1Z7Qc

Crystal structure of the 20s proteasome from yeast in complex with the proteasome activator pa26 from trypanosome brucei at 3.2 angstroms resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
230
structure length
230
Chain Sequence
PPKRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGVDAESGKTKGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGSDHMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The 1.9 A structure of a proteasome-11S activator complex and implications for proteasome-PAN/PA700 interactions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/hydrolase activator
molecule keywords Proteasome component C7-alpha
total genus 80
structure length 230
sequence length 230
chains with identical sequence d, e, f, g, h, i, j, k, l, m, n, o, p
ec nomenclature
pdb deposition date 2005-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
c PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1z7qc01
3IPMO 1AVOB 1Z7Qc 1FNTc 1YA7O 1YAUO 3JRMO 1YARO 3JTLO 3JSEO
chains in the Genus database with same CATH superfamily
2NUTB 4G0HA 5E33A 3U9MA 2J46A 1XZPA 2VCBA 4U5BE 4OIQF 2ZXPA 1MMDA 2DYRC 2GWWA 1SMYF 4Z9IA 2Q4FA 1ZVZA 3K1IA 4IRUA 2L7AA 4HFFB 1TFKB 4AE4B 1GGQA 5CI9A 1E84A 3J06A 1M2OA 1LI7A 2YLIA 3IEEA 3IQ6A 3RYLA 4DXWA 1RKEA 2KK1A 3BRJA 2A68F 4CS8A 1EA8A 4JJGA 2IXPA 3V7OA 2PP4A 2QNLA 1G4WR 2Y39A 3GEHA 2ASRA 2VB6A 3T6JA 1UG7A 4ANJA 2J0XA 4EBBA 2VC9A 3I4UA 3L34A 3K6BA 4XQ1A 1K05A 2JD3A 3EFOA 3NKEA 2MHRA 3QW0A 2YEVA 4HEAJ 5JRAA 2EIJC 3DE8A 2P7VA 1OCRC 1WOLA 2J7PA 4PJMA 1OCOC 4DOZA 5KYWA 5BQIA 3M1CB 1YZAA 1Q0DA 3VF0A 4E0HA 5DVWA 4FESA 3WAQA 2BL2A 3O6XA 2OU6A 3VAYA 2G3KA 2YQYA 3RFYA 5L3QA 1NZEA 2OJED 3C8GD 3RVZA 1PV3A 2XL4A 1TWCA 3UGPA 4U5FE 1E85A 4NTAA 2GFHA 3K33A 1H6GA 3U3BA 1K40A 3UMKA 2C03A 4MS2A 3FVYA 3FOOA 5KYWB 3O55A 2HMZA 2XLHA 2OOCA 5F28E 2WVNA 4DBQA 3EFOB 4E7ZA 3NYLA 3MX3A 1M6TA 1J8MF 3FAPB 3K1HA 3US6A 4DVYP 3W8HA 3IHUA 4QI0A 4XEFA 3RQFA 4JTAB 4JC7A 1MNDA 3B0PA 2E87A 3EJNA 3I5QA 3JSZA 3O39A 2J9UA 4MVSA 4D4NA 2CYDA 5T3TA 2CCYA 2IYLD 2A6EF 4LDQA 4U9EA 3L8IA 3U5SA 4AL1A 2EPLX 2J0WA 5COMA 5B1AC 4BEJA 3WHNA 2W4BA 4JKVA 5K0IA 2W9YA 1NLXA 3V5XA 5EK0A 4WGZA 1OR2A 3HLZA 1ZHTA 4CS9C 1I4ZA 1FR0A 2PFDA 4O79A 3U0CA 2ZXOA 2R7XA 2V26A 3C8GB 2A1DD 3G50A 4A4AA 2QTVA 4U9DA 3F46A 4CIPA 1Z7Qc 1YAUO 3UMIA 3ZQYA 4E7SA 5A6JA 4U5HA 1J8YF 3JYHA 3QZCA 2NSFA 3GEIA 2KQ9A 3SXKA 5D91A 5L0HA 4C7OA 4R32A 