1Z7Qc

Crystal structure of the 20s proteasome from yeast in complex with the proteasome activator pa26 from trypanosome brucei at 3.2 angstroms resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
230
structure length
230
Chain Sequence
PPKRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGVDAESGKTKGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGSDHMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The 1.9 A structure of a proteasome-11S activator complex and implications for proteasome-PAN/PA700 interactions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/hydrolase activator
molecule keywords Proteasome component C7-alpha
total genus 80
structure length 230
sequence length 230
chains with identical sequence d, e, f, g, h, i, j, k, l, m, n, o, p
ec nomenclature
pdb deposition date 2005-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
c PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1z7qc01
1YAUO 3JRMO 3IPMO 3JSEO 1AVOB 1FNTc 1YA7O 3JTLO 1YARO 1Z7Qc
chains in the Genus database with same CATH superfamily
2J46A 2IYLD 3T6BA 3HLZA 2VC9A 4DXWA 4CSAC 3E9VA 3TD7A 4KI2A 3JYHA 2YWAA 3MLGA 1OR3A 4JTDB 3B9QA 1NFOA 2RSEB 2Y3DA 4C7OB 3OA1A 2CNWA 2R02A 1L3PA 1OQCA 1R5ID 1OCZC 1ORJA 1TKNA 3C8GA 4MTOA 4DBQA 3OEOA 4ULVA 1SMYF 4CBEA 1LI5A 4PFPA 2XM0A 4PK4A 4C3DA 1ZU4A 5KYXB 2R7RA 3N0TA 3VAYA 2HV6A 3GODA 1G4US 3DKAA 4IARA 2XRHA 1ZW3A 3U9JA 4AL1A 4CX9A 2IOQA 1E2XA 4N06A 3EHNA 2L6FA 1CGME 3O55A 3HTKC 3DMDA 4JVSA 1RXQA 1V55C 3S27A 4BJ5C 3AGTA 2KK1A 1OKKA 2XLOA 2OQMA 1VLTA 3G4ZA 1BZ4A 5KYNA 2ZXPA 2AWCA 2PF4E 3SXYA 2BE5F 2MHRA 3LEVA 4DRHB 3RQFA 1G5ZA 2YEVA 3U0CA 3UGPA 3SXZA 3TK0A 5DLJA 2IBFA 2Q9CA 4EBKA 2A1DD 4MVRA 3FAPB 1D1AA 1M56C 3KKBA 3VM6A 3LJBA 4YT4A 1XZPA 3JTLO 3VRCA 1KU2A 2GDCA 4JEBA 2Y3GA 1ST6A 5JRAA 2EPNA 1VK5A 3PHF2 1IZMA 4HFKB 1E83A 2ASRA 3B0PA 2NSGA 4H4KC 2DYRC 2NUTA 3EGXB 1MMNA 2J45A 1FMWA 3L8JA 1HW2A 4N6CA 5A6BA 2NUPB 2QLAA 4XEVA 3RH3A 1M2VA 3A11A 4DRJB 3UNGC 5E3CA 2C04A 4YL1A 1GQAA 2OCCC 2FAPB 4NTFA 1RJ9B 2EPMX 1JR8A 1OXBA 1Q0GA 3GEEA 2LIGA 3HNKA 2X51A 3F47A 1OW6A 1HE9A 2YL1A 4U5CE 4CJOA 4J7YA 1U0BB 1YYJA 4XLPF 4N6HA 2C03A 4A4AA 2DGJA 3JZ0A 3E70C 1QQ3A 3ZWIA 5L0HA 2HUJA 3B71A 1TWAA 3JYYA 4FAPB 2R05A 2XSEA 1ZHWA 3K33A 4MQ9F 3TOLA 2EINC 2CW0F 4JC7A 4YT2A 4JRZA 4BG0A 3ZDLA 1TR2A 2CYDA 1YJGA 2J0WA 1BR2A 3QVZA 1QKRA 5DVWA 5L0IA 4XTKA 4G7ZF 1YARO 3UGOA 3DE9A 4CS8C 4U9DA 2R7SA 