;  2FFH A;  4U5F E;  5CI9 A;  4I44 A;  1G5Z A;  2PF4 E;  4C3B A;  3QZC A;  1T5O A;  5B1B C;  5T3W A;  4L6R A;  5IY5 C;  2HMQ A;  5JRA A;  1ZHW A;  1A41 A;  1ZU4 A;  4EKW A;  3KYJ A;  3IPM O;  1WGW A;  3ZQV A;  3KMI A;  5B3I A;  5A69 A;  1BZ4 A;  2OG2 A;  2YL3 A;  1ZVZ A;  3A9C A;  2A0U A;  3U3F A;  2EIJ C;  2ICW G;  3RIP A;  2HSQ A;  3TJ5 A;  4CBE A;  5A6K A;  3RFY A;  5EHH A;  4UDV A;  4CSA A;  4G7O F;  3G4X A;  1OCZ C;  5L0I A;  1CGM E;  3Q6M A;  1PV3 A;  3NG1 A;  4IAO A;  1PD0 A;  2XLW A;  4YT8 A;  5T1D B;  4EBJ A;  4R32 A;  2R7S A;  2Q9C A;  1QPU A;  3KH2 A;  4JKV A;  4OIQ F;  2R7U A;  5DQT A;  2A6E F;  2ZD9 A;  4CSA C;  3HNK A;  1ZYR F;  3H2U A;  5JT4 A;  2Z15 A;  3CSK A;  5D92 A;  1I4Z A;  2J9B A;  3DJN B;  3ZG1 A;  3HJC A;  1YLM A;  2VB6 A;  1K40 A;  1TWH A;  4G78 A;  3VAY A;  2WVQ A;  3FDQ A;  3C8G B;  3BEH A;  1UFB A;  2KQ9 A;  3KPH A;  4JRZ A;  2J0W A;  3QTH A;  2H7O A;  3FOP A;  4Q4Z F;  2Q9B A;  2XLV A;  1WAS A;  1D0X A;  4U5B E;  3WG7 C;  2IXN A;  2EPN A;  2J9U A;  3DJU B;  2BE5 F;  3M4C A;  4AL1 A;  2YZS A;  2GAQ A;  1YA7 O;  1T6I A;  3T6G B;  3B9Q A;  3V5Y A;  3VYW A;  3UNG C;  4C7O A;  1NG1 A;  3SXK A;  1RXQ A;  2A68 F;  3O10 A;  5BQG A;  4PR9 A;  1CPQ A;  1CGO A;  3FHD A;  1C17 M;  4Z9J A;  1M2O A;  4IB4 A;  3FVY A;  1RKE A;  3K66 A;  2X0C A;  3GM3 A;  4N6C A;  2YLG A;  3W8I A;  4BJ5 A;  3Q6N A;  5L0J A;  2Y3D A;  1LS4 A;  1VLS A;  4XTK A;  3S9O A;  3ZSU A;  1LS1 A;  1EI7 A;  1LPE A;  2DGJ A;  2VCA A;  3DXJ F;  3MYI A;  4RD9 A;  1OR3 A;  3UGO A;  4KI2 A;  1GGQ A;  1ORJ A;  3L34 A;  2G62 A;  4HEA J;  2A69 F;  1YAU O;  3GEI A;  4IAQ A;  4IJJ A;  2VCC A;  2LSE A;  4LLE A;  4ONS A;  4BJ5 C;  3POV A;  4LDK A;  3NMK A;  2C03 A;  3SXM A;  3NRH A;  4WGZ A;  4PJJ A;  4YL1 A;  2YLD A;  3U0C A;  2Y39 A;  3MX3 A;  3PDM P;  2L9J A;  4O6M A;  4XEF A;  1FAP B;  3AOU A;  2R05 A;  4JVS A;  3QW1 A;  1KU2 A;  3E9V A;  3Q7L A;  4K7B A;  2A0B A;  1A7E A;  1D0Y A;  2AP3 A;  3GM2 A;  1F1M A;  1UG7 A;  2EIN C;  1VLT A;  2EPK X;  4KNV A;  3H2V A;  5DVW A;  3X2Q C;  1GM5 A;  3B71 A;  2YVK A;  2YLI A;  1U6H A;  4WGY A;  1Q0K A;  3MFN A;  3B0V C;  2YL0 A;  1RJ9 B;  2R7R A;  3ABM C;  