3POVA 2R7RA 2HZ8A 3AGTA 3ATPA 4XTKA 3LEOA 3RH3A 1OR3A 3HTKC 5DS4A 1KTMA 5GPGB 2L6GA 3GWLA 4N4WA 4EBJA 3RF3A 1YDIA 3HNKA 1LS4A 1NG1A 1ZU5A 4CS7A 4H4KC 5BQGA 1NBBA 3FXHA 1GM5A 2R7SA 1TWGA 5DQZA 4CDAA 4YT2A 3OWTA 4DVZA 3K1IC 5E3AA 5EHHA 3H2VA 4CX9A 2AVKA 2AU5A 2O9XA 1T5OA 4NC3A 2YWAA 1DOWA 3EZIA 3FAJA 1F1MA 3LAYA 1V4AA 1YA7O 4NY3A 2L6FA 3W4YA 1TKNA 3S0XA 2P6VA 3RQEA 4B6IA 4E0IA 3TJ5A 4KBLA 1RXQA 3S27A 2CW0F 2DYSC 1LIHA 1WWPA 4PACA 3U3FA 4DJ9A 2HSQA 4LLEA 4JTDB 4Q7CA 1H7IA 1RJ9B 3DKAA 2ICWG 2Q9AA 2W45A 4AX2A 5DS6A 2UUIA 2VH3A 1ZW2A 1CGNA 5L0GA 4LDKA 3EPVA 4KNVA 1A41A 5A6BD 2HSBA 1CGME 2KJGA 2JPUA 2Q7RA 2EILC 4BG0A 1KNYA 3DXJF 3S90A 2L6HA 2IXNA 3M79A 1C03A 2WB7A 2OKUA 3MYFA 2R7QA 3W2VA 1ORJA 3L8JA 2XLMA 3ABMC 4XPWA 5CI8A 4P6IC 3WODF 1APCA 1NFNA 4BPMA 3B9QA 1HMDA 4PFOA 4OIOF 4CDYA 2WZGA 4I44A 4UDVA 1JR8A 4X0RA 2NPUA 1C02A 3SEOA 2XLWA 3ECSA 3QTHA 5CIVA 2AWYA 3UMHA 3U2LA 3FOPA 3CAXA 1V54C 4MVOA 2FGYA 4NTBA 3M4CA 1T6QA 2L81A 1D1AA 3AQBA 3N0TA 1ZZPA 4OINF 4WJ0A 1LI5A 5F5HA 2NG1A 4LDRA 2R7OA 2QE9A 4NTFA 3W8IA 4E17A 5JT4A 4MNDA 1D1CA 1TWHA 3AOUA 3UR3C 2X0CA 3TULA 2A6HF 3DMDA 1QPUA 5KYXB 2WZLA 5AGFA 2RD9A 2J9WA 3NG1A 3VM6A 4J7YA 4LLCA 3JSEO 3VYWA 2HV6A 5DQTA 1FTSA 4MTGA 2H7VC 4U5GA 4CS9A 3SP1A 2H8AA 3T6GB 3DD7A 3Q6NA 3TK0A 3WG7C 4F4BA 3U2MA 4XLPF 1XZQA 5A6BA 3LS0A 4AE4A 3SNHA 4O6MA 4C3DA 1FMVA 2EPMX 3GODA 3A11A 3CSKA 3JCUQ 3AQCA 3IQCA 2YL7A 2KW3C 2G62A 1BR4A 3HJCA 1SF8A 2OEVA 5B1BC 4AL0A 4A2NB 2NUTA 1K04A 2IM8A 1A7VA 1FFHA 2KGOA 2YVKA 4EWCA 1H9TA 4GQHA 4FAPB 3S9OA 2H7OA 4ULVA 4IJJA 4EHPA 1UFBA 1NU9C 4H54A 2TMVP 2A0BA 1MMAA 2RSEB 1ORYA 1T6UA 3RKOF 1LE2A 3SXMA 3GWNA 2HV7A 3M4BA 1IZMA 2KC3A 2LD6A 4QDLA 5BUOA 5E3CA 1PCXA 2BC5A 2HJMA 1HE1A 1T01A 1YVIA 1CPRA 2PNOA 4K7BA 2OEXA 1LM3B 2J45A 2EIMC 3N24A 1T9KA 1VTMP 4JURI 3ZC4A 1U0BB 4C3EA 5A6AA 4G7ZF 4LERA 2JX0A 4RDAA 4BJ6C 4E18A 4WGYA 4I1OB 2V3CC 1WASA 2NUPB 1HY5A 1OCZC 2QUPA 3PDMP 2B0HA 2P1AA 1L3PA 2Y69C 1YYJA 1OW7A 2XS1A 4I1MA 2R7VA 4W8PA 3C8ZA 3CZ6A 1Q0GA 4JCZA 2F22A 3DJNB 3EHNA 1VYIA 4IAQA 3E70C 1JOGA 2I15A 1Z5ZA 4I3MA 4JW1A 2WVOA 1OW8A 4CDVA 4XWJA 3ZWIA 2LK4A 3LLKA 1CPQA 3TOLA 1XWJA 4J7TA 5JS5A 5KYUA 3EH1A 1JRAA 1AVOB 4YT5A 1I5NA 1VOMA 2OG2A 1NSGB 2D4UA 1WATA 3K66A 3LNMB 2YL0A 3NMJA 4PR9A 4CBEA 1RCPA 3CQZA 4EBKA 2OCCC 1VK5A 1PD0A 1TR2A 1MQVA 1QSPA 1OQCA 3SXZA 1QQ3A 2HUJA 1LE4A 3HNLA 1ST6A 3LJBA 3B0VC 3ZTMA 1NU7D 1O87A 1S7ZA 3AG4C 1QVXA 1WGWA 3OEOA 4BEMJ 4ER9A 3C7JA 