3WAQA

Hemerythrin-like domain of dcrh i119e mutant (met)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
134
structure length
134
Chain Sequence
ADVLVKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHEMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemerythrin-like domain protein DcrH
publication title Crystal structure, exogenous ligand binding, and redox properties of an engineered diiron active site in a bacterial hemerythrin
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Metal binding protein
total genus 59
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 3waqA00
1A7EA 3WAQA 4XPXA 2HMQA 2AVKA 2MHRA 2AWYA 1I4ZA 3AGUA 1HMDA 1I4YA 3WHNA 4XQ1A 4XPYA 2HMZA 4XPWA 3AGTA 1HMOA 1A7DA 2AWCA
chains in the Genus database with same CATH superfamily
1IW7F 1YYJA 4OD4A 4YT8A 4FESA 4MNDA 1GM5A 2H7OA 1ZHZA 3EHNA 4DXWA 4O7GA 2HMQA 1H7IA 3PCVA 3SYNA 4IRUA 3MFNA 1W2WA 4EBBA 3ABLC 2CYDA 2A0UA 3ZG1A 3LUTB 1NZEA 2W4MA 1JR8A 3LLKA 1J8YF 4PJMA 4BEJA 5A69A 4J30B 1SZIA 2OKUA 3TQOA 2Q9CA 4JW1A 4M63A 2HV7A 1NFNA 4RDAA 5D92A 2LSEA 2A1DD 2YL7A 5E3AA 4D4XA 4PFPA 2H7VC 3MBGA 1PD0A 2MWQA 2Y3GA 3US6A 1Z23A 3IHUA 1F1MA 2LIGA 3FMSA 3GM1A 1Q0KA 2QTVA 3O6XA 5L0CA 5B1AC 2FFHA 2NSFA 1MMNA 2RD9A 3I5QA 1BR1A 2J45A 1ZU4A 1H6GA 2QNLA 4IB4A 3U3FA 1A7VA 2M64A 2L6HA 2WZGA 3CAXA 3GWNA 4KC9A 3W2VA 4BEMJ 5A6BA 1GGQA 1ZYRF 3O55A 4XPXA 3K1IA 3UGPA 3CZ6A 2NUPB 3UNGC 4C3DA 2L9JA 5B1BC 5KYYB 2R03A 3LNRA 3DZAA 1PCXA 3U9JA 3IQCA 3AGUA 1YDIA 3S90A 3ITFA 4DBRA 1MQVA 2R7QA 1YYXA 2VASA 3OEOA 1RJ9A 3JCUQ 2VCAA 3IQ6A 3Q7LA 4P9TA 2CNWD 4Z9HA 2PX3A 2P61A 3WHNA 3S0XA 2LFFA 4ANJA 1H9TA 3GANA 4JKVA 2XXAB 1JOGA 2B0HA 4MTGA 4C3BA 2L7AA 5KYWB 5KYXB 4Q4ZF 4IWBA 3AG2C 2BL2A 1NU7D 4U5BE 2G3KA 4CDAA 1V4AA 2KSFA 3I4UA 4LACB 2ZXOA 3GEHA 1YAUO 4MVZA 5KYUB 5L0FA 2EPLX 2R7UA 4KI2A 3AQCA 3KPHA 4ER9A 1ZHYA 1T9KA 3S27A 3ZIBA 2ETSA 3ZC4A 1QKRA 3OA1A 1QQ3A 1TR2A 2YL0A 1BR4A 2PF4E 2PNOA 3EGXB 1YARO 4MTOA 3ZQVA 3IQ5A 4EKWA 1D0ZA 4ZLCA 3G4ZA 2DB4A 1O3UA 1E85A 2CDQA 2YL3A 4U5EE 4XWJA 1U0BB 2PBEA 2PP4A 2GFHA 1KNYA 3ECSA 2BC5A 1D1AA 4ULVA 1TWHA 4C7OB 1RKEB 3DJUB 3M1CB 1HE9A 5JS5A 3EPVA 2UUHA 2F22A 3HJCA 2EPMX 1JMWA 3V5ZA 2Q3TA 4E0HA 2NUTA 1V74B 2WVQA 2PX0A 2V26A 3B0UX 3J06A 1O5HA 1JPJA 3W8IA 1CPQA 2J9UA 2KNHA 3LEVA 2AVKA 1JRAA 4DVZA 1M57C 256BA 1A41A 1EQ1A 4BJ6C 3NMJA 4U9DA 2HKVA 4G7ZF 1XWJA 1T6UA 2Q9BA 1XZPA 3CEXA 5JRAA 2DGJA 3K6BA 3U2MA 1TKNA 3O10A 3Q6NA 