3WAQA

Hemerythrin-like domain of dcrh i119e mutant (met)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
134
structure length
134
Chain Sequence
ADVLVKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHEMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemerythrin-like domain protein DcrH
publication title Crystal structure, exogenous ligand binding, and redox properties of an engineered diiron active site in a bacterial hemerythrin
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Metal binding protein
total genus 59
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 3waqA00
2HMZA 4XPXA 4XPWA 3WAQA 1I4YA 4XQ1A 3AGTA 1A7DA 2HMQA 3WHNA 2MHRA 2AVKA 2AWYA 2AWCA 1A7EA 1I4ZA 3AGUA 4XPYA 1HMDA 1HMOA
chains in the Genus database with same CATH superfamily
3NKDA 2XLDA 1QKRA 4AL0A 1D0XA 1WTYA 2EIJC 3U9JA 2FAPB 4XQ1A 2ZXPA 3EPVA 4X0RA 2GWWA 2B0JA 3DM5A 2XLMA 3MLGA 5B1BC 4B6IA 2W45A 3B9QA 5DVWA 4DVYP 3K1IC 2C04A 4KNVA 3V5XA 4BPMA 2LP4A 4KI2A 2EPLX 2E87A 4GYTA 2ETSA 3SZRA 5K0IA 1DOVA 5DS5A 1WATA 1G8XA 3U3BA 2NPUA 2W9YA 3MBGA 4U5EE 1LI5A 1T6UA 2DYRC 2R7WA 3G50A 2J7PD 2XM4A 4E7ZA 2VC9A 1DOWA 5JS5A 2HS5A 4PJMA 5HSWA 4JEAA 2L7AA 4W8PA 2LSEA 3G4XA 4JJFA 2LK4A 3N24A 3RQEA 3FOOA 3SEOA 4A4AA 3NYMA 1Z3IX 3NYJA 2R7VA 1MMDA 4KBLA 4FAPB 4CSAA 3ABMC 1UFBA 3UMKA 1VK5A 1T6IA 2ZPAA 5DQTA 1B68A 2OOCA 3LUTB 4CS8C 5KYWB 1I4ZA 3DE8A 1M57C 3K66A 1WGWA 3OEOA 4U5FE 1EQ1A 1TFKB 4JCZA 4O7GA 1IZMA 4ANJA 5BUOA 5EK0A 4MTFA 3UR3C 4BJ6C 3I5QA 1FFTC 4JW1A 4XPYA 1L3PA 2VCBA 3V5ZA 3GORA 4WJ0A 5L0GA 4KNWA 3ZC4A 2X51A 3DWWA 4YL1A 1G4WR 5JP7A 2R7OA 3M15A 2HMZA 5A6BD 2EPMX 5KYXB 2V3CC 3LEVA 1YVIA 4JURI 4YK5A 1LPEA 3EZHA 1RKEB 3TD7A 4YWQA 3C18A 4J7YA 4MS2A 5T3TA 2Y3HA 1TKNA 2YL7A 4I44A 3WHNA 2D4UA 1FAPB 4OD4A 4GQHA 3U0CA 1YYJA 4DBQA 3K7DA 3IHUA 1ZU4A 2J0WA 3CQZA 2EPNA 4LLCA 2R7RA 4G7HF 4MW3A 2GAQA 4IAQA 4AX2A 3BEHA 2QTVA 3AG1C 1XZPA 1TWHA 3NKEA 2ZXOA 5BQIA 2I15A 4K1OA 3TJ6A 1RCPA 2YL1A 5AGFA 4IJJA 4BJ1A 2QUPA 2Y3GA 1D0ZA 1MMGA 2XRHA 4FX5A 2KK1A 3VM6A 3VYWA 2JPUA 1VTMP 3JCUQ 2HSQA 2J7PA 3AQCA 1YLMA 1ORSC 3CZ6A 3KH2A 1S7ZA 4QDLA 5T3WA 3JTLO 3ZWIA 1ZW3A 2XLWA 2P7VA 3DAFA 1GM5A 1E2XA 2A1DD 5E3AA 3R7CA 5CIVA 1QZXA 3W2WA 5FCLA 4RD9A 3HNIA 3EH1A 2H7BA 3RVYA 2XLEA 4EBJA 3NG1A 2LIGA 5EGYA 2LFFA 1YZAA 3KYIA 1NFNA 2R03A 4N6CA 5JLIA 2WVOA 2IM8A 5COMA 3BRJA 5AC4A 2OEXA 3S84A 3PMRA 3LLKA 4CX9A 3W4YA 1LI7A 2KW3C 3U5SA 5BQGA 2YL0A 3SNHA 1V54C 3U8PA 4XEKA 3NDBB 3S27A 2GDCA 1R5ID 1H7IA 4I1MA 2J9VA 3DE9A 1AEPA 1LM3B 3LJBA 1M2VA 3C8GB 4IGGA 3ZTZA 4EBBA 4JCHA 2ASRA 3DXJF 1OKKD 4JTAB 1FNTc 3AQBA 4JEBA 3Q6MA 3TQOA 4JE9A 1T6QA 2AWCA 2QY9A 2V26A 3ASOC 4OIPF 3RQGA 5IY5C 1I5NA 3SXMA 2YHSA 4CDVA 1JAFA 2KJGA 3C8GD 4DRHB 2OJED 1H9TA 1ZHWA 3LESA 2QLAA 4KC9A 5L0JA 1M2OA 1OW7A 2EINC 1VLSA 1OW6A 1ZW2A 4JRZA 5COGA 3TOLA 4AE4A 2NSFA 2A6HF 3TJ5A 2IYLD 2WVNA 2HFIA 4HFFB 3GEIA 5E33A 2ZXWC 4U9EA 3PCVA 4L6RA 1PD0A 2HSBA 4XPXA 5KYYA 1JRAA 2A69F 2KNHA 3M79A 2PFDA 3RIPA 1N1CA 2MYSA 3FVYA 3RYLA 4NTAA 4YT5A 3VRCA 5A69A 2Q3TA 2CYDA 2WZLA 1OXBA 3GEEA 2WZFA 3W2VA 4OINF 3WODF 3G4ZA 3X2QC 1RXQA 3N0TA 4R32A 1OQCA 1ZHTA 3LEOA 4W8KA 4MTGA 4IB4A 3Q6NA 1Z7Qc 1E86A 3QVYA 4BJ5C 2L81A 2XS1A 3U8VA 3ZDLA 1K40A 3JSZA 2L6FA 2M64A 4H54A 1K05A 4JKVA 3EQLF 2NUTB 1MMNA 2YKZA 4YN0B 3PHF2 2W4BA 5CI9A 5JUAA 2YZSA 2XL8A 1TWCA 1LKXA 1I4YA 3EGDA 3I5PA 3U3FA 3KL4A 3AGTA 1ORJA 4G7ZF 1QLEC 2P1AA 2IXMA 1W2WA 2Y69C 3PDMP 2JX0A 3U9MA 3ZIBA 4J7TA 3S0XA 4LLEA 4Z9HA 5DS4A 4PFPA 1A7EA 1D1BA 3DJUB 3MFNA 4EIYA 4C7OA 1YZCA 1YAUO 3L8JA 4JVSA 3GWLA 3Q7GA 4O79A 3FXHA 3DAGA 1BR4A 2DI3A 2XL4A 3VF0A 1F1MA 4CBEA 4ULWA 4D4NA 1EKYA 2IOQA 1JOGA 4U5CE 1J8YF 1SR2A 1BBHA 3EHMA 5D91A 5HV9A 1E83A 4IAOA 1Z63A 3J06A 3NYLA 5E3CA 4ONSA 1V4AA 4J30B 3EFOB 3RQFA 2EPKX 2XLVA 2J9BA 2XSEA 3HJCA 4N4WA 4E7SA 1LS1A 2FFHA 4CDYA 3M4CA 3HNJA 4EHPA 4NTFA 3DKAA 5L3QA 2OCCC 3CEXA 3RFYA 2GA0A 1T9KA 4MQ9F 1JMWA 5TJ5E 5EHHA 1NSGB 4QI0A 5L0CA 3QVZA 1MNDA 5COFA 2OJQA 4E0HA 2CNWD 1Q0GA 2LFDA 1RJ9B 2WL8A 3QW0A 1J8MF 4U5BE 2A0UA 3SYNA 4C3DA 4DRJB 3ZQVA 3TULA 2HKVA 4K7BA 3POVA 2YL3A 2G62A 1FR0A 3AGUA 4MVOA 1G4US 3QMKA 1IW7F 4MVUA 3UNGC 3CSKA 1ZHZA 4IRUA 1MMAA 2VCCA 3H65A 5B3IA 2R7TA 4MVRA 4Q5SF 1SF8A 1HMOA 2J0XA 3FHDA 2LQGA 4Q7CA 1BDJB 1HE9A 3IQ6A 1FMWA 2YLDA 3L8IA 3LNRA 3LNMB 4U5GA 1A7VA 1OCRC 3SXZA 4A2NB 1VOMA 2O9XA 1Q0DA 4P9TA 3WAQA 4CIPA 5KYYB 4OIRF 1CGME 2A6EF 1RKCA 3QW1A 2XM0A 3HKKA 1FFHA 4IARA 1YJGA 2YWAA 4UDVA 4CIHA 4OIOF 3T9OA 3C63A 1LS4A 1M56C 3VAYA 1T01A 4YT2A 3KKBA 5B3SC 3B0UX 1YDIA 2YEVA 4WGZA 1ZVZA 4XEFA 2HV6A 3V5YA 1A0BA 2W4MA 4XLNF 1EA8A 4DBRA 2GFHA 3K6BA 4JZAA 3EZIA 3F46A 2EIMC 3LAYA 3IPMO 4U5HA 2R02A 3FAPB 2J9WA 3ZQYA 2XXAA 3U2LA 1CGOA 3DI5A 4N06A 2XS8A 3B0VC 3SP1A 1D1CA 1NFOA 4PJJA 5F5HA 3K1IA 1Z23A 2HZ8A 4AK9A 3RW0A 1KU2A 4CJGA 2ICWG 3F47A 4ER9A 1S05A 1Z6AA 1NZEA 1Z5ZA 1ZHYA 3EGXA 3DZAA 3H2UA 5A6BA 2LCHA 1V74B 3A11A 3EGDB 