1Z7Qc

Crystal structure of the 20s proteasome from yeast in complex with the proteasome activator pa26 from trypanosome brucei at 3.2 angstroms resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
230
structure length
230
Chain Sequence
PPKRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGVDAESGKTKGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGSDHMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proteasome component C7-alpha
publication title The 1.9 A structure of a proteasome-11S activator complex and implications for proteasome-PAN/PA700 interactions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/hydrolase activator
total genus 80
structure length 230
sequence length 230
chains with identical sequence d, e, f, g, h, i, j, k, l, m, n, o, p
ec nomenclature
pdb deposition date 2005-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
c PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1z7qc01
1YA7O 3JSEO 3JRMO 3IPMO 1YARO 1FNTc 1YAUO 1AVOB 3JTLO 1Z7Qc
chains in the Genus database with same CATH superfamily
1O5HA 3DE8A 4PACA 2AVKA 1NFNA 1CGOA 4JJFA 4HFKB 4U5EE 1BR4A 2HFIA 3LS0A 1MMAA 2NUTA 4HEAJ 2XL4A 3W8HA 1VYKA 4C3BA 4E0HA 4IAOA 4P9FA 4Z9JA 4JC7A 3RW0A 3JYHA 3CZ6A 3I5PA 3W4YA 1Z23A 4EBBA 2G62A 4XPXA 3LS1A 4BJTA 3O6XA 4YT5A 3HJCA 3IHUA 1E84A 2EINC 3JZ0A 2LD6A 5EGYA 3M15A 1Z5ZA 2BC5A 2HS5A 4WGZA 2PX0A 2VCBA 2LIGA 3AG3C 4U5BE 1FR0A 1J8YF 1NLXA 3K7DA 4IB4A 2XRHA 2D4UA 2ETSA 4CS8C 1O87A 2ZXWC 3RF3A 4E18A 1HW2A 2CGEA 2EIJC 2PNOA 2HV6A 2P61A 2Q9BA 1TWAA 4WGYA 4Z9HA 3ZVRA 4K0DA 1ORSC 4I1OB 4DRHB 4HFFB 4U5HA 4EKWA 1AUEA 4ONSA 5JT4A 1KTMA 1WWPA 3K6BA 2YLDA 4OD5A 2EPMX 2XXAA 4MVSA 3ZQVA 1YYXA 3DM5A 4OIOF 1GQAA 3MYIA 3V5XA 2UUIA 1YLMA 3S90A 2JX0A 4DVZA 5L0IA 2Q4FA 1JPJA 4WJ0A 2A6HF 5IY5C 1QKRA 3GM1A 1SZIA 3EPVA 3FHDA 3IQ5A 3NYMA 4MVZA 4P6IC 2I8BA 4PJLA 2QLAA 2YZSA 5JRAA 2YQYA 1FTSA 5CI8A 4XEFA 2ZD9A 3G50A 5E33A 3UMIA 1JMWA 2GDCA 1QQ3A 2CDQA 4YL0A 5L3VA 3H65A 5JLIA 1EI7A 1YVIA 3AGTA 3EGDB 1FMVA 3HTKC 4N06A 5KYWB 5GPGB 2OQMA 1M2VB 2KJGA 1RJ9A 2R05A 2VCCA 3NRHA 3B9QA 3NG1A 2VC9A 4D4XA 2NUPB 1HW1A 4OIPF 3DMDA 3U3BA 1OKKA 2J7PD 1M2OA 3UGOA 2J9UA 4BEJA 3SYNA 2R7SA 1ORYA 2G3KA 2IXMA 4XLNF 3FOOA 1D0YA 1F1MA 1O3UA 3GEHA 4CX9A 2BL2A 2Y69C 5B3IA 3ABLC 3QW0A 3DAGA 3LEVA 5T1DB 4JZAA 4BPMA 1I4ZA 3X1OA 2YEVA 3DM9B 4XEKA 3C8GA 2FAPB 1CGNA 3DI5A 4YL3A 2IYLD 3B0UX 4CDAA 1LS4A 2DYSC 4G7ZF 2PX3A 