2VCCA 4C7OA 4K1OA 5D91A 3LNMB 2J7PD 4XPYA 5KYUB 4ZLDA 1BBHA 4GQHA 4E7SA 3AQBA 1GGQA 2DYSC 5IY5C 2LFDA 3CAXA 4OIRF 5DQTA 4OINF 3I5QA 2P61A 2VASA 4PJMA 2LCHA 1Q0KA 2J9VA 3ASOC 2WZFA 3SXMA 1YA7O 4OD5A 5L0FA 1UFBA 2KSFA 2JX0A 3KL4A 4RD9A 3EPVA 1M6TA 1NFNA 3KPHA 3L8IA 5JP7A 3U2LA 1LPEA 1E86A 4M63A 4Q4ZF 1Z6AA 4LLCA 2YL3A 3U9MA 4ANJA 1VB5A 3DXJF 3L1MA 1R4TA 1Z5ZA 3U5SA 2J8WA 2AP3A 4DJ9A 3EJNA 3S29A 4DVYP 2ZXOA 1T01A 1C03A 1QLEC 1H6GA 3DAFA 4CS9C 4U5GA 5K0IA 5T1DB 3X1OA 1PD0A 2PX0A 4Z9HA 1LM3B 4LDKA 4BEMJ 3DJNB 1QSPA 2JPUA 3L34A 4JTAB 3U3BA 3EZIA 2PBEA 5COFA 2YL7A 1YAUO 2GA0A 3NMKA 2IXOA 2W9YA 2Y3BA 2V3CC 3JSZA 1O87A 4FWVA 2OEVA 4ONSA 2P0NA 5E2QA 3IQ6A 2XL4A 1T5OA 2R7OA 3W2WA 4U5HA 3LS0A 1TWGA 2W45A 2VCBA 2XLWA 2XS1A 3ABMC 4IB4A 2AU5A 2V26A 2YL0A 4NTBA 4U5EE 4FX5A 2R7XA 4YK5A 2XM4A 3AOUA 4WJ0A 5BQHA 3TULA 2HSQA 4DOZA 3C8GD 1GS9A 4CS7A 1C17M 1RJ9A 4QDLA 4ER9A 5JS5A 3GM1A 2MYSA 4BEJA 2P7VA 1E84A 3Q6MA 5T3TA 4XLNF 4XEFA 1A7DA 3QTHA 2TMVP 1YVIA 4IJJA 2XXAB 3GM2A 1SYQA 1TFOB 3AG3C 4LDQA 4N4WA 1I4ZA 1JAFA 1I4YA 1TQGA 2F22A 2XLEA 3KYIA 3TJ5A 3VF0A 2FFHA 1G8XA 3SYNA 4I1MA 4CDYA 1H7IA 2L6GA 1I5NA 2PNOA 4X0RA 4EIYA 3M1CB 5EHHA 1EQ1A 3U8PA 1SZIA 1WGWA 1QVXA 1OKKD 2ZXWC 4IWBA 4LERA 2GWWA 2XLVA 2GAQA 2R9RB 3EG9A 4MVQA 2DI3A 3H2UA 4PJLA 4PFOA 1VMAA 2P6VA 3RVYA 3TQOA 3W2VA 2H7OA 4CSAA 3RF3A 2YHSA 4O6YA 2LQGA 4AK9A 4EBBA 3NYMA 3WHNA 1LS4A 1O3UA 1OW7A 1TWHA 1V74B 1ZHYA 3QW1A 4LACB 2Q3TA 4U5FE 4W8KA 1SF8A 4HFFB 4MTGA 4PJJA 3ZIBA 4DRIB 3NYJA 2G3VA 5COGA 5BQGA 4OIOF 3BRJA 3CZ6A 1FFTC 3SNHA 2OJED 4FESA 1ZW2A 3EG9B 3VYWA 2CCYA 3ZC4A 4B6IA 3NKDA 3L0IA 4I44A 2ZD9A 4E18A 1Z7Qc 3SZRA 4G0HA 1VOMA 2J0XA 1QPUA 3HJCA 3PMRA 1VLSA 4I1OB 5JLIA 1K40A 4JEAA 2D4UA 3N2ZB 2Z15A 5EGYA 3FAJA 1ZZPA 3JT1A 1ORYA 4NC3A 2B0JA 3LNRA 3EZHA 2HFIA 1Z63A 3RFYA 1PCXA 3K7DA 4EKWA 3ABKC 2M4EA 1H9GA 3AG2C 2AWYA 5A69A 3KH2A 3DZAA 4GYTA 4C3BA 1TFKB 2AVKA 2CGEA 2KNHA 1G4WR 3AGUA 3U8VA 4BPMA 3FDQA 3NYLA 4OIQF 4EHPA 1FFHA 1ZU5A 5TJ5E 3LAYA 4F4BA 3HNJA 4IAQA 5E3AA 4Z9IA 3SP1A 4BJ6A 3TOMA 2XXAA 4G78A 1JRAA 1S05A 2IXNA 3ABLC 3ATPA 1FNTc 1OXKA 3EGDB 2FGYA 4CIHA 4C3EA 2Q4FA 4JURI 3K6BA 5A6AA 1C02A 3K1IA 2E87A 1ZYRF 1FAPB 2A69F 2JD3A 3AJMA 3HNIA 1U6HA 2VB6A 3EGXA 3GEIA 3Q6NA 4P9FA 3DD7A 2PFDA 4RDAA 4RBNA 1D0YA 2Q7RA 4JJFA 1Z23A 2BC5A 2B0HA 3LEOA 5B3SC 3ZQVA 1NU9C 2YLGA 3MX3A 3UMHA 4DBRA 2I8BA 3O10A 3CEXA 5BQIA 2G62A 4NCQA 1NU7D 1AUEA 4I3MA 4AE4A 1J8YF 1V54C 3I4UA 2YLIA 