3SXMA

Metal-free fcd domain of tm0439 a putative transcriptional regulator
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
140
structure length
137
Chain Sequence
b'GAMDEKFIRETIETRIMMEVFCLENYFDKIAGSEELLEIKGEIDDVAAREIFDDSDERLHKLFIRASGNELIISLYEKIWDRIDLVRHLNERYVVSNREHKELIERIISGDKEGAIEKLKEHLKNVEAETIKNLYTY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, GntR family
publication title Metal-free FCD domain of TM0439 a putative transcriptional regulator
rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
total genus 59
structure length 137
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3sxmA00
1E2XA 3FMSA 1H9TA 2DI3A 3SXYA 1HW2A 3SXMA 2HS5A 3C7JA 3SXKA 3SXZA 4P9FA 3IHUA 1HW1A 1H9GA
chains in the Genus database with same CATH superfamily
1Z3IX 4PACA 5F5HA 2LFFA 1OW8A 2HSQA 2Y3GA 1Q0KA 5E2QA 5B3IA 4YWQA 1H6GA 4MVSA 4PJMA 4RD9A 1E85A 1YYJA 2J9UA 2IBFA 2VC9A 2Q9BA 3IPMO 2EINC 2L6GA 3UMKA 4CDVA 5EK0A 3GM3A 2Y3HA 4QI0A 4Z9HA 3C8GA 4I44A 5B1BC 3SYNA 2W45A 3RVYA 3T6JA 1A7DA 1VK5A 3K1IA 3C8GD 2Q9AA 1M2OA 2CDQA 1NSGB 3DZAA 4N06A 3NMKA 3HLZA 1R4TA 1BR2A 1ZW3A 1QLEC 1NU7D 2JD3A 3DE9A 1ZHYA 1ZU5A 3JRMO 3ZG1A 2R9RB 1EQ1A 4MVRA 3KMIA 1GS9A 4DVZA 2KK1A 3RFYA 2ZD9A 2J7PA 2Y69C 3QTHA 1HW1A 2L9JA 1D0ZA 1JPNA 5JVEA 4DBRA 2CNWA 2G62A 2BE5F 2V26A 2XL8A 2A6HF 3MYFA 2XSEA 1RCPA 3NYMA 4IJJA 5COGA 3R7CA 3DAGA 1BR4A 4CIHA 3TULA 1BR1A 2LSEA 2HSBA 4K1OA 3UNGC 3AG4C 2LFDA 2YEVA 4XEKA 3NKDA 4O6YA 1A0BA 1MNEA 3ECSA 3I5QA 5IY5C 4MTGA 3ZWIA 4JCZA 1Z23A 4IRUA 2J9VA 1E83A 2CW0F 4PFPA 4YK5A 3L8JA 4KNWA 1TR2A 5JP7A 1JPJA 3DM5A 3JTLO 3OWTA 2Y39A 1SYQA 2YL3A 3HKKA 3GODA 3H2VA 4LLCA 5GPGB 5BQIA 2XLDA 1WN0A 3U8PA 5L0HA 3AJMA 5E3AA 3U5SA 1C17M 4YL3A 1KTMA 1ORSC 2H7BA 3SEOA 2RSEB 2YHSA 1ZVZA 1LS4A 1WTYA 4OD4A 4B6IA 2LCHA 1WASA 3O55A 3JCUQ 2OCCC 1OW6A 2KW3C 1LPEA 2EIKC 4RDAA 4LDQA 5L0FA 1KNYA 4CJGA 4M63A 4DRIB 1FNTc 1LVKA 1ZHXA 2LK4A 1QPUA 2X51A 4BG0A 2MWQA 4YT2A 4U5CE 4WGZA 4FAPB 3PMRA 3E70C 2ZXRA 3AQCA 3EPVA 5HV9A 1VMAA 2WVNA 4PJJA 1XZPA 2Y3DA 4YL1A 2A0UA 4Q5SF 3V5XA 2NG1A 1LE2A 3M79A 1RKEB 1ZZPA 3US6A 4LERA 2YKZA 4PFOA 1A7VA 4NTBA 1YZAA 1TWHA 5E3CA 4EBKA 1RXQA 2YVKA 1NFOA 3MLGA 3LNRA 3RKOF 4L6RA 3S0XA 1G5ZA 3JYHA 1NLXA 2ZXOA 5DS4A 4BJ5C 3TOLA 3C63A 1A7EA 3LUTB 4HFFB 5CI8A 3U9JA 4AL0A 1QZXA 1JAFA 5FCLA 1XWJA 4CSAA 3Q6MA 1E84A 