1Z7Qc

Crystal structure of the 20s proteasome from yeast in complex with the proteasome activator pa26 from trypanosome brucei at 3.2 angstroms resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
230
structure length
230
Chain Sequence
PPKRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGVDAESGKTKGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGSDHMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase activator
molecule keywords Proteasome component C7-alpha
publication title The 1.9 A structure of a proteasome-11S activator complex and implications for proteasome-PAN/PA700 interactions.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 80
structure length 230
sequence length 230
chains with identical sequence d, e, f, g, h, i, j, k, l, m, n, o, p
ec nomenclature
pdb deposition date 2005-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
c PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 1z7qc01
3JSEO 1AVOB 1Z7Qc 1YA7O 3JRMO 3IPMO 1YAUO 1FNTc 3JTLO 1YARO
chains in the Genus database with same CATH superfamily
4E0HA 3H65A 4CX9A 3I5PA 1HE1A 3MX3A 256BA 2EPOA 3FHDA 4OIQF 3LLKA 1PD1A 4ZLCA 4IAQA 4CSAA 2EILC 4DRIB 4GYTA 3LLIA 3S0XA 2CNWD 3GEHA 5A6BD 3W4YA 4U9EA 1L7CA 4BEJA 5L0JA 2AVKA 4O6MA 3U2MA 3EFOA 3NKDA 1VYIA 3JYYA 3JSEO 3ASNC 1E2XA 2W4BA 3RF3A 3E70C 4D4XA 1XZPA 4U9DA 3MLGA 1ZHTA 5JSLA 3GODA 4U5HA 2ASRA 1Z5ZA 2GWWA 2JX0A 4YT8A 1SF8A 4H54A 4CS8C 1VK5A 3TD7A 3PCVA 2HFIA 2P7VA 3T6GB 2H7BA 3C63A 2R05A 1M56C 3S29A 2Y3BA 1GQAA 5CIVA 3FOPA 2QY9A 1VOMA 2GA0A 3TJ6A 5KYWA 2Q9BA 4O6YA 1QLEC 4DRJB 1SZIA 3HNIA 2Y69C 4Q4ZF 2JD3A 3RQFA 5E2QA 2AWYA 2P6VA 1VB5A 3AGTA 3DXJF 3QTHA 2NSGA 2XL6A 4MVOA 4Q7CA 5L0FA 4JJGA 1QVXA 4HFFB 3Q6NA 4EWCA 2P0NA 5KYYB 2QUPA 3SXYA 4XLPF 2GDCA 1M6TA 2Y3GA 3U8PA 2R7RA 4J32B 1Q0FA 1R4TA 1FFHA 1TWCA 3L8JA 3IEEA 1V54C 1VYKA 3JYHA 4JTAB 1OW7A 1ZZPA 2DYRC 5F5HA 5DS5A 1OKKA 3OEOA 1WOLA 1LE2A 5EGYA 2YVKA 1XWJA 2KQ9A 3DAFA 3JZ0A 5CI9A 4WABA 1MMAA 1R5ID 5COGA 2YWAA 3QVZA 3VRCA 4JURI 3EJNA 1XZQA 3QVYA 4LDQA 1T6UA 5DVWA 4DBQA 3X1OA 2R7VA 1AEPA 4ZLDA 2Z15A 1NU7D 2J9BA 3ZWIA 1A7DA 2W9YA 3AQBA 3NRHA 3PMRA 1YVIA 3JRTA 4YL1A 3G50A 4R32A 4PFPA 2M4EA 1C17M 2ZXPA 4ONSA 4CS8A 2CNWA 1ORSC 3HNKA 1FMWA 2EPKX 3JRMO 4YWQA 5A6BA 1NG1A 3GWNA 1RJ9B 4CS9C 3SXMA 4C7OB 1VMAA 3O55A 2Q00A 4MVUA 2OKUA 4FESA 1AVOB 2LFDA 1I4ZA 3HTKC 1N1CA 1YA7O 2KW3C 3KMIA 3LS0A 1APCA 1YA9A 3DE9A 4N4WA 4KC9A 