2J9WA 3SXMA 1T6IA 4H54A 1W2WA 4OIRF 3U3FA 4CJGA 1OW6A 4CIHA 3G4ZA 3EHMA 1CGME 3ZIBA 2A0UA 1A7DA 5JUAA 1RKEA 3S29A 2M4EA 1TR2A 4PFPA 4IGGA 4CSAA 4LLEA 3X2QC 1D1AA 1RCPA 4JEBA 2XLMA 1PD1A 4JE9A 3GANA 2Y3DA 5L0GA 2XLDA 2RD9A 3RH3A 3AJMA 1M2VA 4JTDB 5F5FA 3C7JA 2H7VC 3LJBA 3EQLF 5DLJA 2WZGA 3JCUQ 3DE9A 4MTOA 2MWQA 3E9VA 4YT8A 4O6YA 5BQGA 3ASOC 3SXZA 1VB5A 4A2NB 2GWWA 4ZLDA 2J0WA 2H7BA 3EG9A 1D0XA 1TWHA 5DS5A 1DOWA 2OKUA 2VCAA 2HV7A 2Q7RA 3S9OA 3HNLA 3NMJA 1YZCA 4KC9A 4YT2A 3JYYA 2PF4E 2HKVA 1H6GA 4FWVA 4PFOA 5JS5A 2W4MA 5A6KA 5HSWA 3ATPA 3KYIA 1SR2A 3CEXA 3A11A 3AGUA 4IWBA 3RYLA 3LNRA 1JOGA 4FESA 1AVOB 1FMWA 2EPNA 2HSQA 3S27A 2KNHA 2R7OA 3UR3C 2WVOA 1IW7F 1PCXA 4G7HF 4ZLCA 3MBGA 2KYHA 2NSFA 4L6RA 1R5ID 3DXJF 1I4YA 4YK5A 2YLGA 3O10A 4R32A 4MQ9F 3MYFA 3ZWIA 4H4KC 4NTBA 3U0CA 4MTFA 3QZCA 4JTCB 5A6BA 1WASA 1QSPA 4NCQA 4W8KA 2Q00A 3ZDLA 5DS6A 1XZQA 2OJED 3U9MA 3C8ZA 1NG1A 1Q0FA 5L0DA 1K40A 3NKEA 4JCZA 4AL0A 2D5RB 3GORA 1LI5A 3GODA 2LSEA 1TQGA 2OJQA 2XSEA 3Q6MA 2LFDA 1LI7A 2L9JA 2R7TA 4Q5SF 5DS4A 5KYUB 2KC3A 2YL1A 4M63A 4BEMJ 5F5HA 1A7EA 1L3PA 2YL0A 3LLIA 1HMOA 1M56C 4ER9A 3SXKA 2B0HA 2LQGA 1ZHYA 3PDMP 2P1AA 2XLOA 2YKZA 3S0XA 1VOMA 2V3CC 1T5OA 2P0NA 1ORJA 3JRMO 1BZ4A 2HMQA 4GQHA 3ZSUA 1XZPA 1ZHTA 4JRZA 4O79A 1I5NA 3WHNA 1G4US 3T6GB 1RXQA 1PD0A 4EWCA 4XPWA 2PP4A 3L34A 4C3EA 2O9XA 3V7OA 3VAYA 4EBJA 4JTAB 2FFHA 2OCCC 2DGJA 2NSGA 1Q0GA 4PR9A 1VLSA 3T4RA 3W2WA 2Y3BA 3EZHA 3IQTA 3KL4A 1S7ZA 1S05A 2XM0A 3PMRA 4LERA 3AOUA 3TD7A 3CSKA 3B29A 1NZEA 2AP3A 3FVYA 3KYJA 2KK1A 3MX3A 4G7OF 4KI2A 3FDQA 2R7WA 2IBFA 2WL8A 3C62A 3FAJA 2XLHA 2QNLA 5B3SC 2F22A 4O6MA 1WGWA 4PJJA 1V55C 4E7ZA 1VLTA 4I1MA 4QDLA 2XL8A 2Q9CA 3J06A 1H9TA 2IXPA 2J0XA 3SNHA 5KYNA 1OXBA 4DXWA 1LPEA 2IXNA 4Q4ZF 3K33A 3Q7LA 1J8MF 256BA 4ULVA 4CJOA 2WVQA 5BQHA 2XLWA 2R25A 1TFOB 1ZHZA 4BJ1A 4CS7A 3JRTA 5KYXB 1RKCA 2KW3C 1IZMA 2YWAA 4AK9A 4CIPA 4J7TA 3JSEO 2IM8A 1C17M 3N24A 1VYIA 2J8WA 1HMDA 1ZZPA 2LCHA 1OR3A 3QVYA 2LP4A 1OCOC 1K05A 3F46A 2TMVP 3MLGA 2B0JA 2C03A 2YRFA 4EIYA 5HV9A 4B6IA 4U5FE 4YN0B 1U89A 3B71A 1BR1A 3V5YA 1VMAA 1Z63A 4QI0A 2ICWG 2Y3GA 1MNDA 2I15A 3K1HA 1D1CA 4J30B 2ASRA 3C8GD 1Z3IX 3HLZA 2L81A 1U6HA 3U2MA 1YA9A 1ZHXA 3RQEA 2J7PA 4DOZA 2OU6A 3ZTMA 3L8JA 4PJNA 3K1IA 4I44A 2YLIA 4YL1A 1R4TA 3KMIA 2G3VA 1DOVA 4JKVA 3K1IC 2C04A 2HZ8A 2YVKA 3AQBA 3HNKA 3AG4C 3M79A 4N6CA 4NQFA 3ZC4A 5JSLA 2WZFA 5A6AA 3GWNA 5KYWA 4CSAC 3EGDA 2W45A 4D4NA 3JT1A 3BEHA 3BRJA 