4U5DE 3U2MA 3UMKA 3ZQYA 1WATA 2NUTB 4NTAA 2I15A 1N1CA 4L6RA 2ZPAA 1DOVA 2HJMA 3RYLA 3RQGA 2YQYA 4CIPA 2J9WA 2LD6A 3DE8A 1Q0MA 1V4AA 2WL8A 4NY3A 3IPMO 2D5RB 4JW1A 3ZSUA 1D1BA 1M57C 2HS5A 4YN0B 2Q9BA 3K1HA 1RKCA 5AGFA 2R7WA 4HEAJ 5GPGB 4EWCA 3MBGA 5CI8A 5KYUA 1YZCA 1NG1A 1Y4CA 2KYHA 1NBBA 4MVUA 3NDBB 1HMDA 1NLXA 3W4YA 5B3IA 3NMIA 4PJNA 3RVZA 3RW0A 3DI5A 2A0BA 2OOCA 3AG1C 4MVMA 1JOGA 2L9JA 2Q00A 4YT5A 3X2QC 4CDVA 2Y39A 4AX2A 1UG7A 4BJ5A 3MYFA 4IGGA 2XLHA 5DQZA 2A6HF 2UUHA 1CGOA 3HKKA 2EPLX 4JKVA 2EPOA 1A41A 1LI7A 2ETSA 2OU6A 1RMVA 4U5BE 3G50A 5DS4A 3J06A 4EBJA 3NRHA 1MMGA 2CDQA 3F46A 1XZQA 2A0UA 3JRTA 3LS1A 5L0DA 2R7UA 2IXPA 1AVOB 2XS8A 1DOWA 3V7OA 4QI0A 2R7TA 3DJUB 4GEHA 4PACA 5JUAA 4O6MA 1D0ZA 3DM9B 1M2OA 2UUIA 1WOLA 1Z3IX 5KYWA 4JZAA 2H7VC 2HV7A 4D4XA 4JTCB 4JJGA 1S7ZA 2A6EF 2QY9A 4XPXA 1U89A 2Q9AA 1HW1A 3QMKA 1B68A 1ZHTA 2R7QA 4E0IA 5JSLA 1MMAA 2R03A 3GM3A 2EPKX 4J32B 2IXMA 2W4BA 3FXHA 4J30B 3IHUA 3KMIA 5D92A 1D1CA 1M2VB 2OJQA 4MW8A 1ZVZA 3QVYA 2ZXRA 5A6BD 5KYYB 4Q5SF 3SEOA 2WZLA 2NSFA 3O6XA 4NQFA 5HV9A 1H9TA 3IEEA 3GANA 3A9CA 5CIVA 1LKXA 4BJ6C 2IM8A 4MTFA 5KYYA 1PD1A 2HMQA 3C62A 3S0XA 1J8MF 1NSGB 3B29A 1APCA 3IQ5A 2KJGA 2QNLA 3S28A 3M4BA 3QW0A 4P9TA 3R7CA 3ZVRA 3H2VA 3W8IA 3NKEA 4G7OF 3Q7LA 1Q0DA 3QZCA 4Z9JA 1T9KA 1KNYA 3GEHA 1WN0A 3NMJA 1T6UA 1JPNA 4WABA 3H65A 1FMVA 1K05A 3T6GB 1TWCA 1SR2A 3C7JA 4XQ1A 1OCOC 5JVEA 3MFNA 1A7VA 3ITFA 5F28E 4OIPF 4ULWA 3SXKA 3EH1A 2HZ8A 3EGDA 2NG1A 1MNDA 256BA 3OWTA 2LFFA 2PX3A 2NPUA 5F5FA 2LK4A 4MW3A 4Q7CA 1YYXA 2L81A 4BJTA 1L7CA 3WODF 5BUOA 3ZG1A 5L3VA 4KC9A 1HE1A 1Y6DA 2WB7A 2DB4A 2WVQA 1EKYA 3EH2A 1RKEB 4JIOA 3LLIA 2OG2A 2KGOA 5HSWA 2YLDA 3S84A 1LE2A 2HKVA 4MVOA 4XPWA 3EHMA 4XEKA 4CS8A 1A7EA 3DWWA 3C63A 3RQEA 1OW8A 3WG7C 2HSBA 3N24A 3PDMP 4LDRA 4R32A 3GWLA 4PR9A 3CSKA 2EIMC 2YKZA 3LESA 2R7VA 1VYIA 1BDJB 5L0JA 2L6HA 1LVKA 1A0BA 1QZXA 4MNDA 3US6A 3Q7GA 1LIHA 2X0CA 1VYKA 2NUPA 1HY5A 2VCAA 1CPRA 1RKEA 3LUTB 4MVSA 4O7GA 4E17A 4YT8A 5A6JA 5CI9A 3IQTA 1YDIA 4U9EA 2WZGA 5FCLA 2Y69C 4IAOA 5L3QA 3UMIA 5AC4A 3RKOF 5L0CA 2L7AA 4W8PA 2A68F 4BJ1A 3C18A 5AC5A 1OCCC 2QTVA 3FHDA 3T9OA 3GORA 4O6NA 1HMOA 1ZHZA 2O9XA 2YRFA 5B1AC 4WGZA 3W8HA 2WVOA 3UR3C 2YVKA 5A6KA 3U3FA 1D0XA 2XL8A 2G3KA 1GM5A 1MNEA 1WWPA 1JPJA 2HJ3A 1BR1A 2H7BA 4WGYA 2QUPA 4D4NA 4E7ZA 2XLDA 3AG4C 3FOPA 5KYXA 3TJ6A 4JE9A 2MWQA 5E33A 3ASNC 1YA9A 1JMWA 2WVNA 3EQLF 4YL0A 2EIKC 3T6JA 1XWJA 3AQCA 3DM5A 3JRMO 3K1IC 4KNVA 