3SXMA

Metal-free fcd domain of tm0439 a putative transcriptional regulator
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
140
structure length
137
Chain Sequence
GAMDEKFIRETIETRIMMEVFCLENYFDKIAGSEELLEIKGEIDDVAAREIFDDSDERLHKLFIRASGNELIISLYEKIWDRIDLVRHLNERYVVSNREHKELIERIISGDKEGAIEKLKEHLKNVEAETIKNLYTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, GntR family
publication title Metal-free FCD domain of TM0439 a putative transcriptional regulator
rcsb
source organism Thermotoga maritima
total genus 59
structure length 137
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3sxmA00
1E2XA 2DI3A 3SXKA 4P9FA 3FMSA 3SXMA 3SXYA 3SXZA 1HW1A 1HW2A 1H9TA 3C7JA 1H9GA 3IHUA 2HS5A
chains in the Genus database with same CATH superfamily
3DJUB 3AGTA 5JP7A 1TWAA 4UDVA 3K1IC 4IARA 4RBNA 2R7RA 3J06A 1AEPA 2A69F 2YRFA 1M56C 3ASOC 4JKVA 1L3PA 1ZVZA 2MHRA 3IEEA 1SZIA 2YZSA 3EGDA 3QVZA 4ULVA 2NG1A 3PCVA 2R05A 3MBGA 3DD7A 4DJ9A 3MFNA 1C02A 2KNHA 2LK4A 2YL0A 3B71A 3H65A 1NU7D 3NKEA 3AG1C 1QKRA 2O9XA 3ECSA 1VK5A 3KH2A 5CI8A 3C8GB 3NYMA 5BUOA 1EQ1A 2CGEA 2IXMA 2OEVA 3GEEA 3I5QA 4LLEA 3OA1A 1MNDA 1H7IA 1HMDA 1NSGB 1ST6A 2G3VA 3GORA 3EHNA 4W8KA 5EK0A 4CS9C 5COGA 2PBEA 5L3VA 3GEIA 4BJ6A 2M64A 3T4RA 1PD1A 4GYTA 4XWJA 3ZWIA 2JPUA 1HW1A 1LI5A 2HV7A 4KNVA 2L6HA 5L0JA 2LIGA 2PFDA 1OKKD 3ATPA 4CS8C 4EHPA 1O5HA 5HV9A 3B0VC 2AP3A 1I4YA 1BR1A 2V26A 1OCRC 1M2VA 1O87A 1TWGA 4I1MA 2J9VA 3V5YA 2HV6A 4O79A 5L0IA 3RKOF 4JW1A 2XM4A 2A68F 3U5SA 3SYNA 4MQ9F 1V54C 1VMAA 1QVXA 1D0YA 4K7BA 4E0HA 2NSGA 5KYYA 2XXAA 3US6A 5JSLA 2GAQA 5DS4A 5DS6A 1M57C 4MVOA 1Z23A 3V5ZA 2QNLA 1ZW3A 3S27A 5AGFA 1PCXA 1HMOA 1A7EA 3MLGA 2H7OA 1RKEA 5E33A 1T9KA 1M6TA 2A6EF 4OD4A 4MVSA 1VYKA 1K05A 3GWNA 3B0UX 4MW3A 3LNMB 1LS1A 2P6VA 1QPUA 5DQTA 2VCAA 4G7HF 1TKNA 2CNWA 4ANJA 2VCCA 2L6GA 3SXYA 2LFFA 3CZ6A 4JRZA 1H9TA 1J8YF 4ZLCA 3TULA 1K40A 5FCLA 2EIMC 4FESA 2YL7A 1AVOB 3RF3A 5KYUB 4DRIB 1Q0GA 2HJMA 4P6IC 3ZG1A 4A4AA 4OIOF 4EIYA 4C7OA 2ZXPA 4RD9A 5AC4A 3POVA 1TWCA 2JX0A 3S9OA 1H9GA 3H2VA 3U2MA 3ZVRA 4CS9A 5A6BD 3ASNC 4MNDA 2KQ9A 5COFA 3VAYA 4PFOA 3ITFA 2PP4A 2ZPAA 4BEMJ 1YARO 2ZXOA 2EIJC 3FDQA 1MMDA 4K0DA 4AE4A 4GEHA 2L81A 4BG0A 1NLXA 2AWCA 1A41A 2OEXA 2W45A 3MX3A 3UR3C 2WVQA 2Y39A 3E9VA 2XL4A 4KNWA 5D91A 1Z6AA 2Y3DA 5E2QA 5E3AA 2NUTA 3NYLA 3K6BA 2DGJA 4HEAJ 4K1OA 3FVYA 3I5PA 4DVYP 3QMKA 4E18A 1V55C 1YVIA 1YYXA 1IW7F 3LAYA 5DQZA 2B0HA 1G4US 