3SXMA

Metal-free fcd domain of tm0439 a putative transcriptional regulator
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
140
structure length
137
Chain Sequence
GAMDEKFIRETIETRIMMEVFCLENYFDKIAGSEELLEIKGEIDDVAAREIFDDSDERLHKLFIRASGNELIISLYEKIWDRIDLVRHLNERYVVSNREHKELIERIISGDKEGAIEKLKEHLKNVEAETIKNLYTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-free FCD domain of TM0439 a putative transcriptional regulator
rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, GntR family
total genus 59
structure length 137
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3sxmA00
3SXZA 1H9GA 4P9FA 1HW1A 2HS5A 3C7JA 3FMSA 1HW2A 1E2XA 3SXYA 3IHUA 3SXKA 2DI3A 3SXMA 1H9TA
chains in the Genus database with same CATH superfamily
1V74B 3F47A 3K66A 1WATA 4U9DA 4EBBA 3EQLF 1KNYA 4YT2A 2JPUA 2YWAA 3U2MA 2YZSA 5KYUA 2H8AA 4AK9A 1C02A 1T6IA 2YL7A 2XLMA 3ABMC 4HE8D 1G8XA 1JPJA 4AX2A 3ZSUA 1BR2A 3IQCA 2LD6A 4CSAA 3KPHA 1SF8A 3OEOA 4OD4A 1YA9A 3AQCA 3KYJA 256BA 1B68A 2GA0A 3NG1A 4I44A 3GM1A 4MW8A 3QVYA 2WL8A 4JEBA 5AGFA 4YL3A 2J45A 2YQYA 4P9FA 4D4XA 4C3BA 3QW0A 2DYRC 1D1CA 1VYIA 3RW0A 2XXAA 3IQTA 3RYLA 3X1OA 5DS5A 3DAFA 3I5PA 3VYWA 1A7EA 1PD1A 1Z3IX 2OKUA 1OCCC 2PFDA 5E2QA 3FDQA 2RSEB 3DM9B 1GGQA 2L9JA 3HNLA 1GM5A 3TJ6A 1O87A 1T01A 3S29A 3SXYA 1EKYA 3C63A 2CYDA 5L0DA 2W9YA 3ECSA 4GQHA 3F46A 1ZW2A 2HJ3A 2ZXWC 4MVZA 2HV7A 3U5SA 1MQVA 1FNTc 2J46A 1PCXA 3N0TA 1YA7O 5E3AA 3PMRA 4JRZA 1ST6A 2Z15A 2WZLA 1NFNA 3AJMA 3ZIBA 3WHNA 3T9OA 4G7OF 3DJNB 1IW7F 3V5ZA 2W4BA 3DWWA 5L0IA 2XS1A 4C7OB 4MVMA 3R2PA 1FMVA 4CDVA 3EGXA 3NMJA 2NG1A 2YLDA 4HFFB 5DQTA 2AP3A 4YWQA 1OCZC 2NUPB 3C18A 2AU5A 1F1MA 4FWVA 4XLPF 1I4ZA 2KW3C 4E7ZA 4IARA 1JOGA 3JCUQ 1L3PA 2W45A 4N6HA 5B1BC 2R03A 2ZPAA 4Q7CA 4UDVA 2KNHA 2P61A 2Y3DA 1BBHA 3DM5A 4LLCA 2B0HA 5DLJA 4EBKA 5L3QA 2KC3A 5A6KA 4J7YA 4A4AA 1NG1A 2PP4A 2Q3TA 1QSPA 4DBQA 1NU9C 5JSLA 1VB5A 2EIJC 1SZIA 2L6GA 3WG7C 3UR3C 1GQAA 1HMOA 4JURI 1MMGA 1N1CA 3I5QA 2YLIA 2R7VA 2GWWA 4H4KC 4CBEA 4NC3A 1BZ4A 3FAPB 3TULA 1Z7Qc 3IPMO 4DRHB 3PDMP 1OXBA 3TQOA 2QTVA 4BJ5A 2UUHA 3RQEA 3LS0A 1WOLA 3HTKC 2VH3A 3U0CA 4L6RA 2WVQA 2VCBA 3ABKC 3K1IC 3W8IA 2QUPA 1QQ3A 4IRUA 2OJQA 3KKBA 3RFYA 2YEVA 5TJ5E 4PJNA 3M4CA 2IXPA 2R7WA 2FAPB 3TOMA 1EQ1A 4WGYA 3RIPA 5FZTA 3S28A 3L8IA 4LACB 3EH1A 3GORA 4C3EA 1YYJA 4MVQA 4C3DA 1LE2A 1OQCA 1QKRA 2H7OA 5FCLA 4U5CE 2R9RB 2Q7RA 1QZXA 4JVSA 3C7JA 4JE9A 2A0UA 1JR8A 