4CJGA 2KC3A 5DS5A 5FZTA 2PP4A 2J9UA 5L0GA 2OEXA 4MVZA 1LE4A 1Q0FA 4P6IC 3KYJA 4OD4A 2HMZA 4ZLCA 4YWQA 1OCRC 3M4CA 4CDAA 2W4MA 3C8ZA 1E85A 1ZHXA 3I5PA 3T4RA 3BEHA 3FMSA 3RIPA 4CS9A 1MQVA 1T6QA 1IW7F 3FOOA 4UDVA 3ZTMA 1RCPA 1PV3A 3GWNA 2P1AA 1YZAA 4QI2A 3POVA 2R25A 4K0DA 3S9OA 4HE8D 4E0HA 2LP4A 2YZSA 4MS2A 4K7BA 1MMDA 1WASA 1FTSA 4YL3A 5B1BC 3JSEO 1ORSC 2J7PA 4AL0A 1KTMA 5T3WA 3V5YA 3LLKA 4EUKB 5EK0A 4YJWA 1VTMP 2GFHA 2CNWD 2RD9A 3S90A 1CPQA 1LS1A 1O5HA 1EA8A 4A2NB 4G7HF 5KYWB 4XWJA 2BL2A 1BR4A 4O79A 1WTYA 3C8GB 3IQCA 3K66A 5F5HA 4KNWA 2H8AA 1K04A 4H54A 3DAGA 3B0UX 1EI7A 3R2PA 2KQ9A 4AE4B 1T6IA 3M79A 2EILC 3V5XA 3NG1A 3M15A 3JCUQ 3MYIA 1FR0A 3WAQA 3HNLA 1AEPA 1W2WA 5COMA 2XL6A 2ICWG 2VH3A 3ECSA 4LLEA 3V5ZA 2LSEA 4DVZA 3FVYA 3O39A 3EFOB 4JCZA 4IRUA 5JT4A 1YLMA 3B0VC 2KW3C 2OKUA 1OR2A 2QE9A 2Y3HA 3G4XA 2J9BA 2EIJC 4J7TA 3ZTZA 1F1MA 1NZEA 3EFOA 3PCVA 1CGNA 5DS6A 2XLMA 3CQZA 4KBLA 4JCHA 2M64A
chains in the Genus database with same CATH topology
1YAUO 3JRMO 3IPMO 3JSEO 1AVOB 1FNTc 1YA7O 3JTLO 1YARO 1Z7Qc
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YAU O;  3JRM O;  3IPM O;  3JSE O;  1AVO B;  1FNT c;  1YA7 O;  3JTL O;  1YAR O;  1Z7Q c; 
#chains in the Genus database with same CATH topology
 2J46 A;  2IYL D;  3T6B A;  3HLZ A;  2VC9 A;  4DXW A;  4CSA C;  3E9V A;  3TD7 A;  4KI2 A;  3JYH A;  2YWA A;  3MLG A;  1OR3 A;  4JTD B;  3B9Q A;  1NFO A;  2RSE B;  2Y3D A;  4C7O B;  3OA1 A;  2CNW A;  2R02 A;  1L3P A;  1OQC A;  1R5I D;  1OCZ C;  1ORJ A;  1TKN A;  3C8G A;  4MTO A;  4DBQ A;  3OEO A;  4ULV A;  1SMY F;  4CBE A;  1LI5 A;  4PFP A;  2XM0 A;  4PK4 A;  4C3D A;  1ZU4 A;  5KYX B;  2R7R A;  3N0T A;  3VAY A;  2HV6 A;  3GOD A;  1G4U S;  3DKA A;  4IAR A;  2XRH A;  1ZW3 A;  3U9J A;  4AL1 A;  4CX9 A;  2IOQ A;  1E2X A;  4N06 A;  3EHN A;  2L6F A;  1CGM E;  3O55 A;  3HTK C;  3DMD A;  4JVS A;  1RXQ A;  1V55 C;  3S27 A;  4BJ5 C;  3AGT A;  2KK1 A;  1OKK A;  2XLO A;  2OQM A;  1VLT A;  3G4Z A;  1BZ4 A;  5KYN A;  2ZXP A;  2AWC A;  2PF4 E;  3SXY A;  2BE5 F;  2MHR A;  3LEV A;  4DRH B;  3RQF A;  1G5Z A;  2YEV A;  3U0C A;  3UGP A;  3SXZ A;  3TK0 A;  5DLJ A;  2IBF A;  2Q9C A;  4EBK A;  2A1D D;  4MVR A;  3FAP B;  1D1A A;  1M56 C;  3KKB A;  3VM6 A;  3LJB A;  4YT4 A;  1XZP A;  3JTL O;  3VRC A;  1KU2 A;  2GDC A;  4JEB A;  2Y3G A;  1ST6 A;  5JRA A;  2EPN A;  1VK5 A;  3PHF 2;  1IZM A;  4HFK B;  1E83 A;  2ASR A;  3B0P A;  2NSG A;  4H4K C;  