3SXMA

Metal-free fcd domain of tm0439 a putative transcriptional regulator
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
140
structure length
137
Chain Sequence
GAMDEKFIRETIETRIMMEVFCLENYFDKIAGSEELLEIKGEIDDVAAREIFDDSDERLHKLFIRASGNELIISLYEKIWDRIDLVRHLNERYVVSNREHKELIERIISGDKEGAIEKLKEHLKNVEAETIKNLYTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, GntR family
publication title Metal-free FCD domain of TM0439 a putative transcriptional regulator
rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
total genus 59
structure length 137
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3sxmA00
1H9GA 4P9FA 3SXZA 1HW2A 1HW1A 2HS5A 3SXKA 3C7JA 2DI3A 1E2XA 1H9TA 3FMSA 3SXYA 3SXMA 3IHUA
chains in the Genus database with same CATH superfamily
4QI2A 2WVQA 1HW1A 2YLDA 2Q9BA 2HZ8A 5KYWB 3O39A 1Z5ZA 1O87A 1BDJB 2OEXA 3O10A 2R9RB 2YKZA 2HSQA 2J8WA 2HS5A 2CCYA 2YL1A 4JKVA 3S27A 2KSFA 1Y4CA 3CQZA 4ULWA 5F5HA 3QW0A 1APCA 4IB4A 2B0JA 1TQGA 2HV6A 3NMKA 5HSWA 1AUEA 3OWTA 5AC5A 4X0RA 1RCPA 3K33A 5JP7A 5DQTA 4MNDA 2XL6A 2RD9A 1HE1A 2Y39A 3ZC4A 5COGA 5BUOA 2LIGA 2Y3BA 2GA0A 1RJ9A 4O6NA 3J06A 4MVQA 3FDQA 1ZYRF 2CGEA 4AX2A 2Q4FA 1JR8A 3LESA 2P0NA 3VAYA 2XXAA 3U8VA 1A0BA 2KW3C 4CDYA 3JSEO 4Q5SF 5T3WA 1K04A 3T6BA 2R7SA 3LLKA 4LLCA 2YWAA 5B1AC 1OCOC 2DYRC 1FAPB 4O79A 1H7IA 1T5OA 2NUPA 4C7OB 5KYUA 3L1MA 2AWCA 2PP4A 2AVKA 3JZ0A 2OU6A 1FTSA 4ANJA 2D4UA 1YARO 3DXJF 3G4ZA 3SZRA 5EHHA 2LP4A 1JPJA 1T9KA 2A69F 4N6HA 2WVOA 2DYSC 5COMA 1V4AA 3JT1A 4F4BA 4E0IA 3A11A 3MYIA 3V7OA 4OIOF 4YWQA 4YN0B 3U3BA 3R2PA 1H9GA 4I3MA 4LDQA 4MVMA 1YZAA 4PJJA 3V5XA 4DBQA 3GWLA 3C63A 1OR2A 1Y6DA 2LSEA 3RVZA 1CGNA 1Q0KA 2V26A 1T6QA 2PFDA 3H65A 4QDLA 3T4RA 1A7VA 3FAJA 1QZXA 3GEHA 4YT2A 3UGOA 2KC3A 4CBEA 4CJGA 3WODF 2W45A 4CS9A 3DM5A 4EBKA 3V5YA 5COFA 1JPNA 3LS0A 1ZVZA 2DB4A 2H8AA 3T9OA 3ZVRA 2R7UA 1MMGA 1WTYA 5FZTA 2C04A 3RIPA 4E0HA 5F28E 3S0XA 3IQ6A 3KYIA 5JUAA 3O6XA 5FCLA 1OKKD 3X1OA 3TULA 5EGYA 3K1IC 2KJGA 2J0XA 3HTKC 3JRMO 2W9YA 5D91A 2XSEA 3DWWA 2XL4A 3ZIBA 2RSEB 2UUIA 4XQ1A 1YDIA 3LLIA 5BQGA 3GWNA 1VLTA 2P7VA 4MVRA 3C8GD 2JD3A 3S9OA 5A6JA 2VH3A 2L81A 2XS1A 3ABMC 3Q6MA 5DS6A 3K6BA 3EGDA 4AL1A 1TR2A 3A9CA 1QLEC 4G78A 1ZHWA 4J7YA 3EH2A 3LEOA 1LI7A 2P61A 5L0JA 4DJ9A 1TWAA 4NTBA 2FAPB 1YJGA 4PJMA 2LCHA 3L8IA 1V55C 4RDAA 1AVOB 3K7DA 5JLIA 5JVEA 4G7HF 2EINC 2ETSA 5E3AA 4C3DA 3GANA 3LNRA 4EHPA 2XM4A 1DOWA 3C18A 4JTAB 3KPHA 