3GM2A 2A69F 1YDIA 2OKUA 2YZSA 2A68F 4MS2A 3N0TA 2PF4E 4ZLDA 3L8IA 1TFKB 5D91A 5EHHA 1O87A 1XZQA 2PX0A 3T4RA 4E0IA 4JZAA 1BDJB 2BL2A 4U5EE 4C7OA 1YLMA 1IW7F 2WVOA 2ZPAA 3IHUA 4IAOA 3CZ6A 3NYLA 4NTFA 3V5ZA 1DOWA 4DOZA 5A6KA 1T5OA 2NSGA 1PCXA 2GWWA 2WB7A 2FAPB 5DS6A 1H9GA 5A6BA 4MVQA 2RD9A 1HE9A 4GQHA 2OEXA 3B71A 1VTMP 5COFA 4MW3A 1U0BB 1ZU4A 1J8YF 2VCBA 1NBBA 3JT1A 5L0CA 2WZLA 1TWGA 2L7AA 3E9VA 5A6BD 4CX9A 3CAXA 2R7TA 1KU2A 3LAYA 4XTKA 3RH3A 3S28A 4FWVA 4W8KA 1Z6AA 1HE1A 4BJ6A 3W8IA 5HSWA 2NUTB 4MVOA 2ASRA 3HNIA 3ZQYA 3WG7C 2HJ3A 2KC3A 1M57C 3W8HA 4Z9IA 2HUJA 5L0GA 3ASNC 4FX5A 2XXAB 4G7OF 1J8MF 4JCHA 4D4XA 1M2VB 2MYSA 4E0HA 3NMIA 4EBBA 1FMWA 4EBJA 1RKCA 2J0WA 3RQEA 2I8BA 4YT5A 3GANA 2JX0A 2LIGA 1ZW2A 1Y4CA 4LLEA 3IEEA 3Q7GA 4JC7A 4YL0A 3K33A 3OA1A 5DLJA 3B0UX 2PP4A 1FFTC 3EG9A 3IQ5A 4XLNF 2QLAA 4JEAA 3O39A 3CEXA 2WL8A 3VM6A 2ETSA 5L0IA 2JPUA 3LS0A 4GEHA 4AE4B 3JSZA 3L34A 1O5HA 5CIVA 3R2PA 3G4XA 4ULVA 1VLSA 1LI5A 2HV6A 3FXHA 4O7GA 2QTVA 4BEMJ 2KGOA 4J7YA 3UMIA 3DXJF 5KYNA 2X0CA 3FHDA 3EH2A 2EPOA 1HY5A 4JTCB 4H4KC 2YLDA 3UR3C 4CDYA 1RJ9A 4IAQA 5DVWA 1C02A 2EPKX 5AC4A 5JS5A 1YARO 5COMA 3LEVA 4KNVA 2R03A 3AG2C 5AGFA 4Z9JA 3G4ZA 2HZ8A 5EGYA 5KYWB 3HNJA 3FOPA 1ZHTA 1ZHZA 4I1MA 2D4UA 4Q4ZF 1Z5ZA 1LM3B 1WATA 4NCQA 1QQ3A 3K1IC 2OOCA 3ITFA 2G3KA 3U3BA 3KH2A 2VH3A 5BUOA 1MNDA 3V5YA 5A69A 4NQFA 4FESA 4UDVA 3MX3A 4LDKA 2W9YA 3EFOB 1D0YA 2DI3A 3EHNA 4G0HA 3JYYA 4P6IC 3SXKA 2NUPB 2QNLA 3QVZA 3I5PA 2LQGA 2DYSC 1OR3A 3GEEA 4XEFA 3S29A 4AK9A 1Q0MA 1I4ZA 4LACB 3EGXB 5DQTA 3WAQA 3S90A 2WZGA 3F47A 3H65A 1CGME 1NG1A 4EIYA 4JIOA 1CPQA 5B3SC 1Z63A 2EIJC 2R02A 4JJGA 4CS9A 3RYLA 5F5FA 2XM0A 2R7QA 1WOLA 1FR0A 4MVUA 4E18A 1FFHA 1Q0DA 4QI2A 1YAUO 1D0XA 5KYYB 2F22A 2UUIA 1H7IA 4BJTA 4G7ZF 3TJ6A 1U6HA 2XS1A 3MYIA 3TQOA 2A0BA 4MVMA 4XPWA 4K7BA 3EGDB 1JR8A 3EH1A 1JRAA 1TKNA 4DBQA 2NUPA 4JE9A 4A4AA 1MMGA 4JTAB 4CDAA 2B0JA 3N2ZB 2H7OA 4N6HA 2VASA 3PCVA 1FAPB 5A6JA 1SMYF 3I4UA 4YN0B 3UMHA 3ZTMA 1GQAA 2XLHA 3AG1C 2AWCA 3UGPA 1M56C 3W2WA 4K0DA 1LIHA 1Q0GA 3JSEO 2IXPA 1V4AA 2IXOA 4I3MA 3J06A 1APCA 4KC9A 3SP1A 4U5GA 2XLEA 2EPMX 2VCCA 1PD1A 1K05A 2HV7A 2L6FA 2Q9CA 3IQTA 2HMZA 3DJNB 3GEIA 2DGJA 3KPHA 1VYKA 4IARA 1JMWA 1G4WR 4HEAJ 256BA 2OG2A 3K7DA 1QSPA 2J8WA 5L0DA 5BQHA 3PDMP 1MMAA 3X1OA 4OIQF 1LE4A 2AVKA 4PK4A 4E7SA 4XLPF 3SXYA 2R7SA 2IOQA 2MHRA 