2DYR C;  2NUT A;  3EGX B;  1MMN A;  2J45 A;  1FMW A;  3L8J A;  1HW2 A;  4N6C A;  5A6B A;  2NUP B;  2QLA A;  4XEV A;  3RH3 A;  1M2V A;  3A11 A;  4DRJ B;  3UNG C;  5E3C A;  2C04 A;  4YL1 A;  1GQA A;  2OCC C;  2FAP B;  4NTF A;  1RJ9 B;  2EPM X;  1JR8 A;  1OXB A;  1Q0G A;  3GEE A;  2LIG A;  3HNK A;  2X51 A;  3F47 A;  1OW6 A;  1HE9 A;  2YL1 A;  4U5C E;  4CJO A;  4J7Y A;  1U0B B;  1YYJ A;  4XLP F;  4N6H A;  2C03 A;  4A4A A;  2DGJ A;  3JZ0 A;  3E70 C;  1QQ3 A;  3ZWI A;  5L0H A;  2HUJ A;  3B71 A;  1TWA A;  3JYY A;  4FAP B;  2R05 A;  2XSE A;  1ZHW A;  3K33 A;  4MQ9 F;  3TOL A;  2EIN C;  2CW0 F;  4JC7 A;  4YT2 A;  4JRZ A;  4BG0 A;  3ZDL A;  1TR2 A;  2CYD A;  1YJG A;  2J0W A;  1BR2 A;  3QVZ A;  1QKR A;  5DVW A;  5L0I A;  4XTK A;  4G7Z F;  1YAR O;  3UGO A;  3DE9 A;  4CS8 C;  4U9D A;  2R7S A;  2VCC A;  4C7O A;  4K1O A;  5D91 A;  3LNM B;  2J7P D;  4XPY A;  5KYU B;  4ZLD A;  1BBH A;  4GQH A;  4E7S A;  3AQB A;  1GGQ A;  2DYS C;  5IY5 C;  2LFD A;  3CAX A;  4OIR F;  5DQT A;  4OIN F;  3I5Q A;  2P61 A;  2VAS A;  4PJM A;  2LCH A;  1Q0K A;  2J9V A;  3ASO C;  2WZF A;  3SXM A;  1YA7 O;  4OD5 A;  5L0F A;  1UFB A;  2KSF A;  2JX0 A;  3KL4 A;  4RD9 A;  3EPV A;  1M6T A;  1NFN A;  3KPH A;  3L8I A;  5JP7 A;  3U2L A;  1LPE A;  1E86 A;  4M63 A;  4Q4Z F;  1Z6A A;  4LLC A;  2YL3 A;  3U9M A;  4ANJ A;  1VB5 A;  3DXJ F;  3L1M A;  1R4T A;  1Z5Z A;  3U5S A;  2J8W A;  2AP3 A;  4DJ9 A;  3EJN A;  3S29 A;  4DVY P;  2ZXO A;  1T01 A;  1C03 A;  1QLE C;  1H6G A;  3DAF A;  4CS9 C;  4U5G A;  5K0I A;  5T1D B;  3X1O A;  1PD0 A;  2PX0 A;  4Z9H A;  1LM3 B;  4LDK A;  4BEM J;  3DJN B;  1QSP A;  2JPU A;  3L34 A;  4JTA B;  3U3B A;  3EZI A;  2PBE A;  5COF A;  2YL7 A;  1YAU O;  2GA0 A;  3NMK A;  2IXO A;  2W9Y A;  2Y3B A;  2V3C C;  3JSZ A;  1O87 A;  4FWV A;  2OEV A;  4ONS A;  2P0N A;  5E2Q A;  3IQ6 A;  2XL4 A;  1T5O A;  2R7O A;  3W2W A;  4U5H A;  3LS0 A;  1TWG A;  2W45 A;  2VCB A;  2XLW A;  2XS1 A;  3ABM C;  4IB4 A;  2AU5 A;  2V26 A;  2YL0 A;  4NTB A;  4U5E E;  4FX5 A;  2R7X A;  4YK5 A;  2XM4 A;  3AOU A;  4WJ0 A;  5BQH A;  3TUL A;  2HSQ A;  4DOZ A;  3C8G D;  1GS9 A;  4CS7 A;  1C17 M;  1RJ9 A;  4QDL A;  4ER9 A;  5JS5 A;  3GM1 A;  2MYS A;  4BEJ A;  2P7V A;  1E84 A;  3Q6M A;  5T3T A;  4XLN F;  4XEF A;  1A7D A;  3QTH A;  2TMV P;  1YVI A;  4IJJ A;  2XXA B;  3GM2 A;  1SYQ A;  1TFO B;  3AG3 C;  4LDQ A;  4N4W A;  1I4Z A;  1JAF A;  1I4Y A;  1TQG A;  2F22 A;  2XLE A;  