3S84A 3IHUA 4G7OF 1L3PA 3EG9A 4IRUA 3ECSA 2YL7A 2B0JA 4IAOA 3NG1A 5KYXA 3NYMA 1VLSA 3BRJA 3EH1A 5B1BC 3VYWA 1Z63A 3HJCA 2WZLA 5TJ5E 2WZGA 3EGDA 1TWAA 4PACA 2EINC 1TQGA 2IOQA 4PJNA 2VB6A 3AGUA 3B29A 4CDAA 2YZSA 4BJ5A 5JT4A 2XS8A 4O6NA 4WJ0A 4FAPB 3AG3C 5BQHA 1WGWA 1CGME 2HSBA 2D5RB 4MVMA 3T6BA 4B6IA 1RCPA 3QZCA 1LM3B 2ZXOA 3SP1A 4E18A 4OIPF 2NUPA 3DE8A 1SR2A 2XLDA 3M15A 2XM4A 2QNLA 3NMIA 1HE9A 4C3DA 4U5EE 1O5HA 2PNOA 4YJWA 3ZTMA 3MBGA 1V4AA 4IWBA 5D91A 3V7OA 1G5ZA 3MYFA 4HEAJ 5FZTA 1OW6A 2EPLX 1EI7A 4A2NB 1OCCC 2D4UA 2EIKC 2NPUA 1I5NA 2EIMC 2OJQA 3EHMA 3EGXB 3FXHA 3CSKA 3J06A 2BL2A 2PX0A 4DVZA 1A41A 4LDKA 1Y4CA 2YEVA 4IB4A 1EA8A 4P6IC 3UMIA 2XM0A 3GWLA 5EHHA 1A7EA 2UUIA 2J8WA 3B9QA 3LESA 5CI8A 1LVKA 2NUTA 5L3VA 2LSEA 2C03A 3V5XA 3RQEA 2HS5A 3O39A 2WVOA 1BR2A 1G4US 1NZEA 1Q0KA 3FAJA 4O79A 3HNJA 4OD5A 2MHRA 1ZYRF 4YN0B 4EBJA 2V26A 1TFOB 1G8XA 3JT1A 4JEBA 4YL3A 4X0RA 4JW1A 3ASOC 2LCHA 2IYLD 3IQTA 1U0BB 3IPMO 1FTSA 3O6XA 2YL0A 5L0IA 2YLDA 4XWJA 3C62A 1M2VB 1DOVA 2V3CC 4U5DE 1QKRA 3POVA 5COFA 2OQMA 1YDIA 2A1DD 2YLGA 2F22A 1OCRC 3FVYA 2XXAB 2VCCA 1AUEA 1GS9A 2X51A 1VTMP 2YHSA 2YRFA 2G3KA 1WASA 3LNMB 2ICWG 4MVZA 2EPNA 2L6HA 5FCLA 3LUTB 4I1MA 1WTYA 3Q7GA 2KJGA 3DM5A 3WAQA 1OR3A 2L6FA 4OD4A 5JP7A 4EKWA 2RD9A 2L9JA 1S05A 3ZQVA 1HW2A 1YAUO 3EQLF 4EHPA 4UDVA 3UGOA 3DWWA 3TOMA 4XEKA 1TKNA 2A6EF 1OXBA 4AK9A 5AC5A 4U5GA 1C03A 1O3UA 1OCZC 2CW0F 4LLEA 2A6HF 4Z9JA 3K66A 4ULVA 3US6A 1QQ3A 2IBFA 4IGGA 4U5FE 2XLHA 5E33A 3SZRA 2YKZA 4CDYA 3S90A 5AC4A 1OR2A 1K04A 2R7SA 2A0UA 3RH3A 3UR3C 1TWGA 4NTBA 1MMNA 2BC5A 3PDMP 2JPUA 1LI7A 2GAQA 1J8MF 5EK0A 3CZ6A 3F47A 1RMVA 4BJ5C 2Y3DA 2XSEA 3DKAA 4DJ9A 4CIPA 2EPMX 1ZU5A 2XLEA 1JR8A 5T3WA 3B0PA 4FX5A 3SYNA 2ZXWC 3RVZA 4G0HA 2NSFA 3U3BA 2HJMA 4W8PA 4XLNF 3ZQYA 1T6IA 4HE8D 4MTGA 1IW7F 3JTLO 3TJ5A 4XPWA 3UMKA 2B0HA 5KYYA 1KNYA 2WL8A 2MYSA 2Q9AA 4NCQA 1U89A 2YQYA 4KNVA 3Q7LA 5L0HA 1EQ1A 1FAPB 2YL1A 5KYWB 4JEAA 2O9XA 1LI5A 3DMDA 5A6KA 4ULWA 3L0IA 3UMHA 2HMQA 3ATPA 3M1CB 3RKOF 3DJNB 3UNGC 4JCHA 4BJTA 3SXKA 4G78A 4LERA 5JRAA 2R9RB 3EZHA 1ORJA 2VH3A 2WVQA 4P9TA 1JAFA 1ZW3A 3U9JA 1W2WA 1I4YA 5AGFA 2IXPA 4IARA 5DS6A 1V55C 3R2PA 2PX3A 4A4AA 4EBKA 3QW0A 4PJJA 5L0CA 2G3VA 4NTFA 2HV6A 2Y3HA 4NQFA 1IZMA 1FMVA 1NLXA 4BG0A 3TQOA 1E85A 2IXOA 2AWCA 3GM2A 3C18A 1SMYF 1TR2A 2J0WA 4JJFA 4PJMA 3U5SA 4QI2A 5KYXB 3I5QA 3HLZA 3SNHA 3C7JA 5T1DB 5HV9A 1OXKA 1D0XA 1RJ9A 5D92A 4DOZA 3FMSA 1YARO 4C7OA 4Q5SF 1U6HA 