1ZW2A 4ZLDA 2DI3A 2VH3A 1SMYF 4MVUA 2HSQA 4JE9A 5L0GA 2IYLD 1XZPA 2LSEA 2HKVA 4BJ6C 5KYXB 4ONSA 1OCOC 4U5HA 5A6BA 5L0DA 2D4UA 3KPHA 1EI7A 1NG1A 1XZQA 4LLCA 3QW1A 3EG9B 3EPVA 2R25A 3EFOB 4N06A 5TJ5E 2YQYA 4JZAA 2C04A 1TQGA 1WGWA 1WTYA 2A6HF 2HSBA 2Y3HA 3DWWA 2ICWG 2HFIA 4XPWA 3SXKA 3PDMP 3M4BA 3V7OA 4LDQA 4E17A 3AG3C 1JPJA 1NU9C 1RJ9A 2FGYA 2XLHA 2YL3A 4AK9A 2B0JA 3ZQVA 4P9TA 2R7XA 1OR3A 4JIOA 2OQMA 2RD9A 4DVZA 5A69A 3HNLA 3IQTA 3M4CA 5DS5A 3EQLF 3LEOA 3C7JA 4C3EA 2XL6A 1SYQA 1L7CA 1R4TA 2R9RB 4OIQF 1YLMA 4MVRA 1ZYRF 2P7VA 2XRHA 3O39A 4F4BA 1GQAA 1LE2A 2QTVA 3RQGA 1EA8A 1YAUO 3KKBA 4E7ZA 1KTMA 3KYIA 1Z3IX 4CIHA 1QZXA 1FNTc 2ZXRA 3FHDA 3E70C 2J45A 2TMVP 3DZAA 1HW2A 1C17M 4MVMA 2OCCC 1YZAA 3GM1A 5FZTA 2I15A 3RIPA 3NDBB 3PMRA 5T3WA 3ZC4A 4C3BA 4G0HA 2KGOA 2NUPB 4U5CE 3IHUA 1C03A 1RCPA 1E84A 5D92A 1YA9A 3RVYA 5B3SC 4KBLA 1OKKA 2IXOA 1YYJA 1QQ3A 1ZHWA 2PF4E 2R7WA 4LERA 2EINC 3SP1A 2QLAA 3R2PA 1T6IA 1TFOB 2J0XA 1MMGA 4OINF 3TK0A 5KYWB 2NSFA 3KMIA 3N0TA 3W8HA 3S0XA 1HY5A 1E86A 5COMA 4J7YA 2L6FA 4WGZA 4DOZA 3C63A 3RW0A 4YJWA 2EPLX 1OR2A 1Z5ZA 2QUPA 4U5DE 4YK5A 2R7QA 1ZHYA 1E85A 4H4KC 1R5ID 1PV3A 4X0RA 1LVKA 1Z63A 4KC9A 5B1BC 3K66A 4YT8A 3DKAA 1T5OA 2UUIA 3KL4A 1LM3B 3UNGC 2R7OA 3JSZA 2VCBA 3U8PA 4XLNF 4LDKA 3N2ZB 3BRJA 1U89A 3SZRA 1F1MA 1M2OA 3HKKA 2A0BA 5A6JA 1JOGA 2W4BA 2GA0A 3EGDB 3NKDA 3DM5A 1TFKB 4NQFA 3F47A 5E3CA 2VB6A 2KYHA 1Z7Qc 4C3DA 2PNOA 3FAJA 5HSWA 2G3KA 4N6HA 2WZLA 4JJFA 4NY3A 3DM9B 3SEOA 1T6QA 3EZHA 2WVOA 4PJLA 4MTOA 2XLWA 4U5FE 1I4ZA 3ZTZA 2R7VA 3VF0A 3S90A 4KI2A 4Q5SF 1T6UA 4PK4A 2CYDA 3WHNA 256BA 4JCZA 1G5ZA 1Q0KA 4I44A 2F22A 4OIRF 3U2LA 1Q0DA 2R03A 3B0PA 3NMKA 3OWTA 4O6YA 1FMWA 3K33A 3ABKC 1FMVA 4IJJA 4LDRA 4XQ1A 4JCHA 2WZFA 4DXWA 4MTFA 2CW0F 1CPQA 2Q7RA 1NFOA 2PX0A 2WB7A 1OW7A 1GGQA 1V74B 2J0WA 1GS9A 3OEOA 1OXKA 2Z15A 4PFPA 1M2VB 1MMNA 2P0NA 2W4MA 4U5EE 1RMVA 4CDAA 4FX5A 1S7ZA 2J9WA 1JRAA 1LI7A 4E7SA 5F5FA 3HNKA 2BL2A 3WG7C 2J7PD 3LLIA 3JTLO 1RKCA 1QSPA 3RQFA 3W2WA 4Q4ZF 1WATA 4YWQA 2IXPA 5KYYB 4J32B 2Y69C 2XXAB 2YKZA 1WWPA 1V4AA 2IBFA 3AGUA 2X51A 5B3IA 5L3QA 4DRHB 1FR0A 5IY5C 2R02A 3EGXA 1CGNA 2WZGA 1S05A 1BZ4A 3S84A 1TWHA 3AQCA 1A0BA 2XLVA 3K1HA 1YDIA 4J7TA 4U9DA 1RKEB 1D0XA 2HJ3A 2R7SA 1QLEC 3DAFA 1E83A 1B68A 4QI2A 4G7OF 1D1CA 2A0UA 2AWYA 2EPNA 2CCYA 3QW0A 3A9CA 4U5GA 4XEKA 5BQHA 3FOOA 1ORJA 2E87A 3U8VA 4I3MA 4O6NA 2KJGA 2JD3A 3B29A 1JAFA 1YJGA 1UG7A 3G50A 5EHHA 