3S9OA 4BJ6A 1A0BA 3EZIA 3FOPA 2CDQA 4MTGA 4MS2A 5EHHA 1LIHA 2G62A 2KGOA 1RJ9A 2PBEA 4DOZA 3I4UA 1YARO 5B1AC 2G3VA 4EWCA 3VRCA 4CS9A 3IQ5A 2Y69C 3TD7A 1OW6A 1VOMA 2ZXOA 3VM6A 4NY3A 4Z9IA 3HKKA 1OKKA 1UG7A 4NCQA 3RKOF 2NSGA 4N06A 4JIOA 1M56C 1SYQA 4LERA 3KL4A 4IGGA 4ANJA 2XM0A 2ZXPA 1XWJA 4OINF 4B6IA 5F5HA 3TOLA 5BQIA 1TR2A 3U3FA 4DBRA 2P0NA 2HZ8A 2YHSA 3DJUB 2OEXA 3K7DA 1U89A 2IOQA 3N2ZB 4JZAA 5E3CA 3LNRA 2CCYA 3US6A 3JYYA 3NRHA 3SYNA 3WAQA 5L0HA 3JT1A 3J06A 2F22A 3ZTZA 1TQGA 2GDCA 1Q0DA 3DXJF 2J7PA 1TFKB 3DZAA 4NTBA 3EPVA 2EPKX 4P6IC 2J9BA 3EG9B 1HE1A 5L0CA 2WVNA 4A2NB 4W8PA 3T6GB 1APCA 2QY9A 3QVZA 2OOCA 5COGA 5A6JA 3AG3C 3NYMA 5KYNA 1DOVA 3S0XA 4O7GA 1H6GA 3UGPA 3IHUA 4D4NA 1Y6DA 3JRMO 3LS1A 2EPMX 2OQMA 3EFOA 2CW0F 2E87A 2RD9A 4DJ9A 2J9WA 1VYKA 4U5HA 4Q5SF 2OU6A 3U8PA 5BUOA 2PX0A 2XL4A 1NBBA 5COMA 5JP7A 4I1OB 3UMKA 1RJ9B 3H2UA 1U0BB 2P1AA 4G7HF 2R7XA 4G78A 4XPYA 1YLMA 4JC7A 1QVXA 1BDJB 2EIMC 2KQ9A 4IAOA 4LDKA 4OIRF 1ORYA 5B3SC 5E33A 2DGJA 1KTMA 2Y3HA 4Z9JA 1ZW3A 2A6HF 5BQGA 2J9VA 2LP4A 3JZ0A 1Q0FA 2LQGA 3KMIA 1MMDA 4PK4A 1LPEA 1ZU4A 1D0YA 3FMSA 2WZGA 2ICWG 1J8YF 1I4YA 2HSBA 4J30B 3BRJA 2YLGA 4PJLA 3B9QA 5F28E 3H2VA 4J7TA 2CNWD 3C8GA 2VB6A 2AWYA 5T3TA 2YVKA 4N6CA 3G4XA 1TWHA 3HJCA 2I8BA 2H7VC 3SXKA 1S05A 5JRAA 4P9TA 2MHRA 2YL1A 2YL0A 4YT5A 3AG1C 2EPNA 5JT4A 1TWGA 3OA1A 1YAUO 3SP1A 4MQ9F 1XZPA 3JSEO 4CS8A 1ZHXA 2KJGA 2UUIA 3QTHA 2XLEA 4BPMA 1FAPB 2XLHA 2ZXRA 4KNWA 2NSFA 5GPGB 2TMVP 1JMWA 3DE9A 3EG9A 5DQZA 3NKEA 3SXMA 4KNVA 1NLXA 2DB4A 2R25A 2EPOA 2WZFA 5T3WA 3BEHA 1MMNA 3IEEA 2YRFA 3C8ZA 3V5XA 4MTFA 4EHPA 3EFOB 3MYIA 1RCPA 3B29A 4ZLCA 4ER9A 1HY5A 1M57C 2D5RB 5JLIA 2J0XA 1V4AA 4Z9HA 1H9TA 2J8WA 3ZWIA 1V54C 4EUKB 1SR2A 2R7UA 2V3CC 1E85A 1UFBA 2GFHA 2Q9CA 3EHNA 1IZMA 3LEVA 3FHDA 4PJJA 5KYYB 3CSKA 3EJNA 1ZHYA 3K33A 3SNHA 3U3BA 1NSGB 2ETSA 2P6VA 3GODA 4CJOA 4NTFA 1R5ID 4RBNA 5A6BD 4N4WA 1U6HA 3GANA 5L0GA 1LKXA 4JJFA 2R7OA 2OCCC 1WTYA 1OKKD 2HJMA 4XQ1A 5JUAA 3W2VA 5AC5A 1HE9A 2DI3A 3VF0A 5KYXB 3GEIA 3JSZA 2Q00A 2XLOA 3C8GB 3EHMA 4U5GA 1TKNA 3B0PA 4PR9A 4KC9A 5D91A 1BR1A 3TJ5A 3E9VA 1OCRC 3KH2A 4XPWA 1FFTC 2A1DD 1C03A 1WWPA 4ULWA 3DMDA 1ZYRF 1FR0A 3EZHA 4K1OA 3ZG1A 3O39A 3U9MA 1OW7A 4BEJA 1LM3B 1E83A 1M6TA 1VLTA 4CX9A 1NZEA 3CQZA 1G4WR 4KI2A 1T6QA 4EKWA 3A11A 3AQBA 3RQFA 1WN0A 4X0RA 1CPRA 2VCCA 2Q9AA 4JEAA 4XWJA 1WASA 1LS1A 4O79A 1OR2A 4YT8A 4AL1A 4ZLDA 4F4BA 1AVOB 2BL2A 2M4EA 2L81A 