2CNWA 3EZHA 3JYYA 2ZD9A 3N0TA 1D0XA 1AUEA 4JURI 5T1DB 5TJ5E 2Q4FA 2R7WA 1Y4CA 3QMKA 4XPYA 5JSLA 2OEXA 1L7CA 3TK0A 1BR2A 1HMOA 1L3PA 4ONSA 2KK1A 2OU6A 2JD3A 3IEEA 3EFOB 2W45A 5F5FA 4BJ5A 2V3CC 1SYQA 3KL4A 2CW0F 5L0HA 2KW3C 3U5SA 3WAQA 4JTDB 3H2UA 4XTKA 3TULA 2XLWA 4G7HF 4GYTA 3OWTA 4DOZA 4C7OA 3W2WA 4YWQA 1ZW2A 1NBBA 1VOMA 1MMDA 1SMYF 3L1MA 2EIKC 1D1BA 1WTYA 2JPUA 2XM0A 2Y69C 2HSQA 3EGDB 3JT1A 5T3TA 2GDCA 2OG2A 2XLVA 3NKEA 3WODF 2I15A 1FTSA 2VCBA 3S29A 4AE4A 3KMIA 3UR3C 3H2VA 1VTMP 3L34A 2XRHA 3LS1A 2A69F 2AWCA 3KYJA 4IAOA 3TOMA 1JAFA 1QPUA 1Y6DA 3MYFA 1CPRA 4LDRA 3MLGA 3GM3A 3RW0A 3M15A 2WVNA 1Z63A 4I44A 4PJLA 2NSGA 5L0GA 2YLIA 3K7DA 2YRFA 2A68F 2AWYA 1M2VA 4JJFA 3U8PA 4OIRF 2Y39A 3SZRA 3B71A 2WZLA 5DS6A 1TWCA 3ZTMA 1JPNA 4CSAC 2J9BA 3R2PA 5F28E 1MMGA 3DAFA 3E9VA 2XS8A 3SXKA 3FAJA 4AL0A 1E84A 1B68A 2KQ9A 2HJMA 4EBJA 2DYRC 3U3BA 2ZXPA 1Z7Qc 1Q0MA 3EG9A 1K05A 5HSWA 1G5ZA 3MX3A 3JSZA 3N2ZB 3QW1A 1FR0A 3NYJA 4YT2A 4DVYP 4ZLDA 1G4WR 2L81A 3AGTA 1NLXA 4AK9A 4BPMA 3X1OA 1OQCA 5T3WA 3B0VC 1WGWA 3FOOA 5K0IA 1VK5A 2GWWA 2OOCA 5DQTA 3G4XA 4NTBA 2KGOA 2HUJA 2LK4A 3JRMO 4XEFA 2H8AA 2YVKA 1FMVA 2I8BA 2RSEB 3DD7A 4G7OF 1U6HA 1TFKB 5A6AA 1DOWA 3K1IC 1FAPB 2C03A 4CS8A 4DRHB 1CGME 1DOVA 3DE9A 3ATPA 3K33A 3RQEA 1M6TA 2WB7A 1OKKD 1WOLA 3F47A 1YZCA 2QE9A 2XLEA 3JRTA 1QLEC 1LVKA 4I1MA 3UMHA 5JT4A 3TJ6A 3RH3A 3NKDA 1ZW3A 1O87A 2EPOA 4BJ1A 4OIPF 2EPNA 2KJGA 3RQFA 3LAYA 3V5YA 2R7SA 2D4UA 2R7XA 2OEVA 2Y3BA 3L0IA 4P9FA 2YWAA 3AOUA 4WJ0A 4O79A 1OCZC 3DJNB 1WN0A 1VYKA 2IXPA 2OQMA 4MQ9F 3SXMA 3ZTZA 4DRIB 3JTLO 1YVIA 1ZU5A 2NUPA 3K1HA 5JUAA 4NC3A 3DMDA 4MVQA 5CIVA 2OCCC 5D91A 1K40A 1OCOC 4KNVA 4G78A 1OXBA 4JZAA 3RYLA 1M2OA 3T9OA 3GORA 1ZHXA 3EH1A 1FFTC 4KNWA 4U5CE 3BEHA 4W8KA 3R7CA 4CJGA 1R5ID 2X0CA 4CIPA 3VAYA 3B29A 3U9MA 1Z6AA 2J8WA 5KYXA 3FVYA 4ULWA 1S7ZA 2IOQA 2G62A 2Q9AA 3WG7C 1HE1A 4IAQA 1UFBA 4QI2A 2WVOA 4HFFB 4QDLA 4OD5A 4MVRA 4MTFA 4JC7A 5JVEA 4EIYA 2P7VA 1T6QA 2GAQA 3HNJA 5EHHA 3ZSUA 4BG0A 2NUTB 3SNHA 4JVSA 4A4AA 2L6GA 3C7JA 4IGGA 2MHRA 4JCHA 1AVOB 3ZVRA 2QUPA 4AL1A 4LLCA 3RF3A 4PFOA 3SXYA 1C03A 2J7PD 3AG1C 4IARA 2VH3A 3VM6A 1TFOB 3HNLA 2DI3A 2ICWG 1EA8A 1MMAA 3MYIA 3RFYA 3DWWA 2NG1A 2PFDA 4CS9C 1OKKA 3EHMA 1QZXA 5AGFA 1GS9A 4EUKB 2ZXWC 3C62A 3LLIA 3IQTA 1RKEA 1TWAA 4U5GA 1LIHA 2P1AA 4CDVA 4JRZA 4I3MA 1LKXA 1Q0FA 1Q0DA 3FOPA 2D5RB 2EIMC 3M4BA 4JTAB 3B0PA 5E33A 4PJNA 3EH2A 3HKKA 2E87A 3AG4C 3T6GB 2QY9A 2OJED 3NRHA 