2R7TA 4WGZA 2OEVA 3K1HA 5JLIA 1ZHZA 1RKEB 3M4CA 1UFBA 3C8GB 1KU2A 2J9UA 3GM1A 4HFKB 1Q0GA 4N6CA 4RDAA 3VAYA 3FAPB 1NSGB 3KKBA 1ZHXA 4P9FA 3ZG1A 1WN0A 2HUJA 4E17A 2QLAA 4YT2A 1G4WR 4OINF 3VM6A 2HJ3A 2Q4FA 2A68F 1BR4A 4JCZA 4OIRF 5KYUB 4MQ9F 1Z23A 1A7VA 4J7TA 5B3IA 3JCUQ 5BQIA 1H9TA 3QMKA 2LIGA 4C3BA 4JE9A 3EZIA 3W2VA 4U5CE 2A0BA 2HMZA 3UGPA 3ABKC 2DGJA 4LACB 1VLTA 1J8YF 2OJED 2J46A 3QW1A 2XLVA 1FNTc 4CBEA 1D1CA 4EUKB 2KNHA 1RKCA 4Z9HA 3V5YA 3B71A 1D0YA 3GEEA 4M63A 2C04A 4QDLA 1LIHA 2HKVA 1NFOA 5L0GA 1H7IA 2P1AA 2QE9A 2DB4A 1YZAA 2AU5A 1S7ZA 2H7OA 3EGXA 4ER9A 3BEHA 3TULA 1QPUA 2XL4A 4MTOA 3GEIA 3MFNA 3DM9B 4XEVA 4J7YA 3R7CA 4G7HF 1H6GA 2OEXA 4OIOF 4AE4B 3DJUB 4DBRA 3N0TA 3CAXA 1NBBA 1ZW2A 2OCCC 3A11A 1YJGA 4I44A 3N24A 4FWVA 4JC7A 4JTCB 4PJLA 4XTKA 2R7UA 2XS1A 1LS4A 1EKYA 4DRHB 1QZXA 1ZVZA 2BE5F 2H7VC 1NFNA 2PP4A 3ABLC 3CEXA 1K40A 3G4ZA 2R7QA 2XLOA 3ITFA 4XQ1A 4XPXA 3RQGA 2R25A 1QSPA 4RBNA 3ZIBA 4KI2A 4G7ZF 3AG1C 3EFOB 4PK4A 3TK0A 4K7BA 5L3QA 1PCXA 2XL8A 4JRZA 4JVSA 4MVSA 1D0ZA 5B1AC 2GFHA 1M2VA 3O10A 2EIJC 3U2LA 2G62A 2FAPB 2ZD9A 2Y39A 1FFTC 4K0DA 4YT4A 2OG2A 3AQCA 1YLMA 4CJGA 1BZ4A 1JOGA 3W8IA 1E84A 3PHF2 3NMJA 2XXAA 2M64A 4CJOA 2XLWA 3OA1A 2HV7A 2PFDA 4I1OB 2WB7A 4IJJA 4XEFA 3KYIA 2FGYA 2QTVA 3DD7A 4LDRA 3U9MA 5BUOA 1E83A 2KSFA 3NYJA 2E87A 3OWTA 4O7GA 3LEOA 3T6JA 4YL0A 4Z9IA 2FFHA 3H2VA 3K33A 2CYDA 1UG7A 4W8KA 4D4NA 4E0IA 2DI3A 2KYHA 3AJMA 4H4KC 1BDJB 2VCAA 3GORA 3ABMC 4BJ6C 5K0IA 3ZDLA 1M2OA 1Z7Qc 3Q6MA 3SEOA 4AL0A 1HY5A 1Y6DA 4BPMA 3RIPA 3S28A 3K6BA 5HSWA 1MMDA 2R7XA 3DZAA 2R02A 3FOOA 5JVEA 3M79A 3C8GD 4JIOA 4KNWA 4RD9A 3S9OA 5KYNA 1YYJA 1HW1A 2R7WA 1K05A 1LKXA 3X2QC 4E7ZA 4QI0A 3F46A 5F5FA 1PV3A 3GM3A 2I8BA 4CIHA 3LNRA 4CS7A 1Z6AA 3GANA 1CPRA 2VASA 3DAGA 3G4XA 4JTDB 3B0UX 5COMA 2WZFA 3U3FA 2I15A 3MYIA 1T01A 1JPNA 1YZCA 3T9OA 1Z3IX 3RFYA 1Q0DA 5A6JA 2MWQA 2TMVP 2NG1A 1CPQA 3DI5A 1CGOA 1LS1A 1WATA 1BBHA 2J7PD 1CGNA 2VCBA 3KH2A 1MNEA 3KL4A 3L8IA 1B68A 2Q3TA 2L7AA 3LJBA 1T6QA 5DQZA 3EHNA 2LQGA 2XLMA 2KK1A 2R03A 4AX2A 2UUHA 3I4UA 3IQ6A 3NMKA 1O87A 1RXQA 4EIYA 3EG9B 4MNDA 1MQVA 3AG4C 1H9GA 3C8ZA 3IQ5A 2ZXRA 3H2UA 2R7OA 3AOUA 4L6RA 4PFOA 3EH2A 4U5BE 3U8VA 3K1IC 1D1AA 1TWHA 4JZAA 3L34A 3RW0A 2W4MA 3EGDB 2YL3A 4BJ6A 2VC9A 3RVYA 2CGEA 4GEHA 4NTAA 3TOLA 1TFKB 2OU6A 4KBLA 4EBBA 5L0DA 1MMGA 5JUAA 3HNLA 3U0CA 1M57C 1ZHYA 2IM8A 2LP4A 1JRAA 4JKVA 4WGYA 5T3TA 1V74B 2LD6A 4NY3A 2HZ8A 3B0VC 3FDQA 1KTMA 4CDVA 3CQZA 