2MHRA 2R7QA 4DVZA 5AC5A 2AVKA 2CDQA 2DYSC 1HY5A 2CGEA 1OW8A 2M4EA 4RBNA 1MQVA 3B29A 3ATPA 2YLIA 2DB4A 3AG3C 5FZTA 3JRTA 4LERA 3OA1A 4CJOA 4C7OB 1VYIA 2L9JA 3ECSA 4CS9C 2HV7A 1RMVA 1ZU5A 2VB6A 3HLZA 3SXYA 1XWJA 1EI7A 1BR1A 2BC5A 2DGJA 2NG1A 1LE2A 5KYXA 3QTHA 5JSLA 4Q4ZF 2I8BA 2EIKC 4DJ9A 1H6GA 1K04A 1L7CA 1RKEA 3M1CB 3RVZA 5BQHA 5L3VA 3EG9A 5KYNA 2WB7A 4CS8A 4F4BA 3AG2C 4MVQA 3X1OA 4XWJA 1AVOB 2Q4FA 4MVSA 1LIHA 1ST6A 4EBKA 2Y3BA 2VCAA 3L34A 1HW2A 3L0IA 1Q0KA 2HMQA 3MYIA 4BJ6A 3OWTA 1R4TA 1U89A 2A0BA 3ABLC 3C7JA 4WABA 2ZXRA 1C02A 1SMYF 5L0FA 1U0BB 4MVMA 3DJNB 5D92A 4JC7A 2WZGA 4FESA 3V7OA 3K33A 3I4UA 1D0YA 4XEVA 3O39A 1OR3A 2IXNA 2KYHA 2D5RB 5KYUA 1NU9C 2Q00A 2Q9BA 2PX3A 4H4KC 3ZG1A 3NMIA 4MTOA 3Q7LA 4CDAA 1LVKA 1C17M 1HMDA 1U6HA 1WN0A 2F22A 4G0HA 3SXKA 2L6GA 4G7OF 4Z9IA 4I3MA 4J32B 4P9FA 1VLTA 2HJ3A 2YVKA 4O6YA 4PK4A 4E0IA 4NQFA 3NRHA 1YA7O 2RD9A 4XPWA 5A6JA 3UMHA 2J46A 2VH3A 3O6XA 2AU5A 4QI2A 1VMAA 3GODA 2XLHA 3E70C 2PF4E 3B71A 2XL6A 1A41A 5CI8A 2Q7RA 4NY3A 4HE8D 4U9DA 1OCZC 3N2ZB 4JTDB 2TMVP 3CAXA 1OKKA 2YQYA 3LS0A 1ZHXA 2VASA 1BZ4A 2P61A 4RDAA 2YLGA 2FGYA 2OKUA 4EUKB 4HEAJ 2JD3A 4M63A 3KYJA 2XLOA 4O6MA 2R9RB 2R7SA 3LLIA 1JR8A 3EJNA 3GM1A 4G78A 3B0PA 3C8GA 5A6AA 2XXAB 3TOMA 2G3VA 3S9OA 1NU7D 3DM9B 3JSEO 2Q9CA 3AG4C 1QQ3A 5F28E 3C62A 1QVXA 4BEMJ 4OIQF 2H7OA 3T6GB 1H9GA 2CW0F 2Z15A 2AP3A 3JYYA 4EWCA 1E84A 2J8WA 1LE4A 1M2VB 3EGXB 4LDRA 1FMVA 3HNKA 1TWAA 4D4XA 5JT4A 2AWYA 3NMKA 3U2MA 4JTCB 1SZIA 1TWGA 1XZQA 2Y3DA 3HNLA 1CGNA 2UUHA 4NCQA 4JJGA 5L0HA 3W8IA 2B0HA 4DXWA 2IXOA 1YARO 4E17A 4LDQA 2NUPA 4XTKA 1NBBA 3RF3A 4E18A 4PFOA 5GPGB 3MYFA 1YYXA 3IQCA 2OU6A 1O3UA 2IXPA 2YRFA 3EHNA 3GM2A 2HUJA 3KPHA 1Y6DA 2KGOA 2OEVA 3W8HA 2R25A 1OCCC 3S90A 3FDQA 1O87A 1D1AA 2RSEB 3S29A 4CS7A 1KNYA 4AE4B 2MWQA 1E85A 2L6HA 2PNOA 4NC3A 1C03A 1PD1A 1PV3A 5T1DB 3EG9B 2H7VC 4I1OB 2QE9A 4O6NA 2J45A 5B1AC 4CS9A 4N6HA 2UUIA 5DQZA 4MVZA 2PP4A 1Q0FA 3EH2A 3AOUA 3IQ5A 1O5HA 1NLXA 1ZZPA 3FAJA 4NTBA 4U5DE 4C3EA 3US6A 1Y4CA 4YT4A 2C03A 2QNLA 4K0DA 2ZD9A 1AUEA 3ZVRA 4WGYA 4LACB 1JPNA 1QPUA 1V55C 3DMDA 2H8AA 2NUTA 4FWVA 5KYUB 2KSFA 3T6JA 4LDKA 4BEJA 1GGQA 2R7UA 3RKOF 4AL1A 2BL2A 1CPQA 1UG7A 3C8ZA 3FMSA 1G5ZA 1JPJA 2X0CA 3ZSUA 3JT1A 1TFOB 1NG1A 3T4RA 3JYHA 3ZTMA 3FOPA 2CCYA 5L0IA 3GM3A 3GWNA 4HFKB 4BJ5A 1KTMA 1A7DA 3M4BA 1TR2A 4Z9JA 5JVEA 5KYWA 1HW1A 3ABKC 4ZLDA 5A6KA 2PBEA 4JIOA 1WASA 2J9UA 2OQMA 4YJWA 4YL3A 1OR2A 2G3KA 3IEEA 1HE1A 