2OJQA 4Q7CA 2YEVA 2IM8A 4MTFA 4OINF 4AK9A 4BJ1A 3EHMA 4HE8D 4OD5A 3B71A 3OEOA 3DZAA 1K40A 2A1DD 1NFOA 4H4KC 1CPQA 5JSLA 3CZ6A 1KTMA 3ZWIA 5L0HA 3DJUB 3HLZA 2EPOA 3US6A 4LLEA 2X51A 3TOLA 1I4YA 2HUJA 2LFFA 2ZPAA 1GS9A 3Q7LA 5EK0A 3RW0A 2IYLD 1OKKA 4U5CE 1GQAA 2YHSA 4GYTA 4N4WA 1UG7A 3M4CA 4XEFA 3T6GB 2JPUA 2H7BA 1MQVA 1E85A 1MMAA 2A6EF 4Z9HA 4YK5A 2WZLA 2EPNA 3MLGA 4O6MA 5JT4A 2ZXPA 3HNIA 3JYHA 3C8GA 1M2VA 4P6IC 3RQFA 2HMQA 4OIPF 3GM1A 3IEEA 4LACB 4DRHB 3AG4C 1DOVA 5HV9A 1CGME 4JEBA 3EHNA 4J7TA 4IWBA 2MWQA 1SR2A 4MVSA 3S29A 5L3QA 4FWVA 3PHF2 2YZSA 2AWYA 4K0DA 4KNWA 2JX0A 4BJ5C 3H2VA 3MFNA 3CAXA 4BJ6C 1M6TA 3B29A 4PK4A 4ZLCA 3B0PA 4QI0A 5T1DB 3IQ5A 2ZXRA 5JS5A 2R7OA 1C02A 4HFFB 1BR2A 5TJ5E 3HJCA 4AE4B 5B3IA 2IBFA 4JRZA 4L6RA 5L0DA 2J7PA 2CNWA 2EILC 2R02A 3ZG1A 3M15A 2Y3GA 1VB5A 2LFDA 4YL1A 4KNVA 1Q0DA 3EG9B 3JRTA 4CS7A 3G4XA 3ASOC 4MW3A 2Y3DA 4FAPB 1LE2A 4R32A 3ASNC 4NTAA 4W8KA 1LS4A 1G4WR 2LK4A 3DKAA 3FVYA 5B1BC 1UFBA 2KK1A 2L9JA 2EIKC 3RVYA 2Y3HA 1RMVA 4G7OF 1XZPA 1Q0FA 1KNYA 1OW7A 2NPUA 4CJOA 4DOZA 5KYNA 2LD6A 3KL4A 1ZW3A 3POVA 1A7EA 2EPKX 4XEKA 3L8JA 1E2XA 1LKXA 1NU7D 1J8MF 1XZQA 3ZSUA 4CX9A 2D5RB 4XPYA 4DVZA 3AQBA 3QMKA 4E17A 2QNLA 4IRUA 1PCXA 2R7VA 1MMDA 1MNEA 1YA7O 4A2NB 4XLNF 1NG1A 3TK0A 3AG3C 3B0VC 3U2LA 3Q6NA 4OD4A 4OIRF 1SYQA 2ZXOA 4JW1A 5BQHA 3OA1A 2Y69C 2Z15A 4JTCB 3ZQVA 2R25A 1VYKA 1RJ9B 1Z3IX 2HJ3A 5L0IA 2GWWA 2FGYA 3FHDA 2XXAB 3UMHA 4IARA 4WGYA 2MYSA 3K1HA 3KYJA 3RH3A 3W4YA 2HJMA 2Q9AA 4NY3A 4NCQA 1J8YF 3L0IA 3AGTA 3TJ5A 3E70C 1EQ1A 1TKNA 2HSBA 3EJNA 2R03A 1A7DA 2ASRA 2W4BA 3IHUA 5AC4A 4MS2A 2NUPB 2PNOA 4NC3A 1BBHA 3VF0A 2L6FA 1AEPA 2XLHA 3NRHA 3TD7A 1VYIA 3HNJA 3DM9B 4NQFA 4P9TA 2OG2A 2OCCC 3K1IA 1G5ZA 2QY9A 3UGPA 1ZU4A 1OR3A 3PCVA 1O5HA 4U5FE 5A6KA 2H7OA 1D0YA 5KYXA 2HFIA 1YZCA 3LS1A 4FESA 1WN0A 4IJJA 3KMIA 4JIOA 2IOQA 5A6AA 1A41A 3U2MA 3UMIA 5IY5C 4WJ0A 1T6IA 1OW8A 1IW7F 1PD1A 3DE9A 2J9WA 3VYWA 4CS8A 1BR1A 5E3CA 2I8BA 2OKUA 4OIQF 2CDQA 2P6VA 1D1CA 2HMZA 2ICWG 3N24A 3BEHA 3S28A 1ZW2A 4JTDB 1GM5A 3MX3A 2M4EA 1PV3A 1WOLA 4EIYA 1Z6AA 5CI9A 1LVKA 2YRFA 3ECSA 2YQYA 4LDRA 2O9XA 2UUHA 3BRJA 4CS8C 4EKWA 3ZDLA 4EBJA 3FOPA 3FMSA 2PX0A 3HNLA 3Q7GA 3HNKA 1ORSC 2XM0A 2KQ9A 4GEHA 3EGXA 1U6HA 3AJMA 3EFOA 3SXZA 1R4TA 3VM6A 4E7ZA 3LNMB 5KYYA 2J46A 3NMJA 1TFOB 2YL0A 4EUKB 4HFKB 1YLMA 1VMAA 3I4UA 4D4XA 3W8IA 3G50A 2YLIA 1NU9C 1D0XA 4D4NA 2L7AA 3C8ZA 3NG1A 2R7WA 1SZIA 2CNWD 2J7PD 