2R7OA 1PV3A 5F28E 4RBNA 1W2WA 2LP4A 5D92A 5FZTA 1OXBA 3VRCA 1HMOA 1TWAA 3O10A 1YA9A 2P6VA 2GA0A 4GYTA 4JURI 2J9BA 3QVYA 4PJNA 3ZVRA 4IB4A 2OJED 2BC5A 4I1OB 1RKEA 4P9TA 5KYXB 1T6UA 3MFNA 1N1CA 3T6BA 5TJ5E 4CSAC 4R32A 4D4NA 3ZQVA 4X0RA 4YT4A 2HS5A 1OCZC 3U0CA 3O6XA 3PHF2 3N24A 3RQFA 1I4YA 1OXKA 4MW8A 5BQGA 4J30B 3C18A 3GM1A 3DE8A 4XPYA 4XWJA 3G50A 5B1AC 3A11A 1O3UA 4BJ1A 2R05A 5L3QA 5T1DB 2D5RB 4ER9A 2H7VC 2V3CC 1WWPA 3U8VA 3NYJA 3AGUA 4Q7CA 2Q3TA 4MNDA 4OIRF 4YT8A 4U5FE 3K6BA 3ZDLA 2Q00A 3DAFA 2KQ9A 3A9CA 1OCRC 3FVYA 3RQGA 2O9XA 4XQ1A 2J45A 2PNOA 1OKKA 4F4BA 4WABA 2EPLX 3TD7A 2HFIA 1T9KA 2W4MA 4JRZA 3ZSUA 4DRJB 1VLTA 5KYUB 2J9WA 3RF3A 2OJQA 4BJ6C 3EZHA 1EA8A 1OKKD 2OEVA 2WVQA 4N6CA 1E86A 1MMDA 2IXMA 3LNMB 1ZHWA 3LS1A 3HNKA 4E7ZA 3C8GB 1B68A 3BEHA 2XS8A 3LJBA 3JRTA 1G8XA 1BZ4A 1C03A 4WGYA 3QMKA 2XL4A 3LEOA 4JVSA 3ZC4A 5A6AA 2NUTA 3B29A 3DMDA 2KYHA 2C04A 1SR2A 3CSKA 3FAPB 3ZIBA 1IZMA 5DQZA 4NC3A 1YVIA 2ICWG 1D1AA 4JJFA 2L6HA 1HW2A 2XXAA 3AQBA 3NG1A 4OIPF 4BPMA 3L0IA 1M2VA 4QDLA 3CQZA 1LI7A 1S7ZA 2IXNA 3TK0A 4CJOA 1NU9C 4G7HF 4U5BE 2H8AA 4OD5A 5KYUA 4CIPA 1L3PA 2B0HA 3W2VA 1OR2A 5L3VA 4G78A 3NKEA 1D1CA 2P0NA 3QW0A 1RMVA 4CS7A 2PFDA 4JW1A 1S05A 1T6QA 5DS5A 1Z7Qc 3M1CB 4PJLA 4U5DE 3V7OA 2EILC 4AE4A 1YA7O 1JOGA 3RW0A 4KI2A 2CYDA 2C03A 2R7XA 2FFHA 4EUKB 1ST6A 1V74B 2Y3BA 1HMDA 3AGTA 4IWBA 1I5NA 1R5ID 1NFNA 1ORJA 2R25A 4MVZA 1UFBA 3L1MA 3GWNA 3U9MA 1T01A 3ABKC 3EHMA 1Q0FA 1WGWA 3GWLA 3SZRA 4A2NB 1QKRA 3IQ6A 4EWCA 5KYWA 2R7UA 1AUEA 2J7PD 3TJ5A 2XLMA 5L0JA 5T3WA 3LESA 2CNWD 1CGNA 3B0PA 2M64A 4KBLA 2AWYA 2UUHA 3H2UA 3LLKA 3ABLC 4JKVA 3U2LA 3X2QC 2YL7A 4C3EA 3K1HA 4MQ9F 2KNHA 2P61A 2XLVA 2YL0A 3EFOA 3U2MA 1GM5A 2YQYA 3SXZA 1L7CA 3ATPA 3WHNA 3B9QA 4CS9C 1M6TA 2AP3A 3C62A 4EHPA 2ZXWC 1E2XA 2PX3A 3WODF 2HJMA 5JT4A 2QY9A 5CI9A 2OQMA 1PD0A 2XL6A 3EGXA 1K40A 3SNHA 1LS1A 1U89A 3ABMC 3BRJA 1VOMA 1K04A 2HKVA 3MBGA 2GAQA 2XLOA 1VB5A 2Q7RA 4C3DA 4DRHB 4EKWA 1TWCA 4PR9A 5T3TA 3TOMA 2LD6A 2R7RA 3Q6NA 1AVOB 4OINF 1H9TA 2VCAA 4W8PA 1YJGA 2M4EA 3DI5A 5KYYA 3EJNA 2R7VA 5JRAA 1TFOB 2NPUA 2WZFA 3T6GB 3Q7LA 4J7TA 3HTKC 4O6MA 4BJ5A 4BEJA 2OU6A 3EGDA 3HNLA 4YJWA 4C7OB 1GGQA 1UG7A 4CS8A 1DOVA 3EZIA 4N4WA 4U9EA 3DJUB 2YRFA 1V55C 2DB4A 4XEVA 4AL1A 1OQCA 3KKBA 4ONSA 2KJGA 4ZLCA 5JUAA 4MTFA 4XPXA 4MTOA 4E17A 4O79A 1SZIA 1EI7A 2VB6A 3DM9B 