3WAQA

Hemerythrin-like domain of dcrh i119e mutant (met)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
134
structure length
134
Chain Sequence
ADVLVKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHEMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Hemerythrin-like domain protein DcrH
publication title Crystal structure, exogenous ligand binding, and redox properties of an engineered diiron active site in a bacterial hemerythrin
pubmed doi rcsb
source organism Desulfovibrio vulgaris
total genus 59
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 3waqA00
4XPXA 3WAQA 1A7EA 1HMDA 1I4YA 2AVKA 2HMZA 2HMQA 3AGUA 2MHRA 1HMOA 3WHNA 1A7DA 2AWCA 3AGTA 4XQ1A 4XPWA 4XPYA 2AWYA 1I4ZA
chains in the Genus database with same CATH superfamily
1Q0GA 1N1CA 4JEBA 3RW0A 1M6TA 4DRIB 4YN0B 4FAPB 2YL0A 2R25A 1TR2A 2R7WA 2HFIA 1IZMA 4JTCB 1CGNA 4KNWA 1JR8A 5CI8A 3SXYA 3IHUA 4GQHA 3WG7C 3RQFA 5KYUA 1Z63A 1ZW2A 1VK5A 3U3BA 3WHNA 2E87A 4KI2A 4NY3A 4E0IA 1RMVA 2MYSA 1MMNA 4KBLA 1OXBA 3K6BA 2R7RA 4CX9A 4JCHA 3ZG1A 2GFHA 3NDBB 4GYTA 1BR1A 3UMHA 2QNLA 2XM4A 3ZDLA 1BZ4A 3L0IA 2J7PA 3X2QC 1NG1A 4IARA 4C7OA 4CS9A 2C03A 5JRAA 3H2UA 3AG4C 4A2NB 3C8GA 3O6XA 3F46A 5BQGA 3TJ5A 1Z6AA 4C3EA 4F4BA 1Y4CA 1TWHA 2X51A 4OD5A 4Z9HA 4BJ6C 1SMYF 4MW8A 4YT2A 2HSQA 4C3DA 3K1IC 3LAYA 4R32A 2OJQA 3QVYA 3JZ0A 4DVYP 2RD9A 4I1OB 4JTAB 4P9TA 4K0DA 1NZEA 3AG2C 2XM0A 1A7DA 4G7OF 3FDQA 2OCCC 3VAYA 3NRHA 5B3SC 2Y39A 4G0HA 2GA0A 4MTFA 2Q9CA 2WVOA 3KH2A 1ST6A 4YL1A 5JS5A 3SXKA 4JW1A 3W8HA 2ZD9A 4U9EA 1YJGA 4JVSA 4BG0A 2PP4A 3EGDB 4BJTA 2YLIA 3LJBA 4WJ0A 4E17A 1RKEB 3KL4A 2A68F 1EQ1A 2OG2A 3VRCA 4N6HA 3ZVRA 5BUOA 3FAPB 2W4BA 4ULVA 3G50A 3CAXA 4N6CA 1L3PA 1QVXA 1A7EA 5L0DA 4E7SA 4G7ZF 1MMDA 1A0BA 4AL1A 4J7TA 4AK9A 2L7AA 3CZ6A 4CBEA 4N4WA 4JJGA 1FMWA 3RYLA 1WASA 2DYSC 3B29A 1LS1A 4OIRF 5KYNA 1BBHA 1ZU4A 3GEHA 3NKDA 3SEOA 3AQBA 3EH1A 3TK0A 3UR3C 1MQVA 2C04A 2J9UA 2QTVA 3EFOA 2Q7RA 3ZWIA 5HV9A 3QZCA 4U9DA 5L0IA 4Q7CA 1Z23A 4I44A 4O6MA 1T6UA 4BPMA 1FMVA 3U8PA 2PX3A 4JZAA 2L9JA 5KYYA 1BR4A 1GGQA 2YL1A 1D1AA 3NMIA 3C62A 3MFNA 2W45A 5JVEA 3UGPA 3GEIA 4JEAA 2H7VC 3C7JA 1JPNA 4BJ6A 1QLEC 2XL4A 1YVIA 2NUPB 1VB5A 1MNDA 3HJCA 1G8XA 3K1IA 3U9JA 2AVKA 1T6QA 2HMQA 2YLDA 4PFOA 5AGFA 3QW0A 5D91A 3UMIA 1EKYA 2CNWA 3EGXB 2MHRA 2A69F 4HFFB 3TQOA 4Q4ZF 2PBEA 4LDRA 3CEXA 4DBQA 2V3CC 2R7QA 1Q0KA 1V55C 3ZQVA 4RDAA 4DJ9A 3RFYA 1AEPA 3ZQYA 3NG1A 5B1BC 4UDVA 