1ORSC 2EPNA 4JRZA 5E2QA 2XS8A 1M2VB 4IAOA 1ZHYA 5HSWA 3EG9A 4MVMA 4IWBA 4N6HA 1JAFA 3BEHA 3U8VA 3JT1A 4G7HF 4U5DE 4MQ9F 3JZ0A 1RKCA 1Z3IX 2DB4A 2ETSA 1YARO 5KYXA 2G3VA 1VLTA 4P9FA 3S28A 4MTFA 5COFA 4XLNF 3ZQVA 3ZTZA 4FX5A 5T1DB 5KYYB 4CIHA 1MNEA 4DBRA 1OXBA 3A9CA 3LEVA 4PFPA 4RD9A 1Y4CA 5A69A 3RIPA 3IQ5A 3KYJA 1E2XA 4Q4ZF 1GQAA 3OA1A 1VMAA 3DM5A 2C04A 5HV9A 1VLSA 2WZFA 1PD1A 3H2UA 3R2PA 4D4XA 4CJOA 2LQGA 2BE5F 1RJ9A 1ZU4A 3GANA 5AC5A 1WN0A 1OW6A 1ZHXA 3AJMA 3FMSA 3QW1A 1O3UA 4RBNA 4YT4A 5L0FA 2I8BA 1N1CA 3EZHA 4DRJB 3IPMO 2XLDA 3QVYA 4EKWA 1D0XA 3GM2A 3ABKC 2HJ3A 2Y3DA 5DLJA 3DAFA 3ZSUA 4G78A 1EKYA 5L3VA 1E86A 1V55C 1MMGA 3ITFA 2M4EA 3NYMA 4CS8C 2PF4E 4EIYA 3NDBB 3HKKA 5IY5C 1LS1A 1W2WA 5L0JA 2L9JA 2YZSA 4M63A 2R7TA 2X51A 2KNHA 4JTCB 1DOVA 3C63A 4YL3A 5JUAA 3EHMA 5F5FA 5FCLA 2IXMA 2CNWD 1IW7F 4N6CA 3B71A 1H9GA 3X1OA 2R02A 2R9RB 3T6BA 1JMWA 2ZPAA 3KMIA 2GDCA 2LSEA 3NKDA 1A7EA 4JCHA 4WABA 3AGUA 4YWQA 1LVKA 1QZXA 1MMNA 2J9BA 3EGDA 3LNRA 4K0DA 2P61A 1M57C 2QY9A 4FWVA 1KU2A 3DI5A 2DI3A 4MW8A 3MLGA 1OXKA 4Z9HA 2HFIA 2CDQA 1BZ4A 4OD4A 1VYKA 3O10A 1FAPB 5JLIA 3SYNA 1Z63A 1AUEA 4BJ6A 2AWCA 4CJGA 3NRHA 2Q00A 3NYJA 4OIRF 2LCHA 1EI7A 1Z6AA 2GAQA 1BR2A 4XEKA 2Q3TA 2Q9CA 3ZG1A 4Z9JA 1QLEC 2WVQA 3SXYA 1NFOA 4MVUA 5FZTA 1AEPA 4JIOA 4AK9A 4BJ5A 2NUPA 4GEHA 3KKBA 3L0IA 2YHSA 3VRCA 2XM0A 4MVQA 4KI2A 3QMKA 3Q6MA 1D0YA 2XLVA 1A0BA 4ZLCA 2YL3A 4JEAA 3ZDLA 4DRIB 1EQ1A 4IB4A 3DE9A 4CSAA 5COGA 1BDJB 3ASOC 2YLDA 4MVRA 4PJJA 3EGXB 4Q5SF 1L7CA 1BR1A 3GEEA 1SYQA 3JRTA 1HMOA 4J32B 4NCQA 5BQHA 2OJQA 3EGXA 1HE9A 1QKRA 2ZXRA 3AG3C 3AG1C 1B68A 2XLEA 2QLAA 1ZHWA 2OQMA 3U9JA 3NMKA 4XEVA 4EUKB 3C8GA 3HNIA 1JPJA 4HFKB 2KYHA 3EGDB 3Q7LA 3CEXA 3S29A 5EGYA 3GORA 3ZIBA 3R7CA 3LS1A 3DM9B 4J30B 1OCCC 3FHDA 1U89A 4N06A 4YL0A 4LACB 4PJNA 1Q0KA 3HNJA 1G8XA 2XLOA 1Y6DA 3RVYA 1O5HA 4U5EE 3V5ZA 4YT8A 3F47A 5AC4A 1R5ID 1Z23A 3M15A 4NQFA 2HKVA 2GA0A 5DS5A 1FMWA 2R7UA 1I4YA 2KSFA 1D0ZA 3Q7GA 2LFDA 1TFOB 2YLGA 2XSEA 4YJWA 1YYXA 4XPXA 4YL1A 2CNWA 4W8KA 2B0JA 2VCCA 256BA 3W2WA 2IXOA 4ULWA 1Q0MA 2MYSA 3AG2C 2D5RB 2NSGA 1GS9A 2W4MA 2HMQA 1ZHZA 2YRFA 2J9VA 3I5PA 3SZRA 2UUHA 2XL6A 3GM3A 3N2ZB 4P9TA 3E9VA 3DZAA 4OIPF 3ABLC 3GM1A 4ZLDA 1TQGA 2MWQA 4ONSA 2WL8A 3C62A 5KYNA 3MFNA 1YJGA 2HS5A 2A0UA 1RKEB 1C17M 4MVZA 3X2QC 4PJLA 5TJ5E 2AP3A 4YK5A 4BJTA 3V5YA 3G4ZA 2EINC 3K7DA 1HW1A 3EH2A 1FNTc 5T3WA 1WTYA 5B3IA 3IQTA 1LKXA 1TWAA 3JRMO 4JE9A 3T9OA 3TJ6A 2P0NA 2Y3BA 