1OXBA 2VC9A 2P1AA 3IQCA 3AOUA 3LJBA 3O55A 2YVKA 2YL7A 3HKKA 2VCBA 3I5PA 4DRIB 3RQGA 2NSFA 2A0BA 3JCUQ 1ZHXA 4MTOA 2B0HA 2Q3TA 1EA8A 4G0HA 4JJGA 1JOGA 4XTKA 4XWJA 3EGDB 5L3VA 1FMVA 1HMOA 3QW1A 3B0UX 4MW8A 1ORJA 1T01A 1V74B 4U5DE 4DRJB 3U5SA 1SMYF 3X2QC 3L34A 4CSAC 3EZIA 4XLPF 1LM3B 3KKBA 4EWCA 1TWGA 3S90A 2NUTA 1FFTC 1LIHA 3SP1A 1JRAA 1WASA 1E86A 2WL8A 3IPMO 3NYLA 1D0ZA 1SF8A 4PJLA 1CPRA 3ZTZA 4BJ5A 1RKEA 2VCAA 4E18A 2R7QA 4BJ6A 4BPMA 2OEVA 4JURI 2IXMA 2BE5F 3ZQYA 5AGFA 2LQGA 4JJFA 2QE9A 3CSKA 3W2WA 4PFPA 5KYWA 2R7RA 1VK5A 2QUPA 2OJED 3QZCA 2GAQA 4DVYP 4ULVA 4W8PA 4A4AA 2NG1A 3DMDA 1G8XA 3GODA 3GM2A 4JEAA 3AG1C 2X0CA 1QKRA 1U89A 1U0BB 1ZHYA 2XRHA 3KH2A 4WABA 5CI8A 3IQTA 2PX3A 5D92A 1E83A 2WVNA 2KNHA 4MVUA 3SNHA 1RKCA 2IXOA 2J9BA 1VTMP 1FNTc 2NSGA 3MYFA 3UNGC 3VRCA 1TWCA 3UR3C 4N06A 4EBBA 1QQ3A 2IXNA 3C8GB 1M2VB 3NYJA 1L3PA 4O6YA 1NSGB 5E33A 2H7VC 4I1OB 5T3TA 3R7CA 1D1BA 3RKOF 4CDAA 4J30B 4U5GA 4AL0A 3C62A 3F47A 1OQCA 3JTLO 5L0CA 3U0CA 4GQHA 1HMDA 4JCHA 2M64A 2Q00A 1BZ4A 2OOCA 3N2ZB 3W8HA 4ER9A 1OCRC 3ATPA 3SXKA 1JAFA 2HKVA 3AG2C 3ZTMA 1S7ZA 1R5ID 3LEVA 4WGZA 1NBBA 2R05A 1WWPA 3PMRA 2V3CC 4BJTA 1ZHTA 1NZEA 2GFHA 5DLJA 3FOOA 4C7OA 2OQMA 1TWHA 3DAFA 4I44A 2WZFA 4YT8A 2YLGA 3NKEA 2R7TA 2EPMX 4MVZA 2PBEA 4JE9A 5A6BD 3C7JA 2EIJC 1B68A 4YT5A 4CIPA 1HE9A 3RQEA 1YYJA 3M1CB 1WATA 2WB7A 1ZZPA 1T6UA 1ST6A 4BEMJ 1QVXA 1FFHA 2CYDA 2EPLX 2XLWA 4LERA 2F22A 3K66A 4PR9A 3EZHA 4U9EA 4JZAA 3DJNB 1HY5A 4MVOA 2A6HF 4DXWA 2XLOA 4J32B 5BQIA 1FR0A 1YA9A 4CDVA 1CGOA 2EIMC 2Q7RA 1Z63A 2TMVP 4M63A 4Q4ZF 3EQLF 1G4US 2R7XA 3ABKC 4KC9A 4XPWA 1Z7Qc 1LPEA 2KYHA 2DGJA 4JVSA 2HV7A 4IGGA 1O3UA 4U5HA 4BG0A 1QSPA 3SXYA 2AU5A 5DVWA 1M2OA 1YAUO 3GORA 1QPUA 2XL8A 4C3EA 3W2VA 3WHNA 1N1CA 5B3SC 3GEEA 1LI5A 1EI7A 2XLEA 3DE8A 4IAQA 4P9FA 1L7CA 4NTFA 3S84A 4KBLA 2ZD9A 4YT4A 3H2UA 2XS8A 1JMWA 3FAPB 4RBNA 2BC5A 2G62A 5JRAA 4H54A 1WGWA 3TOMA 3QVZA 4LDKA 1Q0MA 3UMKA 4BEJA 1MMNA 3ABLC 1NLXA 2VASA 2FFHA 1IZMA 2J9UA 5A69A 3E9VA 5F5FA 3RYLA 1YYXA 2A68F 5A6BA 1Z23A 2VCCA 3QTHA 4YL0A 1BR4A 4MQ9F 3N0TA 2KGOA 5DS5A 2XLMA 3RFYA 2AP3A 5KYUB 4ZLDA 2YL3A 2L6GA 2QLAA 3GM3A 2J45A 4K1OA 4U5EE 5CIVA 3B9QA 2BL2A 1RXQA 2IXPA 4IAOA 2WZGA 5E2QA 4B6IA 2VB6A 5KYXB 1OCCC 3U9MA 4C3BA 3SXMA 3MBGA 1S05A 4CIHA 2XLDA 3FXHA 4CS9C 4UDVA 3PDMP 1M56C 5L0GA 2C03A 3CEXA 4U5BE 1GGQA 3QVYA 1KU2A 3M79A 1V54C 4MTGA 4CSAA 1H6GA 1OCZC 1OXKA 3F46A 3SEOA 4PFOA 1M57C 