5JLIA 1T6IA 2CCYA 4OIOF 2TMVP 3RVZA 1C02A 2L6FA 4NY3A 4BJ5C 2C04A 4EHPA 3DKAA 2B0JA 4MS2A 1HW2A 5DS5A 2LD6A 2A6HF 3PDMP 2R05A 1BDJB 3QVYA 4O6MA 5A6JA 3Q7GA 1YJGA 2ASRA 1SF8A 3DE8A 1LI5A 2HJ3A 2J0WA 3DM5A 1APCA 3GWLA 3HTKC 3NYLA 4X0RA 3T4RA 4P6IC 5FCLA 1QVXA 4PACA 3IPMO 3F46A 4CX9A 2HMZA 4JE9A 3NMIA 4AE4B 2CGEA 5COFA 3SEOA 3UGOA 4FWVA 5FZTA 1LM3B 1FMWA 3C8GB 3NMKA 5CI8A 3ZDLA 5F5HA 1ZZPA 2R7VA 4O6NA 1RKCA 4B6IA 2Q7RA 1A7EA 2XLHA 1T01A 2YLDA 2R7TA 2YHSA 2AU5A 1ZHWA 5L3QA 3RQGA 3AG3C 2IYLD 4W8PA 3FXHA 4Z9JA 2XL8A 1IZMA 2Y3HA 5COGA 3V7OA 4CS7A 3GM2A 1M2VB 1VYIA 2XSEA 2LQGA 4FX5A 5L3VA 2J7PA 4JEAA 3S9OA 2EILC 3C18A 3LEOA 3FHDA 3W8HA 3Q6MA 4N6CA 2IM8A 4WGZA 3KYIA 1VLTA 1A0BA 4YT5A 3VYWA 1G4US 1FNTc 4XQ1A 1YA7O 2OJQA 3RKOF 2YEVA 1ORSC 5E3CA 3UMKA 1PD1A 1MNEA 3PMRA 4JIOA 1KTMA 2J9WA 2HSBA 4U5DE 4HFKB 1TQGA 2ZPAA 2W9YA 4N4WA 4YJWA 1OR3A 3TJ5A 3ZWIA 1RXQA 3KKBA 3BRJA 4NTAA 4CSAA 1E86A 1BZ4A 3CSKA 1E83A 1LPEA 5COMA 3GODA 1UG7A 3U8VA 1I4ZA 4J32B 4AX2A 1D1CA 2EPKX 3JSEO 4I1OB 1U89A 3O39A 3DM9B 1ST6A 2LCHA 2VCCA 5A6KA 2BE5F 3LJBA 2H7BA 4NCQA 1VB5A 1HY5A 2XL6A 4CS8C 1RJ9B 2R9RB 5AC5A 1D0YA 4K0DA 5IY5C 4JCZA 1LS1A 2NPUA 3EQLF 3G50A 3LNMB 4MW3A 4XPWA 1G8XA 2WL8A 3H65A 3RIPA 4DJ9A 1A7DA 3U2LA 3DXJF 5B3SC 1I4YA 2IXMA 4K1OA 1SR2A 5CI9A 2G3VA 4RBNA 1OR2A 2M4EA 2KYHA 4OINF 5EK0A 5HV9A 3HNIA 3L8IA 3QTHA 3EZIA 5KYYA 4MVUA 1K04A 1NSGB 3T6JA 4E7SA 5BQHA 2KC3A 2FGYA 4WGYA 2UUIA 4CIHA 4JJGA 5AC4A 1EI7A 1OW7A 5DLJA 1CGNA 5EGYA 5DS4A 2Y3DA 2P0NA 3T6BA 4J7YA 2MYSA 1QSPA 1WWPA 2IXOA 1GQAA 2J9VA 2XXAA 4GQHA 5JP7A 3L8JA 5KYWA 3NG1A 4D4NA 3TOLA 4HE8D 2J46A 2R25A 2QLAA 1LS4A 4CBEA 4EBKA 3VF0A 2R7RA 1S05A 4XEKA 4K7BA 4U5FE 4N6HA 4L6RA 1VMAA 4PJJA 5BQIA 1AEPA 4MVMA 3HNKA 4LDKA 5KYUA 5L0DA 1NG1A 4MW8A 2JX0A 4Q5SF 4JTCB 2XS1A 1I5NA 1MNDA 4UDVA 1KU2A 3EJNA 3SXZA 4G0HA 2YL1A 3ASNC 2XM4A 1XZQA 4OIQF 4U9EA 4DBQA 1CGOA 3JZ0A 1N1CA 1WATA 4YL1A 2Q00A 3A11A 3QVZA 2ZXRA 4GEHA 4MVOA 1TWGA 4YL3A 3A9CA 1HMDA 1OW6A 1Z5ZA 2O9XA 3EGXA 5L0JA 1WASA 2A0BA 4JEBA 2YLGA 2XLOA 4BJTA 2Z15A 5DVWA 5B3IA 3DI5A 3NDBB 2IBFA 1C17M 4YL0A 2AP3A 4Q7CA 3C8GD 4NTFA 4XLPF 2P6VA 2LFDA 2LP4A 1HW1A 2WZFA 4F4BA 3AJMA 3UMIA 3C8ZA 4E18A 2XLMA 4DRJB 1H9GA 1RCPA 1OW8A 1YA9A 3HLZA 3JYHA 1ORYA 3GEIA 4BJ6A 4EWCA 1OXKA 1PV3A 4H54A 5BQGA 4CS9A 1J8MF 1NU9C 2VC9A 1M56C 1YLMA 4Z9IA 3M79A 4XLNF 4J7TA 3CQZA 3DAGA 3TD7A 3POVA 2GA0A 4IJJA 4KBLA 3E70C 2DYSC 3LESA 4LDQA 4LERA 5E2QA 3RVYA 