3KYI A;  3TJ5 A;  3VF0 A;  2FFH A;  1G8X A;  3SYN A;  4I1M A;  4CDY A;  1H7I A;  2L6G A;  1I5N A;  2PNO A;  4X0R A;  4EIY A;  3M1C B;  5EHH A;  1EQ1 A;  3U8P A;  1SZI A;  1WGW A;  1QVX A;  1OKK D;  2ZXW C;  4IWB A;  4LER A;  2GWW A;  2XLV A;  2GAQ A;  2R9R B;  3EG9 A;  4MVQ A;  2DI3 A;  3H2U A;  4PJL A;  4PFO A;  1VMA A;  2P6V A;  3RVY A;  3TQO A;  3W2V A;  2H7O A;  4CSA A;  3RF3 A;  2YHS A;  4O6Y A;  2LQG A;  4AK9 A;  4EBB A;  3NYM A;  3WHN A;  1LS4 A;  1O3U A;  1OW7 A;  1TWH A;  1V74 B;  1ZHY A;  3QW1 A;  4LAC B;  2Q3T A;  4U5F E;  4W8K A;  1SF8 A;  4HFF B;  4MTG A;  4PJJ A;  3ZIB A;  4DRI B;  3NYJ A;  2G3V A;  5COG A;  5BQG A;  4OIO F;  3BRJ A;  3CZ6 A;  1FFT C;  3SNH A;  2OJE D;  4FES A;  1ZW2 A;  3EG9 B;  3VYW A;  2CCY A;  3ZC4 A;  4B6I A;  3NKD A;  3L0I A;  4I44 A;  2ZD9 A;  4E18 A;  1Z7Q c;  3SZR A;  4G0H A;  1VOM A;  2J0X A;  1QPU A;  3HJC A;  3PMR A;  1VLS A;  4I1O B;  5JLI A;  1K40 A;  4JEA A;  2D4U A;  3N2Z B;  2Z15 A;  5EGY A;  3FAJ A;  1ZZP A;  3JT1 A;  1ORY A;  4NC3 A;  2B0J A;  3LNR A;  3EZH A;  2HFI A;  1Z63 A;  3RFY A;  1PCX A;  3K7D A;  4EKW A;  3ABK C;  2M4E A;  1H9G A;  3AG2 C;  2AWY A;  5A69 A;  3KH2 A;  3DZA A;  4GYT A;  4C3B A;  1TFK B;  2AVK A;  2CGE A;  2KNH A;  1G4W R;  3AGU A;  3U8V A;  4BPM A;  3FDQ A;  3NYL A;  4OIQ F;  4EHP A;  1FFH A;  1ZU5 A;  5TJ5 E;  3LAY A;  4F4B A;  3HNJ A;  4IAQ A;  5E3A A;  4Z9I A;  3SP1 A;  4BJ6 A;  3TOM A;  2XXA A;  4G78 A;  1JRA A;  1S05 A;  2IXN A;  3ABL C;  3ATP A;  1FNT c;  1OXK A;  3EGD B;  2FGY A;  4CIH A;  4C3E A;  2Q4F A;  4JUR I;  3K6B A;  5A6A A;  1C02 A;  3K1I A;  2E87 A;  1ZYR F;  1FAP B;  2A69 F;  2JD3 A;  3AJM A;  3HNI A;  1U6H A;  2VB6 A;  3EGX A;  3GEI A;  3Q6N A;  4P9F A;  3DD7 A;  2PFD A;  4RDA A;  4RBN A;  1D0Y A;  2Q7R A;  4JJF A;  1Z23 A;  2BC5 A;  2B0H A;  3LEO A;  5B3S C;  3ZQV A;  1NU9 C;  2YLG A;  3MX3 A;  3UMH A;  4DBR A;  2I8B A;  3O10 A;  3CEX A;  5BQI A;  2G62 A;  4NCQ A;  1NU7 D;  1AUE A;  4I3M A;  4AE4 A;  1J8Y F;  1V54 C;  3I4U A;  2YLI A;  4U5D E;  3U2M A;  3UMK A;  3ZQY A;  1WAT A;  2NUT B;  4NTA A;  2I15 A;  1N1C A;  4L6R A;  2ZPA A;  1DOV A;  2HJM A;  3RYL A;  3RQG A;  2YQY A;  4CIP A;  2J9W A;  2LD6 A;  3DE8 A;  1Q0M A;  1V4A A;  2WL8 A;  4NY3 A;  3IPM O;  2D5R B;  4JW1 A;  3ZSU A;  1D1B A;  1M57 C;  2HS5 A;  4YN0 B;  2Q9B A;  3K1H A;  1RKC A;  5AGF A;  2R7W A;  4HEA J;  5GPG B;  4EWC A;  3MBG A;  5CI8 A;  