3GEHA 1MMNA 3IQCA 3RIPA 3S9OA 1CPRA 3S84A 2EIMC 3DKAA 4JTDB 3M15A 2XM4A 4H54A 3U3FA 2CCYA 2IYLD 4O6NA 2DYRC 4P9FA 1TQGA 5JLIA 1FTSA 4CS8C 2I15A 1SF8A 2W4BA 1A41A 1CGOA 3UGOA 3C7JA 3POVA 3VF0A 1OCCC 3AOUA 2J46A 4HE8D 2HMQA 4OIOF 1D1BA 1ORYA 3FOOA 3QW1A 2IM8A 2A6EF 3VYWA 3ZTZA 3ASOC 3NRHA 3S27A 3VAYA 4HFKB 3DWWA 4ULWA 1V54C 3W4YA 3KL4A 2P7VA 4C3BA 2ZXPA 4DXWA 5K0IA 1EKYA 2GDCA 2QUPA 2TMVP 4DVYP 1YYXA 2J0XA 3C8ZA 2XLWA 4DJ9A 3NDBB 1LKXA 3DD7A 4U5HA 4NTAA 5KYXA 1F1MA 4CBEA 2EPNA 2Z15A 2YWAA 1BBHA 3M4BA 5E33A 3M4CA 2CGEA 2R7WA 1OCOC 2E87A 2GFHA 3EG9B 4J32B 2QE9A 5JSLA 3OEOA 4ANJA 2P1AA 5AC5A 3FMSA 4JEBA 3LLIA 1FMVA 4U9DA 3SXMA 1T6IA 3KYJA 3FAJA 1MQVA 1ZYRF 2NSFA 4WJ0A 3RVZA 2XRHA 1Y6DA 4LDRA 2PBEA 3KYIA 1NZEA 4NY3A 2FGYA 2KSFA 3QZCA 3FDQA 2A1DD 1QVXA 3F46A 3B0VC 1OW7A 3T9OA 1AEPA 2G3VA 3GORA 1G4US 2AU5A 2L81A 1RJ9B 2Q4FA 3HJCA 3EQLF 3K66A 3JZ0A 4IGGA 4AX2A 2YLGA 3AG3C 1VYIA 2YL1A 1YZCA 3NMJA 2YLIA
chains in the Genus database with same CATH topology
1E2XA 3FMSA 1H9TA 2DI3A 3SXYA 1HW2A 3SXMA 2HS5A 3C7JA 3SXKA 3SXZA 4P9FA 3IHUA 1HW1A 1H9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2X A;  3FMS A;  1H9T A;  2DI3 A;  3SXY A;  1HW2 A;  3SXM A;  2HS5 A;  3C7J A;  3SXK A;  3SXZ A;  4P9F A;  3IHU A;  1HW1 A;  1H9G A; 
#chains in the Genus database with same CATH topology
 1Z3I X;  4PAC A;  5F5H A;  2LFF A;  1OW8 A;  2HSQ A;  2Y3G A;  1Q0K A;  5E2Q A;  5B3I A;  4YWQ A;  1H6G A;  4MVS A;  4PJM A;  4RD9 A;  1E85 A;  1YYJ A;  2J9U A;  2IBF A;  2VC9 A;  2Q9B A;  3IPM O;  2EIN C;  2L6G A;  3UMK A;  4CDV A;  5EK0 A;  3GM3 A;  2Y3H A;  4QI0 A;  4Z9H A;  3C8G A;  4I44 A;  5B1B C;  3SYN A;  2W45 A;  3RVY A;  3T6J A;  1A7D A;  1VK5 A;  3K1I A;  3C8G D;  2Q9A A;  1M2O A;  2CDQ A;  1NSG B;  3DZA A;  4N06 A;  3NMK A;  3HLZ A;  1R4T A;  1BR2 A;  1ZW3 A;  1QLE C;  1NU7 D;  2JD3 A;  3DE9 A;  1ZHY A;  1ZU5 A;  3JRM O;  3ZG1 A;  2R9R B;  1EQ1 A;  4MVR A;  3KMI A;  1GS9 A;  4DVZ A;  2KK1 A;  3RFY A;  2ZD9 A;  2J7P A;  2Y69 C;  3QTH A;  1HW1 A;  2L9J A;  1D0Z A;  1JPN A;  5JVE A;  4DBR A;  2CNW A;  2G62 A;  2BE5 F;  2V26 A;  2XL8 A;  2A6H F;  3MYF A;  2XSE A;  1RCP A;  3NYM A;  4IJJ A;  5COG A;  3R7C A;  3DAG A;  1BR4 A;  4CIH A;  3TUL A;  1BR1 A;  2LSE A;  2HSB A;  4K1O A;  3UNG C;  3AG4 C;  2LFD A;  2YEV A;  4XEK A;  3NKD A;  