2IBF A;  1YYJ A;  2YRF A;  2LK4 A;  4JCH A;  1SR2 A;  1EQ1 A;  3IHU A;  3T6B A;  4YT2 A;  3SNH A;  3U2L A;  1ZHT A;  3JYH A;  3LS1 A;  2BC5 A;  2AVK A;  1JRA A;  4XPX A;  4BJ6 A;  1HE1 A;  2EPO A;  3W8H A;  1BBH A;  4N6H A;  5E3C A;  1H9T A;  2LD6 A;  4Z9H A;  4PAC A;  3S90 A;  1Z5Z A;  4W8P A;  4LER A;  5JSL A;  2IM8 A;  3F46 A;  3S29 A;  4I3M A;  4BEJ A;  2Y3B A;  2WZL A;  1VYK A;  2GFH A;  2R7X A;  2IXO A;  2O9X A;  1PD1 A;  4BJT A;  4E0H A;  3RVY A;  1ZU5 A;  2KJG A;  2GA0 A;  3DAF A;  3T4R A;  1FNT c;  1N1C A;  2XM4 A;  5F28 E;  1M6T A;  1GS9 A;  2JX0 A;  2OCC C;  4EBB A;  3DE8 A;  5JLI A;  4E17 A;  1LE2 A;  3ZC4 A;  2V26 A;  3LUT B;  1AUE A;  1Z6A A;  3EHM A;  1D1B A;  1ORS C;  4IRU A;  1YAR O;  3H65 A;  2KC3 A;  5A6J A;  3EG9 A;  4CJG A;  1XZP A;  3QW0 A;  2YHS A;  1NSG B;  3HTK C;  2L6H A;  2RD9 A;  3AG3 C;  4XEV A;  4YJW A;  3RKO F;  3KL4 A;  1OCR C;  5COM A;  1APC A;  2P6V A;  2XL4 A;  2A6H F;  4P9F A;  3SZR A;  3M79 A;  4D4N A;  2AWY A;  4AK9 A;  1CPR A;  4AL0 A;  3RW0 A;  2P61 A;  1TWC A;  3K33 A;  2NUT B;  3O55 A;  1LIH A;  4JIO A;  3ZTZ A;  3ASO C;  2P1A A;  3C18 A;  2BL2 A;  3DM9 B;  2R9R B;  5HSW A;  3EGX B;  1ZHX A;  2R02 A;  3HNJ A;  2XLD A;  3SP1 A;  2M64 A;  3S28 A;  4G7H F;  1G8X A;  4J32 B;  1XWJ A;  5KYN A;  1YZA A;  4Z9I A;  4OIN F;  3A11 A;  3I5P A;  2MYS A;  2R7Q A;  2A1D D;  3N0T A;  1OW6 A;  2XLM A;  3K1H A;  4PFO A;  4JZA A;  3ITF A;  4YT5 A;  3ZQY A;  3EH1 A;  4E18 A;  1XZQ A;  2R25 A;  3U5S A;  4E7Z A;  5KYU B;  2Q7R A;  2VAS A;  4XQ1 A;  1LVK A;  3GWN A;  2UUH A;  2DB4 A;  3ZIB A;  1JR8 A;  2R7O A;  2OJQ A;  3C7J A;  4MVO A;  2W9Y A;  1C02 A;  2W4B A;  3DKA A;  4JTC B;  2OOC A;  5F5H A;  1B68 A;  1MQV A;  4EUK B;  3DI5 A;  4JJG A;  1E2X A;  1H7I A;  4U5G A;  3LNR A;  5DS6 A;  1U89 A;  5E3A A;  5EGY A;  4MQ9 F;  4DJ9 A;  4PFP A;  3AG1 C;  4LDR A;  3ATP A;  2HFI A;  4BPM A;  3OEO A;  2HKV A;  4JJF A;  1W2W A;  2L6F A;  1L7C A;  3LEV A;  256B A;  3EFO A;  4DBQ A;  1E84 A;  2QY9 A;  1K05 A;  2H8A A;  3GOD A;  3V5X A;  1TKN A;  2DYR C;  4QDL A;  3ZWI A;  5B3S C;  2J9V A;  1EA8 A;  2LP4 A;  1J8Y F;  2IXP A;  4CDY A;  4XPY A;  2OEV A;  3VF0 A;  1M2V