2R7QA 3L8JA 3LUTB 4PACA 1Y4CA 2EILC 2IXMA 3W8HA 4DRJB 1H7IA 3UMHA 1K04A 4PFOA 5DS6A 1K05A 2HMZA 3AG2C 3PCVA 1MNDA 2EINC 5JS5A 3Q6MA 4JTAB 1RXQA 3MYFA 4O6YA 4EBJA 4CS7A 5AC4A 3QZCA 2KSFA 2O9XA 4K0DA 4XEVA 3MFNA 3S90A 3N24A 4WJ0A 4E0HA 4CIHA 2XLVA 4MNDA 1TWAA 5COFA 4G0HA 5D92A 5KYYA 4M63A 1ORJA 1E84A 1DOWA 3ZDLA 4YT4A 3ITFA 4JW1A 4FX5A 3JTLO 2XL6A 3O55A 3NDBB 4FAPB 1E86A 3FVYA 3NMKA 3RH3A 1RKEB 3LAYA 1I5NA 2HS5A 3LJBA 3NMIA 4MVRA 4PFPA 4WGZA 2WB7A 3Q7LA 4E17A 3L1MA 4E0IA 1BR4A 3JYHA 3O10A 1MNEA 1YYXA 5CI9A 3S27A 3T6JA 2LFDA 5KYXA 2L6FA 2R7TA 1EI7A 2X51A 1HW1A 4YL1A 1ZHZA 2XRHA 4QI2A 1CPQA 2CGEA 3LLIA 3O6XA 1S7ZA 2Q9BA 3NYLA 1OW8A 2P7VA 3CEXA 4CDAA 1D0XA 1RMVA 4O6NA 3SZRA 4BJ6C 1ZVZA 1CGOA 3OWTA 4GEHA 1ZU5A 4H54A 2I15A 2HFIA 3MLGA 3CAXA 4QDLA 5KYWA 3H65A 1NU7D 1FFHA 2PX3A 4K7BA 4DXWA 2OJED 1G4US 5L0JA 3HNIA 2PNOA 3LLKA 3GWNA 2J0WA 4WABA 2XL8A 4DRIB 3ASNC 2H7BA 2HV6A 2LFFA 5A6AA 1FMWA 2XLWA 1VMAA 3EH2A 1JRAA 3Q7GA 4O6MA 4CIPA 1VTMP 2FGYA 1NFOA 4XTKA 1YZAA 3ZC4A 3KYIA 3B0VC 1T5OA 2HMQA 2L7AA 4U5EE 1ORSC 3T4RA 4CSAC 4XPXA 4U5FE 3AG4C 3AGTA 3C62A 3R7CA 3S84A 3CZ6A 3GEHA 3ZVRA 1M2OA 3SXZA 4IJJA 2ZD9A 4R32A 3Q6NA 3ATPA 4JCZA 4PJMA 1A7DA 4KBLA 1G5ZA 1JAFA 4DVZA 2X0CA 3EGDB 3ZTMA 3W2WA 3HLZA 3MBGA 4MVSA 2NUTA 4XLNF 3G4ZA 2VASA 3M1CB 4OIPF 3PHF2 1E2XA 3M79A 4ONSA 5JVEA 1VK5A 4HFKB 4RD9A 2KYHA 2LK4A 3L0IA 4ULVA 4CS8C 1A41A 1R4TA 2PF4E 4NTAA 1VLSA 2Y39A 3JRTA 2ASRA 1LI7A 1RKEA 2C04A 1CGNA 2IXOA 2XS8A 2FFHA 4JTCB 5B3IA 2R02A 3RVYA 3HNJA 4HEAJ 1YDIA 3GM2A 3FOOA 4E7SA 2R7RA 4AL0A 1V55C 3LNMB 3MX3A 3VAYA 1M2VA 4U5DE 4JTDB 5CI8A 4MVUA 2D4UA 2A6EF 3QMKA 1YVIA 4IB4A 2A69F 4CJGA 1JPNA 5A6BA 1Q0KA 1Q0GA 2J7PD 3M4BA 5BQHA 1O5HA 2JD3A 2XSEA 1K40A 2OEVA 2A0BA 2YKZA 4BEMJ 1AUEA 1D1BA 2EPLX 3V7OA 2W4MA 4AE4B 4DVYP 3UNGC 3RVZA 1T9KA 4W8KA 2MWQA 5KYWB 2QNLA 2XLDA 1T6UA 3U2LA 3POVA 1EA8A 4NQFA 3B0UX 1Z63A 4GYTA 3M15A 2EIKC 5F5FA 2HUJA 3ZQYA 3GM3A 1KU2A 2KK1A 3U9JA 2LCHA 4I1MA 3T6BA 4YL0A 3X2QC 1WGWA 3LESA 3NKDA 2B0JA 2HSQA 3V5YA 4OIOF 2R05A 1TFOB 1QLEC 2C03A 2V26A 5IY5C 5A69A 1C17M 3K6BA 1OCOC 3AGUA 4E18A 3ZQVA 4MTOA 4LDQA 2YL3A 4LLEA 2IYLD 2VCAA 2Y3GA 3L34A 4LDRA 1MMAA 2Y3BA 2LSEA 3EGDA 1YZCA 2A68F 2NUTB 3ASOC 3NYJA 4BG0A 1W2WA 2HKVA 5KYUB 1LE4A 1YJGA 3HNKA 3U8VA 2G3KA 4Q4ZF 3K1IA 5DVWA 3RF3A 4BJ1A 2JX0A 4FESA 4QI0A 3W4YA 1OXKA 4YJWA 3DI5A 4I3MA 4JKVA 3UMIA 1PD0A 3RQGA 5DS4A 1H9GA 2GAQA 1O3UA 1ZZPA 5L3VA 