3GEEA 5DQZA 4CJOA 1BBHA 1NFOA 1V55C 1RMVA 4HEAJ 1E2XA 3C63A 3I5PA 4YT4A 2VB6A 3QZCA 4E17A 3FDQA 4YN0B 4E0IA 2EINC 3B9QA 1R4TA 2YZSA 2R02A 3NYMA 3EFOA 3X2QC 1ORJA 4YK5A 1Z3IX 3ABKC 5KYNA 2J0XA 1Q0GA 4RD9A 2FAPB 4NQFA 1ZHTA 4E7ZA 1OCCC 3AQBA 2YQYA 4PK4A 2HV6A 4WABA 3S84A 2XLDA 3ASOC 3K66A 1LI7A 4LLEA 4U5HA 4H4KC 1LE4A 5A6BD 3U0CA 4N06A 1YZAA 2W4BA 1EKYA 1OCRC 3M4CA 2X51A 2XL4A 1LE2A 5L0IA 3N24A 2EIJC 2HS5A 3S28A 2R7OA 3KH2A 3W4YA 3EGDA 3FAPB 4QI0A 1V54C 1VLSA 2HZ8A 3PHF2 3QW0A 4O6YA 4FAPB 4CDYA 4R32A 3VRCA 3ABMC 4XEVA 1FFHA 4MVSA 4PR9A 4A2NB 5BUOA 5GPGB 3C8GA 3EG9B 1T5OA 2A6EF 3LS0A 3SP1A 2HFIA 1ZVZA 3V5XA 3ZQYA 2YKZA 4C3EA 2IXNA
chains in the Genus database with same CATH topology
1A7EA 3WAQA 4XPXA 2HMQA 2AVKA 2MHRA 2AWYA 1I4ZA 3AGUA 1HMDA 1I4YA 3WHNA 4XQ1A 4XPYA 2HMZA 4XPWA 3AGTA 1HMOA 1A7DA 2AWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A7E A;  3WAQ A;  4XPX A;  2HMQ A;  2AVK A;  2MHR A;  2AWY A;  1I4Z A;  3AGU A;  1HMD A;  1I4Y A;  3WHN A;  4XQ1 A;  4XPY A;  2HMZ A;  4XPW A;  3AGT A;  1HMO A;  1A7D A;  2AWC A; 
#chains in the Genus database with same CATH topology
 1IW7 F;  1YYJ A;  4OD4 A;  4YT8 A;  4FES A;  4MND A;  1GM5 A;  2H7O A;  1ZHZ A;  3EHN A;  4DXW A;  4O7G A;  2HMQ A;  1H7I A;  3PCV A;  3SYN A;  4IRU A;  3MFN A;  1W2W A;  4EBB A;  3ABL C;  2CYD A;  2A0U A;  3ZG1 A;  3LUT B;  1NZE A;  2W4M A;  1JR8 A;  3LLK A;  1J8Y F;  4PJM A;  4BEJ A;  5A69 A;  4J30 B;  1SZI A;  2OKU A;  3TQO A;  2Q9C A;  4JW1 A;  4M63 A;  2HV7 A;  1NFN A;  4RDA A;  5D92 A;  2LSE A;  2A1D D;  2YL7 A;  5E3A A;  4D4X A;  4PFP A;  2H7V C;  3MBG A;  1PD0 A;  2MWQ A;  2Y3G A;  3US6 A;  1Z23 A;  3IHU A;  1F1M A;  2LIG A;  3FMS A;  3GM1 A;  1Q0K A;  2QTV A;  3O6X A;  5L0C A;  5B1A C;  2FFH A;  2NSF A;  1MMN A;  2RD9 A;  3I5Q A;  1BR1 A;  2J45 A;  1ZU4 A;  1H6G A;  2QNL A;  4IB4 A;  3U3F A;  1A7V A;  2M64 A;  2L6H A;  2WZG A;  3CAX A;  3GWN A;  4KC9 A;  3W2V A;  4BEM J;  5A6B A;  1GGQ A;  1ZYR F;  3O55 A;  4XPX A;  3K1I A;  3UGP A;  3CZ6 A;  2NUP B;  3UNG C;  4C3D A;  2L9J A;  5B1B C;  5KYY B;  2R03 A;  3LNR A;  3DZA A;  1PCX A;  3U9J A;  3IQC A;  3AGU A;  1YDI A;  3S90 A;  3ITF A;  4DBR A;  1MQV A;  2R7Q A;  1YYX A;  2VAS A;  3OEO A;  1RJ9 A;  3JCU Q;  2VCA A;  3IQ6 A;  3Q7L A;  4P9T A;  2CNW D;  4Z9H A;  2PX3 A;  2P61 A;  3WHN A;  3S0X A;  2LFF A;  4ANJ A;  1H9T A;  3GAN A;  4JKV A;  2XXA B;  1JOG A;  2B0H A;  