4ULVA 2KQ9A 1Q0MA 1M6TA 2NSGA 2P0NA 3R2PA 1BR2A 2CNWA 1CPRA 4YL0A 1TQGA 3EFOA 4BG0A 3IQTA 5DLJA 2KC3A 3S28A 1APCA 4GEHA 1OXKA 3QZCA 1PCXA 3ASNC 3MX3A 1MNEA 3WG7C 3E9VA 3GANA 2PX0A 2Y39A 3L1MA 4DOZA 1SYQA 1WOLA 3DD7A 4PR9A 3UGOA 3JZ0A 3K1HA 4CSAC 4XLPF 3UMIA 1ORYA 1ZYRF 2LD6A 4PJLA 3AJMA 3RH3A 4C3BA 1QSPA 3NMJA 4YT8A 2Q9AA 3H2VA 4IWBA 4P6IC 5E2QA 1RJ9A 5JRAA 3O10A 5L0DA 1VYKA 3LS1A 2HJMA 4BJTA 1T5OA 4MW8A 2EPOA 3O55A 3HTKC 2OG2A 3GEHA 2R05A 3JRMO 1YA9A 2EILC 3TK0A 4ZLCA 2P6VA 2WVQA 4PJNA 1WWPA 4MNDA 1VB5A 4DRIB 256BA 2A68F 4EKWA 4OD5A 2R7XA 5F5FA 3UGPA 4PACA 2NUPB 1OCOC 2BE5F 3T6BA 1FTSA 3A9CA 3ITFA 3KMIA 1GS9A 1GQAA 5DS6A 2IBFA
chains in the Genus database with same CATH topology
2HMZA 4XPXA 4XPWA 3WAQA 1I4YA 4XQ1A 3AGTA 1A7DA 2HMQA 3WHNA 2MHRA 2AVKA 2AWYA 2AWCA 1A7EA 1I4ZA 3AGUA 4XPYA 1HMDA 1HMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMZ A;  4XPX A;  4XPW A;  3WAQ A;  1I4Y A;  4XQ1 A;  3AGT A;  1A7D A;  2HMQ A;  3WHN A;  2MHR A;  2AVK A;  2AWY A;  2AWC A;  1A7E A;  1I4Z A;  3AGU A;  4XPY A;  1HMD A;  1HMO A; 
#chains in the Genus database with same CATH topology
 3NKD A;  2XLD A;  1QKR A;  4AL0 A;  1D0X A;  1WTY A;  2EIJ C;  3U9J A;  2FAP B;  4XQ1 A;  2ZXP A;  3EPV A;  4X0R A;  2GWW A;  2B0J A;  3DM5 A;  2XLM A;  3MLG A;  5B1B C;  4B6I A;  2W45 A;  3B9Q A;  5DVW A;  4DVY P;  3K1I C;  2C04 A;  4KNV A;  3V5X A;  4BPM A;  2LP4 A;  4KI2 A;  2EPL X;  2E87 A;  4GYT A;  2ETS A;  3SZR A;  5K0I A;  1DOV A;  5DS5 A;  1WAT A;  1G8X A;  3U3B A;  2NPU A;  2W9Y A;  3MBG A;  4U5E E;  1LI5 A;  1T6U A;  2DYR C;  2R7W A;  3G50 A;  2J7P D;  2XM4 A;  4E7Z A;  2VC9 A;  1DOW A;  5JS5 A;  2HS5 A;  4PJM A;  5HSW A;  4JEA A;  2L7A A;  4W8P A;  2LSE A;  3G4X A;  4JJF A;  2LK4 A;  3N24 A;  3RQE A;  3FOO A;  3SEO A;  4A4A A;  3NYM A;  1Z3I X;  3NYJ A;  2R7V A;  1MMD A;  4KBL A;  4FAP B;  4CSA A;  3ABM C;  1UFB A;  3UMK A;  1VK5 A;  1T6I A;  2ZPA A;  5DQT A;  1B68 A;  2OOC A;  3LUT B;  4CS8 C;  5KYW B;  1I4Z A;  3DE8 A;  1M57 C;  3K66 A;  1WGW A;  3OEO A;  4U5F E;  1EQ1 A;  1TFK B;  4JCZ A;  4O7G A;  1IZM A;  4ANJ A;  5BUO A;  5EK0 A;  4MTF A;  3UR3 C;  4BJ6 C;  3I5Q A;  1FFT C;  4JW1 A;  4XPY A;  1L3P A;  2VCB A;  3V5Z A;  3GOR A;  4WJ0 A;  5L0G A;  4KNW A;  3ZC4 A;  2X51 A;  3DWW A;  4YL1 A;  1G4W R;  5JP7 A;  2R7O A;  3M15 A;  2HMZ A;  5A6B D;  2EPM X;  5KYX B;  2V3C C;  3LEV A;  1YVI A;  4JUR I;  4YK5 A;  