3A9CA 2WVOA 3K1HA 5HSWA 1J8MF 1M2VB 2J9UA 3FAJA 4EIYA 3DKAA 2XXAB 5EGYA 3SEOA 1SMYF 1Q0MA 2CNWA 3C8GD 2BC5A 3AOUA 1XZQA 4BJTA 1CGME 1TWCA 2VC9A 2QLAA 5T1DB 4CDYA 3UGOA 3ABLC 4U9EA 1OR3A 2OG2A 4U5BE 5HV9A 1Z23A 4AE4A 2QE9A 3DAGA 2XM4A 5K0IA 1HMDA 1LVKA 1PV3A 1QPUA 1ZHTA 1LI5A 2M64A 2NPUA 4YK5A 2Q4FA 3FXHA 1A7VA 3G50A 5CIVA 2BE5F 4YN0B 1Z5ZA 1D0ZA 4MVOA 2DYSC 3IQ6A 4IAQA 4XEFA 4CS9C 2R7SA 1Z6AA 4IWBA 1FTSA 2AWCA 4BJ5C 3LEOA 4JCHA 4OIQF 2MYSA 4RDAA 3DD7A 4MW3A 3GEEA 3WODF 1RKCA 3QW1A 3DE8A 2AVKA 4G7ZF 4J32B 4OD5A 4C7OA 5EK0A 4JJGA 3EGXB 5L0FA 1LS4A 3E70C 3TK0A 2IM8A 1L7CA 1D1AA 2IBFA 2NUPA 4XEKA 1ZHWA 2LIGA 3B71A 1AEPA 3GWLA 2L6HA 2IXNA 1HW2A 1GS9A
chains in the Genus database with same CATH topology
3SXZA 1H9GA 4P9FA 1HW1A 2HS5A 3C7JA 3FMSA 1HW2A 1E2XA 3SXYA 3IHUA 3SXKA 2DI3A 3SXMA 1H9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SXZ A;  1H9G A;  4P9F A;  1HW1 A;  2HS5 A;  3C7J A;  3FMS A;  1HW2 A;  1E2X A;  3SXY A;  3IHU A;  3SXK A;  2DI3 A;  3SXM A;  1H9T A; 
#chains in the Genus database with same CATH topology
 1V74 B;  3F47 A;  3K66 A;  1WAT A;  4U9D A;  4EBB A;  3EQL F;  1KNY A;  4YT2 A;  2JPU A;  2YWA A;  3U2M A;  2YZS A;  5KYU A;  2H8A A;  4AK9 A;  1C02 A;  1T6I A;  2YL7 A;  2XLM A;  3ABM C;  4HE8 D;  1G8X A;  1JPJ A;  4AX2 A;  3ZSU A;  1BR2 A;  3IQC A;  2LD6 A;  4CSA A;  3KPH A;  1SF8 A;  3OEO A;  4OD4 A;  1YA9 A;  3AQC A;  3KYJ A;  256B A;  1B68 A;  2GA0 A;  3NG1 A;  4I44 A;  3GM1 A;  4MW8 A;  3QVY A;  2WL8 A;  4JEB A;  5AGF A;  4YL3 A;  2J45 A;  2YQY A;  4P9F A;  4D4X A;  4C3B A;  3QW0 A;  2DYR C;  1D1C A;  1VYI A;  3RW0 A;  2XXA A;  3IQT A;  3RYL A;  3X1O A;  5DS5 A;  3DAF A;  3I5P A;  3VYW A;  1A7E A;  1PD1 A;  1Z3I X;  2OKU A;  1OCC C;  2PFD A;  5E2Q A;  3FDQ A;  2RSE B;  3DM9 B;  1GGQ A;  2L9J A;  3HNL A;  1GM5 A;  3TJ6 A;  1O87 A;  1T01 A;  3S29 A;  3SXY A;  1EKY A;  3C63 A;  2CYD A;  5L0D A;  2W9Y A;  3ECS A;  4GQH A;  3F46 A;  1ZW2 A;  2HJ3 A;  2ZXW C;  4MVZ A;  2HV7 A;  3U5S A;  1MQV A;  1FNT c;  2J46 A;  1PCX A;  3N0T A;  1YA7 O;  5E3A A;  3PMR A;  4JRZ A;  1ST6 A;  2Z15 A;  2WZL A;  1NFN A;  3AJM A;  3ZIB A;  3WHN A;  3T9O A;  4G7O F;  3DJN B;  1IW7 F;  3V5Z A;  2W4B A;  3DWW A;  5L0I A;  2XS1 A;  4C7O B;  4MVM A;  3R2P A;  1FMV A;  4CDV A;  3EGX A;  3NMJ A;  2NG1 A;  2YLD A;  4HFF B;  5DQT A;  2AP3 A;  4YWQ A;  1OCZ C;  2NUP B;  3C18 A;  2AU5 A;  