2LFFA 5B3SC 2NUPB 4NC3A 3SXZA 3W2WA 1MNDA 1OQCA 1ZU4A 2IXMA 3NDBB 4BEMJ 5JS5A 2J9WA 1DOWA 3ZC4A 5DQTA 2OOCA 2L6GA 1D1BA 1Q0MA 5A6AA 2J9VA 4DVYP 1GM5A 2ZPAA 4GQHA 1OW8A 1C02A 3HKKA 3JSZA 4BJ1A 4MTFA 1RKEA 2PBEA 4MW3A 4F4BA 3AG2C 2KC3A 4CSAC 1JPJA 3C8GA 2YLIA 5E3CA 1GGQA 1A0BA 1ORYA 3A9CA 3IQCA 3K7DA 2RSEB 3T4RA 1JMWA 1ST6A 2NUTB 1E86A 1YYXA 2J0XA 4XPYA 3M4BA 2Q7RA 3W8HA 3ZVRA 4N6HA 3KYJA 4MVRA 2L81A 3ZSUA 4LLCA 2LK4A 2J45A 3WHNA 4E7SA 3LS1A 3N2ZB 3S27A 1LE4A 1F1MA 2CDQA 2PF4E 5KYUA 1HMOA 2DYSC 2P61A 4MW8A 3LEVA 4PR9A 3V5ZA 5GPGB 1BR1A 2CCYA 1FR0A 3L1MA 5BQGA 4N06A 2H8AA 3K1IA 3RYLA 4AL1A 5IY5C 1WWPA 4YT5A 2IXNA 2KGOA 2J7PA 1OCOC 5DS4A 4CS9A 1SYQA 4I3MA 2A69F 3WODF 4J30B 1OKKD 2X0CA 2HSQA 2WVNA 4YK5A 5DLJA 5F28E 1NU9C 4MVQA 1LPEA 5E3AA 2ETSA 1T5OA 2XRHA 3ZTZA 3KPHA 3WG7C 2Q9CA 1T9KA 4C3EA 3NYLA 1ZHWA 4DXWA 3VF0A 2AP3A 4ANJA 3LAYA 2W45A 4MS2A 4AE4A 4K1OA 1HMDA 3EPVA 3NKEA 3E9VA 5A69A 1PD0A
chains in the Genus database with same CATH topology
3JSEO 1AVOB 1Z7Qc 1YA7O 3JRMO 3IPMO 1YAUO 1FNTc 3JTLO 1YARO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSE O;  1AVO B;  1Z7Q c;  1YA7 O;  3JRM O;  3IPM O;  1YAU O;  1FNT c;  3JTL O;  1YAR O; 
#chains in the Genus database with same CATH topology
 4E0H A;  3H65 A;  4CX9 A;  3I5P A;  1HE1 A;  3MX3 A;  256B A;  2EPO A;  3FHD A;  4OIQ F;  3LLK A;  1PD1 A;  4ZLC A;  4IAQ A;  4CSA A;  2EIL C;  4DRI B;  4GYT A;  3LLI A;  3S0X A;  2CNW D;  3GEH A;  5A6B D;  3W4Y A;  4U9E A;  1L7C A;  4BEJ A;  5L0J A;  2AVK A;  4O6M A;  3U2M A;  3EFO A;  3NKD A;  1VYI A;  3JYY A;  3JSE O;  3ASN C;  1E2X A;  2W4B A;  3RF3 A;  3E70 C;  4D4X A;  1XZP A;  4U9D A;  3MLG A;  1ZHT A;  5JSL A;  3GOD A;  4U5H A;  2ASR A;  1Z5Z A;  2GWW A;  2JX0 A;  4YT8 A;  1SF8 A;  4H54 A;  4CS8 C;  1VK5 A;  3TD7 A;  3PCV A;  2HFI A;  2P7V A;  3T6G B;  2H7B A;  3C63 A;  2R05 A;  1M56 C;  3S29 A;  2Y3B A;  1GQA A;  5CIV A;  3FOP A;  2QY9 A;  1VOM A;  2GA0 A;  3TJ6 A;  5KYW A;  2Q9B A;  4O6Y A;  1QLE C;  4DRJ B;  1SZI A;  3HNI A;  2Y69 C;  4Q4Z F;  2JD3 A;  3RQF A;  5E2Q A;  2AWY A;  2P6V A;  1VB5 A;  3AGT A;  3DXJ F;  3QTH A;  2NSG A;  2XL6 A;  4MVO A;  4Q7C A;  5L0F A;  4JJG A;  1QVX A;  4HFF B;  3Q6N A;  4EWC A;  2P0N A;  5KYY B;  2QUP A;  3SXY A;  4XLP F;  2GDC A;  1M6T A;  2Y3G A;  3U8P A;  2R7R A;  4J32 B;  1Q0F A;  1R4T A;  1FFH A;  1TWC A;  3L8J A;  3IEE A;  1V54 C;  1VYK A;  3JYH A;  4JTA B;  1OW7 A;  