5CI9A 3C63A 3J06A 3AQCA 1K05A 1MNEA 3PMRA 3EZIA 4XLPF 5KYUB 1C17M 1LPEA 1E84A 2ZXRA 2XLOA 3SP1A 4CDAA 1LIHA 4CJOA 1LI5A 2CW0F 1BDJB 1SZIA 1E86A 1PV3A 4YWQA 4P6IC 4MVSA 4K1OA 1ZYRF 4WABA 1R5ID 2G3VA 1O87A 2EIKC 2NSGA 2XSEA 1RXQA 1XZQA 3JRMO 3K33A 4CIHA 4QI0A 2A1DD 2KC3A 1D1CA 3JRTA 1Q0MA 4IB4A 3FMSA 2YZSA 3SXMA 3C8GB 1K04A 1KNYA 2KGOA 1YLMA 1K40A 2WZLA 4JKVA 1WGWA 5BQHA 2XXAA 2JX0A 4PFPA 4U5EE 5DQZA 4X0RA 4Z9JA 2B0HA 5HSWA 2Y3GA 4MVRA 3GEEA 4J30B 1KTMA 2D4UA 2FGYA 1XWJA 4AE4A 1ZHXA 2R7UA 4DOZA 3H2VA 1JOGA 1NU9C 1WTYA 2H7BA 1TFOB 1Z7Qc 4Q5SF 4D4XA 4EIYA 3O39A 4ZLCA 4OIPF 1EA8A 3M4BA 3EJNA 1TKNA 4JIOA 2DB4A 5KYXB 1Q0FA 1TWGA 3T6GB 2YKZA 3W8IA 4YT4A 3TULA 3T6BA 3EG9B 1AUEA 2ETSA 1HW2A 2GAQA 4CSAC 4JC7A 1Y6DA 1R4TA 3JSZA 4LDKA 2DI3A 4JRZA 2BE5F 2L6HA 3V5ZA 3AGTA 1ZHTA 2GWWA 2HJMA 4JCZA 1QKRA 3K7DA 4YL3A 1LS4A 2IOQA 4O7GA 5AC5A 1H7IA 4XTKA 2OJED 3CSKA 2XLMA 3A9CA 1OW6A 4EWCA 1QSPA 2EINC 1A7VA 4IAOA 5E2QA 3N24A 3DE8A 3FHDA 2J9BA 4XPXA 2Z15A 2OQMA 1LVKA 2YEVA 3WAQA 2A0BA 2A0UA 4P9FA 1HW1A 4L6RA 2YHSA 3S28A 4BJ5A 4LDQA 2HMZA 2XLHA 2R9RB 3DKAA 5AC4A 5IY5C 2P61A 2VH3A 1OKKD 1HMOA 3JCUQ 5KYYB 3QVZA 1D0XA 3U2LA 1ZHWA 2L81A 3U8VA 5L0CA 3WODF 3U5SA 1ZU5A 1VYIA 3M4CA 1T01A 5D92A 1E85A 3FAJA 3US6A 1U0BB 3SYNA 2R7TA 1VOMA 3DZAA 4IAQA 2YRFA 4MTOA 2IXNA 3L1MA 3DJNB 1YARO 2PX0A 2XLVA 3KYIA 1I5NA 2XLDA 3MYFA 1V54C 4MW3A 4MTGA 1M57C 3A11A 1NFNA 3R2PA 4B6IA 1OW8A 1HE9A 3PDMP 1RJ9A 2IYLD 3M79A 4PR9A 2CCYA 3ZC4A 1ZHYA 5F5HA 5A69A 2I15A 3DWWA 2NSFA 1VTMP 2LCHA 2WB7A 5E3AA 2YL3A 1LE4A 3Q6NA 2Q3TA 4PK4A 2LK4A 2JD3A 4CSAA 2Y3HA 1S05A 2UUIA 4RD9A 4HFKB 3EHNA 2XRHA 3N2ZB 3RVZA 1T5OA 1EI7A 4PJLA 2MWQA 3MX3A 1NU7D 4LLCA 4NTFA 4O79A 2R7VA 4H4KC 4MVMA 5F28E 3BRJA 2I8BA 4A4AA 4U5CE 5BQIA 1YAUO 5T3TA 5L3QA 2R7SA 4PACA 3ITFA 2ZPAA 2OEVA 2AWYA 2B0JA 1JRAA 3S84A 2EIMC 1D0YA 4E0HA 1ZW3A 3VYWA 3NYLA 4LERA 3GM1A 4U5GA 2Q00A 3HNLA 4LACB 4IGGA 1ORSC 3PCVA 4QDLA 3T4RA 3ZIBA 3B0VC 2R05A 2Y69C 3K66A 1M2VA 3GODA 4XEVA 1LKXA 2P7VA 4EBKA 3AGUA 4DRHB 3DM9B 4NC3A 2YLGA 3SNHA 1U6HA 2WVNA 1D1BA 4H54A 4Z9IA 2G3KA 3RKOF 1MMGA 2FAPB 1XZPA 3KMIA 3EZHA 1M2OA 1W2WA 2VASA 5TJ5E 4AE4B 256BA 4CJGA 4FX5A 2P6VA 2WZFA 1OCRC 2H7OA 3KKBA 3EH2A 3GORA 4JURI 2J0WA 1YZCA 2VCBA 4ONSA 3T6JA 1CGME 4J7YA 3LLKA 4PJJA 3KPHA 1AVOB 4YT5A 5EK0A 2VB6A 5CIVA 3ATPA 2XL6A 2OU6A 4IJJA 1OCOC 3HTKC 2RSEB 4MVOA 3GM2A 1LI7A 3C18A 3CQZA 5E33A 2BL2A 2HKVA 2PFDA 3GWLA 2EIJC 3V5XA 5JLIA 