1F1M A;  4FWV A;  4XLP F;  1I4Z A;  2KW3 C;  4E7Z A;  4IAR A;  1JOG A;  3JCU Q;  1L3P A;  2W45 A;  4N6H A;  5B1B C;  2R03 A;  2ZPA A;  4Q7C A;  4UDV A;  2KNH A;  2P61 A;  2Y3D A;  1BBH A;  3DM5 A;  4LLC A;  2B0H A;  5DLJ A;  4EBK A;  5L3Q A;  2KC3 A;  5A6K A;  4J7Y A;  4A4A A;  1NG1 A;  2PP4 A;  2Q3T A;  1QSP A;  4DBQ A;  1NU9 C;  5JSL A;  1VB5 A;  2EIJ C;  1SZI A;  2L6G A;  3WG7 C;  3UR3 C;  1GQA A;  1HMO A;  4JUR I;  1MMG A;  1N1C A;  3I5Q A;  2YLI A;  2R7V A;  2GWW A;  4H4K C;  4CBE A;  4NC3 A;  1BZ4 A;  3FAP B;  3TUL A;  1Z7Q c;  3IPM O;  4DRH B;  3PDM P;  1OXB A;  3TQO A;  2QTV A;  4BJ5 A;  2UUH A;  3RQE A;  3LS0 A;  1WOL A;  3HTK C;  2VH3 A;  3U0C A;  4L6R A;  2WVQ A;  2VCB A;  3ABK C;  3K1I C;  3W8I A;  2QUP A;  1QQ3 A;  4IRU A;  2OJQ A;  3KKB A;  3RFY A;  2YEV A;  5TJ5 E;  4PJN A;  3M4C A;  2IXP A;  2R7W A;  2FAP B;  3TOM A;  1EQ1 A;  4WGY A;  3RIP A;  5FZT A;  3S28 A;  3L8I A;  4LAC B;  3EH1 A;  3GOR A;  4C3E A;  1YYJ A;  4MVQ A;  4C3D A;  1LE2 A;  1OQC A;  1QKR A;  2H7O A;  5FCL A;  4U5C E;  2R9R B;  2Q7R A;  1QZX A;  4JVS A;  3C7J A;  4JE9 A;  2A0U A;  1JR8 A;  3S9O A;  4BJ6 A;  1A0B A;  3EZI A;  3FOP A;  2CDQ A;  4MTG A;  4MS2 A;  5EHH A;  1LIH A;  2G62 A;  2KGO A;  1RJ9 A;  2PBE A;  4DOZ A;  3I4U A;  1YAR O;  5B1A C;  2G3V A;  4EWC A;  3VRC A;  4CS9 A;  3IQ5 A;  2Y69 C;  3TD7 A;  1OW6 A;  1VOM A;  2ZXO A;  3VM6 A;  4NY3 A;  4Z9I A;  3HKK A;  1OKK A;  1UG7 A;  4NCQ A;  3RKO F;  2NSG A;  4N06 A;  4JIO A;  1M56 C;  1SYQ A;  4LER A;  3KL4 A;  4IGG A;  4ANJ A;  2XM0 A;  2ZXP A;  1XWJ A;  4OIN F;  4B6I A;  5F5H A;  3TOL A;  5BQI A;  1TR2 A;  3U3F A;  4DBR A;  2P0N A;  2HZ8 A;  2YHS A;  3DJU B;  2OEX A;  3K7D A;  1U89 A;  2IOQ A;  3N2Z B;  4JZA A;  5E3C A;  3LNR A;  2CCY A;  3US6 A;  3JYY A;  3NRH A;  3SYN A;  3WAQ A;  5L0H A;  3JT1 A;  3J06 A;  2F22 A;  3ZTZ A;  1TQG A;  2GDC A;  1Q0D A;  3DXJ F;  2J7P A;  1TFK B;  3DZA A;  4NTB A;  3EPV A;  2EPK X;  4P6I C;  2J9B A;  3EG9 B;  1HE1 A;  5L0C A;  2WVN A;  4A2N B;  4W8P A;  3T6G B;  1APC A;  2QY9 A;  3QVZ A;  2OOC A;  5COG A;  5A6J A;  3AG3 C;  3NYM A;  5KYN A;  1DOV A;  3S0X A;  4O7G A;  1H6G A;  3UGP A;  3IHU A;  4D4N A;  1Y6D A;  3JRM O;  3LS1 A;  2EPM X;  2OQM A;  3EFO A;  2CW0 F;  2E87 A;  2RD9 A;  4DJ9 A;  2J9W A;  1VYK A;  4U5H A;  4Q5S F;  2OU6 A;  3U8P A;  5BUO A;  2PX0 A;  2XL4 A;  1NBB A;  5COM A;  5JP7 A;  