1FMWA 2A0UA 4XPXA 3JSZA 4FX5A 2CW0F 1XWJA 1ZU5A 2L6HA 4JCZA 4U9DA 3EH1A 3WG7C 4YL3A 1LE4A 1OW6A 1VLSA 3EGXB 3ITFA 3NMIA 1D1AA 3EFOB 2PF4E 3M4BA 256BA 4JC7A 1W2WA 3T6JA 2XLVA 5KYYB 4Z9JA 1C03A 3LAYA 4G7ZF 3V5ZA 1I4ZA 1H9TA 3LUTB 2G3KA 4ONSA 1TFKB 1K05A 1F1MA 5L0FA 4HEAJ 3U9JA 1HW2A 4K7BA 1LS1A 3U3FA 1MNDA 2G3VA 3WAQA 3NKDA 4N6CA 3DAGA 2ZXWC 2QTVA 3DD7A 4RD9A 3TQOA 3AQCA 3EPVA 2Q9CA 3DI5A 4Z9IA 2E87A 1ZHZA 3GEIA 4XEVA 3TJ6A 5DS4A 3RF3A 5K0IA 1Q0GA 4DBRA 4E7SA 2W4MA 5GPGB 3NDBB 3JYYA 4O7GA 2J0WA 4PACA 2MHRA 1YVIA 1VOMA 2DI3A 4I1MA 1NFNA 1ORYA 1I5NA 4AE4A 5DQZA 4YJWA 3I5QA 3U8PA 1C17M 1PD0A 4PJNA 1E84A 2I15A 2NUTB 3NYMA 4KI2A 3EG9A 2J9VA 3SYNA 3AGUA 2GDCA 1EKYA 1RKEB
chains in the Genus database with same CATH topology
1H9GA 4P9FA 3SXZA 1HW2A 1HW1A 2HS5A 3SXKA 3C7JA 2DI3A 1E2XA 1H9TA 3FMSA 3SXYA 3SXMA 3IHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H9G A;  4P9F A;  3SXZ A;  1HW2 A;  1HW1 A;  2HS5 A;  3SXK A;  3C7J A;  2DI3 A;  1E2X A;  1H9T A;  3FMS A;  3SXY A;  3SXM A;  3IHU A; 
#chains in the Genus database with same CATH topology
 4QI2 A;  2WVQ A;  1HW1 A;  2YLD A;  2Q9B A;  2HZ8 A;  5KYW B;  3O39 A;  1Z5Z A;  1O87 A;  1BDJ B;  2OEX A;  3O10 A;  2R9R B;  2YKZ A;  2HSQ A;  2J8W A;  2HS5 A;  2CCY A;  2YL1 A;  4JKV A;  3S27 A;  2KSF A;  1Y4C A;  3CQZ A;  4ULW A;  5F5H A;  3QW0 A;  1APC A;  4IB4 A;  2B0J A;  1TQG A;  2HV6 A;  3NMK A;  5HSW A;  1AUE A;  3OWT A;  5AC5 A;  4X0R A;  1RCP A;  3K33 A;  5JP7 A;  5DQT A;  4MND A;  2XL6 A;  2RD9 A;  1HE1 A;  2Y39 A;  3ZC4 A;  5COG A;  5BUO A;  2LIG A;  2Y3B A;  2GA0 A;  1RJ9 A;  4O6N A;  3J06 A;  4MVQ A;  3FDQ A;  1ZYR F;  2CGE A;  4AX2 A;  2Q4F A;  1JR8 A;  3LES A;  2P0N A;  3VAY A;  2XXA A;  3U8V A;  1A0B A;  2KW3 C;  4CDY A;  3JSE O;  4Q5S F;  5T3W A;  1K04 A;  3T6B A;  2R7S A;  3LLK A;  4LLC A;  2YWA A;  5B1A C;  1OCO C;  2DYR C;  1FAP B;  4O79 A;  1H7I A;  1T5O A;  2NUP A;  4C7O B;  5KYU A;  3L1M A;  2AWC A;  2PP4 A;  2AVK A;  3JZ0 A;  2OU6 A;  1FTS A;  4ANJ A;  2D4U A;  1YAR O;  3DXJ F;  3G4Z A;  3SZR A;  5EHH A;  2LP4 A;  1JPJ A;  1T9K A;  2A69 F;  4N6H A;  2WVO A;  2DYS C;  5COM A;  1V4A A;  3JT1 A;  4F4B A;  4E0I A;  3A11 A;  3MYI A;  3V7O A;  4OIO F;  4YWQ A;  4YN0 B;  3U3B A;  3R2P A;  1H9G A;  4I3M A;  4LDQ A;  4MVM A;  1YZA A;  4PJJ A;  3V5X A;  4DBQ A;  3GWL A;  3C63 A;  1OR2 A;  1Y6D A;  2LSE A;  3RVZ A;  1CGN A;  1Q0K