2ASRA 2YQYA 1JMWA 3E9VA 4BJ5C 3B71A 5KYWA 1FAPB 1LM3B 2CGEA 2PNOA 4U5HA 4C7OB 1APCA 3DMDA 4KNVA 2J9WA 2Y3BA 1H9GA 1VYKA 2Q9BA 2AWCA 4M63A 1YZAA 3KYJA 5T3WA 2R7XA 2KNHA 3B0UX 3K1HA 1IW7F 1G4WR 4EUKB 4MNDA 3IPMO 4CS7A 2EPNA 4OIOF 2EPLX 2F22A 3PHF2 1S7ZA 3IEEA 4MVQA 4O6NA 4PJMA 4U5DE 3V5YA 2LSEA 3DAGA 3ZSUA 1FR0A 3FVYA 2UUHA 5A6BD 4YK5A 2IXPA 2A6HF 1QPUA 3IQ6A 1HY5A 3GANA 3TJ6A 1OXKA 1J8YF 3E70C 4ZLDA 5COFA 2BC5A 4EHPA 4CDYA 3MYIA 2HUJA 1FFTC 3RQGA 2XS8A 3FXHA 5F5FA 3UMKA 3IQCA 1UG7A 4MQ9F 3DJUB 4ULWA 3ASNC 3S90A 2NUPA 3HNJA 1YYXA 2VCCA 2YWAA 4GEHA 4U5FE 3VF0A 1RJ9B 1SYQA 4XPWA 4FWVA 2ZXWC 2LFDA 1NBBA 1PD1A 5L0FA 2V26A 2LFFA 1MMAA 1I4ZA 5A6KA 2ICWG 1GQAA 1KU2A 1GS9A 3DD7A 2NUTA 4AX2A 1JPJA 2QE9A 2W4MA 2VCAA 3S9OA 2TMVP 3LLIA 4AL0A 1TFKB 3EFOB 3MBGA 4KC9A 1HMDA 4JTDB 1A41A 3DI5A 2QLAA 1I4YA 4W8KA 3S29A 3LNMB 2WL8A 1SR2A 3QMKA 1OR2A 5JSLA 2GDCA 2OKUA 1YA9A 2OEXA 3NMJA 4IRUA 2DYRC 1C02A 1OW7A 2QY9A 2R7OA 3HNIA 2NG1A 2QUPA 4E7ZA 2J7PD 3M15A 2J9VA 1OKKA 4DRJB 1F1MA 1OCCC 3Q7GA 3B0PA 5COMA 1QQ3A 1ZVZA 2AU5A 3RIPA 1M2VB 1ZHZA 3C8GD 3NMKA 1OQCA 3ECSA 5L3VA 1CPQA 5DQTA 1ORJA 2M4EA 1NLXA 4W8PA 3TD7A 4NTBA 3G4XA 1CPRA 1D0ZA 2HZ8A 2KW3C 3JSEO 2XLEA 3LS1A 3W4YA 3GM3A 3L34A 4XWJA 5B3IA 1T6IA 1TWCA 1M56C 3B9QA 4CS8A 2R03A 5DS4A 4JE9A 1ORYA 2LP4A 3FOPA 3HNKA 3ABMC 1TQGA 4ANJA 1T9KA 3AG1C 3X1OA 3HKKA 2X0CA 4DBRA 5L0GA 1RKCA 3FOOA 1RCPA 5L0JA 2HJ3A 2XLWA 3NYMA 1Z3IX 1FTSA 2KK1A 4FESA 4N06A 5JT4A 2LIGA 5EGYA 5DLJA 1UFBA 1VLSA 1YA7O 1ZZPA 2R02A 3VM6A 2CYDA 2J0XA 3JTLO 4LLEA 4XQ1A 3S27A 5EHHA 2G62A 5KYXA 2HSBA 3AG3C 3GWNA 3L8JA 5K0IA 4I3MA 1BR2A 5E3CA 3DE9A 5FZTA 3LEVA 2AP3A 3F47A 4DVZA 1WOLA 3EG9A 4C3BA 1OR3A 2IBFA 4YT8A 1QZXA 5B1AC 5KYWB 3O10A 2XS1A 4QI2A 2YL7A 1U89A 3DAFA 4OINF 2IXOA 3TOLA 1YYJA 3MLGA 3EHMA 3H65A 4O6YA 1PD0A 3M1CB 4EBBA 3Q7LA 4G7HF 1H6GA 1B68A 2EPKX 1VMAA 2XXAB 4OIQF 4G78A 3N0TA 4JJFA 1E2XA 5A6AA 4XEKA 4ER9A 3JYHA 3OWTA 4RBNA 2KJGA 3V7OA 4MVZA 1WWPA 3AOUA 2J46A 2WZGA 3OA1A 4BEMJ 2Q4FA 3ZTZA 2YVKA 4CIPA 3Q6MA 2WVQA 3S0XA 2EILC 2L6GA 2XL8A 4WGZA 3DM5A 4CDVA 3I4UA 3U0CA 3ASOC 2J45A 4IWBA 4J32B 3G4ZA 3UNGC 4PJNA 2JPUA 3NKEA 3RF3A 2NPUA 1WATA 1V74B 3W2WA 4EBJA 1VLTA 3AJMA 3BEHA 1O5HA 1NFOA 2LQGA 2W9YA 4NCQA 4OD4A 5DVWA 3R7CA 3U9MA 2L6FA 4BEJA 5JUAA 4K7BA 5A6JA 1PCXA 3O55A 2O9XA 2DGJA 2CNWD 3LESA 4MS2A 4U5BE 2LD6A 1V4AA 1DOWA 1GM5A 3IQTA 1FNTc 4DXWA 4I1MA 3C8ZA 4EKWA 2D5RB 3EGDA 2FFHA 1RKEA 3QTHA 4YL0A 