4I1O B;  3UMK A;  1RJ9 B;  3H2U A;  1U0B B;  2P1A A;  4G7H F;  2R7X A;  4G78 A;  4XPY A;  1YLM A;  4JC7 A;  1QVX A;  1BDJ B;  2EIM C;  2KQ9 A;  4IAO A;  4LDK A;  4OIR F;  1ORY A;  5B3S C;  5E33 A;  2DGJ A;  1KTM A;  2Y3H A;  4Z9J A;  1ZW3 A;  2A6H F;  5BQG A;  2J9V A;  2LP4 A;  3JZ0 A;  1Q0F A;  2LQG A;  3KMI A;  1MMD A;  4PK4 A;  1LPE A;  1ZU4 A;  1D0Y A;  3FMS A;  2WZG A;  2ICW G;  1J8Y F;  1I4Y A;  2HSB A;  4J30 B;  3BRJ A;  2YLG A;  4PJL A;  3B9Q A;  5F28 E;  3H2V A;  4J7T A;  2CNW D;  3C8G A;  2VB6 A;  2AWY A;  5T3T A;  2YVK A;  4N6C A;  3G4X A;  1TWH A;  3HJC A;  2I8B A;  2H7V C;  3SXK A;  1S05 A;  5JRA A;  4P9T A;  2MHR A;  2YL1 A;  2YL0 A;  4YT5 A;  3AG1 C;  2EPN A;  5JT4 A;  1TWG A;  3OA1 A;  1YAU O;  3SP1 A;  4MQ9 F;  1XZP A;  3JSE O;  4CS8 A;  1ZHX A;  2KJG A;  2UUI A;  3QTH A;  2XLE A;  4BPM A;  1FAP B;  2XLH A;  2ZXR A;  4KNW A;  2NSF A;  5GPG B;  2TMV P;  1JMW A;  3DE9 A;  3EG9 A;  5DQZ A;  3NKE A;  3SXM A;  4KNV A;  1NLX A;  2DB4 A;  2R25 A;  2EPO A;  2WZF A;  5T3W A;  3BEH A;  1MMN A;  3IEE A;  2YRF A;  3C8Z A;  3V5X A;  4MTF A;  4EHP A;  3EFO B;  3MYI A;  1RCP A;  3B29 A;  4ZLC A;  4ER9 A;  1HY5 A;  1M57 C;  2D5R B;  5JLI A;  2J0X A;  1V4A A;  4Z9H A;  1H9T A;  2J8W A;  3ZWI A;  1V54 C;  4EUK B;  1SR2 A;  2R7U A;  2V3C C;  1E85 A;  1UFB A;  2GFH A;  2Q9C A;  3EHN A;  1IZM A;  3LEV A;  3FHD A;  4PJJ A;  5KYY B;  3CSK A;  3EJN A;  1ZHY A;  3K33 A;  3SNH A;  3U3B A;  1NSG B;  2ETS A;  2P6V A;  3GOD A;  4CJO A;  4NTF A;  1R5I D;  4RBN A;  5A6B D;  4N4W A;  1U6H A;  3GAN A;  5L0G A;  1LKX A;  4JJF A;  2R7O A;  2OCC C;  1WTY A;  1OKK D;  2HJM A;  4XQ1 A;  5JUA A;  3W2V A;  5AC5 A;  1HE9 A;  2DI3 A;  3VF0 A;  5KYX B;  3GEI A;  3JSZ A;  2Q00 A;  2XLO A;  3C8G B;  3EHM A;  4U5G A;  1TKN A;  3B0P A;  4PR9 A;  4KC9 A;  5D91 A;  1BR1 A;  3TJ5 A;  3E9V A;  1OCR C;  3KH2 A;  4XPW A;  1FFT C;  2A1D D;  1C03 A;  1WWP A;  4ULW A;  3DMD A;  1ZYR F;  1FR0 A;  3EZH A;  4K1O A;  3ZG1 A;  3O39 A;  3U9M A;  1OW7 A;  4BEJ A;  1LM3 B;  1E83 A;  1M6T A;  1VLT A;  4CX9 A;  1NZE A;  3CQZ A;  1G4W R;  4KI2 A;  1T6Q A;  4EKW A;  3A11 A;  3AQB A;  3RQF A;  1WN0 A;  4X0R A;  1CPR A;  2VCC A;  2Q9A A;  4JEA A;  4XWJ A;  1WAS A;  1LS1 A;  4O79 A;  1OR2 A;  4YT8 A;  4AL1 A;  4ZLD A;  4F4B A;  1AVO B;  2BL2 A;  2M4E A;  2L81 A;  2R7Q A;  3L8J A;  3LUT B;  4PAC A;  1Y4C A;  2EIL C;  2IXM A;  3W8H