4MTG A;  4C3B A;  2L7A A;  5KYW B;  5KYX B;  4Q4Z F;  4IWB A;  3AG2 C;  2BL2 A;  1NU7 D;  4U5B E;  2G3K A;  4CDA A;  1V4A A;  2KSF A;  3I4U A;  4LAC B;  2ZXO A;  3GEH A;  1YAU O;  4MVZ A;  5KYU B;  5L0F A;  2EPL X;  2R7U A;  4KI2 A;  3AQC A;  3KPH A;  4ER9 A;  1ZHY A;  1T9K A;  3S27 A;  3ZIB A;  2ETS A;  3ZC4 A;  1QKR A;  3OA1 A;  1QQ3 A;  1TR2 A;  2YL0 A;  1BR4 A;  2PF4 E;  2PNO A;  3EGX B;  1YAR O;  4MTO A;  3ZQV A;  3IQ5 A;  4EKW A;  1D0Z A;  4ZLC A;  3G4Z A;  2DB4 A;  1O3U A;  1E85 A;  2CDQ A;  2YL3 A;  4U5E E;  4XWJ A;  1U0B B;  2PBE A;  2PP4 A;  2GFH A;  1KNY A;  3ECS A;  2BC5 A;  1D1A A;  4ULV A;  1TWH A;  4C7O B;  1RKE B;  3DJU B;  3M1C B;  1HE9 A;  5JS5 A;  3EPV A;  2UUH A;  2F22 A;  3HJC A;  2EPM X;  1JMW A;  3V5Z A;  2Q3T A;  4E0H A;  2NUT A;  1V74 B;  2WVQ A;  2PX0 A;  2V26 A;  3B0U X;  3J06 A;  1O5H A;  1JPJ A;  3W8I A;  1CPQ A;  2J9U A;  2KNH A;  3LEV A;  2AVK A;  1JRA A;  4DVZ A;  1M57 C;  256B A;  1A41 A;  1EQ1 A;  4BJ6 C;  3NMJ A;  4U9D A;  2HKV A;  4G7Z F;  1XWJ A;  1T6U A;  2Q9B A;  1XZP A;  3CEX A;  5JRA A;  2DGJ A;  3K6B A;  3U2M A;  1TKN A;  3O10 A;  3Q6N A;  2CNW A;  3EZH A;  3JYY A;  2ZD9 A;  3N0T A;  1D0X A;  1AUE A;  4JUR I;  5T1D B;  5TJ5 E;  2Q4F A;  2R7W A;  1Y4C A;  3QMK A;  4XPY A;  5JSL A;  2OEX A;  1L7C A;  3TK0 A;  1BR2 A;  1HMO A;  1L3P A;  4ONS A;  2KK1 A;  2OU6 A;  2JD3 A;  3IEE A;  3EFO B;  2W45 A;  5F5F A;  4BJ5 A;  2V3C C;  1SYQ A;  3KL4 A;  2CW0 F;  5L0H A;  2KW3 C;  3U5S A;  3WAQ A;  4JTD B;  3H2U A;  4XTK A;  3TUL A;  2XLW A;  4G7H F;  4GYT A;  3OWT A;  4DOZ A;  4C7O A;  3W2W A;  4YWQ A;  1ZW2 A;  1NBB A;  1VOM A;  1MMD A;  1SMY F;  3L1M A;  2EIK C;  1D1B A;  1WTY A;  2JPU A;  2XM0 A;  2Y69 C;  2HSQ A;  3EGD B;  3JT1 A;  5T3T A;  2GDC A;  2OG2 A;  2XLV A;  3NKE A;  3WOD F;  2I15 A;  1FTS A;  2VCB A;  3S29 A;  4AE4 A;  3KMI A;  3UR3 C;  3H2V A;  1VTM P;  3L34 A;  2XRH A;  3LS1 A;  2A69 F;  2AWC A;  3KYJ A;  4IAO A;  3TOM A;  1JAF A;  1QPU A;  1Y6D A;  3MYF A;  1CPR A;  4LDR A;  3MLG A;  3GM3 A;  3RW0 A;  3M15 A;  2WVN A;  1Z63 A;  4I44 A;  4PJL A;  2NSG A;  5L0G A;  2YLI A;  3K7D A;  2YRF A;  2A68 F;  2AWY A;  1M2V A;  4JJF A;  3U8P A;  4OIR F;  2Y39 A;  3SZR A;  3B71 A;  2WZL A;  5DS6 A;  1TWC A;  3ZTM A;  1JPN A;  4CSA C;  2J9B A;  3R2P A;  5F28 E;  1MMG A;  3DAF A;  3E9V A;  2XS8 A;  3SXK A;  3FAJ A;  4AL0 A;  1E84 A;  1B68 A;  2KQ9 A;  2HJM A;  4EBJ A;  2DYR C;  3U3B A;  2ZXP A;  1Z7Q c;  1Q0M A;  3EG9 A;  1K05 A;  5HSW A;  1G5Z A;  3MX3 A;  3JSZ A;  3N2Z B;  3QW1 A;  1FR0 A;  3NYJ A;  4YT2 A;  4DVY P;  4ZLD A;  1G4W R;  2L81 A;  3AGT A;  1NLX A;  4AK9 A;  4BPM A;  3X1O A;  1OQC A;  5T3W A;  3B0V C;  1WGW A;  3FOO A;  5K0I A;  1VK5 A;  2GWW A;  2OOC A;  5DQT A;  3G4X A;  4NTB A;  2KGO A;  2HUJ A;  2LK4 A;  3JRM O;  4XEF A;  2H8A A;  2YVK A;  1FMV A;  2I8B A;  2RSE B;  3DD7 A;  4G7O F;  1U6H A;  1TFK B;  5A6A A;  1DOW A;  3K1I C;  1FAP B;  2C03 A;  4CS8 A;  4DRH B;  1CGM E;  1DOV A;  3DE9 A;  3ATP A;  3K33 A;  3RQE A;  1M6T A;  2WB7 A;  1OKK D;  1WOL A;  3F47 A;  1YZC A;  2QE9 A;  2XLE A;  3JRT A;  1QLE C;  1LVK A;  4I1M A;  3UMH A;  5JT4 A;  3TJ6 A;  3RH3 A;  3NKD A;  1ZW3 A;  1O87 A;  2EPO A;  4BJ1 A;  4OIP F;  2EPN A;  2KJG A;  3RQF A;  3LAY A;  3V5Y A;  2R7S A;  2D4U A;  2R7X A;  2OEV A;  2Y3B A;  3L0I A;  4P9F A;  2YWA A;  3AOU A;  4WJ0 A;  4O79 A;  1OCZ C;  3DJN B;  1WN0 A;  1VYK A;  2IXP A;  2OQM A;  4MQ9 F;  3SXM A;  3ZTZ A;  4DRI B;  3JTL O;  1YVI A;  1ZU5 A;  2NUP A;  3K1H A;  5JUA A;  4NC3 A;  3DMD A;  4MVQ A;  5CIV A;  2OCC C;  5D91 A;  1K40 A;  1OCO C;  4KNV A;  4G78 A;  1OXB A;  4JZA A;  3RYL A;  1M2O A;  3T9O A;  3GOR A;  1ZHX A;  3EH1 A;  1FFT C;  4KNW A;  4U5C E;  3BEH A;  4W8K A;  3R7C A;  4CJG A;  1R5I D;  2X0C A;  4CIP A;  3VAY A;  3B29 A;  3U9M A;  1Z6A A;  2J8W A;  5KYX A;  3FVY A;  4ULW A;  1S7Z A;  2IOQ A;  2G62 A;  2Q9A A;  3WG7 C;  1HE1 A;  4IAQ A;  1UFB A;  4QI2 A;  2WVO A;  4HFF B;  4QDL A;  4OD5 A;  4MVR A;  4MTF A;  4JC7 A;  5JVE A;  4EIY A;  2P7V A;  1T6Q A;  2GAQ A;  3HNJ A;  5EHH A;  3ZSU A;  4BG0 A;  2NUT B;  3SNH A;  4JVS A;  4A4A A;  2L6G A;  3C7J A;  4IGG A;  2MHR A;  4JCH A;  1AVO B;  3ZVR A;  2QUP A;  4AL1 A;  4LLC A;  3RF3 A;  4PFO A;  3SXY A;  1C03 A;  2J7P D;  3AG1 C;  4IAR A;  2VH3 A;  3VM6 A;  1TFO B;  3HNL A;  2DI3 A;  2ICW G;  1EA8 A;  1MMA A;  3MYI A;  3RFY A;  3DWW A;  2NG1 A;  2PFD A;  4CS9 C;  1OKK A;  3EHM A;  1QZX A;  5AGF A;  1GS9 A;  4EUK B;  2ZXW C;  3C62 A;  3LLI A;  3IQT A;  1RKE A;  1TWA A;  4U5G A;  1LIH A;  2P1A A;  4CDV A;  4JRZ A;  4I3M A;  1LKX A;  1Q0F A;  1Q0D A;  3FOP A;  2D5R B;  2EIM C;  3M4B A;  4JTA B;  3B0P A;  5E33 A;  4PJN A;  3EH2 A;  3HKK A;  2E87 A;  3AG4 C;  3T6G B;  2QY9 A;  2OJE D;  3NRH A;  5JLI A;  1T6I A;  2CCY A;  4OIO F;  2TMV P;  3RVZ A;  1C02 A;  2L6F A;  