1LPE A;  3EZH A;  1RKE B;  3TD7 A;  4YWQ A;  3C18 A;  4J7Y A;  4MS2 A;  5T3T A;  2Y3H A;  1TKN A;  2YL7 A;  4I44 A;  3WHN A;  2D4U A;  1FAP B;  4OD4 A;  4GQH A;  3U0C A;  1YYJ A;  4DBQ A;  3K7D A;  3IHU A;  1ZU4 A;  2J0W A;  3CQZ A;  2EPN A;  4LLC A;  2R7R A;  4G7H F;  4MW3 A;  2GAQ A;  4IAQ A;  4AX2 A;  3BEH A;  2QTV A;  3AG1 C;  1XZP A;  1TWH A;  3NKE A;  2ZXO A;  5BQI A;  2I15 A;  4K1O A;  3TJ6 A;  1RCP A;  2YL1 A;  5AGF A;  4IJJ A;  4BJ1 A;  2QUP A;  2Y3G A;  1D0Z A;  1MMG A;  2XRH A;  4FX5 A;  2KK1 A;  3VM6 A;  3VYW A;  2JPU A;  1VTM P;  3JCU Q;  2HSQ A;  2J7P A;  3AQC A;  1YLM A;  1ORS C;  3CZ6 A;  3KH2 A;  1S7Z A;  4QDL A;  5T3W A;  3JTL O;  3ZWI A;  1ZW3 A;  2XLW A;  2P7V A;  3DAF A;  1GM5 A;  1E2X A;  2A1D D;  5E3A A;  3R7C A;  5CIV A;  1QZX A;  3W2W A;  5FCL A;  4RD9 A;  3HNI A;  3EH1 A;  2H7B A;  3RVY A;  2XLE A;  4EBJ A;  3NG1 A;  2LIG A;  5EGY A;  2LFF A;  1YZA A;  3KYI A;  1NFN A;  2R03 A;  4N6C A;  5JLI A;  2WVO A;  2IM8 A;  5COM A;  3BRJ A;  5AC4 A;  2OEX A;  3S84 A;  3PMR A;  3LLK A;  4CX9 A;  3W4Y A;  1LI7 A;  2KW3 C;  3U5S A;  5BQG A;  2YL0 A;  3SNH A;  1V54 C;  3U8P A;  4XEK A;  3NDB B;  3S27 A;  2GDC A;  1R5I D;  1H7I A;  4I1M A;  2J9V A;  3DE9 A;  1AEP A;  1LM3 B;  3LJB A;  1M2V A;  3C8G B;  4IGG A;  3ZTZ A;  4EBB A;  4JCH A;  2ASR A;  3DXJ F;  1OKK D;  4JTA B;  1FNT c;  3AQB A;  4JEB A;  3Q6M A;  3TQO A;  4JE9 A;  1T6Q A;  2AWC A;  2QY9 A;  2V26 A;  3ASO C;  4OIP F;  3RQG A;  5IY5 C;  1I5N A;  3SXM A;  2YHS A;  4CDV A;  1JAF A;  2KJG A;  3C8G D;  4DRH B;  2OJE D;  1H9T A;  1ZHW A;  3LES A;  2QLA A;  4KC9 A;  5L0J A;  1M2O A;  1OW7 A;  2EIN C;  1VLS A;  1OW6 A;  1ZW2 A;  4JRZ A;  5COG A;  3TOL A;  4AE4 A;  2NSF A;  2A6H F;  3TJ5 A;  2IYL D;  2WVN A;  2HFI A;  4HFF B;  3GEI A;  5E33 A;  2ZXW C;  4U9E A;  3PCV A;  4L6R A;  1PD0 A;  2HSB A;  4XPX A;  5KYY A;  1JRA A;  2A69 F;  2KNH A;  3M79 A;  2PFD A;  3RIP A;  1N1C A;  2MYS A;  3FVY A;  3RYL A;  4NTA A;  4YT5 A;  3VRC A;  5A69 A;  2Q3T A;  2CYD A;  2WZL A;  1OXB A;  3GEE A;  2WZF A;  3W2V A;  4OIN F;  3WOD F;  3G4Z A;  3X2Q C;  1RXQ A;  3N0T A;  4R32 A;  1OQC A;  1ZHT A;  3LEO A;  4W8K A;  4MTG A;  4IB4 A;  3Q6N A;  1Z7Q c;  1E86 A;  3QVY A;  4BJ5 C;  2L81 A;  2XS1 A;  3U8V A;  3ZDL A;  1K40 A;  3JSZ A;  2L6F A;  2M64 A;  4H54 A;  1K05 A;  4JKV A;  3EQL F;  2NUT B;  1MMN A;  2YKZ A;  4YN0 B;  3PHF 2;  2W4B A;  5CI9 A;  5JUA