3RQEA 2M64A 5L0HA 5T1DB 2KYHA 1E83A 2VC9A 4XEFA 4MVUA 2P1AA 3DXJF 2NUTB 1HE1A 5JP7A 1OCZC 1H9TA 1O3UA 4WGYA 3QW1A 3ABKC 5DS6A 3I5PA 2P0NA 2ZXOA 4XPYA 4NTAA 1JAFA 2ZXPA 3NYJA 4CS9C 1NSGB 2H8AA 2IXMA 4HE8D 3L8IA 1LE2A 1DOVA 2IM8A 2Y3DA 1TWAA 4E18A 3ZTMA 4YJWA 4XLNF 2HV6A 2KQ9A 5COGA 1G4US 5GPGB 3RH3A 3POVA 1J8MF 4CS8C 1FFHA 3IQ5A 4BJ1A 3SZRA 3W2VA 5A6BA 5FCLA 3I5QA 3OEOA 3LS0A 4D4NA 1Z5ZA 3LEOA 3LNRA 1L7CA 1CGOA 2HS5A 3HLZA 3ABLC 2EPOA 1G5ZA 3LUTB 2A6EF 3U3FA 2J8WA 2Q9AA 3U2MA 3JT1A 1YDIA 3EQLF 4NQFA 3T9OA 3RVYA 3UGOA 5DS5A 4HEAJ 1SF8A 2OOCA 2CDQA 2PF4E 1C03A 1Q0DA 3EGXA 3SXZA 1WN0A 3EPVA 3TOMA 2KSFA 2HV7A 2EPMX 3JYYA
chains in the Genus database with same CATH topology
4XPXA 3WAQA 1A7EA 1HMDA 1I4YA 2AVKA 2HMZA 2HMQA 3AGUA 2MHRA 1HMOA 3WHNA 1A7DA 2AWCA 3AGTA 4XQ1A 4XPWA 4XPYA 2AWYA 1I4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPX A;  3WAQ A;  1A7E A;  1HMD A;  1I4Y A;  2AVK A;  2HMZ A;  2HMQ A;  3AGU A;  2MHR A;  1HMO A;  3WHN A;  1A7D A;  2AWC A;  3AGT A;  4XQ1 A;  4XPW A;  4XPY A;  2AWY A;  1I4Z A; 
#chains in the Genus database with same CATH topology
 1Q0G A;  1N1C A;  4JEB A;  3RW0 A;  1M6T A;  4DRI B;  4YN0 B;  4FAP B;  2YL0 A;  2R25 A;  1TR2 A;  2R7W A;  2HFI A;  1IZM A;  4JTC B;  1CGN A;  4KNW A;  1JR8 A;  5CI8 A;  3SXY A;  3IHU A;  4GQH A;  3WG7 C;  3RQF A;  5KYU A;  1Z63 A;  1ZW2 A;  1VK5 A;  3U3B A;  3WHN A;  2E87 A;  4KI2 A;  4NY3 A;  4E0I A;  1RMV A;  2MYS A;  1MMN A;  4KBL A;  1OXB A;  3K6B A;  2R7R A;  4CX9 A;  4JCH A;  3ZG1 A;  2GFH A;  3NDB B;  4GYT A;  1BR1 A;  3UMH A;  2QNL A;  2XM4 A;  3ZDL A;  1BZ4 A;  3L0I A;  2J7P A;  3X2Q C;  1NG1 A;  4IAR A;  4C7O A;  4CS9 A;  2C03 A;  5JRA A;  3H2U A;  3AG4 C;  4A2N B;  3C8G A;  3O6X A;  3F46 A;  5BQG A;  3TJ5 A;  1Z6A A;  4C3E A;  4F4B A;  1Y4C A;  1TWH A;  2X51 A;  4OD5 A;  4Z9H A;  4BJ6 C;  1SMY F;  4MW8 A;  4YT2 A;  2HSQ A;  4C3D A;  3K1I C;  3LAY A;  4R32 A;  2OJQ A;  3QVY A;  3JZ0 A;  4DVY P;  2RD9 A;  4I1O B;  4JTA B;  4P9T A;  4K0D A;  1NZE A;  3AG2 C;  2XM0 A;  1A7D A;  4G7O F;  3FDQ A;  2OCC C;  3VAY A;  3NRH A;  5B3S C;  2Y39 A;  4G0H A;  2GA0 A;  4MTF A;  2Q9C A;  2WVO A;  3KH2 A;  1ST6 A;  4YL1 A;  5JS5 A;  3SXK A;  4JW1 A;  3W8H A;  2ZD9 A;  4U9E A;  1YJG A;  4JVS A;  4BG0 A;  2PP4 A;  3EGD B;  4BJT A;  2YLI A;  3LJB A;  4WJ0 A;  4E17 A;  1RKE B;  3KL4 A;  2A68 F;  1EQ1 A;  2OG2 A;  3VRC A;  4N6H A;  3ZVR A;  