1ZZP A;  2DYR C;  5F5H A;  5DS5 A;  1OKK A;  3OEO A;  1WOL A;  1LE2 A;  5EGY A;  2YVK A;  1XWJ A;  2KQ9 A;  3DAF A;  3JZ0 A;  5CI9 A;  4WAB A;  1MMA A;  1R5I D;  5COG A;  2YWA A;  3QVZ A;  3VRC A;  4JUR I;  3EJN A;  1XZQ A;  3QVY A;  4LDQ A;  1T6U A;  5DVW A;  4DBQ A;  3X1O A;  2R7V A;  1AEP A;  4ZLD A;  2Z15 A;  1NU7 D;  2J9B A;  3ZWI A;  1A7D A;  2W9Y A;  3AQB A;  3NRH A;  3PMR A;  1YVI A;  3JRT A;  4YL1 A;  3G50 A;  4R32 A;  4PFP A;  2M4E A;  1C17 M;  2ZXP A;  4ONS A;  4CS8 A;  2CNW A;  1ORS C;  3HNK A;  1FMW A;  2EPK X;  3JRM O;  4YWQ A;  5A6B A;  1NG1 A;  3GWN A;  1RJ9 B;  4CS9 C;  3SXM A;  4C7O B;  1VMA A;  3O55 A;  2Q00 A;  4MVU A;  2OKU A;  4FES A;  1AVO B;  2LFD A;  1I4Z A;  3HTK C;  1N1C A;  1YA7 O;  2KW3 C;  3KMI A;  3LS0 A;  1APC A;  1YA9 A;  3DE9 A;  4N4W A;  4KC9 A;  3S84 A;  3IHU A;  4G7O F;  1L3P A;  3EG9 A;  4IRU A;  3ECS A;  2YL7 A;  2B0J A;  4IAO A;  3NG1 A;  5KYX A;  3NYM A;  1VLS A;  3BRJ A;  3EH1 A;  5B1B C;  3VYW A;  1Z63 A;  3HJC A;  2WZL A;  5TJ5 E;  2WZG A;  3EGD A;  1TWA A;  4PAC A;  2EIN C;  1TQG A;  2IOQ A;  4PJN A;  2VB6 A;  3AGU A;  3B29 A;  4CDA A;  2YZS A;  4BJ5 A;  5JT4 A;  2XS8 A;  4O6N A;  4WJ0 A;  4FAP B;  3AG3 C;  5BQH A;  1WGW A;  1CGM E;  2HSB A;  2D5R B;  4MVM A;  3T6B A;  4B6I A;  1RCP A;  3QZC A;  1LM3 B;  2ZXO A;  3SP1 A;  4E18 A;  4OIP F;  2NUP A;  3DE8 A;  1SR2 A;  2XLD A;  3M15 A;  2XM4 A;  2QNL A;  3NMI A;  1HE9 A;  4C3D A;  4U5E E;  1O5H A;  2PNO A;  4YJW A;  3ZTM A;  3MBG A;  1V4A A;  4IWB A;  5D91 A;  3V7O A;  1G5Z A;  3MYF A;  4HEA J;  5FZT A;  1OW6 A;  2EPL X;  1EI7 A;  4A2N B;  1OCC C;  2D4U A;  2EIK C;  2NPU A;  1I5N A;  2EIM C;  2OJQ A;  3EHM A;  3EGX B;  3FXH A;  3CSK A;  3J06 A;  2BL2 A;  2PX0 A;  4DVZ A;  1A41 A;  4LDK A;  1Y4C A;  2YEV A;  4IB4 A;  1EA8 A;  4P6I C;  3UMI A;  2XM0 A;  3GWL A;  5EHH A;  1A7E A;  2UUI A;  2J8W A;  3B9Q A;  3LES A;  5CI8 A;  1LVK A;  2NUT A;  5L3V A;  2LSE A;  2C03 A;  3V5X A;  3RQE A;  2HS5 A;  3O39 A;  2WVO A;  1BR2 A;  1G4U S;  1NZE A;  1Q0K A;  3FAJ A;  4O79 A;  3HNJ A;  4OD5 A;  2MHR A;  1ZYR F;  4YN0 B;  4EBJ A;  2V26 A;  1TFO B;  1G8X A;  3JT1 A;  4JEB A;  4YL3 A;  4X0R A;  4JW1 A;  3ASO C;  2LCH A;  2IYL D;  3IQT A;  1U0B B;  3IPM O;  1FTS A;  3O6X A;  2YL0 A;  5L0I A;  2YLD A;  4XWJ A;  3C62 A;  1M2V B;  1DOV A;  2V3C C;  4U5D E;  1QKR A;  3POV A;  5COF A;  2OQM A;  1YDI A;  2A1D D;  2YLG A;  2F22 A;  