5KYU A;  1YZC A;  1NG1 A;  1Y4C A;  2KYH A;  1NBB A;  4MVU A;  3NDB B;  1HMD A;  1NLX A;  3W4Y A;  5B3I A;  3NMI A;  4PJN A;  3RVZ A;  3RW0 A;  3DI5 A;  2A0B A;  2OOC A;  3AG1 C;  4MVM A;  1JOG A;  2L9J A;  2Q00 A;  4YT5 A;  3X2Q C;  4CDV A;  2Y39 A;  4AX2 A;  1UG7 A;  4BJ5 A;  3MYF A;  4IGG A;  2XLH A;  5DQZ A;  2A6H F;  2UUH A;  1CGO A;  3HKK A;  2EPL X;  4JKV A;  2EPO A;  1A41 A;  1LI7 A;  2ETS A;  2OU6 A;  1RMV A;  4U5B E;  3G50 A;  5DS4 A;  3J06 A;  4EBJ A;  3NRH A;  1MMG A;  2CDQ A;  3F46 A;  1XZQ A;  2A0U A;  3JRT A;  3LS1 A;  5L0D A;  2R7U A;  2IXP A;  1AVO B;  2XS8 A;  1DOW A;  3V7O A;  4QI0 A;  2R7T A;  3DJU B;  4GEH A;  4PAC A;  5JUA A;  4O6M A;  1D0Z A;  3DM9 B;  1M2O A;  2UUI A;  1WOL A;  1Z3I X;  5KYW A;  4JZA A;  2H7V C;  2HV7 A;  4D4X A;  4JTC B;  4JJG A;  1S7Z A;  2A6E F;  2QY9 A;  4XPX A;  1U89 A;  2Q9A A;  1HW1 A;  3QMK A;  1B68 A;  1ZHT A;  2R7Q A;  4E0I A;  5JSL A;  1MMA A;  2R03 A;  3GM3 A;  2EPK X;  4J32 B;  2IXM A;  2W4B A;  3FXH A;  4J30 B;  3IHU A;  3KMI A;  5D92 A;  1D1C A;  1M2V B;  2OJQ A;  4MW8 A;  1ZVZ A;  3QVY A;  2ZXR A;  5A6B D;  5KYY B;  4Q5S F;  3SEO A;  2WZL A;  2NSF A;  3O6X A;  4NQF A;  5HV9 A;  1H9T A;  3IEE A;  3GAN A;  3A9C A;  5CIV A;  1LKX A;  4BJ6 C;  2IM8 A;  4MTF A;  5KYY A;  1PD1 A;  2HMQ A;  3C62 A;  3S0X A;  1J8M F;  1NSG B;  3B29 A;  1APC A;  3IQ5 A;  2KJG A;  2QNL A;  3S28 A;  3M4B A;  3QW0 A;  4P9T A;  3R7C A;  3ZVR A;  3H2V A;  3W8I A;  3NKE A;  4G7O F;  3Q7L A;  1Q0D A;  3QZC A;  4Z9J A;  1T9K A;  1KNY A;  3GEH A;  1WN0 A;  3NMJ A;  1T6U A;  1JPN A;  4WAB A;  3H65 A;  1FMV A;  1K05 A;  3T6G B;  1TWC A;  1SR2 A;  3C7J A;  4XQ1 A;  1OCO C;  5JVE A;  3MFN A;  1A7V A;  3ITF A;  5F28 E;  4OIP F;  4ULW A;  3SXK A;  3EH1 A;  2HZ8 A;  3EGD A;  2NG1 A;  1MND A;  256B A;  3OWT A;  2LFF A;  2PX3 A;  2NPU A;  5F5F A;  2LK4 A;  4MW3 A;  4Q7C A;  1YYX A;  2L81 A;  4BJT A;  1L7C A;  3WOD F;  5BUO A;  3ZG1 A;  5L3V A;  4KC9 A;  1HE1 A;  1Y6D A;  2WB7 A;  2DB4 A;  2WVQ A;  1EKY A;  3EH2 A;  1RKE B;  4JIO A;  3LLI A;  2OG2 A;  2KGO A;  5HSW A;  2YLD A;  3S84 A;  1LE2 A;  2HKV A;  4MVO A;  4XPW A;  3EHM A;  4XEK A;  4CS8 A;  1A7E A;  3DWW A;  3C63 A;  3RQE A;  1OW8 A;  3WG7 C;  2HSB A;  3N24 A;  3PDM P;  4LDR A;  4R32 A;  3GWL A;  4PR9 A;  3CSK A;  2EIM C;  2YKZ A;  3LES A;  2R7V A;  1VYI A;  1BDJ B;  5L0J A;  2L6H A;  1LVK A;  1A0B A;  1QZX A;  4MND A;  3US6 A;  