5BUO A;  3FAP B;  2W4B A;  4ULV A;  3G50 A;  3CAX A;  4N6C A;  1L3P A;  1QVX A;  1A7E A;  5L0D A;  4E7S A;  4G7Z F;  1MMD A;  1A0B A;  4AL1 A;  4J7T A;  4AK9 A;  2L7A A;  3CZ6 A;  4CBE A;  4N4W A;  4JJG A;  1FMW A;  3RYL A;  1WAS A;  2DYS C;  3B29 A;  1LS1 A;  4OIR F;  5KYN A;  1BBH A;  1ZU4 A;  3GEH A;  3NKD A;  3SEO A;  3AQB A;  3EH1 A;  3TK0 A;  3UR3 C;  1MQV A;  2C04 A;  2J9U A;  2QTV A;  3EFO A;  2Q7R A;  3ZWI A;  5HV9 A;  3QZC A;  4U9D A;  5L0I A;  4Q7C A;  1Z23 A;  4I44 A;  4O6M A;  1T6U A;  4BPM A;  1FMV A;  3U8P A;  2PX3 A;  4JZA A;  2L9J A;  5KYY A;  1BR4 A;  1GGQ A;  2YL1 A;  1D1A A;  3NMI A;  3C62 A;  3MFN A;  2W45 A;  5JVE A;  3UGP A;  3GEI A;  4JEA A;  2H7V C;  3C7J A;  1JPN A;  4BJ6 A;  1QLE C;  2XL4 A;  1YVI A;  2NUP B;  1VB5 A;  1MND A;  3HJC A;  1G8X A;  3K1I A;  3U9J A;  2AVK A;  1T6Q A;  2HMQ A;  2YLD A;  4PFO A;  5AGF A;  3QW0 A;  5D91 A;  3UMI A;  1EKY A;  2CNW A;  3EGX B;  2MHR A;  2A69 F;  4HFF B;  3TQO A;  4Q4Z F;  2PBE A;  4LDR A;  3CEX A;  4DBQ A;  2V3C C;  2R7Q A;  1Q0K A;  1V55 C;  3ZQV A;  4RDA A;  4DJ9 A;  3RFY A;  1AEP A;  3ZQY A;  3NG1 A;  5B1B C;  4UDV A;  5CI9 A;  3C63 A;  3J06 A;  3AQC A;  1K05 A;  1MNE A;  3PMR A;  3EZI A;  4XLP F;  5KYU B;  1C17 M;  1LPE A;  1E84 A;  2ZXR A;  2XLO A;  3SP1 A;  4CDA A;  1LIH A;  4CJO A;  1LI5 A;  2CW0 F;  1BDJ B;  1SZI A;  1E86 A;  1PV3 A;  4YWQ A;  4P6I C;  4MVS A;  4K1O A;  1ZYR F;  4WAB A;  1R5I D;  2G3V A;  1O87 A;  2EIK C;  2NSG A;  2XSE A;  1RXQ A;  1XZQ A;  3JRM O;  3K33 A;  4CIH A;  4QI0 A;  2A1D D;  2KC3 A;  1D1C A;  3JRT A;  1Q0M A;  4IB4 A;  3FMS A;  2YZS A;  3SXM A;  3C8G B;  1K04 A;  1KNY A;  2KGO A;  1YLM A;  1K40 A;  2WZL A;  4JKV A;  1WGW A;  5BQH A;  2XXA A;  2JX0 A;  4PFP A;  4U5E E;  5DQZ A;  4X0R A;  4Z9J A;  2B0H A;  5HSW A;  2Y3G A;  4MVR A;  3GEE A;  4J30 B;  1KTM A;  2D4U A;  2FGY A;  1XWJ A;  4AE4 A;  1ZHX A;  2R7U A;  4DOZ A;  3H2V A;  1JOG A;  1NU9 C;  1WTY A;  2H7B A;  1TFO B;  1Z7Q c;  4Q5S F;  4D4X A;  4EIY A;  3O39 A;  4ZLC A;  4OIP F;  1EA8 A;  3M4B A;  3EJN A;  1TKN A;  4JIO A;  2DB4 A;  5KYX B;  1Q0F A;  1TWG A;  3T6G B;  2YKZ A;  3W8I A;  4YT4 A;  3TUL A;  3T6B A;  3EG9 B;  1AUE A;  2ETS A;  1HW2 A;  2GAQ A;  4CSA C;  4JC7 A;  1Y6D A;  1R4T A;  3JSZ A;  4LDK A;  2DI3 A;  4JRZ A;  2BE5 F;  2L6H A;  3V5Z A;  3AGT A;  1ZHT A;  2GWW A;  2HJM A;  4JCZ A;  1QKR A;  3K7D A;  4YL3 A;  1LS4 A;  