4O6Y A;  1A0B A;  1MNE A;  3ECS A;  3I5Q A;  5IY5 C;  4MTG A;  3ZWI A;  4JCZ A;  1Z23 A;  4IRU A;  2J9V A;  1E83 A;  2CW0 F;  4PFP A;  4YK5 A;  3L8J A;  4KNW A;  1TR2 A;  5JP7 A;  1JPJ A;  3DM5 A;  3JTL O;  3OWT A;  2Y39 A;  1SYQ A;  2YL3 A;  3HKK A;  3GOD A;  3H2V A;  4LLC A;  5GPG B;  5BQI A;  2XLD A;  1WN0 A;  3U8P A;  5L0H A;  3AJM A;  5E3A A;  3U5S A;  1C17 M;  4YL3 A;  1KTM A;  1ORS C;  2H7B A;  3SEO A;  2RSE B;  2YHS A;  1ZVZ A;  1LS4 A;  1WTY A;  4OD4 A;  4B6I A;  2LCH A;  1WAS A;  3O55 A;  3JCU Q;  2OCC C;  1OW6 A;  2KW3 C;  1LPE A;  2EIK C;  4RDA A;  4LDQ A;  5L0F A;  1KNY A;  4CJG A;  4M63 A;  4DRI B;  1FNT c;  1LVK A;  1ZHX A;  2LK4 A;  1QPU A;  2X51 A;  4BG0 A;  2MWQ A;  4YT2 A;  4U5C E;  4WGZ A;  4FAP B;  3PMR A;  3E70 C;  2ZXR A;  3AQC A;  3EPV A;  5HV9 A;  1VMA A;  2WVN A;  4PJJ A;  1XZP A;  2Y3D A;  4YL1 A;  2A0U A;  4Q5S F;  3V5X A;  2NG1 A;  1LE2 A;  3M79 A;  1RKE B;  1ZZP A;  3US6 A;  4LER A;  2YKZ A;  4PFO A;  1A7V A;  4NTB A;  1YZA A;  1TWH A;  5E3C A;  4EBK A;  1RXQ A;  2YVK A;  1NFO A;  3MLG A;  3LNR A;  3RKO F;  4L6R A;  3S0X A;  1G5Z A;  3JYH A;  1NLX A;  2ZXO A;  5DS4 A;  4BJ5 C;  3TOL A;  3C63 A;  1A7E A;  3LUT B;  4HFF B;  5CI8 A;  3U9J A;  4AL0 A;  1QZX A;  1JAF A;  5FCL A;  1XWJ A;  4CSA A;  3Q6M A;  1E84 A;  3GM2 A;  2A69 F;  1YDI A;  2OKU A;  2YZS A;  2A68 F;  4MS2 A;  3N0T A;  2PF4 E;  4ZLD A;  3L8I A;  1TFK B;  5D91 A;  5EHH A;  1O87 A;  1XZQ A;  2PX0 A;  3T4R A;  4E0I A;  4JZA A;  1BDJ B;  2BL2 A;  4U5E E;  4C7O A;  1YLM A;  1IW7 F;  2WVO A;  2ZPA A;  3IHU A;  4IAO A;  3CZ6 A;  3NYL A;  4NTF A;  3V5Z A;  1DOW A;  4DOZ A;  5A6K A;  1T5O A;  2NSG A;  1PCX A;  2GWW A;  2WB7 A;  2FAP B;  5DS6 A;  1H9G A;  5A6B A;  4MVQ A;  2RD9 A;  1HE9 A;  4GQH A;  2OEX A;  3B71 A;  1VTM P;  5COF A;  4MW3 A;  1U0B B;  1ZU4 A;  1J8Y F;  2VCB A;  1NBB A;  3JT1 A;  5L0C A;  2WZL A;  1TWG A;  2L7A A;  3E9V A;  5A6B D;  4CX9 A;  3CAX A;  2R7T A;  1KU2 A;  3LAY A;  4XTK A;  3RH3 A;  3S28 A;  4FWV A;  4W8K A;  1Z6A A;  1HE1 A;  4BJ6 A;  3W8I A;  5HSW A;  2NUT B;  4MVO A;  2ASR A;  3HNI A;  3ZQY A;  3WG7 C;  2HJ3 A;  2KC3 A;  1M57 C;  3W8H A;  4Z9I A;  2HUJ A;  5L0G A;  3ASN C;  4FX5 A;  2XXA B;  4G7O F;  1J8M F;  4JCH A;  4D4X A;  1M2V B;  2MYS A;  4E0H A;  3NMI A;  4EBB A;  1FMW A;  4EBJ A;  