A;  2V26 A;  1T6Q A;  2PFD A;  3H65 A;  4QDL A;  3T4R A;  1A7V A;  3FAJ A;  1QZX A;  3GEH A;  4YT2 A;  3UGO A;  2KC3 A;  4CBE A;  4CJG A;  3WOD F;  2W45 A;  4CS9 A;  3DM5 A;  4EBK A;  3V5Y A;  5COF A;  1JPN A;  3LS0 A;  1ZVZ A;  2DB4 A;  2H8A A;  3T9O A;  3ZVR A;  2R7U A;  1MMG A;  1WTY A;  5FZT A;  2C04 A;  3RIP A;  4E0H A;  5F28 E;  3S0X A;  3IQ6 A;  3KYI A;  5JUA A;  3O6X A;  5FCL A;  1OKK D;  3X1O A;  3TUL A;  5EGY A;  3K1I C;  2KJG A;  2J0X A;  3HTK C;  3JRM O;  2W9Y A;  5D91 A;  2XSE A;  3DWW A;  2XL4 A;  3ZIB A;  2RSE B;  2UUI A;  4XQ1 A;  1YDI A;  3LLI A;  5BQG A;  3GWN A;  1VLT A;  2P7V A;  4MVR A;  3C8G D;  2JD3 A;  3S9O A;  5A6J A;  2VH3 A;  2L81 A;  2XS1 A;  3ABM C;  3Q6M A;  5DS6 A;  3K6B A;  3EGD A;  4AL1 A;  1TR2 A;  3A9C A;  1QLE C;  4G78 A;  1ZHW A;  4J7Y A;  3EH2 A;  3LEO A;  1LI7 A;  2P61 A;  5L0J A;  4DJ9 A;  1TWA A;  4NTB A;  2FAP B;  1YJG A;  4PJM A;  2LCH A;  3L8I A;  1V55 C;  4RDA A;  1AVO B;  3K7D A;  5JLI A;  5JVE A;  4G7H F;  2EIN C;  2ETS A;  5E3A A;  4C3D A;  3GAN A;  3LNR A;  4EHP A;  2XM4 A;  1DOW A;  3C18 A;  4JTA B;  3KPH A;  2OJQ A;  4Q7C A;  2YEV A;  2IM8 A;  4MTF A;  4OIN F;  4AK9 A;  4BJ1 A;  3EHM A;  4HE8 D;  4OD5 A;  3B71 A;  3OEO A;  3DZA A;  1K40 A;  2A1D D;  1NFO A;  4H4K C;  1CPQ A;  5JSL A;  3CZ6 A;  1KTM A;  3ZWI A;  5L0H A;  3DJU B;  3HLZ A;  2EPO A;  3US6 A;  4LLE A;  2X51 A;  3TOL A;  1I4Y A;  2HUJ A;  2LFF A;  2ZPA A;  1GS9 A;  3Q7L A;  5EK0 A;  3RW0 A;  2IYL D;  1OKK A;  4U5C E;  1GQA A;  2YHS A;  4GYT A;  4N4W A;  1UG7 A;  3M4C A;  4XEF A;  3T6G B;  2JPU A;  2H7B A;  1MQV A;  1E85 A;  1MMA A;  2A6E F;  4Z9H A;  4YK5 A;  2WZL A;  2EPN A;  3MLG A;  4O6M A;  5JT4 A;  2ZXP A;  3HNI A;  3JYH A;  3C8G A;  1M2V A;  4P6I C;  3RQF A;  2HMQ A;  4OIP F;  3GM1 A;  3IEE A;  4LAC B;  4DRH B;  3AG4 C;  1DOV A;  5HV9 A;  1CGM E;  4JEB A;  3EHN A;  4J7T A;  4IWB A;  2MWQ A;  1SR2 A;  4MVS A;  3S29 A;  5L3Q A;  4FWV A;  3PHF 2;  2YZS A;  2AWY A;  4K0D A;  4KNW A;  2JX0 A;  4BJ5 C;  3H2V A;  3MFN A;  3CAX A;  4BJ6 C;  1M6T A;  3B29 A;  4PK4 A;  4ZLC A;  3B0P A;  4QI0 A;  5T1D B;  3IQ5 A;  2ZXR A;  5JS5 A;  2R7O A;  1C02 A;  4HFF B;  1BR2 A;  5TJ5 E;  3HJC A;  4AE4 B;  5B3I A;  2IBF A;  4JRZ A;  4L6R A;  5L0D A;  2J7P A;  2CNW A;  2EIL C;  2R02 A;  3ZG1 A;  3M15 A;  2Y3G A;  1VB5 A;  2LFD A;  4YL1 A;  4KNV A;  1Q0D A;  3EG9 B;  3JRT A;  4CS7 A;  