1VOMA 4BJTA 4BPMA 2YVKA 3O6XA 3GM3A 2YLDA 4M63A 3NMIA 2OJQA 4YT5A 2J8WA 4JC7A 4AL1A 3M79A 1UFBA 1ORSC 4B6IA 1GM5A 3C8GA 2BC5A 3Q6MA 2BE5F 1I5NA 1OW8A 4C7OB 4U5BE 3HNJA 2EIKC 3EHMA 3JRTA 3L8JA 4P9FA 4PR9A 3KYJA 3ZSUA 1OQCA 5EGYA 2GWWA 1LIHA 3C8ZA 1KU2A 3LLKA 3RQEA 4CX9A 2A1DD 3C62A 2GFHA 3RFYA 3DE9A 4AE4B 4PJNA 1FFHA 4BJ1A 4CDVA 4NTAA 4D4XA 5CI9A 3ZQYA 3L34A 3JRMO 3AG4C 4GQHA 1MMAA 4RDAA 3G4XA 2NUTB 2YLIA 3C8GD 2R7UA 2J46A 4WABA 1TR2A 1HE9A 2LQGA 3L1MA 4CSAC 3QTHA 5JLIA 2Y3GA 4MTGA 3C18A 4H54A 3DMDA 3EH1A 2IOQA 3N24A 3EH2A 2OOCA 1O3UA 3M15A 1ORYA 3IQ6A 4IGGA 1SR2A 2XLDA 3DAGA 4JEAA 4QI0A 4CIPA 2P1AA 2XLMA 3NG1A 3NMJA 3Q7GA 3B9QA 1VTMP 2Q3TA 4PACA 4XPYA 3LS1A 2YEVA 3F46A 2W9YA 3IQ5A 4PJMA 3WAQA 4CBEA 2X0CA 3Q6NA 3L0IA 1NZEA 2FAPB 2CDQA 2XLEA 4CDYA 3WODF 3JYYA 1VLTA 3HNIA 5B1AC 1OXBA 2LD6A 1BDJB 3A11A 3ABLC 1RJ9B 3UMIA 1VYIA 4MVZA 3GM2A 1N1CA 4CJGA 4E0IA 2HMZA 3HLZA 4J30B 4DBQA 4G7ZF 4XPXA 4ER9A 4LACB 5DVWA 1D1AA 4JTCB 5JUAA 3U3FA 2HMQA 3CQZA 3GWLA 4YT4A 1U0BB 3TJ6A 1JMWA 2HUJA 2KC3A 2MWQA 3BEHA 4HE8D 4Z9JA 3CSKA 3H2UA 4OD5A 5KYUA 3RVZA 4BJ5A 4O7GA 5F5HA 2VC9A 3QZCA 4JEBA 4NCQA 3ZIBA 1D1BA 1CGME 1EKYA 2J9BA 3G4ZA 3FXHA 4CJOA 1W2WA 2DYRC 2Q00A 1VLSA 2I8BA 3AOUA 2OKUA 4N6CA 4WGYA 4XEFA 4Z9HA 3PHF2 3UGPA 1AUEA 3RH3A 2EPMX 3U9MA 3ZDLA 5AC5A 3V5XA 3FMSA 2KK1A 2ETSA 2LP4A 3LS0A 1LKXA 4G78A 4FAPB 1IZMA 3DI5A 3TD7A 3M1CB 2NPUA 4YL1A 1YA7O 1OCCC 2UUHA 1BR2A 4R32A 2ZD9A 1PD0A 1WASA 4CSAA 1G8XA 1Y6DA 2OG2A 1DOVA 1XWJA 4IWBA 2Q9AA 4MW8A 2WVNA 2IM8A 2VASA 4JTAB 4MVQA 5JS5A 2G62A 3FOPA 4DBRA 4JVSA 1A7VA 1MQVA 2J7PA 3K1IA 1WOLA 4D4NA 4DRJB 3GEHA 3CEXA 5KYNA 3SNHA 1H6GA 4IRUA 3DE8A 5L0HA 1FAPB 4U9EA 2EILC 5KYXA 2YL1A 1D0ZA 3NRHA 4EBKA 2AVKA 1OCZC 2C03A 4W8PA 2WL8A 3S29A 4AL0A 1LS4A 2YHSA 4N4WA 4EKWA 2L7AA 5DLJA 1FFTC 2QE9A 1MNEA 1ZU4A 2H8AA 2LCHA 3AJMA 3EG9A 3EFOA 4JURI 4NC3A 4HFFB 4I1OB 1KNYA 2ZXWC 3U0CA 1YZCA 3GODA 3FAPB 1NFNA 2IXNA 3JZ0A 3JYHA 3LNRA 3NYJA 3T6GB 3W8IA 1BR4A 1LE4A 4CS7A 2XLOA 1CPRA 4ULWA 3AG2C 5GPGB 3TJ5A 2OU6A 2KW3C 1G4WR 1HE1A 3CAXA 3DXJF 2OJED 4XEVA 3L8IA 4MS2A 3RYLA 5JRAA 4EWCA 5A6KA 4YT2A 2M4EA 3TOMA 3W4YA 3SXZA 3TOLA 3X1OA 2CNWD 3HJCA 2XM0A 3ABMC 1Y4CA 3O55A 4PJJA 4YL3A 4OIPF 2DB4A 1U6HA 2MYSA 4IAOA 5JVEA 1SF8A 1E2XA 2Y3BA 1APCA 1FTSA 1Q0MA 3UMHA 3JCUQ 1OW6A 2PX3A 5L0CA 3R7CA 4Q7CA 5K0IA 3IQCA 1K04A 1ZHXA 3JT1A 5T3TA 2Q9CA 2YWAA 2EPKX 3U3BA 3VM6A 4CS8A 4IB4A 3I4UA 3VRCA 