A;  4JTA B;  4E0I A;  2XLO A;  1E83 A;  1ZW3 A;  1I4Y A;  1E85 A;  2G3K A;  4IGG A;  1MND A;  3B0P A;  4OD5 A;  4YT4 A;  5GPG B;  3UR3 C;  3LNM B;  1PCX A;  3C63 A;  3JRT A;  4YL0 A;  3QVZ A;  5FZT A;  2NUP A;  1VTM P;  1TWA A;  2M4E A;  3K6B A;  4PJL A;  4BJ1 A;  3SEO A;  4E7S A;  3ABK C;  3UMH A;  2MWQ A;  2I15 A;  1L3P A;  1Q0G A;  2QE9 A;  4MVU A;  3K7D A;  2V3C C;  3V7O A;  4F4B A;  2B0H A;  4ULW A;  4MW3 A;  4ZLD A;  2IXM A;  2HJM A;  2FAP B;  5E2Q A;  1NBB A;  1S05 A;  2D5R B;  1ZW2 A;  4DRH B;  5DS5 A;  3MYF A;  4DVY P;  1TQG A;  4XWJ A;  1Z7Q c;  3J06 A;  4U9D A;  3PCV A;  2ETS A;  2QLA A;  4DOZ A;  4CX9 A;  4P6I C;  2WVO A;  2CGE A;  2XXA A;  3TOM A;  4A4A A;  3SXY A;  4AE4 A;  3FXH A;  3HLZ A;  3TUL A;  3M15 A;  4MVR A;  1DOW A;  1MMA A;  2XS1 A;  5AGF A;  4KBL A;  2J8W A;  5F5F A;  3B0U X;  3FOO A;  4XPW A;  4DXW A;  4FWV A;  1OQC A;  3LLK A;  4HE8 D;  4X0R A;  3IEE A;  5K0I A;  2L81 A;  4U5E E;  5E33 A;  3ZTM A;  4K0D A;  1IW7 F;  4U5D E;  1D1A A;  2OJE D;  3NMI A;  4PJN A;  4C3E A;  4FAP B;  3AQC A;  3EHN A;  4JCZ A;  1OR2 A;  3PHF 2;  4C7O B;  1WTY A;  1OW8 A;  4MVS A;  4JEB A;  3F47 A;  3TQO A;  2R7W A;  2J0X A;  2WVN A;  3QMK A;  1NFO A;  1D1C A;  2ZXR A;  3AG2 C;  3DZA A;  4CDV A;  4XLP F;  3NDB B;  2E87 A;  1RKE B;  2J46 A;  1CGN A;  1Q0F A;  2F22 A;  3EGD A;  4N06 A;  1V4A A;  2XL8 A;  4ULV A;  2XRH A;  4ZLC A;  2KSF A;  4CDA A;  1FMW A;  3O6X A;  2ZXP A;  1V54 C;  3OWT A;  4DBR A;  3GAN A;  2UUI A;  4I1M A;  5L0D A;  1IZM A;  3RVZ A;  3VM6 A;  4BJ6 C;  3LS0 A;  2VCB A;  4U5C E;  3N24 A;  2LIG A;  4G7Z F;  2TMV P;  1Y6D A;  4LAC B;  3LEO A;  2PFD A;  1ORY A;  5D91 A;  2DI3 A;  5KYY A;  3JYY A;  2WB7 A;  2B0J A;  4NTB A;  5L0G A;  1HMO A;  3R2P A;  1MNE A;  2EIK C;  4MVZ A;  1QVX A;  2PNO A;  5AC4 A;  4MVM A;  2QNL A;  1A0B A;  2EPM X;  4P9T A;  2CNW A;  2EPL X;  4CS7 A; 
#chains in the Genus database with same CATH homology
 2AVK A;  4XPY A;  3WAQ A;  3AGT A;  4XPX A;  1I4Y A;  4XQ1 A;  2MHR A;  2AWY A;  2AWC A;  1A7E A;  4XPW A;  1A7D A;  3AGU A;  1I4Z A;  2HMZ A;  2HMQ A;  1HMO A;  1HMD A;  3WHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...