3H65A 4OD5A 2PBEA 2LFFA 3MBGA 3MYIA 4IGGA 2R7WA 3QVZA 3LUTB 1G5ZA 3EG9B 1M2VA 2DGJA 4BJ1A 1ZYRF 2Y3HA 3TD7A 1JPNA 3PHF2 1VB5A 4MTOA 2IOQA 1R4TA 1D1BA 2H7BA 3ZVRA 3EQLF 1FFTC 3TOMA 4JEBA 1Q0FA 2LIGA 4G7OF 3L1MA 5L0DA 1U6HA 3C18A 4HE8D 2YL1A 2VCAA 5JVEA 4XPYA 1OKKA 2Y3GA 3LESA 5JP7A 2R25A 5KYYA 3ASNC 1SR2A 4K1OA 3B29A 2EIKC 3DJUB 3G4XA 4O6NA 4BJ5C 5KYUB 1T6IA 3PCVA 1YLMA 4PK4A 2EPOA 1V74B 1RMVA 4O6YA 2YKZA 2ZXWC 3KL4A 3U8PA 3FDQA 2XXAA 4L6RA 2PX0A 3KH2A 3RQGA 5L0IA 2R03A 1ZW3A 1S05A 3B0UX 1M56C 4KC9A 2CGEA 2EPKX 2M64A 2FFHA 2XL8A 4JVSA 3RW0A 1HW2A 4CSAC 4JZAA 1CGOA 1G4US 2XXAB 2VASA 3DWWA 4KNWA 2J8WA 4U5CE 5D92A 4GYTA 3DAGA 3UNGC 2Z15A 5B3SC 2R05A 3UGOA 1BBHA 4C3BA 3PMRA 5JSLA 2FAPB 2XM4A 1YZCA 3T4RA 3LLIA 4O7GA 3NMIA 4C7OB 3JTLO 1A7DA 1LPEA 5L0CA 2A69F 2LP4A 2XRHA 3S84A 3JYYA 4YN0B 2J7PD 2PX3A 4MW3A 1YA9A 2ZD9A 4QI2A 3KYIA 2Q9BA 1SZIA 5A6KA 1OKKD 4JJFA 3TQOA 2IBFA 1E83A 4IARA 3KPHA 4DRHB
chains in the Genus database with same CATH topology
3IPMO 1AVOB 1Z7Qc 1FNTc 1YA7O 1YAUO 3JRMO 1YARO 3JTLO 3JSEO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IPM O;  1AVO B;  1Z7Q c;  1FNT c;  1YA7 O;  1YAU O;  3JRM O;  1YAR O;  3JTL O;  3JSE O; 
#chains in the Genus database with same CATH topology
 2NUT B;  4G0H A;  5E33 A;  3U9M A;  2J46 A;  1XZP A;  2VCB A;  4U5B E;  4OIQ F;  2ZXP A;  1MMD A;  2DYR C;  2GWW A;  1SMY F;  4Z9I A;  2Q4F A;  1ZVZ A;  3K1I A;  4IRU A;  2L7A A;  4HFF B;  1TFK B;  4AE4 B;  1GGQ A;  5CI9 A;  1E84 A;  3J06 A;  1M2O A;  1LI7 A;  2YLI A;  3IEE A;  3IQ6 A;  3RYL A;  4DXW A;  1RKE A;  2KK1 A;  3BRJ A;  2A68 F;  4CS8 A;  1EA8 A;  4JJG A;  2IXP A;  3V7O A;  2PP4 A;  2QNL A;  1G4W R;  2Y39 A;  3GEH A;  2ASR A;  2VB6 A;  3T6J A;  1UG7 A;  4ANJ A;  2J0X A;  4EBB A;  2VC9 A;  3I4U A;  3L34 A;  3K6B A;  4XQ1 A;  1K05 A;  2JD3 A;  3EFO A;  3NKE A;  2MHR A;  3QW0 A;  2YEV A;  4HEA J;  5JRA A;  2EIJ C;  3DE8 A;  2P7V A;  1OCR C;  1WOL A;  2J7P A;  4PJM A;  1OCO C;  4DOZ A;  5KYW A;  5BQI A;  3M1C B;  1YZA A;  1Q0D A;  3VF0 A;  4E0H A;  5DVW A;  4FES A;  3WAQ A;  2BL2 A;  3O6X A;  2OU6 A;  3VAY A;  2G3K A;  2YQY A;  3RFY A;  5L3Q A;  1NZE A;  2OJE D;  3C8G D;  3RVZ A;  1PV3 A;  2XL4 A;  1TWC A;  3UGP A;  4U5F E;  1E85 A;  4NTA A;  2GFH A;  3K33 A;  1H6G A;  3U3B A;  1K40 A;  3UMK A;  2C03 A;  4MS2 A;  3FVY A;  3FOO A;  5KYW B;  3O55 A;  2HMZ A;  2XLH A;  2OOC A;  5F28 E;  2WVN A;  4DBQ A;  3EFO B;  