1RKC A;  2J0W A;  3RQE A;  2I8B A;  4YT5 A;  3GAN A;  2JX0 A;  2LIG A;  1ZW2 A;  1Y4C A;  4LLE A;  3IEE A;  3Q7G A;  4JC7 A;  4YL0 A;  3K33 A;  3OA1 A;  5DLJ A;  3B0U X;  2PP4 A;  1FFT C;  3EG9 A;  3IQ5 A;  4XLN F;  2QLA A;  4JEA A;  3O39 A;  3CEX A;  2WL8 A;  3VM6 A;  2ETS A;  5L0I A;  2JPU A;  3LS0 A;  4GEH A;  4AE4 B;  3JSZ A;  3L34 A;  1O5H A;  5CIV A;  3R2P A;  3G4X A;  4ULV A;  1VLS A;  1LI5 A;  2HV6 A;  3FXH A;  4O7G A;  2QTV A;  4BEM J;  2KGO A;  4J7Y A;  3UMI A;  3DXJ F;  5KYN A;  2X0C A;  3FHD A;  3EH2 A;  2EPO A;  1HY5 A;  4JTC B;  4H4K C;  2YLD A;  3UR3 C;  4CDY A;  1RJ9 A;  4IAQ A;  5DVW A;  1C02 A;  2EPK X;  5AC4 A;  5JS5 A;  1YAR O;  5COM A;  3LEV A;  4KNV A;  2R03 A;  3AG2 C;  5AGF A;  4Z9J A;  3G4Z A;  2HZ8 A;  5EGY A;  5KYW B;  3HNJ A;  3FOP A;  1ZHT A;  1ZHZ A;  4I1M A;  2D4U A;  4Q4Z F;  1Z5Z A;  1LM3 B;  1WAT A;  4NCQ A;  1QQ3 A;  3K1I C;  2OOC A;  3ITF A;  2G3K A;  3U3B A;  3KH2 A;  2VH3 A;  5BUO A;  1MND A;  3V5Y A;  5A69 A;  4NQF A;  4FES A;  4UDV A;  3MX3 A;  4LDK A;  2W9Y A;  3EFO B;  1D0Y A;  2DI3 A;  3EHN A;  4G0H A;  3JYY A;  4P6I C;  3SXK A;  2NUP B;  2QNL A;  3QVZ A;  3I5P A;  2LQG A;  2DYS C;  1OR3 A;  3GEE A;  4XEF A;  3S29 A;  4AK9 A;  1Q0M A;  1I4Z A;  4LAC B;  3EGX B;  5DQT A;  3WAQ A;  3S90 A;  2WZG A;  3F47 A;  3H65 A;  1CGM E;  1NG1 A;  4EIY A;  4JIO A;  1CPQ A;  5B3S C;  1Z63 A;  2EIJ C;  2R02 A;  4JJG A;  4CS9 A;  3RYL A;  5F5F A;  2XM0 A;  2R7Q A;  1WOL A;  1FR0 A;  4MVU A;  4E18 A;  1FFH A;  1Q0D A;  4QI2 A;  1YAU O;  1D0X A;  5KYY B;  2F22 A;  2UUI A;  1H7I A;  4BJT A;  4G7Z F;  3TJ6 A;  1U6H A;  2XS1 A;  3MYI A;  3TQO A;  2A0B A;  4MVM A;  4XPW A;  4K7B A;  3EGD B;  1JR8 A;  3EH1 A;  1JRA A;  1TKN A;  4DBQ A;  2NUP A;  4JE9 A;  4A4A A;  1MMG A;  4JTA B;  4CDA A;  2B0J A;  3N2Z B;  2H7O A;  4N6H A;  2VAS A;  3PCV A;  1FAP B;  5A6J A;  1SMY F;  3I4U A;  4YN0 B;  3UMH A;  3ZTM A;  1GQA A;  2XLH A;  3AG1 C;  2AWC A;  3UGP A;  1M56 C;  3W2W A;  4K0D A;  1LIH A;  1Q0G A;  3JSE O;  2IXP A;  1V4A A;  2IXO A;  4I3M A;  3J06 A;  1APC A;  4KC9 A;  3SP1 A;  4U5G A;  2XLE A;  2EPM X;  2VCC A;  1PD1 A;  1K05 A;  2HV7 A;  2L6F A;  2Q9C A;  3IQT A;  2HMZ A;  3DJN B;  3GEI A;  2DGJ A;  3KPH A;  1VYK A;  4IAR A;  1JMW A;  1G4W R;  4HEA J;  256B A;  2OG2 A;  3K7D A;  1QSP