5KYXA 3S84A 1BDJB 2GA0A 2H8AA 4GYTA 2A68F 2NUPA 3ASNC 4U9DA 2AU5A 4LACB 2CNWA 2IXOA 2Z15A 4Z9IA 2R02A 4K7BA 1UG7A 3TQOA 2NG1A 1LE2A 2FGYA 5COFA 4IAQA 5D91A 5AC5A 1EQ1A 3V5ZA 2NPUA 3CQZA 5T3TA 3GEIA 3R7CA 3POVA 5KYYB 1TWCA 2HJ3A 3HNJA 1N1CA 2DYRC 3O55A 3FXHA 4PK4A 4DVYP 3NMIA 4XTKA 1T6QA 4O7GA 2JPUA 4FAPB 2A69F 1D1BA 4IRUA 1V4AA 4LDRA 1ST6A 5CI9A 3EJNA 3AG2C 4G78A 3EZIA 5AC4A 3W8IA 2W4BA 2A1DD 3N0TA 1E83A 3DAFA 1G5ZA 5JP7A 1OCCC 2L6HA 1ZYRF 4NY3A 5L0CA 1YYJA 3LEOA 2CYDA 2E87A 5F28E 3T6JA 4BJ5A 1FNTc 1QVXA 1WTYA 1JPNA 1NU7D 4QI2A 1EKYA 3N2ZB 4BJ5C 1ZVZA 2OEVA 3LLKA 2LK4A 1CPRA 2W9YA 1WOLA 1NBBA 3FMSA 2XLVA 3R2PA 3GM3A 3RVZA 3NMKA 2QE9A 4RBNA 2A0BA 1EA8A 2LFFA 4RDAA 4ULWA 5EK0A 1Z7Qc 3L0IA 3W2VA 1NU9C 2X0CA 3K66A 3T9OA 4O6NA 4K1OA 4MTGA 2R7VA 4FX5A 1LVKA 3US6A 4DRIB 5KYYA 2L6GA 4LDQA 3I4UA 4LLCA 5EHHA 4MVQA 1AEPA 3U8PA 5B1AC 4JEAA 1OR2A 1FFTC 3SZRA 4AL1A 1H9GA 4OINF 2MYSA 2QY9A 1M57C 1B68A 2X51A 3EH2A 3IPMO 1ZW2A 4MW8A 4DBQA 3KH2A 1RMVA 3Q6NA 3DD7A 1L7CA 1LIHA 3DJUB 4OIQF 4C7OB 2XL6A 5B1BC 4RD9A 1LS1A 2WB7A 3VYWA 1JAFA 3C63A 4DJ9A 2YL3A 4LDKA 4ANJA 1HE1A 4BG0A 4YWQA 5TJ5E 3ABMC 3JSZA 3FAPB 4XEVA 1LM3B 5DQZA 2ZPAA 4E17A 5K0IA 4JCHA 2EPOA 1T01A 3AG1C 1D0ZA 4GEHA 3QVZA 4HE8D 5AGFA 3ZG1A 1E85A 4JW1A 1RJ9B 1Z6AA 4KBLA 2PFDA 2VB6A 3UNGC 3VRCA 4CS8A 3F47A 4AX2A 4N4WA 3TOLA 2Y3HA 1ZHWA 4X0RA 2YL7A 1NSGB 4YJWA 3C18A 1Q0MA 5KYUA 1E2XA 1KNYA 1WN0A 2Y39A 3U2LA 2GAQA 1T6UA 3DWWA 3ITFA 3UMHA 5COGA 4E7SA 3ZTZA 4P9TA 4OD4A 4IARA 2R7UA 3EHNA 2EIMC 2IOQA 1MMGA 3WG7C 2WZLA 2XS1A 3OA1A 2R7XA 3EH1A 3C8GB 3UGPA 3PCVA 2DB4A 2ZXRA 1NFOA 2AWCA 2HMZA 3AQCA 3DKAA 1KU2A 3RQGA 3SXYA 2HUJA 3TJ5A 1OW8A 2EIKC 4U9EA 4C7OA 2XM4A 1OKKD 3DZAA 1C03A 1YARO 3TOMA 1PV3A 3OEOA 1MMDA 1TKNA 3TK0A 4J32B 3ZQYA 5L0HA 3SEOA 1RKEB 2J45A 2KSFA 2VASA 1G8XA 2KQ9A 2P7VA 3I5QA 5DVWA 5A69A 2EILC 3M1CB 4CS9A 1OQCA 5E3CA 4UDVA 3A9CA 3U8VA 5T3WA 1OCZC 3IEEA 3M4BA 3QW1A 4CS9C 2GFHA 3ABKC 3NYLA 2QUPA 3IQCA 1E86A 1Q0DA 3H2VA 1TWGA 3LUTB 3JTLO 4JIOA 3IQ6A 3QTHA 1CPQA 2Q3TA 3WODF 1SF8A 1YJGA 5A6JA 3NDBB 3LAYA 2H7OA 4I3MA 4EBKA 2UUHA 1BBHA 4NTFA 4MW3A 2V26A 4F4BA 1WATA 4EHPA 1BR2A 4CDYA 3EG9B 3LESA 4XPYA 3NKDA 4AE4B 4EUKB 4MNDA 1YAUO 4U5DE 1VTMP 3GM2A 3OWTA 3O39A 4NTAA 3HNIA 3RIPA 1YA7O 1HE9A 1SMYF 1T9KA 1XWJA 1ZW3A 2ZXPA 3EGXB 1LE4A 3KKBA 5E2QA 5FZTA 3RKOF 2J9BA 3DJNB 4NC3A 1APCA 1UFBA 4XQ1A 1M6TA 2KGOA 4DRJB 2A6EF 2XS8A 2CNWD 3WAQA 1QLEC 2EPKX 2QTVA 1JRAA 4JJGA 