A;  2YZS A;  2XL8 A;  1TWC A;  1LKX A;  1I4Y A;  3EGD A;  3I5P A;  3U3F A;  3KL4 A;  3AGT A;  1ORJ A;  4G7Z F;  1QLE C;  2P1A A;  2IXM A;  1W2W A;  2Y69 C;  3PDM P;  2JX0 A;  3U9M A;  3ZIB A;  4J7T A;  3S0X A;  4LLE A;  4Z9H A;  5DS4 A;  4PFP A;  1A7E A;  1D1B A;  3DJU B;  3MFN A;  4EIY A;  4C7O A;  1YZC A;  1YAU O;  3L8J A;  4JVS A;  3GWL A;  3Q7G A;  4O79 A;  3FXH A;  3DAG A;  1BR4 A;  2DI3 A;  2XL4 A;  3VF0 A;  1F1M A;  4CBE A;  4ULW A;  4D4N A;  1EKY A;  2IOQ A;  1JOG A;  4U5C E;  1J8Y F;  1SR2 A;  1BBH A;  3EHM A;  5D91 A;  5HV9 A;  1E83 A;  4IAO A;  1Z63 A;  3J06 A;  3NYL A;  5E3C A;  4ONS A;  1V4A A;  4J30 B;  3EFO B;  3RQF A;  2EPK X;  2XLV A;  2J9B A;  2XSE A;  3HJC A;  4N4W A;  4E7S A;  1LS1 A;  2FFH A;  4CDY A;  3M4C A;  3HNJ A;  4EHP A;  4NTF A;  3DKA A;  5L3Q A;  2OCC C;  3CEX A;  3RFY A;  2GA0 A;  1T9K A;  4MQ9 F;  1JMW A;  5TJ5 E;  5EHH A;  1NSG B;  4QI0 A;  5L0C A;  3QVZ A;  1MND A;  5COF A;  2OJQ A;  4E0H A;  2CNW D;  1Q0G A;  2LFD A;  1RJ9 B;  2WL8 A;  3QW0 A;  1J8M F;  4U5B E;  2A0U A;  3SYN A;  4C3D A;  4DRJ B;  3ZQV A;  3TUL A;  2HKV A;  4K7B A;  3POV A;  2YL3 A;  2G62 A;  1FR0 A;  3AGU A;  4MVO A;  1G4U S;  3QMK A;  1IW7 F;  4MVU A;  3UNG C;  3CSK A;  1ZHZ A;  4IRU A;  1MMA A;  2VCC A;  3H65 A;  5B3I A;  2R7T A;  4MVR A;  4Q5S F;  1SF8 A;  1HMO A;  2J0X A;  3FHD A;  2LQG A;  4Q7C A;  1BDJ B;  1HE9 A;  3IQ6 A;  1FMW A;  2YLD A;  3L8I A;  3LNR A;  3LNM B;  4U5G A;  1A7V A;  1OCR C;  3SXZ A;  4A2N B;  1VOM A;  2O9X A;  1Q0D A;  4P9T A;  3WAQ A;  4CIP A;  5KYY B;  4OIR F;  1CGM E;  2A6E F;  1RKC A;  3QW1 A;  2XM0 A;  3HKK A;  1FFH A;  4IAR A;  1YJG A;  2YWA A;  4UDV A;  4CIH A;  4OIO F;  3T9O A;  3C63 A;  1LS4 A;  1M56 C;  3VAY A;  1T01 A;  4YT2 A;  3KKB A;  5B3S C;  3B0U X;  1YDI A;  2YEV A;  4WGZ A;  1ZVZ A;  4XEF A;  2HV6 A;  3V5Y A;  1A0B A;  2W4M A;  4XLN F;  1EA8 A;  4DBR A;  2GFH A;  3K6B A;  4JZA A;  3EZI A;  3F46 A;  2EIM C;  3LAY A;  3IPM O;  4U5H A;  2R02 A;  3FAP B;  2J9W A;  3ZQY A;  2XXA A;  3U2L A;  1CGO A;  3DI5 A;  4N06 A;  2XS8 A;  3B0V C;  3SP1 A;  1D1C A;  1NFO A;  4PJJ A;  5F5H A;  3K1I A;  1Z23 A;  2HZ8 A;  4AK9 A;  3RW0 A;  1KU2 A;  4CJG A;  2ICW G;  3F47 A;  4ER9 A;  1S05 A;  1Z6A A;  1NZE A;  1Z5Z A;  1ZHY A;  3EGX A;  3DZA A;  3H2U A;  5A6B A;  2LCH A;  1V74 B;  3A11 A;  3EGD B;  2MHR A;  2R7Q A;  4DVZ A;  5AC5 A;  2AVK A;  2CDQ A;  2DYS C;  1HY5 A;  