A;  4DRJ B;  1H7I A;  3UMH A;  1K04 A;  4PFO A;  5DS6 A;  1K05 A;  2HMZ A;  3AG2 C;  3PCV A;  1MND A;  2EIN C;  5JS5 A;  3Q6M A;  4JTA B;  1RXQ A;  3MYF A;  4O6Y A;  4EBJ A;  4CS7 A;  5AC4 A;  3QZC A;  2KSF A;  2O9X A;  4K0D A;  4XEV A;  3MFN A;  3S90 A;  3N24 A;  4WJ0 A;  4E0H A;  4CIH A;  2XLV A;  4MND A;  1TWA A;  5COF A;  4G0H A;  5D92 A;  5KYY A;  4M63 A;  1ORJ A;  1E84 A;  1DOW A;  3ZDL A;  4YT4 A;  3ITF A;  4JW1 A;  4FX5 A;  3JTL O;  2XL6 A;  3O55 A;  3NDB B;  4FAP B;  1E86 A;  3FVY A;  3NMK A;  3RH3 A;  1RKE B;  3LAY A;  1I5N A;  2HS5 A;  3LJB A;  3NMI A;  4MVR A;  4PFP A;  4WGZ A;  2WB7 A;  3Q7L A;  4E17 A;  3L1M A;  4E0I A;  1BR4 A;  3JYH A;  3O10 A;  1MNE A;  1YYX A;  5CI9 A;  3S27 A;  3T6J A;  2LFD A;  5KYX A;  2L6F A;  2R7T A;  1EI7 A;  2X51 A;  1HW1 A;  4YL1 A;  1ZHZ A;  2XRH A;  4QI2 A;  1CPQ A;  2CGE A;  3LLI A;  3O6X A;  1S7Z A;  2Q9B A;  3NYL A;  1OW8 A;  2P7V A;  3CEX A;  4CDA A;  1D0X A;  1RMV A;  4O6N A;  3SZR A;  4BJ6 C;  1ZVZ A;  1CGO A;  3OWT A;  4GEH A;  1ZU5 A;  4H54 A;  2I15 A;  2HFI A;  3MLG A;  3CAX A;  4QDL A;  5KYW A;  3H65 A;  1NU7 D;  1FFH A;  2PX3 A;  4K7B A;  4DXW A;  2OJE D;  1G4U S;  5L0J A;  3HNI A;  2PNO A;  3LLK A;  3GWN A;  2J0W A;  4WAB A;  2XL8 A;  4DRI B;  3ASN C;  2H7B A;  2HV6 A;  2LFF A;  5A6A A;  1FMW A;  2XLW A;  1VMA A;  3EH2 A;  1JRA A;  3Q7G A;  4O6M A;  4CIP A;  1VTM P;  2FGY A;  1NFO A;  4XTK A;  1YZA A;  3ZC4 A;  3KYI A;  3B0V C;  1T5O A;  2HMQ A;  2L7A A;  4U5E E;  1ORS C;  3T4R A;  4CSA C;  4XPX A;  4U5F E;  3AG4 C;  3AGT A;  3C62 A;  3R7C A;  3S84 A;  3CZ6 A;  3GEH A;  3ZVR A;  1M2O A;  3SXZ A;  4IJJ A;  2ZD9 A;  4R32 A;  3Q6N A;  3ATP A;  4JCZ A;  4PJM A;  1A7D A;  4KBL A;  1G5Z A;  1JAF A;  4DVZ A;  2X0C A;  3EGD B;  3ZTM A;  3W2W A;  3HLZ A;  3MBG A;  4MVS A;  2NUT A;  4XLN F;  3G4Z A;  2VAS A;  3M1C B;  4OIP F;  3PHF 2;  1E2X A;  3M79 A;  4ONS A;  5JVE A;  1VK5 A;  4HFK B;  4RD9 A;  2KYH A;  2LK4 A;  3L0I A;  4ULV A;  4CS8 C;  1A41 A;  1R4T A;  2PF4 E;  4NTA A;  1VLS A;  2Y39 A;  3JRT A;  2ASR A;  1LI7 A;  1RKE A;  2C04 A;  1CGN A;  2IXO A;  2XS8 A;  2FFH A;  4JTC B;  5B3I A;  2R02 A;  3RVY A;  3HNJ A;  4HEA J;  1YDI A;  3GM2 A;  3FOO A;  4E7S A;  2R7R A;  4AL0 A;  1V55 C;  3LNM B;  3MX3 A;  3VAY A;  1M2V A;  4U5D E;  4JTD B;  5CI8 A;  4MVU A;  2D4U A;  2A6E F;  3QMK A;  1YVI A;  4IB4 A;  2A69 F;  4CJG A;  1JPN