1OCR C;  3FVY A;  2XXA B;  2VCC A;  1AUE A;  1GS9 A;  2X51 A;  1VTM P;  2YHS A;  2YRF A;  2G3K A;  1WAS A;  3LNM B;  2ICW G;  4MVZ A;  2EPN A;  2L6H A;  5FCL A;  3LUT B;  4I1M A;  1WTY A;  3Q7G A;  2KJG A;  3DM5 A;  3WAQ A;  1OR3 A;  2L6F A;  4OD4 A;  5JP7 A;  4EKW A;  2RD9 A;  2L9J A;  1S05 A;  3ZQV A;  1HW2 A;  1YAU O;  3EQL F;  4EHP A;  4UDV A;  3UGO A;  3DWW A;  3TOM A;  4XEK A;  1TKN A;  2A6E F;  1OXB A;  4AK9 A;  5AC5 A;  4U5G A;  1C03 A;  1O3U A;  1OCZ C;  2CW0 F;  4LLE A;  2A6H F;  4Z9J A;  3K66 A;  4ULV A;  3US6 A;  1QQ3 A;  2IBF A;  4IGG A;  4U5F E;  2XLH A;  5E33 A;  3SZR A;  2YKZ A;  4CDY A;  3S90 A;  5AC4 A;  1OR2 A;  1K04 A;  2R7S A;  2A0U A;  3RH3 A;  3UR3 C;  1TWG A;  4NTB A;  1MMN A;  2BC5 A;  3PDM P;  2JPU A;  1LI7 A;  2GAQ A;  1J8M F;  5EK0 A;  3CZ6 A;  3F47 A;  1RMV A;  4BJ5 C;  2Y3D A;  2XSE A;  3DKA A;  4DJ9 A;  4CIP A;  2EPM X;  1ZU5 A;  2XLE A;  1JR8 A;  5T3W A;  3B0P A;  4FX5 A;  3SYN A;  2ZXW C;  3RVZ A;  4G0H A;  2NSF A;  3U3B A;  2HJM A;  4W8P A;  4XLN F;  3ZQY A;  1T6I A;  4HE8 D;  4MTG A;  1IW7 F;  3JTL O;  3TJ5 A;  4XPW A;  3UMK A;  2B0H A;  5KYY A;  1KNY A;  2WL8 A;  2MYS A;  2Q9A A;  4NCQ A;  1U89 A;  2YQY A;  4KNV A;  3Q7L A;  5L0H A;  1EQ1 A;  1FAP B;  2YL1 A;  5KYW B;  4JEA A;  2O9X A;  1LI5 A;  3DMD A;  5A6K A;  4ULW A;  3L0I A;  3UMH A;  2HMQ A;  3ATP A;  3M1C B;  3RKO F;  3DJN B;  3UNG C;  4JCH A;  4BJT A;  3SXK A;  4G78 A;  4LER A;  5JRA A;  2R9R B;  3EZH A;  1ORJ A;  2VH3 A;  2WVQ A;  4P9T A;  1JAF A;  1ZW3 A;  3U9J A;  1W2W A;  1I4Y A;  5AGF A;  2IXP A;  4IAR A;  5DS6 A;  1V55 C;  3R2P A;  2PX3 A;  4A4A A;  4EBK A;  3QW0 A;  4PJJ A;  5L0C A;  2G3V A;  4NTF A;  2HV6 A;  2Y3H A;  4NQF A;  1IZM A;  1FMV A;  1NLX A;  4BG0 A;  3TQO A;  1E85 A;  2IXO A;  2AWC A;  3GM2 A;  3C18 A;  1SMY F;  1TR2 A;  2J0W A;  4JJF A;  4PJM A;  3U5S A;  4QI2 A;  5KYX B;  3I5Q A;  3HLZ A;  3SNH A;  3C7J A;  5T1D B;  5HV9 A;  1OXK A;  1D0X A;  1RJ9 A;  5D92 A;  4DOZ A;  3FMS A;  1YAR O;  4C7O A;  4Q5S F;  1U6H A;  2R7T A;  4WGZ A;  2OEV A;  3K1H A;  5JLI A;  1ZHZ A;  1RKE B;  3M4C A;  1UFB A;  3C8G B;  1KU2 A;  2J9U A;  3GM1 A;  4HFK B;  1Q0G A;  4N6C A;  4RDA A;  3VAY A;  3FAP B;  1NSG B;  3KKB A;  1ZHX A;  4P9F A;  3ZG1 A;  1WN0 A;  2HUJ A;  4E17 A;  2QLA A;  4YT2 A;  1G4W R;  4OIN F;  3VM6 A;  2HJ3 A;  2Q4F A;  2A68 F;  1BR4 A;  4JCZ A;  4OIR F;  5KYU B;  4MQ9 F;  1Z23 A;  1A7V A;  