4NY3 A;  4BJ5 C;  2C04 A;  4EHP A;  3DKA A;  2B0J A;  4MS2 A;  1HW2 A;  5DS5 A;  2LD6 A;  2A6H F;  3PDM P;  2R05 A;  1BDJ B;  3QVY A;  4O6M A;  5A6J A;  3Q7G A;  1YJG A;  2ASR A;  1SF8 A;  3DE8 A;  1LI5 A;  2HJ3 A;  2J0W A;  3DM5 A;  1APC A;  3GWL A;  3HTK C;  3NYL A;  4X0R A;  3T4R A;  4P6I C;  5FCL A;  1QVX A;  4PAC A;  3IPM O;  3F46 A;  4CX9 A;  2HMZ A;  4JE9 A;  3NMI A;  4AE4 B;  2CGE A;  5COF A;  3SEO A;  3UGO A;  4FWV A;  5FZT A;  1LM3 B;  1FMW A;  3C8G B;  3NMK A;  5CI8 A;  3ZDL A;  5F5H A;  1ZZP A;  2R7V A;  4O6N A;  1RKC A;  4B6I A;  2Q7R A;  1A7E A;  2XLH A;  1T01 A;  2YLD A;  2R7T A;  2YHS A;  2AU5 A;  1ZHW A;  5L3Q A;  3RQG A;  3AG3 C;  2IYL D;  4W8P A;  3FXH A;  4Z9J A;  2XL8 A;  1IZM A;  2Y3H A;  5COG A;  3V7O A;  4CS7 A;  3GM2 A;  1M2V B;  1VYI A;  2XSE A;  2LQG A;  4FX5 A;  5L3V A;  2J7P A;  4JEA A;  3S9O A;  2EIL C;  3C18 A;  3LEO A;  3FHD A;  3W8H A;  3Q6M A;  4N6C A;  2IM8 A;  4WGZ A;  3KYI A;  1VLT A;  1A0B A;  4YT5 A;  3VYW A;  1G4U S;  1FNT c;  4XQ1 A;  1YA7 O;  2OJQ A;  3RKO F;  2YEV A;  1ORS C;  5E3C A;  3UMK A;  1PD1 A;  1MNE A;  3PMR A;  4JIO A;  1KTM A;  2J9W A;  2HSB A;  4U5D E;  4HFK B;  1TQG A;  2ZPA A;  2W9Y A;  4N4W A;  4YJW A;  1OR3 A;  3TJ5 A;  3ZWI A;  1RXQ A;  3KKB A;  3BRJ A;  4NTA A;  4CSA A;  1E86 A;  1BZ4 A;  3CSK A;  1E83 A;  1LPE A;  5COM A;  3GOD A;  1UG7 A;  3U8V A;  1I4Z A;  4J32 B;  4AX2 A;  1D1C A;  2EPK X;  3JSE O;  4I1O B;  1U89 A;  3O39 A;  3DM9 B;  1ST6 A;  2LCH A;  2VCC A;  5A6K A;  2BE5 F;  3LJB A;  2H7B A;  4NCQ A;  1VB5 A;  1HY5 A;  2XL6 A;  4CS8 C;  1RJ9 B;  2R9R B;  5AC5 A;  1D0Y A;  4K0D A;  5IY5 C;  4JCZ A;  1LS1 A;  2NPU A;  3EQL F;  3G50 A;  3LNM B;  4MW3 A;  4XPW A;  1G8X A;  2WL8 A;  3H65 A;  3RIP A;  4DJ9 A;  1A7D A;  3U2L A;  3DXJ F;  5B3S C;  1I4Y A;  2IXM A;  4K1O A;  1SR2 A;  5CI9 A;  2G3V A;  4RBN A;  1OR2 A;  2M4E A;  2KYH A;  4OIN F;  5EK0 A;  5HV9 A;  3HNI A;  3L8I A;  3QTH A;  3EZI A;  5KYY A;  4MVU A;  1K04 A;  1NSG B;  3T6J A;  4E7S A;  5BQH A;  2KC3 A;  2FGY A;  4WGY A;  2UUI A;  4CIH A;  4JJG A;  5AC4 A;  1EI7 A;  1OW7 A;  5DLJ A;  1CGN A;  5EGY A;  5DS4 A;  2Y3D A;  2P0N A;  3T6B A;  4J7Y A;  2MYS A;  1QSP A;  1WWP A;  2IXO A;  1GQA A;  2J9V A;  2XXA A;  4GQH A;  5JP7 A;  3L8J A;  5KYW A;  3NG1 A;  4D4N A;  3TOL A;  4HE8 D;  2J46 A;  2R25 A;  2QLA A;  1LS4 A;  4CBE A;  4EBK A;  3VF0 A;  2R7R A;  1S05 A;  4XEK A;  