5BQGA 3IPMO 3UMKA 4AX2A 2KSFA 2HS5A 2HZ8A 3O10A 2GDCA 1BBHA 2NUPA 4XTKA 3MYFA 2H7VC 4BEJA 1T01A 3TQOA 2FFHA 2EPOA 5A6AA 1CGOA 2YLGA 5F28E 1Q0FA 1JR8A 4JTDB 2AU5A 1NBBA 2XL8A 4YL0A 5T1DB 3AQBA 3LUTB 4EUKB 5CIVA 3U9JA 3ZTMA 4BJ5C 1ZU5A 4A2NB 3EZIA 3GANA 2RSEB 3HTKC 3T6BA 4EBBA 5KYWA 4Z9IA 2XS8A 3JSEO 3LJBA 2V3CC 1JPNA 2H7BA 2QY9A 3MYIA 4WJ0A 2LFDA 3SXMA 1ZHTA 2XSEA 3K7DA 2D5RB 4L6RA 3W2VA 5JT4A 2R7TA 2P61A 3LESA 4JJGA 1J8MF 2ASRA 3VYWA 3X2QC 2J9UA 2L9JA 4O6MA 4YN0B 5L0FA 1LPEA 1RXQA 2Q4FA 3EJNA 5BQIA 2DYSC 1ZHZA 4FWVA 1ZZPA 4NTBA 3UGOA 3T9OA 1WN0A 3Q7LA 4HFKB 4EBJA 4QDLA 4XLPF 3LEVA 1VB5A 1DOWA 2XS1A 1A7DA 2Q9BA 3EGXB 4IAQA 3DJNB 3QVYA 3S28A 3T6JA 4NTFA
chains in the Genus database with same CATH topology
1E2XA 2DI3A 3SXKA 4P9FA 3FMSA 3SXMA 3SXYA 3SXZA 1HW1A 1HW2A 1H9TA 3C7JA 1H9GA 3IHUA 2HS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2X A;  2DI3 A;  3SXK A;  4P9F A;  3FMS A;  3SXM A;  3SXY A;  3SXZ A;  1HW1 A;  1HW2 A;  1H9T A;  3C7J A;  1H9G A;  3IHU A;  2HS5 A; 
#chains in the Genus database with same CATH topology
 3DJU B;  3AGT A;  5JP7 A;  1TWA A;  4UDV A;  3K1I C;  4IAR A;  4RBN A;  2R7R A;  3J06 A;  1AEP A;  2A69 F;  2YRF A;  1M56 C;  3ASO C;  4JKV A;  1L3P A;  1ZVZ A;  2MHR A;  3IEE A;  1SZI A;  2YZS A;  3EGD A;  3QVZ A;  4ULV A;  2NG1 A;  3PCV A;  2R05 A;  3MBG A;  3DD7 A;  4DJ9 A;  3MFN A;  1C02 A;  2KNH A;  2LK4 A;  2YL0 A;  3B71 A;  3H65 A;  1NU7 D;  3NKE A;  3AG1 C;  1QKR A;  2O9X A;  3ECS A;  1VK5 A;  3KH2 A;  5CI8 A;  3C8G B;  3NYM A;  5BUO A;  1EQ1 A;  2CGE A;  2IXM A;  2OEV A;  3GEE A;  3I5Q A;  4LLE A;  3OA1 A;  1MND A;  1H7I A;  1HMD A;  1NSG B;  1ST6 A;  2G3V A;  3GOR A;  3EHN A;  4W8K A;  5EK0 A;  4CS9 C;  5COG A;  2PBE A;  5L3V A;  3GEI A;  4BJ6 A;  2M64 A;  3T4R A;  1PD1 A;  4GYT A;  4XWJ A;  3ZWI A;  2JPU A;  1HW1 A;  1LI5 A;  2HV7 A;  4KNV A;  2L6H A;  5L0J A;  2LIG A;  2PFD A;  1OKK D;  3ATP A;  4CS8 C;  4EHP A;  1O5H A;  5HV9 A;  3B0V C;  2AP3 A;  1I4Y A;  1BR1 A;  2V26 A;  1OCR C;  1M2V A;  1O87 A;  1TWG A;  4I1M A;  2J9V A;  3V5Y A;  2HV6 A;  4O79 A;  5L0I A;  3RKO F;  4JW1 A;  2XM4 A;  2A68 F;  3U5S A;  3SYN A;  4MQ9 F;  1V54 C;  1VMA A;  1QVX A;  1D0Y A;  4K7B A;  4E0H A;  2NSG A;  5KYY A;  2XXA A;  3US6 A;  5JSL A;  2GAQ A;  5DS4 A;  5DS6 A;  1M57 C;  4MVO A;  1Z23 A;  3V5Z A;  2QNL A;  1ZW3 A;  3S27 A;  5AGF A;  1PCX A;  1HMO A;  1A7E