3RFYA 4C3DA 4G0HA 5BUOA 1YDIA 1HY5A 3GEEA 1OCRC 1TFKB 2R7QA 1V74B 2OG2A 2BE5F 2R03A 3B0PA 3GWLA 3KPHA 5FCLA 4W8PA 4U5CE 4A4AA 1GM5A 2YHSA 2VH3A 1MMNA 3ECSA 2L6FA 2P6VA 2L7AA 1Y6DA 1QZXA 3NYJA 1A7VA 1G4WR 3SP1A 2XLEA 3TJ6A 4CBEA 2WVNA 3EFOB 1A41A 3L8IA 2EPLX 4IJJA 1Y4CA 2HJMA 1YZAA 3VF0A 4CDVA 2CCYA 2DI3A 3PHF2 4E0IA 1SYQA 2OOCA 4XWJA 3FOPA 4MVRA 4JURI 4KNWA 5BQIA 2PBEA 2R7RA 3LNMB 3B0VC 2NUTB 4AE4A 1LKXA 5A6BD 5E3AA 4MVMA 5CIVA 4YT4A 1OW7A 4KNVA 3UMKA 1FFHA 4MS2A 3EGXA 3G4XA 4DBRA 3L1MA 3RVYA 3T6BA 5D92A 3U5SA 3E70C 1C02A 1ZU4A 4MVUA 3VM6A 3TULA 2OEXA 1A0BA 5L0JA 1U0BB 1GS9A 2J46A 2HSBA 2ZXOA 3MFNA 1MQVA 3Q7GA 3U9JA 4MVOA 1ZU5A 5L0FA 2M64A 4JVSA 3H2UA 1GGQA 1VK5A 1JR8A 1K04A 2J9VA 1H7IA 3S28A 5DQTA 4XLPF 4Q7CA 3RQFA 1OXKA 3HKKA 4BJ6A 2RSEB 1Q0KA 1V54C 2CW0F 1QPUA 4WABA 4U5GA 2XXAB 3M4CA 5L3QA 4BJ6C 1MNEA 5COMA 4N6HA 5JVEA 3EFOA 2R9RB 4J7YA 2MHRA 2JD3A 3CAXA 1FAPB 3QMKA 2AWYA 2Q9AA 4PJMA
chains in the Genus database with same CATH topology
1YA7O 3JSEO 3JRMO 3IPMO 1YARO 1FNTc 1YAUO 1AVOB 3JTLO 1Z7Qc
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YA7 O;  3JSE O;  3JRM O;  3IPM O;  1YAR O;  1FNT c;  1YAU O;  1AVO B;  3JTL O;  1Z7Q c; 
#chains in the Genus database with same CATH topology
 1O5H A;  3DE8 A;  4PAC A;  2AVK A;  1NFN A;  1CGO A;  4JJF A;  4HFK B;  4U5E E;  1BR4 A;  2HFI A;  3LS0 A;  1MMA A;  2NUT A;  4HEA J;  2XL4 A;  3W8H A;  1VYK A;  4C3B A;  4E0H A;  4IAO A;  4P9F A;  4Z9J A;  4JC7 A;  3RW0 A;  3JYH A;  3CZ6 A;  3I5P A;  3W4Y A;  1Z23 A;  4EBB A;  2G62 A;  4XPX A;  3LS1 A;  4BJT A;  3O6X A;  4YT5 A;  3HJC A;  3IHU A;  1E84 A;  2EIN C;  3JZ0 A;  2LD6 A;  5EGY A;  3M15 A;  1Z5Z A;  2BC5 A;  2HS5 A;  4WGZ A;  2PX0 A;  2VCB A;  2LIG A;  3AG3 C;  4U5B E;  1FR0 A;  1J8Y F;  1NLX A;  3K7D A;  4IB4 A;  2XRH A;  2D4U A;  2ETS A;  4CS8 C;  1O87 A;  2ZXW C;  3RF3 A;  4E18 A;  1HW2 A;  2CGE A;  2EIJ C;  2PNO A;  2HV6 A;  2P61 A;  2Q9B A;  1TWA A;  4WGY A;  4Z9H A;  3ZVR A;  4K0D A;  1ORS C;  4I1O B;  4DRH B;  4HFF B;  4U5H A;  4EKW A;  1AUE A;  4ONS A;  5JT4 A;  1KTM A;  1WWP A;  3K6B A;  2YLD A;  4OD5 A;  2EPM X;  2XXA A;  4MVS A;  3ZQV A;  1YYX A;  3DM5 A;  4OIO F;  1GQA A;  3MYI A;  3V5X A;  2UUI A;  1YLM A;  3S90 A;  2JX0 A;  4DVZ A;  5L0I A;  2Q4F A;  1JPJ A;  4WJ0 A;  2A6H F;  5IY5 C;  1QKR A;  3GM1 A;  1SZI A;  3EPV A;  3FHD A;  3IQ5 A;  3NYM A;  4MVZ A;  4P6I C;  2I8B A;  4PJL A;  2QLA A;  