4E7Z A;  3NYL A;  3MX3 A;  1M6T A;  1J8M F;  3FAP B;  3K1H A;  3US6 A;  4DVY P;  3W8H A;  3IHU A;  4QI0 A;  4XEF A;  3RQF A;  4JTA B;  4JC7 A;  1MND A;  3B0P A;  2E87 A;  3EJN A;  3I5Q A;  3JSZ A;  3O39 A;  2J9U A;  4MVS A;  4D4N A;  2CYD A;  5T3T A;  2CCY A;  2IYL D;  2A6E F;  4LDQ A;  4U9E A;  3L8I A;  3U5S A;  4AL1 A;  2EPL X;  2J0W A;  5COM A;  5B1A C;  4BEJ A;  3WHN A;  2W4B A;  4JKV A;  5K0I A;  2W9Y A;  1NLX A;  3V5X A;  5EK0 A;  4WGZ A;  1OR2 A;  3HLZ A;  1ZHT A;  4CS9 C;  1I4Z A;  1FR0 A;  2PFD A;  4O79 A;  3U0C A;  2ZXO A;  2R7X A;  2V26 A;  3C8G B;  2A1D D;  3G50 A;  4A4A A;  2QTV A;  4U9D A;  3F46 A;  4CIP A;  1Z7Q c;  1YAU O;  3UMI A;  3ZQY A;  4E7S A;  5A6J A;  4U5H A;  1J8Y F;  3JYH A;  3QZC A;  2NSF A;  3GEI A;  2KQ9 A;  3SXK A;  5D91 A;  5L0H A;  4C7O A;  4R32 A;  3POV A;  2R7R A;  2HZ8 A;  3AGT A;  3ATP A;  4XTK A;  3LEO A;  3RH3 A;  1OR3 A;  3HTK C;  5DS4 A;  1KTM A;  5GPG B;  2L6G A;  3GWL A;  4N4W A;  4EBJ A;  3RF3 A;  1YDI A;  3HNK A;  1LS4 A;  1NG1 A;  1ZU5 A;  4CS7 A;  4H4K C;  5BQG A;  1NBB A;  3FXH A;  1GM5 A;  2R7S A;  1TWG A;  5DQZ A;  4CDA A;  4YT2 A;  3OWT A;  4DVZ A;  3K1I C;  5E3A A;  5EHH A;  3H2V A;  4CX9 A;  2AVK A;  2AU5 A;  2O9X A;  1T5O A;  4NC3 A;  2YWA A;  1DOW A;  3EZI A;  3FAJ A;  1F1M A;  3LAY A;  1V4A A;  1YA7 O;  4NY3 A;  2L6F A;  3W4Y A;  1TKN A;  3S0X A;  2P6V A;  3RQE A;  4B6I A;  4E0I A;  3TJ5 A;  4KBL A;  1RXQ A;  3S27 A;  2CW0 F;  2DYS C;  1LIH A;  1WWP A;  4PAC A;  3U3F A;  4DJ9 A;  2HSQ A;  4LLE A;  4JTD B;  4Q7C A;  1H7I A;  1RJ9 B;  3DKA A;  2ICW G;  2Q9A A;  2W45 A;  4AX2 A;  5DS6 A;  2UUI A;  2VH3 A;  1ZW2 A;  1CGN A;  5L0G A;  4LDK A;  3EPV A;  4KNV A;  1A41 A;  5A6B D;  2HSB A;  1CGM E;  2KJG A;  2JPU A;  2Q7R A;  2EIL C;  4BG0 A;  1KNY A;  3DXJ F;  3S90 A;  2L6H A;  2IXN A;  3M79 A;  1C03 A;  2WB7 A;  2OKU A;  3MYF A;  2R7Q A;  3W2V A;  1ORJ A;  3L8J A;  2XLM A;  3ABM C;  4XPW A;  5CI8 A;  4P6I C;  3WOD F;  1APC A;  1NFN A;  4BPM A;  3B9Q A;  1HMD A;  4PFO A;  4OIO F;  4CDY A;  2WZG A;  4I44 A;  4UDV A;  1JR8 A;  4X0R A;  2NPU A;  1C02 A;  3SEO A;  2XLW A;  3ECS A;  3QTH A;  5CIV A;  2AWY A;  3UMH A;  3U2L A;  3FOP A;  3CAX A;  1V54 C;  4MVO A;  2FGY A;  4NTB A;  3M4C A;  1T6Q A;  2L81 A;  1D1A A;  3AQB A;  3N0T A;  1ZZP A;  4OIN F;  4WJ0 A;  1LI5 A;  5F5H A;  2NG1 A;  4LDR A;  2R7O A;  2QE9 A;  4NTF A;  3W8I A;  4E17 A;  5JT4 A;  4MND A;  