A;  3MLG A;  2H7O A;  1RKE A;  5E33 A;  1T9K A;  1M6T A;  2A6E F;  4OD4 A;  4MVS A;  1VYK A;  1K05 A;  3GWN A;  3B0U X;  4MW3 A;  3LNM B;  1LS1 A;  2P6V A;  1QPU A;  5DQT A;  2VCA A;  4G7H F;  1TKN A;  2CNW A;  4ANJ A;  2VCC A;  2L6G A;  3SXY A;  2LFF A;  3CZ6 A;  4JRZ A;  1H9T A;  1J8Y F;  4ZLC A;  3TUL A;  1K40 A;  5FCL A;  2EIM C;  4FES A;  2YL7 A;  1AVO B;  3RF3 A;  5KYU B;  4DRI B;  1Q0G A;  2HJM A;  4P6I C;  3ZG1 A;  4A4A A;  4OIO F;  4EIY A;  4C7O A;  2ZXP A;  4RD9 A;  5AC4 A;  3POV A;  1TWC A;  2JX0 A;  3S9O A;  1H9G A;  3H2V A;  3U2M A;  3ZVR A;  4CS9 A;  5A6B D;  3ASN C;  4MND A;  2KQ9 A;  5COF A;  3VAY A;  4PFO A;  3ITF A;  2PP4 A;  2ZPA A;  4BEM J;  1YAR O;  2ZXO A;  2EIJ C;  3FDQ A;  1MMD A;  4K0D A;  4AE4 A;  4GEH A;  2L81 A;  4BG0 A;  1NLX A;  2AWC A;  1A41 A;  2OEX A;  2W45 A;  3MX3 A;  3UR3 C;  2WVQ A;  2Y39 A;  3E9V A;  2XL4 A;  4KNW A;  5D91 A;  1Z6A A;  2Y3D A;  5E2Q A;  5E3A A;  2NUT A;  3NYL A;  3K6B A;  2DGJ A;  4HEA J;  4K1O A;  3FVY A;  3I5P A;  4DVY P;  3QMK A;  4E18 A;  1V55 C;  1YVI A;  1YYX A;  1IW7 F;  3LAY A;  5DQZ A;  2B0H A;  1G4U S;  1ZW2 A;  4ZLD A;  2DI3 A;  2VH3 A;  1SMY F;  4MVU A;  2HSQ A;  4JE9 A;  5L0G A;  2IYL D;  1XZP A;  2LSE A;  2HKV A;  4BJ6 C;  5KYX B;  4ONS A;  1OCO C;  4U5H A;  5A6B A;  5L0D A;  2D4U A;  3KPH A;  1EI7 A;  1NG1 A;  1XZQ A;  4LLC A;  3QW1 A;  3EG9 B;  3EPV A;  2R25 A;  3EFO B;  4N06 A;  5TJ5 E;  2YQY A;  4JZA A;  2C04 A;  1TQG A;  1WGW A;  1WTY A;  2A6H F;  2HSB A;  2Y3H A;  3DWW A;  2ICW G;  2HFI A;  4XPW A;  3SXK A;  3PDM P;  3M4B A;  3V7O A;  4LDQ A;  4E17 A;  3AG3 C;  1JPJ A;  1NU9 C;  1RJ9 A;  2FGY A;  2XLH A;  2YL3 A;  4AK9 A;  2B0J A;  3ZQV A;  4P9T A;  2R7X A;  1OR3 A;  4JIO A;  2OQM A;  2RD9 A;  4DVZ A;  5A69 A;  3HNL A;  3IQT A;  3M4C A;  5DS5 A;  3EQL F;  3LEO A;  3C7J A;  4C3E A;  2XL6 A;  1SYQ A;  1L7C A;  1R4T A;  2R9R B;  4OIQ F;  1YLM A;  4MVR A;  1ZYR F;  2P7V A;  2XRH A;  3O39 A;  4F4B A;  1GQA A;  1LE2 A;  2QTV A;  3RQG A;  1EA8 A;  1YAU O;  3KKB A;  4E7Z A;  1KTM A;  3KYI A;  1Z3I X;  4CIH A;  1QZX A;  1FNT c;  2ZXR A;  3FHD A;  3E70 C;  2J45 A;  2TMV P;  3DZA A;  1HW2 A;  1C17 M;  4MVM A;  2OCC C;  1YZA A;  3GM1 A;  5FZT A;  2I15 A;  3RIP A;  3NDB B;  3PMR A;  5T3W A;  3ZC4 A;  4C3B A;  4G0H A;  2KGO A;  2NUP B;  4U5C E;  3IHU A;  1C03 A;  1RCP A;  1E84 A;  5D92 A;  1YA9 A;  3RVY A;  5B3S C;  