A;  5A6B A;  1Q0K A;  1Q0G A;  2J7P D;  3M4B A;  5BQH A;  1O5H A;  2JD3 A;  2XSE A;  1K40 A;  2OEV A;  2A0B A;  2YKZ A;  4BEM J;  1AUE A;  1D1B A;  2EPL X;  3V7O A;  2W4M A;  4AE4 B;  4DVY P;  3UNG C;  3RVZ A;  1T9K A;  4W8K A;  2MWQ A;  5KYW B;  2QNL A;  2XLD A;  1T6U A;  3U2L A;  3POV A;  1EA8 A;  4NQF A;  3B0U X;  1Z63 A;  4GYT A;  3M15 A;  2EIK C;  5F5F A;  2HUJ A;  3ZQY A;  3GM3 A;  1KU2 A;  2KK1 A;  3U9J A;  2LCH A;  4I1M A;  3T6B A;  4YL0 A;  3X2Q C;  1WGW A;  3LES A;  3NKD A;  2B0J A;  2HSQ A;  3V5Y A;  4OIO F;  2R05 A;  1TFO B;  1QLE C;  2C03 A;  2V26 A;  5IY5 C;  5A69 A;  1C17 M;  3K6B A;  1OCO C;  3AGU A;  4E18 A;  3ZQV A;  4MTO A;  4LDQ A;  2YL3 A;  4LLE A;  2IYL D;  2VCA A;  2Y3G A;  3L34 A;  4LDR A;  1MMA A;  2Y3B A;  2LSE A;  3EGD A;  1YZC A;  2A68 F;  2NUT B;  3ASO C;  3NYJ A;  4BG0 A;  1W2W A;  2HKV A;  5KYU B;  1LE4 A;  1YJG A;  3HNK A;  3U8V A;  2G3K A;  4Q4Z F;  3K1I A;  5DVW A;  3RF3 A;  4BJ1 A;  2JX0 A;  4FES A;  4QI0 A;  3W4Y A;  1OXK A;  4YJW A;  3DI5 A;  4I3M A;  4JKV A;  3UMI A;  1PD0 A;  3RQG A;  5DS4 A;  1H9G A;  2GAQ A;  1O3U A;  1ZZP A;  5L3V A;  3A9C A;  2WVO A;  3K1H A;  5HSW A;  1J8M F;  1M2V B;  2J9U A;  3FAJ A;  4EIY A;  3DKA A;  2XXA B;  5EGY A;  3SEO A;  1SMY F;  1Q0M A;  2CNW A;  3C8G D;  2BC5 A;  3AOU A;  1XZQ A;  4BJT A;  1CGM E;  1TWC A;  2VC9 A;  2QLA A;  5T1D B;  4CDY A;  3UGO A;  3ABL C;  4U9E A;  1OR3 A;  2OG2 A;  4U5B E;  5HV9 A;  1Z23 A;  4AE4 A;  2QE9 A;  3DAG A;  2XM4 A;  5K0I A;  1HMD A;  1LVK A;  1PV3 A;  1QPU A;  1ZHT A;  1LI5 A;  2M64 A;  2NPU A;  4YK5 A;  2Q4F A;  3FXH A;  1A7V A;  3G50 A;  5CIV A;  2BE5 F;  4YN0 B;  1Z5Z A;  1D0Z A;  4MVO A;  2DYS C;  3IQ6 A;  4IAQ A;  4XEF A;  4CS9 C;  2R7S A;  1Z6A A;  4IWB A;  1FTS A;  2AWC A;  4BJ5 C;  3LEO A;  4JCH A;  4OIQ F;  2MYS A;  4RDA A;  3DD7 A;  4MW3 A;  3GEE A;  3WOD F;  1RKC A;  3QW1 A;  3DE8 A;  2AVK A;  4G7Z F;  4J32 B;  4OD5 A;  4C7O A;  5EK0 A;  4JJG A;  3EGX B;  5L0F A;  1LS4 A;  3E70 C;  3TK0 A;  2IM8 A;  1L7C A;  1D1A A;  2IBF A;  2NUP A;  4XEK A;  1ZHW A;  2LIG A;  3B71 A;  1AEP A;  3GWL A;  2L6H A;  2IXN A;  1HW2 A;  1GS9 A; 
#chains in the Genus database with same CATH homology
 3SXZ A;  1H9G A;  4P9F A;  1HW1 A;  2HS5 A;  3C7J A;  3FMS A;  1HW2 A;  1E2X A;  3SXY A;  3IHU A;  3SXK A;  2DI3 A;  3SXM A;  1H9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...