4J7T A;  5B3I A;  3JCU Q;  5BQI A;  1H9T A;  3QMK A;  2LIG A;  4C3B A;  4JE9 A;  3EZI A;  3W2V A;  4U5C E;  2A0B A;  2HMZ A;  3UGP A;  3ABK C;  2DGJ A;  4LAC B;  1VLT A;  1J8Y F;  2OJE D;  2J46 A;  3QW1 A;  2XLV A;  1FNT c;  4CBE A;  1D1C A;  4EUK B;  2KNH A;  1RKC A;  4Z9H A;  3V5Y A;  3B71 A;  1D0Y A;  3GEE A;  4M63 A;  2C04 A;  4QDL A;  1LIH A;  2HKV A;  1NFO A;  5L0G A;  1H7I A;  2P1A A;  2QE9 A;  2DB4 A;  1YZA A;  2AU5 A;  1S7Z A;  2H7O A;  3EGX A;  4ER9 A;  3BEH A;  3TUL A;  1QPU A;  2XL4 A;  4MTO A;  3GEI A;  3MFN A;  3DM9 B;  4XEV A;  4J7Y A;  3R7C A;  4G7H F;  1H6G A;  2OEX A;  4OIO F;  4AE4 B;  3DJU B;  4DBR A;  3N0T A;  3CAX A;  1NBB A;  1ZW2 A;  2OCC C;  3A11 A;  1YJG A;  4I44 A;  3N24 A;  4FWV A;  4JC7 A;  4JTC B;  4PJL A;  4XTK A;  2R7U A;  2XS1 A;  1LS4 A;  1EKY A;  4DRH B;  1QZX A;  1ZVZ A;  2BE5 F;  2H7V C;  1NFN A;  2PP4 A;  3ABL C;  3CEX A;  1K40 A;  3G4Z A;  2R7Q A;  2XLO A;  3ITF A;  4XQ1 A;  4XPX A;  3RQG A;  2R25 A;  1QSP A;  4RBN A;  3ZIB A;  4KI2 A;  4G7Z F;  3AG1 C;  3EFO B;  4PK4 A;  3TK0 A;  4K7B A;  5L3Q A;  1PCX A;  2XL8 A;  4JRZ A;  4JVS A;  4MVS A;  1D0Z A;  5B1A C;  2GFH A;  1M2V A;  3O10 A;  2EIJ C;  3U2L A;  2G62 A;  2FAP B;  2ZD9 A;  2Y39 A;  1FFT C;  4K0D A;  4YT4 A;  2OG2 A;  3AQC A;  1YLM A;  4CJG A;  1BZ4 A;  1JOG A;  3W8I A;  1E84 A;  3PHF 2;  3NMJ A;  2XXA A;  2M64 A;  4CJO A;  2XLW A;  3OA1 A;  2HV7 A;  2PFD A;  4I1O B;  2WB7 A;  4IJJ A;  4XEF A;  3KYI A;  2FGY A;  2QTV A;  3DD7 A;  4LDR A;  3U9M A;  5BUO A;  1E83 A;  2KSF A;  3NYJ A;  2E87 A;  3OWT A;  4O7G A;  3LEO A;  3T6J A;  4YL0 A;  4Z9I A;  2FFH A;  3H2V A;  3K33 A;  2CYD A;  1UG7 A;  4W8K A;  4D4N A;  4E0I A;  2DI3 A;  2KYH A;  3AJM A;  4H4K C;  1BDJ B;  2VCA A;  3GOR A;  3ABM C;  4BJ6 C;  5K0I A;  3ZDL A;  1M2O A;  1Z7Q c;  3Q6M A;  3SEO A;  4AL0 A;  1HY5 A;  1Y6D A;  4BPM A;  3RIP A;  3S28 A;  3K6B A;  5HSW A;  1MMD A;  2R7X A;  3DZA A;  2R02 A;  3FOO A;  5JVE A;  3M79 A;  3C8G D;  4JIO A;  4KNW A;  4RD9 A;  3S9O A;  5KYN A;  1YYJ A;  1HW1 A;  2R7W A;  1K05 A;  1LKX A;  3X2Q C;  4E7Z A;  4QI0 A;  3F46 A;  5F5F A;  1PV3 A;  3GM3 A;  2I8B A;  4CIH A;  3LNR A;  4CS7 A;  1Z6A A;  3GAN A;  1CPR A;  2VAS A;  3DAG A;  3G4X A;  4JTD B;  3B0U X;  5COM A;  2WZF A;  3U3F A;  2I15 A;  3MYI A;  1T01 A;  1JPN A;  1YZC A;  3T9O A;  1Z3I X;  3RFY A;  1Q0D A;  5A6J A;  2MWQ A;  2TMV P;  2NG1 A;  1CPQ A;  3DI5 A;  