4KBL A;  1OKK A;  2IXO A;  1YYJ A;  1QQ3 A;  1ZHW A;  2PF4 E;  2R7W A;  4LER A;  2EIN C;  3SP1 A;  2QLA A;  3R2P A;  1T6I A;  1TFO B;  2J0X A;  1MMG A;  4OIN F;  3TK0 A;  5KYW B;  2NSF A;  3KMI A;  3N0T A;  3W8H A;  3S0X A;  1HY5 A;  1E86 A;  5COM A;  4J7Y A;  2L6F A;  4WGZ A;  4DOZ A;  3C63 A;  3RW0 A;  4YJW A;  2EPL X;  1OR2 A;  1Z5Z A;  2QUP A;  4U5D E;  4YK5 A;  2R7Q A;  1ZHY A;  1E85 A;  4H4K C;  1R5I D;  1PV3 A;  4X0R A;  1LVK A;  1Z63 A;  4KC9 A;  5B1B C;  3K66 A;  4YT8 A;  3DKA A;  1T5O A;  2UUI A;  3KL4 A;  1LM3 B;  3UNG C;  2R7O A;  3JSZ A;  2VCB A;  3U8P A;  4XLN F;  4LDK A;  3N2Z B;  3BRJ A;  1U89 A;  3SZR A;  1F1M A;  1M2O A;  3HKK A;  2A0B A;  5A6J A;  1JOG A;  2W4B A;  2GA0 A;  3EGD B;  3NKD A;  3DM5 A;  1TFK B;  4NQF A;  3F47 A;  5E3C A;  2VB6 A;  2KYH A;  1Z7Q c;  4C3D A;  2PNO A;  3FAJ A;  5HSW A;  2G3K A;  4N6H A;  2WZL A;  4JJF A;  4NY3 A;  3DM9 B;  3SEO A;  1T6Q A;  3EZH A;  2WVO A;  4PJL A;  4MTO A;  2XLW A;  4U5F E;  1I4Z A;  3ZTZ A;  2R7V A;  3VF0 A;  3S90 A;  4KI2 A;  4Q5S F;  1T6U A;  4PK4 A;  2CYD A;  3WHN A;  256B A;  4JCZ A;  1G5Z A;  1Q0K A;  4I44 A;  2F22 A;  4OIR F;  3U2L A;  1Q0D A;  2R03 A;  3B0P A;  3NMK A;  3OWT A;  4O6Y A;  1FMW A;  3K33 A;  3ABK C;  1FMV A;  4IJJ A;  4LDR A;  4XQ1 A;  4JCH A;  2WZF A;  4DXW A;  4MTF A;  2CW0 F;  1CPQ A;  2Q7R A;  1NFO A;  2PX0 A;  2WB7 A;  1OW7 A;  1GGQ A;  1V74 B;  2J0W A;  1GS9 A;  3OEO A;  1OXK A;  2Z15 A;  4PFP A;  1M2V B;  1MMN A;  2P0N A;  2W4M A;  4U5E E;  1RMV A;  4CDA A;  4FX5 A;  1S7Z A;  2J9W A;  1JRA A;  1LI7 A;  4E7S A;  5F5F A;  3HNK A;  2BL2 A;  3WG7 C;  2J7P D;  3LLI A;  3JTL O;  1RKC A;  1QSP A;  3RQF A;  3W2W A;  4Q4Z F;  1WAT A;  4YWQ A;  2IXP A;  5KYY B;  4J32 B;  2Y69 C;  2XXA B;  2YKZ A;  1WWP A;  1V4A A;  2IBF A;  3AGU A;  2X51 A;  5B3I A;  5L3Q A;  4DRH B;  1FR0 A;  5IY5 C;  2R02 A;  3EGX A;  1CGN A;  2WZG A;  1S05 A;  1BZ4 A;  3S84 A;  1TWH A;  3AQC A;  1A0B A;  2XLV A;  3K1H A;  1YDI A;  4J7T A;  4U9D A;  1RKE B;  1D0X A;  2HJ3 A;  2R7S A;  1QLE C;  3DAF A;  1E83 A;  1B68 A;  4QI2 A;  4G7O F;  1D1C A;  2A0U A;  2AWY A;  2EPN A;  2CCY A;  3QW0 A;  3A9C A;  4U5G A;  4XEK A;  5BQH A;  3FOO A;  1ORJ A;  2E87 A;  3U8V A;  4I3M A;  4O6N A;  2KJG A;  2JD3 A;  3B29 A;  1JAF A;  1YJG A;  1UG7 A;  3G50 A;  5EHH A;  1VOM A;  4BJT A;  4BPM A;  2YVK A;  3O6X A;  3GM3 A;  2YLD A;  4M63 A;  