2CGE A;  1OW8 A;  2M4E A;  4RBN A;  1MQV A;  3B29 A;  3ATP A;  2YLI A;  2DB4 A;  3AG3 C;  5FZT A;  3JRT A;  4LER A;  3OA1 A;  4CJO A;  4C7O B;  1VYI A;  2L9J A;  3ECS A;  4CS9 C;  2HV7 A;  1RMV A;  1ZU5 A;  2VB6 A;  3HLZ A;  3SXY A;  1XWJ A;  1EI7 A;  1BR1 A;  2BC5 A;  2DGJ A;  2NG1 A;  1LE2 A;  5KYX A;  3QTH A;  5JSL A;  4Q4Z F;  2I8B A;  2EIK C;  4DJ9 A;  1H6G A;  1K04 A;  1L7C A;  1RKE A;  3M1C B;  3RVZ A;  5BQH A;  5L3V A;  3EG9 A;  5KYN A;  2WB7 A;  4CS8 A;  4F4B A;  3AG2 C;  4MVQ A;  3X1O A;  4XWJ A;  1AVO B;  2Q4F A;  4MVS A;  1LIH A;  1ST6 A;  4EBK A;  2Y3B A;  2VCA A;  3L34 A;  1HW2 A;  3L0I A;  1Q0K A;  2HMQ A;  3MYI A;  4BJ6 A;  3OWT A;  1R4T A;  1U89 A;  2A0B A;  3ABL C;  3C7J A;  4WAB A;  2ZXR A;  1C02 A;  1SMY F;  5L0F A;  1U0B B;  4MVM A;  3DJN B;  5D92 A;  4JC7 A;  2WZG A;  4FES A;  3V7O A;  3K33 A;  3I4U A;  1D0Y A;  4XEV A;  3O39 A;  1OR3 A;  2IXN A;  2KYH A;  2D5R B;  5KYU A;  1NU9 C;  2Q00 A;  2Q9B A;  2PX3 A;  4H4K C;  3ZG1 A;  3NMI A;  4MTO A;  3Q7L A;  4CDA A;  1LVK A;  1C17 M;  1HMD A;  1U6H A;  1WN0 A;  2F22 A;  4G0H A;  3SXK A;  2L6G A;  4G7O F;  4Z9I A;  4I3M A;  4J32 B;  4P9F A;  1VLT A;  2HJ3 A;  2YVK A;  4O6Y A;  4PK4 A;  4E0I A;  4NQF A;  3NRH A;  1YA7 O;  2RD9 A;  4XPW A;  5A6J A;  3UMH A;  2J46 A;  2VH3 A;  3O6X A;  2AU5 A;  4QI2 A;  1VMA A;  3GOD A;  2XLH A;  3E70 C;  2PF4 E;  3B71 A;  2XL6 A;  1A41 A;  5CI8 A;  2Q7R A;  4NY3 A;  4HE8 D;  4U9D A;  1OCZ C;  3N2Z B;  4JTD B;  2TMV P;  3CAX A;  1OKK A;  2YQY A;  3LS0 A;  1ZHX A;  2VAS A;  1BZ4 A;  2P61 A;  4RDA A;  2YLG A;  2FGY A;  2OKU A;  4EUK B;  4HEA J;  2JD3 A;  4M63 A;  3KYJ A;  2XLO A;  4O6M A;  2R9R B;  2R7S A;  3LLI A;  1JR8 A;  3EJN A;  3GM1 A;  4G78 A;  3B0P A;  3C8G A;  5A6A A;  2XXA B;  3TOM A;  2G3V A;  3S9O A;  1NU7 D;  3DM9 B;  3JSE O;  2Q9C A;  3AG4 C;  1QQ3 A;  5F28 E;  3C62 A;  1QVX A;  4BEM J;  4OIQ F;  2H7O A;  3T6G B;  1H9G A;  2CW0 F;  2Z15 A;  2AP3 A;  3JYY A;  4EWC A;  1E84 A;  2J8W A;  1LE4 A;  1M2V B;  3EGX B;  4LDR A;  1FMV A;  3HNK A;  1TWA A;  4D4X A;  5JT4 A;  2AWY A;  3NMK A;  3U2M A;  4JTC B;  1SZI A;  1TWG A;  1XZQ A;  2Y3D A;  3HNL A;  1CGN A;  2UUH A;  4NCQ A;  4JJG A;  5L0H A;  3W8I A;  2B0H A;  4DXW A;  2IXO A;  1YAR O;  4E17 A;  4LDQ A;  2NUP A;  4XTK A;  1NBB A;  3RF3 A;  4E18 A;  4PFO A;  5GPG B;  3MYF A;  1YYX A;  3IQC A;  2OU6 A;  1O3U A;  2IXP A;  2YRF A;  3EHN A;  