3G4X A;  3ASO C;  4MW3 A;  2Y3D A;  4FAP B;  1LE2 A;  4R32 A;  3ASN C;  4NTA A;  4W8K A;  1LS4 A;  1G4W R;  2LK4 A;  3DKA A;  3FVY A;  5B1B C;  1UFB A;  2KK1 A;  2L9J A;  2EIK C;  3RVY A;  2Y3H A;  1RMV A;  4G7O F;  1XZP A;  1Q0F A;  1KNY A;  1OW7 A;  2NPU A;  4CJO A;  4DOZ A;  5KYN A;  2LD6 A;  3KL4 A;  1ZW3 A;  3POV A;  1A7E A;  2EPK X;  4XEK A;  3L8J A;  1E2X A;  1LKX A;  1NU7 D;  1J8M F;  1XZQ A;  3ZSU A;  4CX9 A;  2D5R B;  4XPY A;  4DVZ A;  3AQB A;  3QMK A;  4E17 A;  2QNL A;  4IRU A;  1PCX A;  2R7V A;  1MMD A;  1MNE A;  1YA7 O;  4A2N B;  4XLN F;  1NG1 A;  3TK0 A;  3AG3 C;  3B0V C;  3U2L A;  3Q6N A;  4OD4 A;  4OIR F;  1SYQ A;  2ZXO A;  4JW1 A;  5BQH A;  3OA1 A;  2Y69 C;  2Z15 A;  4JTC B;  3ZQV A;  2R25 A;  1VYK A;  1RJ9 B;  1Z3I X;  2HJ3 A;  5L0I A;  2GWW A;  2FGY A;  3FHD A;  2XXA B;  3UMH A;  4IAR A;  4WGY A;  2MYS A;  3K1H A;  3KYJ A;  3RH3 A;  3W4Y A;  2HJM A;  2Q9A A;  4NY3 A;  4NCQ A;  1J8Y F;  3L0I A;  3AGT A;  3TJ5 A;  3E70 C;  1EQ1 A;  1TKN A;  2HSB A;  3EJN A;  2R03 A;  1A7D A;  2ASR A;  2W4B A;  3IHU A;  5AC4 A;  4MS2 A;  2NUP B;  2PNO A;  4NC3 A;  1BBH A;  3VF0 A;  2L6F A;  1AEP A;  2XLH A;  3NRH A;  3TD7 A;  1VYI A;  3HNJ A;  3DM9 B;  4NQF A;  4P9T A;  2OG2 A;  2OCC C;  3K1I A;  1G5Z A;  2QY9 A;  3UGP A;  1ZU4 A;  1OR3 A;  3PCV A;  1O5H A;  4U5F E;  5A6K A;  2H7O A;  1D0Y A;  5KYX A;  2HFI A;  1YZC A;  3LS1 A;  4FES A;  1WN0 A;  4IJJ A;  3KMI A;  4JIO A;  2IOQ A;  5A6A A;  1A41 A;  3U2M A;  3UMI A;  5IY5 C;  4WJ0 A;  1T6I A;  1OW8 A;  1IW7 F;  1PD1 A;  3DE9 A;  2J9W A;  3VYW A;  4CS8 A;  1BR1 A;  5E3C A;  2I8B A;  2OKU A;  4OIQ F;  2CDQ A;  2P6V A;  1D1C A;  2HMZ A;  2ICW G;  3N24 A;  3BEH A;  3S28 A;  1ZW2 A;  4JTD B;  1GM5 A;  3MX3 A;  2M4E A;  1PV3 A;  1WOL A;  4EIY A;  1Z6A A;  5CI9 A;  1LVK A;  2YRF A;  3ECS A;  2YQY A;  4LDR A;  2O9X A;  2UUH A;  3BRJ A;  4CS8 C;  4EKW A;  3ZDL A;  4EBJ A;  3FOP A;  3FMS A;  2PX0 A;  3HNL A;  3Q7G A;  3HNK A;  1ORS C;  2XM0 A;  2KQ9 A;  4GEH A;  3EGX A;  1U6H A;  3AJM A;  3EFO A;  3SXZ A;  1R4T A;  3VM6 A;  4E7Z A;  3LNM B;  5KYY A;  2J46 A;  3NMJ A;  1TFO B;  2YL0 A;  4EUK B;  4HFK B;  1YLM A;  1VMA A;  3I4U A;  4D4X A;  3W8I A;  3G50 A;  2YLI A;  1NU9 C;  1D0X A;  4D4N A;  2L7A A;  3C8Z A;  3NG1 A;  2R7W A;  1SZI A;  2CNW D;  2J7P D;  1OXB A;  2VC9 A;  2P1A A;  3IQC A;  3AOU A;  3LJB A;  3O55 A;  2YVK A;  2YL7 A;  3HKK