2IOQ A;  4O7G A;  5AC5 A;  1H7I A;  4XTK A;  2OJE D;  3CSK A;  2XLM A;  3A9C A;  1OW6 A;  4EWC A;  1QSP A;  2EIN C;  1A7V A;  4IAO A;  5E2Q A;  3N24 A;  3DE8 A;  3FHD A;  2J9B A;  4XPX A;  2Z15 A;  2OQM A;  1LVK A;  2YEV A;  3WAQ A;  2A0B A;  2A0U A;  4P9F A;  1HW1 A;  4L6R A;  2YHS A;  3S28 A;  4BJ5 A;  4LDQ A;  2HMZ A;  2XLH A;  2R9R B;  3DKA A;  5AC4 A;  5IY5 C;  2P61 A;  2VH3 A;  1OKK D;  1HMO A;  3JCU Q;  5KYY B;  3QVZ A;  1D0X A;  3U2L A;  1ZHW A;  2L81 A;  3U8V A;  5L0C A;  3WOD F;  3U5S A;  1ZU5 A;  1VYI A;  3M4C A;  1T01 A;  5D92 A;  1E85 A;  3FAJ A;  3US6 A;  1U0B B;  3SYN A;  2R7T A;  1VOM A;  3DZA A;  4IAQ A;  2YRF A;  4MTO A;  2IXN A;  3L1M A;  3DJN B;  1YAR O;  2PX0 A;  2XLV A;  3KYI A;  1I5N A;  2XLD A;  3MYF A;  1V54 C;  4MW3 A;  4MTG A;  1M57 C;  3A11 A;  1NFN A;  3R2P A;  4B6I A;  1OW8 A;  1HE9 A;  3PDM P;  1RJ9 A;  2IYL D;  3M79 A;  4PR9 A;  2CCY A;  3ZC4 A;  1ZHY A;  5F5H A;  5A69 A;  2I15 A;  3DWW A;  2NSF A;  1VTM P;  2LCH A;  2WB7 A;  5E3A A;  2YL3 A;  1LE4 A;  3Q6N A;  2Q3T A;  4PK4 A;  2LK4 A;  2JD3 A;  4CSA A;  2Y3H A;  1S05 A;  2UUI A;  4RD9 A;  4HFK B;  3EHN A;  2XRH A;  3N2Z B;  3RVZ A;  1T5O A;  1EI7 A;  4PJL A;  2MWQ A;  3MX3 A;  1NU7 D;  4LLC A;  4NTF A;  4O79 A;  2R7V A;  4H4K C;  4MVM A;  5F28 E;  3BRJ A;  2I8B A;  4A4A A;  4U5C E;  5BQI A;  1YAU O;  5T3T A;  5L3Q A;  2R7S A;  4PAC A;  3ITF A;  2ZPA A;  2OEV A;  2AWY A;  2B0J A;  1JRA A;  3S84 A;  2EIM C;  1D0Y A;  4E0H A;  1ZW3 A;  3VYW A;  3NYL A;  4LER A;  3GM1 A;  4U5G A;  2Q00 A;  3HNL A;  4LAC B;  4IGG A;  1ORS C;  3PCV A;  4QDL A;  3T4R A;  3ZIB A;  3B0V C;  2R05 A;  2Y69 C;  3K66 A;  1M2V A;  3GOD A;  4XEV A;  1LKX A;  2P7V A;  4EBK A;  3AGU A;  4DRH B;  3DM9 B;  4NC3 A;  2YLG A;  3SNH A;  1U6H A;  2WVN A;  1D1B A;  4H54 A;  4Z9I A;  2G3K A;  3RKO F;  1MMG A;  2FAP B;  1XZP A;  3KMI A;  3EZH A;  1M2O A;  1W2W A;  2VAS A;  5TJ5 E;  4AE4 B;  256B A;  4CJG A;  4FX5 A;  2P6V A;  2WZF A;  1OCR C;  2H7O A;  3KKB A;  3EH2 A;  3GOR A;  4JUR I;  2J0W A;  1YZC A;  2VCB A;  4ONS A;  3T6J A;  1CGM E;  4J7Y A;  3LLK A;  4PJJ A;  3KPH A;  1AVO B;  4YT5 A;  5EK0 A;  2VB6 A;  5CIV A;  3ATP A;  2XL6 A;  2OU6 A;  4IJJ A;  1OCO C;  3HTK C;  2RSE B;  4MVO A;  3GM2 A;  1LI7 A;  3C18 A;  3CQZ A;  5E33 A;  2BL2 A;  2HKV A;  2PFD A;  3GWL A;  2EIJ C;  3V5X A;  5JLI A;  2ASR A;  2YQY A;  1JMW A;  3E9V A;  4BJ5 C;  3B71 A;  5KYW