1D1C A;  1TWH A;  3AOU A;  3UR3 C;  2X0C A;  3TUL A;  2A6H F;  3DMD A;  1QPU A;  5KYX B;  2WZL A;  5AGF A;  2RD9 A;  2J9W A;  3NG1 A;  3VM6 A;  4J7Y A;  4LLC A;  3JSE O;  3VYW A;  2HV6 A;  5DQT A;  1FTS A;  4MTG A;  2H7V C;  4U5G A;  4CS9 A;  3SP1 A;  2H8A A;  3T6G B;  3DD7 A;  3Q6N A;  3TK0 A;  3WG7 C;  4F4B A;  3U2M A;  4XLP F;  1XZQ A;  5A6B A;  3LS0 A;  4AE4 A;  3SNH A;  4O6M A;  4C3D A;  1FMV A;  2EPM X;  3GOD A;  3A11 A;  3CSK A;  3JCU Q;  3AQC A;  3IQC A;  2YL7 A;  2KW3 C;  2G62 A;  1BR4 A;  3HJC A;  1SF8 A;  2OEV A;  5B1B C;  4AL0 A;  4A2N B;  2NUT A;  1K04 A;  2IM8 A;  1A7V A;  1FFH A;  2KGO A;  2YVK A;  4EWC A;  1H9T A;  4GQH A;  4FAP B;  3S9O A;  2H7O A;  4ULV A;  4IJJ A;  4EHP A;  1UFB A;  1NU9 C;  4H54 A;  2TMV P;  2A0B A;  1MMA A;  2RSE B;  1ORY A;  1T6U A;  3RKO F;  1LE2 A;  3SXM A;  3GWN A;  2HV7 A;  3M4B A;  1IZM A;  2KC3 A;  2LD6 A;  4QDL A;  5BUO A;  5E3C A;  1PCX A;  2BC5 A;  2HJM A;  1HE1 A;  1T01 A;  1YVI A;  1CPR A;  2PNO A;  4K7B A;  2OEX A;  1LM3 B;  2J45 A;  2EIM C;  3N24 A;  1T9K A;  1VTM P;  4JUR I;  3ZC4 A;  1U0B B;  4C3E A;  5A6A A;  4G7Z F;  4LER A;  2JX0 A;  4RDA A;  4BJ6 C;  4E18 A;  4WGY A;  4I1O B;  2V3C C;  1WAS A;  2NUP B;  1HY5 A;  1OCZ C;  2QUP A;  3PDM P;  2B0H A;  2P1A A;  1L3P A;  2Y69 C;  1YYJ A;  1OW7 A;  2XS1 A;  4I1M A;  2R7V A;  4W8P A;  3C8Z A;  3CZ6 A;  1Q0G A;  4JCZ A;  2F22 A;  3DJN B;  3EHN A;  1VYI A;  4IAQ A;  3E70 C;  1JOG A;  2I15 A;  1Z5Z A;  4I3M A;  4JW1 A;  2WVO A;  1OW8 A;  4CDV A;  4XWJ A;  3ZWI A;  2LK4 A;  3LLK A;  1CPQ A;  3TOL A;  1XWJ A;  4J7T A;  5JS5 A;  5KYU A;  3EH1 A;  1JRA A;  1AVO B;  4YT5 A;  1I5N A;  1VOM A;  2OG2 A;  1NSG B;  2D4U A;  1WAT A;  3K66 A;  3LNM B;  2YL0 A;  3NMJ A;  4PR9 A;  4CBE A;  1RCP A;  3CQZ A;  4EBK A;  2OCC C;  1VK5 A;  1PD0 A;  1TR2 A;  1MQV A;  1QSP A;  1OQC A;  3SXZ A;  1QQ3 A;  2HUJ A;  1LE4 A;  3HNL A;  1ST6 A;  3LJB A;  3B0V C;  3ZTM A;  1NU7 D;  1O87 A;  1S7Z A;  3AG4 C;  1QVX A;  1WGW A;  3OEO A;  4BEM J;  4ER9 A;  3C7J A;  1ORS C;  2EPN A;  4JRZ A;  5E2Q A;  2XS8 A;  1M2V B;  4IAO A;  1ZHY A;  5HSW A;  3EG9 A;  4MVM A;  4IWB A;  4N6H A;  1JAF A;  3BEH A;  3U8V A;  3JT1 A;  4G7H F;  4U5D E;  4MQ9 F;  3JZ0 A;  1RKC A;  1Z3I X;  2DB4 A;  2ETS A;  1YAR O;  5KYX A;  2G3V A;  1VLT A;  4P9F A;  3S28 A;  4MTF A;  5COF A;  4XLN F;  3ZQV A;  3ZTZ A;  4FX5 A;  5T1D B;  5KYY B;  4CIH A;  1MNE A;  4DBR A;  