3NMI A;  2OJQ A;  4YT5 A;  2J8W A;  4JC7 A;  4AL1 A;  3M79 A;  1UFB A;  1ORS C;  4B6I A;  1GM5 A;  3C8G A;  2BC5 A;  3Q6M A;  2BE5 F;  1I5N A;  1OW8 A;  4C7O B;  4U5B E;  3HNJ A;  2EIK C;  3EHM A;  3JRT A;  3L8J A;  4P9F A;  4PR9 A;  3KYJ A;  3ZSU A;  1OQC A;  5EGY A;  2GWW A;  1LIH A;  3C8Z A;  1KU2 A;  3LLK A;  3RQE A;  4CX9 A;  2A1D D;  3C62 A;  2GFH A;  3RFY A;  3DE9 A;  4AE4 B;  4PJN A;  1FFH A;  4BJ1 A;  4CDV A;  4NTA A;  4D4X A;  5CI9 A;  3ZQY A;  3L34 A;  3JRM O;  3AG4 C;  4GQH A;  1MMA A;  4RDA A;  3G4X A;  2NUT B;  2YLI A;  3C8G D;  2R7U A;  2J46 A;  4WAB A;  1TR2 A;  1HE9 A;  2LQG A;  3L1M A;  4CSA C;  3QTH A;  5JLI A;  2Y3G A;  4MTG A;  3C18 A;  4H54 A;  3DMD A;  3EH1 A;  2IOQ A;  3N24 A;  3EH2 A;  2OOC A;  1O3U A;  3M15 A;  1ORY A;  3IQ6 A;  4IGG A;  1SR2 A;  2XLD A;  3DAG A;  4JEA A;  4QI0 A;  4CIP A;  2P1A A;  2XLM A;  3NG1 A;  3NMJ A;  3Q7G A;  3B9Q A;  1VTM P;  2Q3T A;  4PAC A;  4XPY A;  3LS1 A;  2YEV A;  3F46 A;  2W9Y A;  3IQ5 A;  4PJM A;  3WAQ A;  4CBE A;  2X0C A;  3Q6N A;  3L0I A;  1NZE A;  2FAP B;  2CDQ A;  2XLE A;  4CDY A;  3WOD F;  3JYY A;  1VLT A;  3HNI A;  5B1A C;  1OXB A;  2LD6 A;  1BDJ B;  3A11 A;  3ABL C;  1RJ9 B;  3UMI A;  1VYI A;  4MVZ A;  3GM2 A;  1N1C A;  4CJG A;  4E0I A;  2HMZ A;  3HLZ A;  4J30 B;  4DBQ A;  4G7Z F;  4XPX A;  4ER9 A;  4LAC B;  5DVW A;  1D1A A;  4JTC B;  5JUA A;  3U3F A;  2HMQ A;  3CQZ A;  3GWL A;  4YT4 A;  1U0B B;  3TJ6 A;  1JMW A;  2HUJ A;  2KC3 A;  2MWQ A;  3BEH A;  4HE8 D;  4Z9J A;  3CSK A;  3H2U A;  4OD5 A;  5KYU A;  3RVZ A;  4BJ5 A;  4O7G A;  5F5H A;  2VC9 A;  3QZC A;  4JEB A;  4NCQ A;  3ZIB A;  1D1B A;  1CGM E;  1EKY A;  2J9B A;  3G4Z A;  3FXH A;  4CJO A;  1W2W A;  2DYR C;  2Q00 A;  1VLS A;  2I8B A;  3AOU A;  2OKU A;  4N6C A;  4WGY A;  4XEF A;  4Z9H A;  3PHF 2;  3UGP A;  1AUE A;  3RH3 A;  2EPM X;  3U9M A;  3ZDL A;  5AC5 A;  3V5X A;  3FMS A;  2KK1 A;  2ETS A;  2LP4 A;  3LS0 A;  1LKX A;  4G78 A;  4FAP B;  1IZM A;  3DI5 A;  3TD7 A;  3M1C B;  2NPU A;  4YL1 A;  1YA7 O;  1OCC C;  2UUH A;  1BR2 A;  4R32 A;  2ZD9 A;  1PD0 A;  1WAS A;  4CSA A;  1G8X A;  1Y6D A;  2OG2 A;  1DOV A;  1XWJ A;  4IWB A;  2Q9A A;  4MW8 A;  2WVN A;  2IM8 A;  2VAS A;  4JTA B;  4MVQ A;  5JS5 A;  2G62 A;  3FOP A;  4DBR A;  4JVS A;  1A7V A;  1MQV A;  2J7P A;  3K1I A;  1WOL A;  4D4N A;  4DRJ B;  3GEH A;  3CEX A;  5KYN A;  3SNH A;  1H6G A;  4IRU A;  3DE8 A;  5L0H