A;  2VCB A;  3I5P A;  4DRI B;  3RQG A;  2NSF A;  2A0B A;  3JCU Q;  1ZHX A;  4MTO A;  2B0H A;  2Q3T A;  1EA8 A;  4G0H A;  4JJG A;  1JOG A;  4XTK A;  4XWJ A;  3EGD B;  5L3V A;  1FMV A;  1HMO A;  3QW1 A;  3B0U X;  4MW8 A;  1ORJ A;  1T01 A;  1V74 B;  4U5D E;  4DRJ B;  3U5S A;  1SMY F;  3X2Q C;  3L34 A;  4CSA C;  3EZI A;  4XLP F;  1LM3 B;  3KKB A;  4EWC A;  1TWG A;  3S90 A;  2NUT A;  1FFT C;  1LIH A;  3SP1 A;  1JRA A;  1WAS A;  1E86 A;  2WL8 A;  3IPM O;  3NYL A;  1D0Z A;  1SF8 A;  4PJL A;  1CPR A;  3ZTZ A;  4BJ5 A;  1RKE A;  2VCA A;  4E18 A;  2R7Q A;  4BJ6 A;  4BPM A;  2OEV A;  4JUR I;  2IXM A;  2BE5 F;  3ZQY A;  5AGF A;  2LQG A;  4JJF A;  2QE9 A;  3CSK A;  3W2W A;  4PFP A;  5KYW A;  2R7R A;  1VK5 A;  2QUP A;  2OJE D;  3QZC A;  2GAQ A;  4DVY P;  4ULV A;  4W8P A;  4A4A A;  2NG1 A;  3DMD A;  1G8X A;  3GOD A;  3GM2 A;  4JEA A;  3AG1 C;  2X0C A;  1QKR A;  1U89 A;  1U0B B;  1ZHY A;  2XRH A;  3KH2 A;  4WAB A;  5CI8 A;  3IQT A;  2PX3 A;  5D92 A;  1E83 A;  2WVN A;  2KNH A;  4MVU A;  3SNH A;  1RKC A;  2IXO A;  2J9B A;  1VTM P;  1FNT c;  2NSG A;  3MYF A;  3UNG C;  3VRC A;  1TWC A;  3UR3 C;  4N06 A;  4EBB A;  1QQ3 A;  2IXN A;  3C8G B;  1M2V B;  3NYJ A;  1L3P A;  4O6Y A;  1NSG B;  5E33 A;  2H7V C;  4I1O B;  5T3T A;  3R7C A;  1D1B A;  3RKO F;  4CDA A;  4J30 B;  4U5G A;  4AL0 A;  3C62 A;  3F47 A;  1OQC A;  3JTL O;  5L0C A;  3U0C A;  4GQH A;  1HMD A;  4JCH A;  2M64 A;  2Q00 A;  1BZ4 A;  2OOC A;  3N2Z B;  3W8H A;  4ER9 A;  1OCR C;  3ATP A;  3SXK A;  1JAF A;  2HKV A;  3AG2 C;  3ZTM A;  1S7Z A;  1R5I D;  3LEV A;  4WGZ A;  1NBB A;  2R05 A;  1WWP A;  3PMR A;  2V3C C;  4BJT A;  1ZHT A;  1NZE A;  2GFH A;  5DLJ A;  3FOO A;  4C7O A;  2OQM A;  1TWH A;  3DAF A;  4I44 A;  2WZF A;  4YT8 A;  2YLG A;  3NKE A;  2R7T A;  2EPM X;  4MVZ A;  2PBE A;  4JE9 A;  5A6B D;  3C7J A;  2EIJ C;  1B68 A;  4YT5 A;  4CIP A;  1HE9 A;  3RQE A;  1YYJ A;  3M1C B;  1WAT A;  2WB7 A;  1ZZP A;  1T6U A;  1ST6 A;  4BEM J;  1QVX A;  1FFH A;  2CYD A;  2EPL X;  2XLW A;  4LER A;  2F22 A;  3K66 A;  4PR9 A;  3EZH A;  4U9E A;  4JZA A;  3DJN B;  1HY5 A;  4MVO A;  2A6H F;  4DXW A;  2XLO A;  4J32 B;  5BQI A;  1FR0 A;  1YA9 A;  4CDV A;  1CGO A;  2EIM C;  2Q7R A;  1Z63 A;  2TMV P;  4M63 A;  4Q4Z F;  3EQL F;  1G4U S;  2R7X A;  3ABK C;  4KC9 A;  4XPW A;  1Z7Q c;  1LPE A;  2KYH A;  2DGJ A;  4JVS A;  2HV7 A;  4IGG A;  1O3U A;  4U5H A;  4BG0 A;  1QSP A;  