3Q7G A;  1LIH A;  2X0C A;  1VYK A;  2NUP A;  1HY5 A;  2VCA A;  1CPR A;  1RKE A;  3LUT B;  4MVS A;  4O7G A;  4E17 A;  4YT8 A;  5A6J A;  5CI9 A;  3IQT A;  1YDI A;  4U9E A;  2WZG A;  5FCL A;  2Y69 C;  4IAO A;  5L3Q A;  3UMI A;  5AC4 A;  3RKO F;  5L0C A;  2L7A A;  4W8P A;  2A68 F;  4BJ1 A;  3C18 A;  5AC5 A;  1OCC C;  2QTV A;  3FHD A;  3T9O A;  3GOR A;  4O6N A;  1HMO A;  1ZHZ A;  2O9X A;  2YRF A;  5B1A C;  4WGZ A;  3W8H A;  2WVO A;  3UR3 C;  2YVK A;  5A6K A;  3U3F A;  1D0X A;  2XL8 A;  2G3K A;  1GM5 A;  1MNE A;  1WWP A;  1JPJ A;  2HJ3 A;  1BR1 A;  2H7B A;  4WGY A;  2QUP A;  4D4N A;  4E7Z A;  2XLD A;  3AG4 C;  3FOP A;  5KYX A;  3TJ6 A;  4JE9 A;  2MWQ A;  5E33 A;  3ASN C;  1YA9 A;  1JMW A;  2WVN A;  3EQL F;  4YL0 A;  2EIK C;  3T6J A;  1XWJ A;  3AQC A;  3DM5 A;  3JRM O;  3K1I C;  4KNV A;  4CJG A;  2KC3 A;  5DS5 A;  5FZT A;  2PP4 A;  2J9U A;  5L0G A;  2OEX A;  4MVZ A;  1LE4 A;  1Q0F A;  4P6I C;  3KYJ A;  4OD4 A;  2HMZ A;  4ZLC A;  4YWQ A;  1OCR C;  3M4C A;  4CDA A;  2W4M A;  3C8Z A;  1E85 A;  1ZHX A;  3I5P A;  3T4R A;  3BEH A;  3FMS A;  3RIP A;  4CS9 A;  1MQV A;  1T6Q A;  1IW7 F;  3FOO A;  4UDV A;  3ZTM A;  1RCP A;  1PV3 A;  3GWN A;  2P1A A;  1YZA A;  4QI2 A;  3POV A;  2R25 A;  4K0D A;  3S9O A;  4HE8 D;  4E0H A;  2LP4 A;  2YZS A;  4MS2 A;  4K7B A;  1MMD A;  1WAS A;  1FTS A;  4YL3 A;  5B1B C;  3JSE O;  1ORS C;  2J7P A;  4AL0 A;  1KTM A;  5T3W A;  3V5Y A;  3LLK A;  4EUK B;  5EK0 A;  4YJW A;  1VTM P;  2GFH A;  2CNW D;  2RD9 A;  3S90 A;  1CPQ A;  1LS1 A;  1O5H A;  1EA8 A;  4A2N B;  4G7H F;  5KYW B;  4XWJ A;  2BL2 A;  1BR4 A;  4O79 A;  1WTY A;  3C8G B;  3IQC A;  3K66 A;  5F5H A;  4KNW A;  2H8A A;  1K04 A;  4H54 A;  3DAG A;  3B0U X;  1EI7 A;  3R2P A;  2KQ9 A;  4AE4 B;  1T6I A;  3M79 A;  2EIL C;  3V5X A;  3NG1 A;  3M15 A;  3JCU Q;  3MYI A;  1FR0 A;  3WAQ A;  3HNL A;  1AEP A;  1W2W A;  5COM A;  2XL6 A;  2ICW G;  2VH3 A;  3ECS A;  4LLE A;  3V5Z A;  2LSE A;  4DVZ A;  3FVY A;  3O39 A;  3EFO B;  4JCZ A;  4IRU A;  5JT4 A;  1YLM A;  3B0V C;  2KW3 C;  2OKU A;  1OR2 A;  2QE9 A;  2Y3H A;  3G4X A;  2J9B A;  2EIJ C;  4J7T A;  3ZTZ A;  1F1M A;  1NZE A;  3EFO A;  3PCV A;  1CGN A;  5DS6 A;  2XLM A;  3CQZ A;  4KBL A;  4JCH A;  2M64 A; 
#chains in the Genus database with same CATH homology
 1YAU O;  3JRM O;  3IPM O;  3JSE O;  1AVO B;  1FNT c;  1YA7 O;  3JTL O;  1YAR O;  1Z7Q c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...