A;  1FAP B;  4U9E A;  2EIL C;  5KYX A;  2YL1 A;  1D0Z A;  3NRH A;  4EBK A;  2AVK A;  1OCZ C;  2C03 A;  4W8P A;  2WL8 A;  3S29 A;  4AL0 A;  1LS4 A;  2YHS A;  4N4W A;  4EKW A;  2L7A A;  5DLJ A;  1FFT C;  2QE9 A;  1MNE A;  1ZU4 A;  2H8A A;  2LCH A;  3AJM A;  3EG9 A;  3EFO A;  4JUR I;  4NC3 A;  4HFF B;  4I1O B;  1KNY A;  2ZXW C;  3U0C A;  1YZC A;  3GOD A;  3FAP B;  1NFN A;  2IXN A;  3JZ0 A;  3JYH A;  3LNR A;  3NYJ A;  3T6G B;  3W8I A;  1BR4 A;  1LE4 A;  4CS7 A;  2XLO A;  1CPR A;  4ULW A;  3AG2 C;  5GPG B;  3TJ5 A;  2OU6 A;  2KW3 C;  1G4W R;  1HE1 A;  3CAX A;  3DXJ F;  2OJE D;  4XEV A;  3L8I A;  4MS2 A;  3RYL A;  5JRA A;  4EWC A;  5A6K A;  4YT2 A;  2M4E A;  3TOM A;  3W4Y A;  3SXZ A;  3TOL A;  3X1O A;  2CNW D;  3HJC A;  2XM0 A;  3ABM C;  1Y4C A;  3O55 A;  4PJJ A;  4YL3 A;  4OIP F;  2DB4 A;  1U6H A;  2MYS A;  4IAO A;  5JVE A;  1SF8 A;  1E2X A;  2Y3B A;  1APC A;  1FTS A;  1Q0M A;  3UMH A;  3JCU Q;  1OW6 A;  2PX3 A;  5L0C A;  3R7C A;  4Q7C A;  5K0I A;  3IQC A;  1K04 A;  1ZHX A;  3JT1 A;  5T3T A;  2Q9C A;  2YWA A;  2EPK X;  3U3B A;  3VM6 A;  4CS8 A;  4IB4 A;  3I4U A;  3VRC A;  5BQG A;  3IPM O;  3UMK A;  4AX2 A;  2KSF A;  2HS5 A;  2HZ8 A;  3O10 A;  2GDC A;  1BBH A;  2NUP A;  4XTK A;  3MYF A;  2H7V C;  4BEJ A;  1T01 A;  3TQO A;  2FFH A;  2EPO A;  5A6A A;  1CGO A;  2YLG A;  5F28 E;  1Q0F A;  1JR8 A;  4JTD B;  2AU5 A;  1NBB A;  2XL8 A;  4YL0 A;  5T1D B;  3AQB A;  3LUT B;  4EUK B;  5CIV A;  3U9J A;  3ZTM A;  4BJ5 C;  1ZU5 A;  4A2N B;  3EZI A;  3GAN A;  2RSE B;  3HTK C;  3T6B A;  4EBB A;  5KYW A;  4Z9I A;  2XS8 A;  3JSE O;  3LJB A;  2V3C C;  1JPN A;  2H7B A;  2QY9 A;  3MYI A;  4WJ0 A;  2LFD A;  3SXM A;  1ZHT A;  2XSE A;  3K7D A;  2D5R B;  4L6R A;  3W2V A;  5JT4 A;  2R7T A;  2P61 A;  3LES A;  4JJG A;  1J8M F;  2ASR A;  3VYW A;  3X2Q C;  2J9U A;  2L9J A;  4O6M A;  4YN0 B;  5L0F A;  1LPE A;  1RXQ A;  2Q4F A;  3EJN A;  5BQI A;  2DYS C;  1ZHZ A;  4FWV A;  1ZZP A;  4NTB A;  3UGO A;  3T9O A;  1WN0 A;  3Q7L A;  4HFK B;  4EBJ A;  4QDL A;  4XLP F;  3LEV A;  1VB5 A;  1DOW A;  2XS1 A;  1A7D A;  2Q9B A;  3EGX B;  4IAQ A;  3DJN B;  3QVY A;  3S28 A;  3T6J A;  4NTF A; 
#chains in the Genus database with same CATH homology
 1E2X A;  2DI3 A;  3SXK A;  4P9F A;  3FMS A;  3SXM A;  3SXY A;  3SXZ A;  1HW1 A;  1HW2 A;  1H9T A;  3C7J A;  1H9G A;  3IHU A;  2HS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...