1OXB A;  3A9C A;  3LEV A;  4PFP A;  4RD9 A;  1Y4C A;  5A69 A;  3RIP A;  3IQ5 A;  3KYJ A;  1E2X A;  4Q4Z F;  1GQA A;  3OA1 A;  1VMA A;  3DM5 A;  2C04 A;  5HV9 A;  1VLS A;  2WZF A;  1PD1 A;  3H2U A;  3R2P A;  4D4X A;  4CJO A;  2LQG A;  2BE5 F;  1RJ9 A;  1ZU4 A;  3GAN A;  5AC5 A;  1WN0 A;  1OW6 A;  1ZHX A;  3AJM A;  3FMS A;  3QW1 A;  1O3U A;  4RBN A;  4YT4 A;  5L0F A;  2I8B A;  1N1C A;  3EZH A;  4DRJ B;  3IPM O;  2XLD A;  3QVY A;  4EKW A;  1D0X A;  3GM2 A;  3ABK C;  2HJ3 A;  2Y3D A;  5DLJ A;  3DAF A;  3ZSU A;  4G78 A;  1EKY A;  5L3V A;  1E86 A;  1V55 C;  1MMG A;  3ITF A;  2M4E A;  3NYM A;  4CS8 C;  2PF4 E;  4EIY A;  3NDB B;  3HKK A;  5IY5 C;  1LS1 A;  1W2W A;  5L0J A;  2L9J A;  2YZS A;  4M63 A;  2R7T A;  2X51 A;  2KNH A;  4JTC B;  1DOV A;  3C63 A;  4YL3 A;  5JUA A;  3EHM A;  5F5F A;  5FCL A;  2IXM A;  2CNW D;  1IW7 F;  4N6C A;  3B71 A;  1H9G A;  3X1O A;  2R02 A;  2R9R B;  3T6B A;  1JMW A;  2ZPA A;  3KMI A;  2GDC A;  2LSE A;  3NKD A;  1A7E A;  4JCH A;  4WAB A;  3AGU A;  4YWQ A;  1LVK A;  1QZX A;  1MMN A;  2J9B A;  3EGD A;  3LNR A;  4K0D A;  2P61 A;  1M57 C;  2QY9 A;  4FWV A;  1KU2 A;  3DI5 A;  2DI3 A;  4MW8 A;  3MLG A;  1OXK A;  4Z9H A;  2HFI A;  2CDQ A;  1BZ4 A;  4OD4 A;  1VYK A;  3O10 A;  1FAP B;  5JLI A;  3SYN A;  1Z63 A;  1AUE A;  4BJ6 A;  2AWC A;  4CJG A;  3NRH A;  2Q00 A;  3NYJ A;  4OIR F;  2LCH A;  1EI7 A;  1Z6A A;  2GAQ A;  1BR2 A;  4XEK A;  2Q3T A;  2Q9C A;  3ZG1 A;  4Z9J A;  1QLE C;  2WVQ A;  3SXY A;  1NFO A;  4MVU A;  5FZT A;  1AEP A;  4JIO A;  4AK9 A;  4BJ5 A;  2NUP A;  4GEH A;  3KKB A;  3L0I A;  2YHS A;  3VRC A;  2XM0 A;  4MVQ A;  4KI2 A;  3QMK A;  3Q6M A;  1D0Y A;  2XLV A;  1A0B A;  4ZLC A;  2YL3 A;  4JEA A;  3ZDL A;  4DRI B;  1EQ1 A;  4IB4 A;  3DE9 A;  4CSA A;  5COG A;  1BDJ B;  3ASO C;  2YLD A;  4MVR A;  4PJJ A;  3EGX B;  4Q5S F;  1L7C A;  1BR1 A;  3GEE A;  1SYQ A;  3JRT A;  1HMO A;  4J32 B;  4NCQ A;  5BQH A;  2OJQ A;  3EGX A;  1HE9 A;  1QKR A;  2ZXR A;  3AG3 C;  3AG1 C;  1B68 A;  2XLE A;  2QLA A;  1ZHW A;  2OQM A;  3U9J A;  3NMK A;  4XEV A;  4EUK B;  3C8G A;  3HNI A;  1JPJ A;  4HFK B;  2KYH A;  3EGD B;  3Q7L A;  3CEX A;  3S29 A;  5EGY A;  3GOR A;  3ZIB A;  3R7C A;  3LS1 A;  3DM9 B;  4J30 B;  1OCC C;  3FHD A;  1U89 A;  4N06 A;  4YL0 A;  4LAC B;  4PJN A;  1Q0K A;  3HNJ A;  1G8X A;  2XLO A;  1Y6D A;  3RVY A;  1O5H A;  4U5E E;  3V5Z A;  4YT8 A;  3F47 A;  5AC4 A;  1R5I D;  1Z23 A;  3M15 A;  