2YZS A;  5JRA A;  2YQY A;  1FTS A;  5CI8 A;  4XEF A;  2ZD9 A;  3G50 A;  5E33 A;  3UMI A;  1JMW A;  2GDC A;  1QQ3 A;  2CDQ A;  4YL0 A;  5L3V A;  3H65 A;  5JLI A;  1EI7 A;  1YVI A;  3AGT A;  3EGD B;  1FMV A;  3HTK C;  4N06 A;  5KYW B;  5GPG B;  2OQM A;  1M2V B;  2KJG A;  1RJ9 A;  2R05 A;  2VCC A;  3NRH A;  3B9Q A;  3NG1 A;  2VC9 A;  4D4X A;  2NUP B;  1HW1 A;  4OIP F;  3DMD A;  3U3B A;  1OKK A;  2J7P D;  1M2O A;  3UGO A;  2J9U A;  4BEJ A;  3SYN A;  2R7S A;  1ORY A;  2G3K A;  2IXM A;  4XLN F;  3FOO A;  1D0Y A;  1F1M A;  1O3U A;  3GEH A;  4CX9 A;  2BL2 A;  2Y69 C;  5B3I A;  3ABL C;  3QW0 A;  3DAG A;  3LEV A;  5T1D B;  4JZA A;  4BPM A;  1I4Z A;  3X1O A;  2YEV A;  3DM9 B;  4XEK A;  3C8G A;  2FAP B;  1CGN A;  3DI5 A;  4YL3 A;  2IYL D;  3B0U X;  4CDA A;  1LS4 A;  2DYS C;  4G7Z F;  2PX3 A;  2J9W A;  3SXM A;  1T6I A;  4H54 A;  1W2W A;  4OIR F;  3U3F A;  4CJG A;  1OW6 A;  4CIH A;  3G4Z A;  3EHM A;  1CGM E;  3ZIB A;  2A0U A;  1A7D A;  5JUA A;  1RKE A;  3S29 A;  2M4E A;  1TR2 A;  4PFP A;  4IGG A;  4CSA A;  4LLE A;  3X2Q C;  1D1A A;  1RCP A;  4JEB A;  2XLM A;  1PD1 A;  4JE9 A;  3GAN A;  2Y3D A;  5L0G A;  2XLD A;  2RD9 A;  3RH3 A;  3AJM A;  1M2V A;  4JTD B;  5F5F A;  3C7J A;  2H7V C;  3LJB A;  3EQL F;  5DLJ A;  2WZG A;  3JCU Q;  3DE9 A;  4MTO A;  2MWQ A;  3E9V A;  4YT8 A;  4O6Y A;  5BQG A;  3ASO C;  3SXZ A;  1VB5 A;  4A2N B;  2GWW A;  4ZLD A;  2J0W A;  2H7B A;  3EG9 A;  1D0X A;  1TWH A;  5DS5 A;  1DOW A;  2OKU A;  2VCA A;  2HV7 A;  2Q7R A;  3S9O A;  3HNL A;  3NMJ A;  1YZC A;  4KC9 A;  4YT2 A;  3JYY A;  2PF4 E;  2HKV A;  1H6G A;  4FWV A;  4PFO A;  5JS5 A;  2W4M A;  5A6K A;  5HSW A;  3ATP A;  3KYI A;  1SR2 A;  3CEX A;  3A11 A;  3AGU A;  4IWB A;  3RYL A;  3LNR A;  1JOG A;  4FES A;  1AVO B;  1FMW A;  2EPN A;  2HSQ A;  3S27 A;  2KNH A;  2R7O A;  3UR3 C;  2WVO A;  1IW7 F;  1PCX A;  4G7H F;  4ZLC A;  3MBG A;  2KYH A;  2NSF A;  4L6R A;  1R5I D;  3DXJ F;  1I4Y A;  4YK5 A;  2YLG A;  3O10 A;  4R32 A;  4MQ9 F;  3MYF A;  3ZWI A;  4H4K C;  4NTB A;  3U0C A;  4MTF A;  3QZC A;  4JTC B;  5A6B A;  1WAS A;  1QSP A;  4NCQ A;  4W8K A;  2Q00 A;  3ZDL A;  5DS6 A;  1XZQ A;  2OJE D;  3U9M A;  3C8Z A;  1NG1 A;  1Q0F A;  5L0D A;  1K40 A;  3NKE A;  4JCZ A;  4AL0 A;  2D5R B;  3GOR A;  1LI5 A;  3GOD A;  2LSE A;  1TQG A;  2OJQ A;  2XSE A;  3Q6M A;  2LFD A;  1LI7 A;  2L9J A;  2R7T A;  4Q5S F;  5DS4 A;  5KYU B;  2KC3 A;  2YL1 A;  4M63 A;  4BEM J;  