3GM2 A;  2HUJ A;  3KPH A;  1Y6D A;  2KGO A;  2OEV A;  3W8H A;  2R25 A;  1OCC C;  3S90 A;  3FDQ A;  1O87 A;  1D1A A;  2RSE B;  3S29 A;  4CS7 A;  1KNY A;  4AE4 B;  2MWQ A;  1E85 A;  2L6H A;  2PNO A;  4NC3 A;  1C03 A;  1PD1 A;  1PV3 A;  5T1D B;  3EG9 B;  2H7V C;  4I1O B;  2QE9 A;  4O6N A;  2J45 A;  5B1A C;  4CS9 A;  4N6H A;  2UUI A;  5DQZ A;  4MVZ A;  2PP4 A;  1Q0F A;  3EH2 A;  3AOU A;  3IQ5 A;  1O5H A;  1NLX A;  1ZZP A;  3FAJ A;  4NTB A;  4U5D E;  4C3E A;  3US6 A;  1Y4C A;  4YT4 A;  2C03 A;  2QNL A;  4K0D A;  2ZD9 A;  1AUE A;  3ZVR A;  4WGY A;  4LAC B;  1JPN A;  1QPU A;  1V55 C;  3DMD A;  2H8A A;  2NUT A;  4FWV A;  5KYU B;  2KSF A;  3T6J A;  4LDK A;  4BEJ A;  1GGQ A;  2R7U A;  3RKO F;  4AL1 A;  2BL2 A;  1CPQ A;  1UG7 A;  3C8Z A;  3FMS A;  1G5Z A;  1JPJ A;  2X0C A;  3ZSU A;  3JT1 A;  1TFO B;  1NG1 A;  3T4R A;  3JYH A;  3ZTM A;  3FOP A;  2CCY A;  5L0I A;  3GM3 A;  3GWN A;  4HFK B;  4BJ5 A;  1KTM A;  1A7D A;  3M4B A;  1TR2 A;  4Z9J A;  5JVE A;  5KYW A;  1HW1 A;  3ABK C;  4ZLD A;  5A6K A;  2PBE A;  4JIO A;  1WAS A;  2J9U A;  2OQM A;  4YJW A;  4YL3 A;  1OR2 A;  2G3K A;  3IEE A;  1HE1 A;  4ULV A;  2KQ9 A;  1Q0M A;  1M6T A;  2NSG A;  2P0N A;  3R2P A;  1BR2 A;  2CNW A;  1CPR A;  4YL0 A;  1TQG A;  3EFO A;  4BG0 A;  3IQT A;  5DLJ A;  2KC3 A;  3S28 A;  1APC A;  4GEH A;  1OXK A;  3QZC A;  1PCX A;  3ASN C;  3MX3 A;  1MNE A;  3WG7 C;  3E9V A;  3GAN A;  2PX0 A;  2Y39 A;  3L1M A;  4DOZ A;  1SYQ A;  1WOL A;  3DD7 A;  4PR9 A;  3UGO A;  3JZ0 A;  3K1H A;  4CSA C;  4XLP F;  3UMI A;  1ORY A;  1ZYR F;  2LD6 A;  4PJL A;  3AJM A;  3RH3 A;  4C3B A;  1QSP A;  3NMJ A;  4YT8 A;  2Q9A A;  3H2V A;  4IWB A;  4P6I C;  5E2Q A;  1RJ9 A;  5JRA A;  3O10 A;  5L0D A;  1VYK A;  3LS1 A;  2HJM A;  4BJT A;  1T5O A;  4MW8 A;  2EPO A;  3O55 A;  3HTK C;  2OG2 A;  3GEH A;  2R05 A;  3JRM O;  1YA9 A;  2EIL C;  3TK0 A;  4ZLC A;  2P6V A;  2WVQ A;  4PJN A;  1WWP A;  4MND A;  1VB5 A;  4DRI B;  256B A;  2A68 F;  4EKW A;  4OD5 A;  2R7X A;  5F5F A;  3UGP A;  4PAC A;  2NUP B;  1OCO C;  2BE5 F;  3T6B A;  1FTS A;  3A9C A;  3ITF A;  3KMI A;  1GS9 A;  1GQA A;  5DS6 A;  2IBF A; 
#chains in the Genus database with same CATH homology
 2HMZ A;  4XPX A;  4XPW A;  3WAQ A;  1I4Y A;  4XQ1 A;  3AGT A;  1A7D A;  2HMQ A;  3WHN A;  2MHR A;  2AVK A;  2AWY A;  2AWC A;  1A7E A;  1I4Z A;  3AGU A;  4XPY A;  1HMD A;  1HMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...