A;  1FAP B;  1LM3 B;  2CGE A;  2PNO A;  4U5H A;  4C7O B;  1APC A;  3DMD A;  4KNV A;  2J9W A;  2Y3B A;  1H9G A;  1VYK A;  2Q9B A;  2AWC A;  4M63 A;  1YZA A;  3KYJ A;  5T3W A;  2R7X A;  2KNH A;  3B0U X;  3K1H A;  1IW7 F;  1G4W R;  4EUK B;  4MND A;  3IPM O;  4CS7 A;  2EPN A;  4OIO F;  2EPL X;  2F22 A;  3PHF 2;  1S7Z A;  3IEE A;  4MVQ A;  4O6N A;  4PJM A;  4U5D E;  3V5Y A;  2LSE A;  3DAG A;  3ZSU A;  1FR0 A;  3FVY A;  2UUH A;  5A6B D;  4YK5 A;  2IXP A;  2A6H F;  1QPU A;  3IQ6 A;  1HY5 A;  3GAN A;  3TJ6 A;  1OXK A;  1J8Y F;  3E70 C;  4ZLD A;  5COF A;  2BC5 A;  4EHP A;  4CDY A;  3MYI A;  2HUJ A;  1FFT C;  3RQG A;  2XS8 A;  3FXH A;  5F5F A;  3UMK A;  3IQC A;  1UG7 A;  4MQ9 F;  3DJU B;  4ULW A;  3ASN C;  3S90 A;  2NUP A;  3HNJ A;  1YYX A;  2VCC A;  2YWA A;  4GEH A;  4U5F E;  3VF0 A;  1RJ9 B;  1SYQ A;  4XPW A;  4FWV A;  2ZXW C;  2LFD A;  1NBB A;  1PD1 A;  5L0F A;  2V26 A;  2LFF A;  1MMA A;  1I4Z A;  5A6K A;  2ICW G;  1GQA A;  1KU2 A;  1GS9 A;  3DD7 A;  2NUT A;  4AX2 A;  1JPJ A;  2QE9 A;  2W4M A;  2VCA A;  3S9O A;  2TMV P;  3LLI A;  4AL0 A;  1TFK B;  3EFO B;  3MBG A;  4KC9 A;  1HMD A;  4JTD B;  1A41 A;  3DI5 A;  2QLA A;  1I4Y A;  4W8K A;  3S29 A;  3LNM B;  2WL8 A;  1SR2 A;  3QMK A;  1OR2 A;  5JSL A;  2GDC A;  2OKU A;  1YA9 A;  2OEX A;  3NMJ A;  4IRU A;  2DYR C;  1C02 A;  1OW7 A;  2QY9 A;  2R7O A;  3HNI A;  2NG1 A;  2QUP A;  4E7Z A;  2J7P D;  3M15 A;  2J9V A;  1OKK A;  4DRJ B;  1F1M A;  1OCC C;  3Q7G A;  3B0P A;  5COM A;  1QQ3 A;  1ZVZ A;  2AU5 A;  3RIP A;  1M2V B;  1ZHZ A;  3C8G D;  3NMK A;  1OQC A;  3ECS A;  5L3V A;  1CPQ A;  5DQT A;  1ORJ A;  2M4E A;  1NLX A;  4W8P A;  3TD7 A;  4NTB A;  3G4X A;  1CPR A;  1D0Z A;  2HZ8 A;  2KW3 C;  3JSE O;  2XLE A;  3LS1 A;  3W4Y A;  3GM3 A;  3L34 A;  4XWJ A;  5B3I A;  1T6I A;  1TWC A;  1M56 C;  3B9Q A;  4CS8 A;  2R03 A;  5DS4 A;  4JE9 A;  1ORY A;  2LP4 A;  3FOP A;  3HNK A;  3ABM C;  1TQG A;  4ANJ A;  1T9K A;  3AG1 C;  3X1O A;  3HKK A;  2X0C A;  4DBR A;  5L0G A;  1RKC A;  3FOO A;  1RCP A;  5L0J A;  2HJ3 A;  2XLW A;  3NYM A;  1Z3I X;  1FTS A;  2KK1 A;  4FES A;  4N06 A;  5JT4 A;  2LIG A;  5EGY A;  5DLJ A;  1UFB A;  1VLS A;  1YA7 O;  1ZZP A;  2R02 A;  3VM6 A;  2CYD A;  2J0X A;  3JTL O;  4LLE A;  4XQ1 A;  3S27 A;  5EHH A;  2G62 A;  5KYX A;  2HSB A;  3AG3 C;  3GWN A;  3L8J A;  5K0I A;  4I3M A;  1BR2 A;  5E3C A;  3DE9 A;  5FZT A;  3LEV A;  2AP3 A;  3F47 A;  4DVZ A;  1WOL