1CGO A;  1LS1 A;  1WAT A;  1BBH A;  2J7P D;  1CGN A;  2VCB A;  3KH2 A;  1MNE A;  3KL4 A;  3L8I A;  1B68 A;  2Q3T A;  2L7A A;  3LJB A;  1T6Q A;  5DQZ A;  3EHN A;  2LQG A;  2XLM A;  2KK1 A;  2R03 A;  4AX2 A;  2UUH A;  3I4U A;  3IQ6 A;  3NMK A;  1O87 A;  1RXQ A;  4EIY A;  3EG9 B;  4MND A;  1MQV A;  3AG4 C;  1H9G A;  3C8Z A;  3IQ5 A;  2ZXR A;  3H2U A;  2R7O A;  3AOU A;  4L6R A;  4PFO A;  3EH2 A;  4U5B E;  3U8V A;  3K1I C;  1D1A A;  1TWH A;  4JZA A;  3L34 A;  3RW0 A;  2W4M A;  3EGD B;  2YL3 A;  4BJ6 A;  2VC9 A;  3RVY A;  2CGE A;  4GEH A;  4NTA A;  3TOL A;  1TFK B;  2OU6 A;  4KBL A;  4EBB A;  5L0D A;  1MMG A;  5JUA A;  3HNL A;  3U0C A;  1M57 C;  1ZHY A;  2IM8 A;  2LP4 A;  1JRA A;  4JKV A;  4WGY A;  5T3T A;  1V74 B;  2LD6 A;  4NY3 A;  2HZ8 A;  3B0V C;  3FDQ A;  1KTM A;  4CDV A;  3CQZ A;  2LFF A;  5B3S C;  2NUP B;  4NC3 A;  3SXZ A;  3W2W A;  1MND A;  1OQC A;  1ZU4 A;  2IXM A;  3NDB B;  4BEM J;  5JS5 A;  2J9W A;  1DOW A;  3ZC4 A;  5DQT A;  2OOC A;  2L6G A;  1D1B A;  1Q0M A;  5A6A A;  2J9V A;  4DVY P;  1GM5 A;  2ZPA A;  4GQH A;  1OW8 A;  1C02 A;  3HKK A;  3JSZ A;  4BJ1 A;  4MTF A;  1RKE A;  2PBE A;  4MW3 A;  4F4B A;  3AG2 C;  2KC3 A;  4CSA C;  1JPJ A;  3C8G A;  2YLI A;  5E3C A;  1GGQ A;  1A0B A;  1ORY A;  3A9C A;  3IQC A;  3K7D A;  2RSE B;  3T4R A;  1JMW A;  1ST6 A;  2NUT B;  1E86 A;  1YYX A;  2J0X A;  4XPY A;  3M4B A;  2Q7R A;  3W8H A;  3ZVR A;  4N6H A;  3KYJ A;  4MVR A;  2L81 A;  3ZSU A;  4LLC A;  2LK4 A;  2J45 A;  3WHN A;  4E7S A;  3LS1 A;  3N2Z B;  3S27 A;  1LE4 A;  1F1M A;  2CDQ A;  2PF4 E;  5KYU A;  1HMO A;  2DYS C;  2P61 A;  4MW8 A;  3LEV A;  4PR9 A;  3V5Z A;  5GPG B;  1BR1 A;  2CCY A;  1FR0 A;  3L1M A;  5BQG A;  4N06 A;  2H8A A;  3K1I A;  3RYL A;  4AL1 A;  5IY5 C;  1WWP A;  4YT5 A;  2IXN A;  2KGO A;  2J7P A;  1OCO C;  5DS4 A;  4CS9 A;  1SYQ A;  4I3M A;  2A69 F;  3WOD F;  4J30 B;  1OKK D;  2X0C A;  2HSQ A;  2WVN A;  4YK5 A;  5DLJ A;  5F28 E;  1NU9 C;  4MVQ A;  1LPE A;  5E3A A;  2ETS A;  1T5O A;  2XRH A;  3ZTZ A;  3KPH A;  3WG7 C;  2Q9C A;  1T9K A;  4C3E A;  3NYL A;  1ZHW A;  4DXW A;  3VF0 A;  2AP3 A;  4ANJ A;  3LAY A;  2W45 A;  4MS2 A;  4AE4 A;  4K1O A;  1HMD A;  3EPV A;  3NKE A;  3E9V A;  5A69 A;  1PD0 A; 
#chains in the Genus database with same CATH homology
 3JSE O;  1AVO B;  1Z7Q c;  1YA7 O;  3JRM O;  3IPM O;  1YAU O;  1FNT c;  3JTL O;  1YAR O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...