5F5H A;  1A7E A;  1L3P A;  2YL0 A;  3LLI A;  1HMO A;  1M56 C;  4ER9 A;  3SXK A;  2B0H A;  2LQG A;  1ZHY A;  3PDM P;  2P1A A;  2XLO A;  2YKZ A;  3S0X A;  1VOM A;  2V3C C;  1T5O A;  2P0N A;  1ORJ A;  3JRM O;  1BZ4 A;  2HMQ A;  4GQH A;  3ZSU A;  1XZP A;  1ZHT A;  4JRZ A;  4O79 A;  1I5N A;  3WHN A;  1G4U S;  3T6G B;  1RXQ A;  1PD0 A;  4EWC A;  4XPW A;  2PP4 A;  3L34 A;  4C3E A;  2O9X A;  3V7O A;  3VAY A;  4EBJ A;  4JTA B;  2FFH A;  2OCC C;  2DGJ A;  2NSG A;  1Q0G A;  4PR9 A;  1VLS A;  3T4R A;  3W2W A;  2Y3B A;  3EZH A;  3IQT A;  3KL4 A;  1S7Z A;  1S05 A;  2XM0 A;  3PMR A;  4LER A;  3AOU A;  3TD7 A;  3CSK A;  3B29 A;  1NZE A;  2AP3 A;  3FVY A;  3KYJ A;  2KK1 A;  3MX3 A;  4G7O F;  4KI2 A;  3FDQ A;  2R7W A;  2IBF A;  2WL8 A;  3C62 A;  3FAJ A;  2XLH A;  2QNL A;  5B3S C;  2F22 A;  4O6M A;  1WGW A;  4PJJ A;  1V55 C;  4E7Z A;  1VLT A;  4I1M A;  4QDL A;  2XL8 A;  2Q9C A;  3J06 A;  1H9T A;  2IXP A;  2J0X A;  3SNH A;  5KYN A;  1OXB A;  4DXW A;  1LPE A;  2IXN A;  4Q4Z F;  3K33 A;  3Q7L A;  1J8M F;  256B A;  4ULV A;  4CJO A;  2WVQ A;  5BQH A;  2XLW A;  2R25 A;  1TFO B;  1ZHZ A;  4BJ1 A;  4CS7 A;  3JRT A;  5KYX B;  1RKC A;  2KW3 C;  1IZM A;  2YWA A;  4AK9 A;  4CIP A;  4J7T A;  3JSE O;  2IM8 A;  1C17 M;  3N24 A;  1VYI A;  2J8W A;  1HMD A;  1ZZP A;  2LCH A;  1OR3 A;  3QVY A;  2LP4 A;  1OCO C;  1K05 A;  3F46 A;  2TMV P;  3MLG A;  2B0J A;  2C03 A;  2YRF A;  4EIY A;  5HV9 A;  4B6I A;  4U5F E;  4YN0 B;  1U89 A;  3B71 A;  1BR1 A;  3V5Y A;  1VMA A;  1Z63 A;  4QI0 A;  2ICW G;  2Y3G A;  1MND A;  2I15 A;  3K1H A;  1D1C A;  4J30 B;  2ASR A;  3C8G D;  1Z3I X;  3HLZ A;  2L81 A;  1U6H A;  3U2M A;  1YA9 A;  1ZHX A;  3RQE A;  2J7P A;  4DOZ A;  2OU6 A;  3ZTM A;  3L8J A;  4PJN A;  3K1I A;  4I44 A;  2YLI A;  4YL1 A;  1R4T A;  3KMI A;  2G3V A;  1DOV A;  4JKV A;  3K1I C;  2C04 A;  2HZ8 A;  2YVK A;  3AQB A;  3HNK A;  3AG4 C;  3M79 A;  4N6C A;  4NQF A;  3ZC4 A;  5JSL A;  2WZF A;  5A6A A;  3GWN A;  5KYW A;  4CSA C;  3EGD A;  2W45 A;  4D4N A;  3JT1 A;  3BEH A;  3BRJ A;  5KYX A;  3S84 A;  1BDJ B;  2GA0 A;  2H8A A;  4GYT A;  2A68 F;  2NUP A;  3ASN C;  4U9D A;  2AU5 A;  4LAC B;  2CNW A;  2IXO A;  2Z15 A;  4Z9I A;  2R02 A;  4K7B A;  1UG7 A;  3TQO A;  2NG1 A;  1LE2 A;  2FGY A;  5COF A;  4IAQ A;  5D91 A;  5AC5 A;  1EQ1 A;  3V5Z A;  2NPU A;  3CQZ A;  5T3T A;  3GEI A;  3R7C A;  3POV A;  5KYY B;  1TWC A;  2HJ3 A;  3HNJ A;  1N1C A;  2DYR C;  3O55 A;  