A;  3EG9 A;  4C3B A;  1OR3 A;  2IBF A;  4YT8 A;  1QZX A;  5B1A C;  5KYW B;  3O10 A;  2XS1 A;  4QI2 A;  2YL7 A;  1U89 A;  3DAF A;  4OIN F;  2IXO A;  3TOL A;  1YYJ A;  3MLG A;  3EHM A;  3H65 A;  4O6Y A;  1PD0 A;  3M1C B;  4EBB A;  3Q7L A;  4G7H F;  1H6G A;  1B68 A;  2EPK X;  1VMA A;  2XXA B;  4OIQ F;  4G78 A;  3N0T A;  4JJF A;  1E2X A;  5A6A A;  4XEK A;  4ER9 A;  3JYH A;  3OWT A;  4RBN A;  2KJG A;  3V7O A;  4MVZ A;  1WWP A;  3AOU A;  2J46 A;  2WZG A;  3OA1 A;  4BEM J;  2Q4F A;  3ZTZ A;  2YVK A;  4CIP A;  3Q6M A;  2WVQ A;  3S0X A;  2EIL C;  2L6G A;  2XL8 A;  4WGZ A;  3DM5 A;  4CDV A;  3I4U A;  3U0C A;  3ASO C;  2J45 A;  4IWB A;  4J32 B;  3G4Z A;  3UNG C;  4PJN A;  2JPU A;  3NKE A;  3RF3 A;  2NPU A;  1WAT A;  1V74 B;  3W2W A;  4EBJ A;  1VLT A;  3AJM A;  3BEH A;  1O5H A;  1NFO A;  2LQG A;  2W9Y A;  4NCQ A;  4OD4 A;  5DVW A;  3R7C A;  3U9M A;  2L6F A;  4BEJ A;  5JUA A;  4K7B A;  5A6J A;  1PCX A;  3O55 A;  2O9X A;  2DGJ A;  2CNW D;  3LES A;  4MS2 A;  4U5B E;  2LD6 A;  1V4A A;  1DOW A;  1GM5 A;  3IQT A;  1FNT c;  4DXW A;  4I1M A;  3C8Z A;  4EKW A;  2D5R B;  3EGD A;  2FFH A;  1RKE A;  3QTH A;  4YL0 A;  3RQE A;  2M64 A;  5L0H A;  5T1D B;  2KYH A;  1E83 A;  2VC9 A;  4XEF A;  4MVU A;  2P1A A;  3DXJ F;  2NUT B;  1HE1 A;  5JP7 A;  1OCZ C;  1H9T A;  1O3U A;  4WGY A;  3QW1 A;  3ABK C;  5DS6 A;  3I5P A;  2P0N A;  2ZXO A;  4XPY A;  4NTA A;  1JAF A;  2ZXP A;  3NYJ A;  4CS9 C;  1NSG B;  2H8A A;  2IXM A;  4HE8 D;  3L8I A;  1LE2 A;  1DOV A;  2IM8 A;  2Y3D A;  1TWA A;  4E18 A;  3ZTM A;  4YJW A;  4XLN F;  2HV6 A;  2KQ9 A;  5COG A;  1G4U S;  5GPG B;  3RH3 A;  3POV A;  1J8M F;  4CS8 C;  1FFH A;  3IQ5 A;  4BJ1 A;  3SZR A;  3W2V A;  5A6B A;  5FCL A;  3I5Q A;  3OEO A;  3LS0 A;  4D4N A;  1Z5Z A;  3LEO A;  3LNR A;  1L7C A;  1CGO A;  2HS5 A;  3HLZ A;  3ABL C;  2EPO A;  1G5Z A;  3LUT B;  2A6E F;  3U3F A;  2J8W A;  2Q9A A;  3U2M A;  3JT1 A;  1YDI A;  3EQL F;  4NQF A;  3T9O A;  3RVY A;  3UGO A;  5DS5 A;  4HEA J;  1SF8 A;  2OOC A;  2CDQ A;  2PF4 E;  1C03 A;  1Q0D A;  3EGX A;  3SXZ A;  1WN0 A;  3EPV A;  3TOM A;  2KSF A;  2HV7 A;  2EPM X;  3JYY A; 
#chains in the Genus database with same CATH homology
 4XPX A;  3WAQ A;  1A7E A;  1HMD A;  1I4Y A;  2AVK A;  2HMZ A;  2HMQ A;  3AGU A;  2MHR A;  1HMO A;  3WHN A;  1A7D A;  2AWC A;  3AGT A;  4XQ1 A;  4XPW A;  4XPY A;  2AWY A;  1I4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...