A;  2J8W A;  5L0D A;  5BQH A;  3PDM P;  1MMA A;  3X1O A;  4OIQ F;  1LE4 A;  2AVK A;  4PK4 A;  4E7S A;  4XLP F;  3SXY A;  2R7S A;  2IOQ A;  2MHR A;  2R7O A;  1PV3 A;  5F28 E;  4RBN A;  1W2W A;  2LP4 A;  5D92 A;  5FZT A;  1OXB A;  3VRC A;  1HMO A;  1TWA A;  3O10 A;  1YA9 A;  2P6V A;  2GA0 A;  4GYT A;  4JUR I;  2J9B A;  3QVY A;  4PJN A;  3ZVR A;  4IB4 A;  2OJE D;  2BC5 A;  4I1O B;  1RKE A;  4P9T A;  5KYX B;  1T6U A;  3MFN A;  1N1C A;  3T6B A;  5TJ5 E;  4CSA C;  4R32 A;  4D4N A;  3ZQV A;  4X0R A;  4YT4 A;  2HS5 A;  1OCZ C;  3U0C A;  3O6X A;  3PHF 2;  3N24 A;  3RQF A;  1I4Y A;  1OXK A;  4MW8 A;  5BQG A;  4J30 B;  3C18 A;  3GM1 A;  3DE8 A;  4XPY A;  4XWJ A;  3G50 A;  5B1A C;  3A11 A;  1O3U A;  4BJ1 A;  2R05 A;  5L3Q A;  5T1D B;  2D5R B;  4ER9 A;  2H7V C;  2V3C C;  1WWP A;  3U8V A;  3NYJ A;  3AGU A;  4Q7C A;  2Q3T A;  4MND A;  4OIR F;  4YT8 A;  4U5F E;  3K6B A;  3ZDL A;  2Q00 A;  3DAF A;  2KQ9 A;  3A9C A;  1OCR C;  3FVY A;  3RQG A;  2O9X A;  4XQ1 A;  2J45 A;  2PNO A;  1OKK A;  4F4B A;  4WAB A;  2EPL X;  3TD7 A;  2HFI A;  1T9K A;  2W4M A;  4JRZ A;  3ZSU A;  4DRJ B;  1VLT A;  5KYU B;  2J9W A;  3RF3 A;  2OJQ A;  4BJ6 C;  3EZH A;  1EA8 A;  1OKK D;  2OEV A;  2WVQ A;  4N6C A;  1E86 A;  1MMD A;  2IXM A;  3LNM B;  1ZHW A;  3LS1 A;  3HNK A;  4E7Z A;  3C8G B;  1B68 A;  3BEH A;  2XS8 A;  3LJB A;  3JRT A;  1G8X A;  1BZ4 A;  1C03 A;  4WGY A;  3QMK A;  2XL4 A;  3LEO A;  4JVS A;  3ZC4 A;  5A6A A;  2NUT A;  3B29 A;  3DMD A;  2KYH A;  2C04 A;  1SR2 A;  3CSK A;  3FAP B;  3ZIB A;  1IZM A;  5DQZ A;  4NC3 A;  1YVI A;  2ICW G;  1D1A A;  4JJF A;  2L6H A;  1HW2 A;  2XXA A;  3AQB A;  3NG1 A;  4OIP F;  4BPM A;  3L0I A;  1M2V A;  4QDL A;  3CQZ A;  1LI7 A;  1S7Z A;  2IXN A;  3TK0 A;  4CJO A;  1NU9 C;  4G7H F;  4U5B E;  2H8A A;  4OD5 A;  5KYU A;  4CIP A;  1L3P A;  2B0H A;  3W2V A;  1OR2 A;  5L3V A;  4G78 A;  3NKE A;  1D1C A;  2P0N A;  3QW0 A;  1RMV A;  4CS7 A;  2PFD A;  4JW1 A;  1S05 A;  1T6Q A;  5DS5 A;  1Z7Q c;  3M1C B;  4PJL A;  4U5D E;  3V7O A;  2EIL C;  4AE4 A;  1YA7 O;  1JOG A;  3RW0 A;  4KI2 A;  2CYD A;  2C03 A;  2R7X A;  2FFH A;  4EUK B;  1ST6 A;  1V74 B;  2Y3B A;  1HMD A;  3AGT A;  4IWB A;  1I5N A;  1R5I D;  1NFN A;  1ORJ A;  2R25 A;  4MVZ A;  1UFB A;  3L1M A;  3GWN A;  3U9M A;  1T01 A;  3ABK C;  3EHM A;  1Q0F A;  1WGW A;  3GWL