3FXH A;  4PK4 A;  4DVY P;  3NMI A;  4XTK A;  1T6Q A;  4O7G A;  2JPU A;  4FAP B;  2A69 F;  1D1B A;  4IRU A;  1V4A A;  4LDR A;  1ST6 A;  5CI9 A;  3EJN A;  3AG2 C;  4G78 A;  3EZI A;  5AC4 A;  3W8I A;  2W4B A;  2A1D D;  3N0T A;  1E83 A;  3DAF A;  1G5Z A;  5JP7 A;  1OCC C;  2L6H A;  1ZYR F;  4NY3 A;  5L0C A;  1YYJ A;  3LEO A;  2CYD A;  2E87 A;  5F28 E;  3T6J A;  4BJ5 A;  1FNT c;  1QVX A;  1WTY A;  1JPN A;  1NU7 D;  4QI2 A;  1EKY A;  3N2Z B;  4BJ5 C;  1ZVZ A;  2OEV A;  3LLK A;  2LK4 A;  1CPR A;  2W9Y A;  1WOL A;  1NBB A;  3FMS A;  2XLV A;  3R2P A;  3GM3 A;  3RVZ A;  3NMK A;  2QE9 A;  4RBN A;  2A0B A;  1EA8 A;  2LFF A;  4RDA A;  4ULW A;  5EK0 A;  1Z7Q c;  3L0I A;  3W2V A;  1NU9 C;  2X0C A;  3K66 A;  3T9O A;  4O6N A;  4K1O A;  4MTG A;  2R7V A;  4FX5 A;  1LVK A;  3US6 A;  4DRI B;  5KYY A;  2L6G A;  4LDQ A;  3I4U A;  4LLC A;  5EHH A;  4MVQ A;  1AEP A;  3U8P A;  5B1A C;  4JEA A;  1OR2 A;  1FFT C;  3SZR A;  4AL1 A;  1H9G A;  4OIN F;  2MYS A;  2QY9 A;  1M57 C;  1B68 A;  2X51 A;  3EH2 A;  3IPM O;  1ZW2 A;  4MW8 A;  4DBQ A;  3KH2 A;  1RMV A;  3Q6N A;  3DD7 A;  1L7C A;  1LIH A;  3DJU B;  4OIQ F;  4C7O B;  2XL6 A;  5B1B C;  4RD9 A;  1LS1 A;  2WB7 A;  3VYW A;  1JAF A;  3C63 A;  4DJ9 A;  2YL3 A;  4LDK A;  4ANJ A;  1HE1 A;  4BG0 A;  4YWQ A;  5TJ5 E;  3ABM C;  3JSZ A;  3FAP B;  4XEV A;  1LM3 B;  5DQZ A;  2ZPA A;  4E17 A;  5K0I A;  4JCH A;  2EPO A;  1T01 A;  3AG1 C;  1D0Z A;  4GEH A;  3QVZ A;  4HE8 D;  5AGF A;  3ZG1 A;  1E85 A;  4JW1 A;  1RJ9 B;  1Z6A A;  4KBL A;  2PFD A;  2VB6 A;  3UNG C;  3VRC A;  4CS8 A;  3F47 A;  4AX2 A;  4N4W A;  3TOL A;  2Y3H A;  1ZHW A;  4X0R A;  2YL7 A;  1NSG B;  4YJW A;  3C18 A;  1Q0M A;  5KYU A;  1E2X A;  1KNY A;  1WN0 A;  2Y39 A;  3U2L A;  2GAQ A;  1T6U A;  3DWW A;  3ITF A;  3UMH A;  5COG A;  4E7S A;  3ZTZ A;  4P9T A;  4OD4 A;  4IAR A;  2R7U A;  3EHN A;  2EIM C;  2IOQ A;  1MMG A;  3WG7 C;  2WZL A;  2XS1 A;  3OA1 A;  2R7X A;  3EH1 A;  3C8G B;  3UGP A;  3PCV A;  2DB4 A;  2ZXR A;  1NFO A;  2AWC A;  2HMZ A;  3AQC A;  3DKA A;  1KU2 A;  3RQG A;  3SXY A;  2HUJ A;  3TJ5 A;  1OW8 A;  2EIK C;  4U9E A;  4C7O A;  2XM4 A;  1OKK D;  3DZA A;  1C03 A;  1YAR O;  3TOM A;  1PV3 A;  3OEO A;  1MMD A;  1TKN A;  3TK0 A;  4J32 B;  3ZQY A;  5L0H A;  3SEO A;  1RKE B;  2J45 A;  2KSF A;  2VAS A;  1G8X A;  2KQ9 A;  2P7V A;  3I5Q A;  5DVW A;  5A69 A;  2EIL C;  3M1C B;  4CS9 A;  1OQC A;  5E3C A;  4UDV A;  3A9C A;  3U8V A;  