4NQF A;  2HKV A;  2GA0 A;  5DS5 A;  1FMW A;  2R7U A;  1I4Y A;  2KSF A;  1D0Z A;  3Q7G A;  2LFD A;  1TFO B;  2YLG A;  2XSE A;  4YJW A;  1YYX A;  4XPX A;  4YL1 A;  2CNW A;  4W8K A;  2B0J A;  2VCC A;  256B A;  3W2W A;  2IXO A;  4ULW A;  1Q0M A;  2MYS A;  3AG2 C;  2D5R B;  2NSG A;  1GS9 A;  2W4M A;  2HMQ A;  1ZHZ A;  2YRF A;  2J9V A;  3I5P A;  3SZR A;  2UUH A;  2XL6 A;  3GM3 A;  3N2Z B;  4P9T A;  3E9V A;  3DZA A;  4OIP F;  3ABL C;  3GM1 A;  4ZLD A;  1TQG A;  2MWQ A;  4ONS A;  2WL8 A;  3C62 A;  5KYN A;  3MFN A;  1YJG A;  2HS5 A;  2A0U A;  1RKE B;  1C17 M;  4MVZ A;  3X2Q C;  4PJL A;  5TJ5 E;  2AP3 A;  4YK5 A;  4BJT A;  3V5Y A;  3G4Z A;  2EIN C;  3K7D A;  1HW1 A;  3EH2 A;  1FNT c;  5T3W A;  1WTY A;  5B3I A;  3IQT A;  1LKX A;  1TWA A;  3JRM O;  4JE9 A;  3T9O A;  3TJ6 A;  2P0N A;  2Y3B A;  3H65 A;  4OD5 A;  2PBE A;  2LFF A;  3MBG A;  3MYI A;  4IGG A;  2R7W A;  3QVZ A;  3LUT B;  1G5Z A;  3EG9 B;  1M2V A;  2DGJ A;  4BJ1 A;  1ZYR F;  2Y3H A;  3TD7 A;  1JPN A;  3PHF 2;  1VB5 A;  4MTO A;  2IOQ A;  1R4T A;  1D1B A;  2H7B A;  3ZVR A;  3EQL F;  1FFT C;  3TOM A;  4JEB A;  1Q0F A;  2LIG A;  4G7O F;  3L1M A;  5L0D A;  1U6H A;  3C18 A;  4HE8 D;  2YL1 A;  2VCA A;  5JVE A;  4XPY A;  1OKK A;  2Y3G A;  3LES A;  5JP7 A;  2R25 A;  5KYY A;  3ASN C;  1SR2 A;  4K1O A;  3B29 A;  2EIK C;  3DJU B;  3G4X A;  4O6N A;  4BJ5 C;  5KYU B;  1T6I A;  3PCV A;  1YLM A;  4PK4 A;  2EPO A;  1V74 B;  1RMV A;  4O6Y A;  2YKZ A;  2ZXW C;  3KL4 A;  3U8P A;  3FDQ A;  2XXA A;  4L6R A;  2PX0 A;  3KH2 A;  3RQG A;  5L0I A;  2R03 A;  1ZW3 A;  1S05 A;  3B0U X;  1M56 C;  4KC9 A;  2CGE A;  2EPK X;  2M64 A;  2FFH A;  2XL8 A;  4JVS A;  3RW0 A;  1HW2 A;  4CSA C;  4JZA A;  1CGO A;  1G4U S;  2XXA B;  2VAS A;  3DWW A;  4KNW A;  2J8W A;  4U5C E;  5D92 A;  4GYT A;  3DAG A;  3UNG C;  2Z15 A;  5B3S C;  2R05 A;  3UGO A;  1BBH A;  4C3B A;  3PMR A;  5JSL A;  2FAP B;  2XM4 A;  1YZC A;  3T4R A;  3LLI A;  4O7G A;  3NMI A;  4C7O B;  3JTL O;  1A7D A;  1LPE A;  5L0C A;  2A69 F;  2LP4 A;  2XRH A;  3S84 A;  3JYY A;  4YN0 B;  2J7P D;  2PX3 A;  4MW3 A;  1YA9 A;  2ZD9 A;  4QI2 A;  3KYI A;  2Q9B A;  1SZI A;  5A6K A;  1OKK D;  4JJF A;  3TQO A;  2IBF A;  1E83 A;  4IAR A;  3KPH A;  4DRH B; 
#chains in the Genus database with same CATH homology
 3IPM O;  1AVO B;  1Z7Q c;  1FNT c;  1YA7 O;  1YAU O;  3JRM O;  1YAR O;  3JTL O;  3JSE O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...