3SXY A;  2AU5 A;  5DVW A;  1M2O A;  1YAU O;  3GOR A;  1QPU A;  2XL8 A;  4C3E A;  3W2V A;  3WHN A;  1N1C A;  5B3S C;  3GEE A;  1LI5 A;  1EI7 A;  2XLE A;  3DE8 A;  4IAQ A;  4P9F A;  1L7C A;  4NTF A;  3S84 A;  4KBL A;  2ZD9 A;  4YT4 A;  3H2U A;  2XS8 A;  1JMW A;  3FAP B;  4RBN A;  2BC5 A;  2G62 A;  5JRA A;  4H54 A;  1WGW A;  3TOM A;  3QVZ A;  4LDK A;  1Q0M A;  3UMK A;  4BEJ A;  1MMN A;  3ABL C;  1NLX A;  2VAS A;  2FFH A;  1IZM A;  2J9U A;  5A69 A;  3E9V A;  5F5F A;  3RYL A;  1YYX A;  2A68 F;  5A6B A;  1Z23 A;  2VCC A;  3QTH A;  4YL0 A;  1BR4 A;  4MQ9 F;  3N0T A;  2KGO A;  5DS5 A;  2XLM A;  3RFY A;  2AP3 A;  5KYU B;  4ZLD A;  2YL3 A;  2L6G A;  2QLA A;  3GM3 A;  2J45 A;  4K1O A;  4U5E E;  5CIV A;  3B9Q A;  2BL2 A;  1RXQ A;  2IXP A;  4IAO A;  2WZG A;  5E2Q A;  4B6I A;  2VB6 A;  5KYX B;  1OCC C;  3U9M A;  4C3B A;  3SXM A;  3MBG A;  1S05 A;  4CIH A;  2XLD A;  3FXH A;  4CS9 C;  4UDV A;  3PDM P;  1M56 C;  5L0G A;  2C03 A;  3CEX A;  4U5B E;  1GGQ A;  3QVY A;  1KU2 A;  3M79 A;  1V54 C;  4MTG A;  4CSA A;  1H6G A;  1OCZ C;  1OXK A;  3F46 A;  3SEO A;  4PFO A;  1M57 C;  1FMW A;  2A0U A;  4XPX A;  3JSZ A;  4FX5 A;  2CW0 F;  1XWJ A;  1ZU5 A;  2L6H A;  4JCZ A;  4U9D A;  3EH1 A;  3WG7 C;  4YL3 A;  1LE4 A;  1OW6 A;  1VLS A;  3EGX B;  3ITF A;  3NMI A;  1D1A A;  3EFO B;  2PF4 E;  3M4B A;  256B A;  4JC7 A;  1W2W A;  3T6J A;  2XLV A;  5KYY B;  4Z9J A;  1C03 A;  3LAY A;  4G7Z F;  3V5Z A;  1I4Z A;  1H9T A;  3LUT B;  2G3K A;  4ONS A;  1TFK B;  1K05 A;  1F1M A;  5L0F A;  4HEA J;  3U9J A;  1HW2 A;  4K7B A;  1LS1 A;  3U3F A;  1MND A;  2G3V A;  3WAQ A;  3NKD A;  4N6C A;  3DAG A;  2ZXW C;  2QTV A;  3DD7 A;  4RD9 A;  3TQO A;  3AQC A;  3EPV A;  2Q9C A;  3DI5 A;  4Z9I A;  2E87 A;  1ZHZ A;  3GEI A;  4XEV A;  3TJ6 A;  5DS4 A;  3RF3 A;  5K0I A;  1Q0G A;  4DBR A;  4E7S A;  2W4M A;  5GPG B;  3NDB B;  3JYY A;  4O7G A;  2J0W A;  4PAC A;  2MHR A;  1YVI A;  1VOM A;  2DI3 A;  4I1M A;  1NFN A;  1ORY A;  1I5N A;  4AE4 A;  5DQZ A;  4YJW A;  3I5Q A;  3U8P A;  1C17 M;  1PD0 A;  4PJN A;  1E84 A;  2I15 A;  2NUT B;  3NYM A;  4KI2 A;  3EG9 A;  2J9V A;  3SYN A;  3AGU A;  2GDC A;  1EKY A;  1RKE B; 
#chains in the Genus database with same CATH homology
 1H9G A;  4P9F A;  3SXZ A;  1HW2 A;  1HW1 A;  2HS5 A;  3SXK A;  3C7J A;  2DI3 A;  1E2X A;  1H9T A;  3FMS A;  3SXY A;  3SXM A;  3IHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...