5T3W A;  1OCZ C;  3IEE A;  3M4B A;  3QW1 A;  4CS9 C;  2GFH A;  3ABK C;  3NYL A;  2QUP A;  3IQC A;  1E86 A;  1Q0D A;  3H2V A;  1TWG A;  3LUT B;  3JTL O;  4JIO A;  3IQ6 A;  3QTH A;  1CPQ A;  2Q3T A;  3WOD F;  1SF8 A;  1YJG A;  5A6J A;  3NDB B;  3LAY A;  2H7O A;  4I3M A;  4EBK A;  2UUH A;  1BBH A;  4NTF A;  4MW3 A;  2V26 A;  4F4B A;  1WAT A;  4EHP A;  1BR2 A;  4CDY A;  3EG9 B;  3LES A;  4XPY A;  3NKD A;  4AE4 B;  4EUK B;  4MND A;  1YAU O;  4U5D E;  1VTM P;  3GM2 A;  3OWT A;  3O39 A;  4NTA A;  3HNI A;  3RIP A;  1YA7 O;  1HE9 A;  1SMY F;  1T9K A;  1XWJ A;  1ZW3 A;  2ZXP A;  3EGX B;  1LE4 A;  3KKB A;  5E2Q A;  5FZT A;  3RKO F;  2J9B A;  3DJN B;  4NC3 A;  1APC A;  1UFB A;  4XQ1 A;  1M6T A;  2KGO A;  4DRJ B;  2A6E F;  2XS8 A;  2CNW D;  3WAQ A;  1QLE C;  2EPK X;  2QTV A;  1JRA A;  4JJG A;  3RFY A;  4C3D A;  4G0H A;  5BUO A;  1YDI A;  1HY5 A;  3GEE A;  1OCR C;  1TFK B;  2R7Q A;  1V74 B;  2OG2 A;  2BE5 F;  2R03 A;  3B0P A;  3GWL A;  3KPH A;  5FCL A;  4W8P A;  4U5C E;  4A4A A;  1GM5 A;  2YHS A;  2VH3 A;  1MMN A;  3ECS A;  2L6F A;  2P6V A;  2L7A A;  1Y6D A;  1QZX A;  3NYJ A;  1A7V A;  1G4W R;  3SP1 A;  2XLE A;  3TJ6 A;  4CBE A;  2WVN A;  3EFO B;  1A41 A;  3L8I A;  2EPL X;  4IJJ A;  1Y4C A;  2HJM A;  1YZA A;  3VF0 A;  4CDV A;  2CCY A;  2DI3 A;  3PHF 2;  4E0I A;  1SYQ A;  2OOC A;  4XWJ A;  3FOP A;  4MVR A;  4JUR I;  4KNW A;  5BQI A;  2PBE A;  2R7R A;  3LNM B;  3B0V C;  2NUT B;  4AE4 A;  1LKX A;  5A6B D;  5E3A A;  4MVM A;  5CIV A;  4YT4 A;  1OW7 A;  4KNV A;  3UMK A;  1FFH A;  4MS2 A;  3EGX A;  3G4X A;  4DBR A;  3L1M A;  3RVY A;  3T6B A;  5D92 A;  3U5S A;  3E70 C;  1C02 A;  1ZU4 A;  4MVU A;  3VM6 A;  3TUL A;  2OEX A;  1A0B A;  5L0J A;  1U0B B;  1GS9 A;  2J46 A;  2HSB A;  2ZXO A;  3MFN A;  1MQV A;  3Q7G A;  3U9J A;  4MVO A;  1ZU5 A;  5L0F A;  2M64 A;  4JVS A;  3H2U A;  1GGQ A;  1VK5 A;  1JR8 A;  1K04 A;  2J9V A;  1H7I A;  3S28 A;  5DQT A;  4XLP F;  4Q7C A;  3RQF A;  1OXK A;  3HKK A;  4BJ6 A;  2RSE B;  1Q0K A;  1V54 C;  2CW0 F;  1QPU A;  4WAB A;  4U5G A;  2XXA B;  3M4C A;  5L3Q A;  4BJ6 C;  1MNE A;  5COM A;  4N6H A;  5JVE A;  3EFO A;  2R9R B;  4J7Y A;  2MHR A;  2JD3 A;  3CAX A;  1FAP B;  3QMK A;  2AWY A;  2Q9A A;  4PJM A; 
#chains in the Genus database with same CATH homology
 1YA7 O;  3JSE O;  3JRM O;  3IPM O;  1YAR O;  1FNT c;  1YAU O;  1AVO B;  3JTL O;  1Z7Q c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...