4K7B A;  4U5F E;  4N6H A;  4L6R A;  1VMA A;  4PJJ A;  5BQI A;  1AEP A;  4MVM A;  3HNK A;  4LDK A;  5KYU A;  5L0D A;  1NG1 A;  4MW8 A;  2JX0 A;  4Q5S F;  4JTC B;  2XS1 A;  1I5N A;  1MND A;  4UDV A;  1KU2 A;  3EJN A;  3SXZ A;  4G0H A;  2YL1 A;  3ASN C;  2XM4 A;  1XZQ A;  4OIQ F;  4U9E A;  4DBQ A;  1CGO A;  3JZ0 A;  1N1C A;  1WAT A;  4YL1 A;  2Q00 A;  3A11 A;  3QVZ A;  2ZXR A;  4GEH A;  4MVO A;  1TWG A;  4YL3 A;  3A9C A;  1HMD A;  1OW6 A;  1Z5Z A;  2O9X A;  3EGX A;  5L0J A;  1WAS A;  2A0B A;  4JEB A;  2YLG A;  2XLO A;  4BJT A;  2Z15 A;  5DVW A;  5B3I A;  3DI5 A;  3NDB B;  2IBF A;  1C17 M;  4YL0 A;  2AP3 A;  4Q7C A;  3C8G D;  4NTF A;  4XLP F;  2P6V A;  2LFD A;  2LP4 A;  1HW1 A;  2WZF A;  4F4B A;  3AJM A;  3UMI A;  3C8Z A;  4E18 A;  2XLM A;  4DRJ B;  1H9G A;  1RCP A;  1OW8 A;  1YA9 A;  3HLZ A;  3JYH A;  1ORY A;  3GEI A;  4BJ6 A;  4EWC A;  1OXK A;  1PV3 A;  4H54 A;  5BQG A;  4CS9 A;  1J8M F;  1NU9 C;  2VC9 A;  1M56 C;  1YLM A;  4Z9I A;  3M79 A;  4XLN F;  4J7T A;  3CQZ A;  3DAG A;  3TD7 A;  3POV A;  2GA0 A;  4IJJ A;  4KBL A;  3E70 C;  2DYS C;  3LES A;  4LDQ A;  4LER A;  5E2Q A;  3RVY A;  3GEE A;  5DQZ A;  4CJO A;  1BBH A;  1NFO A;  1V55 C;  1RMV A;  4HEA J;  1E2X A;  3C63 A;  3I5P A;  4YT4 A;  2VB6 A;  3QZC A;  4E17 A;  3FDQ A;  4YN0 B;  4E0I A;  2EIN C;  3B9Q A;  1R4T A;  2YZS A;  2R02 A;  3NYM A;  3EFO A;  3X2Q C;  1ORJ A;  4YK5 A;  1Z3I X;  3ABK C;  5KYN A;  2J0X A;  1Q0G A;  4RD9 A;  2FAP B;  4NQF A;  1ZHT A;  4E7Z A;  1OCC C;  3AQB A;  2YQY A;  4PK4 A;  2HV6 A;  4WAB A;  3S84 A;  2XLD A;  3ASO C;  3K66 A;  1LI7 A;  4LLE A;  4U5H A;  4H4K C;  1LE4 A;  5A6B D;  3U0C A;  4N06 A;  1YZA A;  2W4B A;  1EKY A;  1OCR C;  3M4C A;  2X51 A;  2XL4 A;  1LE2 A;  5L0I A;  3N24 A;  2EIJ C;  2HS5 A;  3S28 A;  2R7O A;  3KH2 A;  3W4Y A;  3EGD A;  3FAP B;  4QI0 A;  1V54 C;  1VLS A;  2HZ8 A;  3PHF 2;  3QW0 A;  4O6Y A;  4FAP B;  4CDY A;  4R32 A;  3VRC A;  3ABM C;  4XEV A;  1FFH A;  4MVS A;  4PR9 A;  4A2N B;  5BUO A;  5GPG B;  3C8G A;  3EG9 B;  1T5O A;  2A6E F;  3LS0 A;  3SP1 A;  2HFI A;  1ZVZ A;  3V5X A;  3ZQY A;  2YKZ A;  4C3E A;  2IXN A; 
#chains in the Genus database with same CATH homology
 1A7E A;  3WAQ A;  4XPX A;  2HMQ A;  2AVK A;  2MHR A;  2AWY A;  1I4Z A;  3AGU A;  1HMD A;  1I4Y A;  3WHN A;  4XQ1 A;  4XPY A;  2HMZ A;  4XPW A;  3AGT A;  1HMO A;  1A7D A;  2AWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...