A;  3SZR A;  4A2N B;  1QKR A;  3IQ6 A;  4EWC A;  5KYW A;  2R7U A;  1AUE A;  2J7P D;  3TJ5 A;  2XLM A;  5L0J A;  5T3W A;  3LES A;  2CNW D;  1CGN A;  3B0P A;  2M64 A;  4KBL A;  2AWY A;  2UUH A;  3H2U A;  3LLK A;  3ABL C;  4JKV A;  3U2L A;  3X2Q C;  2YL7 A;  4C3E A;  3K1H A;  4MQ9 F;  2KNH A;  2P61 A;  2XLV A;  2YL0 A;  3EFO A;  3U2M A;  1GM5 A;  2YQY A;  3SXZ A;  1L7C A;  3ATP A;  3WHN A;  3B9Q A;  4CS9 C;  1M6T A;  2AP3 A;  3C62 A;  4EHP A;  2ZXW C;  1E2X A;  2PX3 A;  3WOD F;  2HJM A;  5JT4 A;  2QY9 A;  5CI9 A;  2OQM A;  1PD0 A;  2XL6 A;  3EGX A;  1K40 A;  3SNH A;  1LS1 A;  1U89 A;  3ABM C;  3BRJ A;  1VOM A;  1K04 A;  2HKV A;  3MBG A;  2GAQ A;  2XLO A;  1VB5 A;  2Q7R A;  4C3D A;  4DRH B;  4EKW A;  1TWC A;  4PR9 A;  5T3T A;  3TOM A;  2LD6 A;  2R7R A;  3Q6N A;  1AVO B;  4OIN F;  1H9T A;  2VCA A;  4W8P A;  1YJG A;  2M4E A;  3DI5 A;  5KYY A;  3EJN A;  2R7V A;  5JRA A;  1TFO B;  2NPU A;  2WZF A;  3T6G B;  3Q7L A;  4J7T A;  3HTK C;  4O6M A;  4BJ5 A;  4BEJ A;  2OU6 A;  3EGD A;  3HNL A;  4YJW A;  4C7O B;  1GGQ A;  1UG7 A;  4CS8 A;  1DOV A;  3EZI A;  4N4W A;  4U9E A;  3DJU B;  2YRF A;  1V55 C;  2DB4 A;  4XEV A;  4AL1 A;  1OQC A;  3KKB A;  4ONS A;  2KJG A;  4ZLC A;  5JUA A;  4MTF A;  4XPX A;  4MTO A;  4E17 A;  4O79 A;  1SZI A;  1EI7 A;  2VB6 A;  3DM9 B;  3GEH A;  1MMN A;  3IQC A;  3RIP A;  3S9O A;  1CPR A;  3S84 A;  2EIM C;  3DKA A;  4JTD B;  3M15 A;  2XM4 A;  4H54 A;  3U3F A;  2CCY A;  2IYL D;  4O6N A;  2DYR C;  4P9F A;  1TQG A;  5JLI A;  1FTS A;  4CS8 C;  2I15 A;  1SF8 A;  2W4B A;  1A41 A;  1CGO A;  3UGO A;  3C7J A;  3POV A;  3VF0 A;  1OCC C;  3AOU A;  2J46 A;  4HE8 D;  2HMQ A;  4OIO F;  1D1B A;  1ORY A;  3FOO A;  3QW1 A;  2IM8 A;  2A6E F;  3VYW A;  3ZTZ A;  3ASO C;  3NRH A;  3S27 A;  3VAY A;  4HFK B;  3DWW A;  4ULW A;  1V54 C;  3W4Y A;  3KL4 A;  2P7V A;  4C3B A;  2ZXP A;  4DXW A;  5K0I A;  1EKY A;  2GDC A;  2QUP A;  2TMV P;  4DVY P;  1YYX A;  2J0X A;  3C8Z A;  2XLW A;  4DJ9 A;  3NDB B;  1LKX A;  3DD7 A;  4U5H A;  4NTA A;  5KYX A;  1F1M A;  4CBE A;  2EPN A;  2Z15 A;  2YWA A;  1BBH A;  3M4B A;  5E33 A;  3M4C A;  2CGE A;  2R7W A;  1OCO C;  2E87 A;  2GFH A;  3EG9 B;  4J32 B;  2QE9 A;  5JSL A;  3OEO A;  4ANJ A;  2P1A A;  5AC5 A;  3FMS A;  4JEB A;  3LLI A;  1FMV A;  4U9D A;  3SXM A;  1T6I A;  3KYJ A;  3FAJ A;  1MQV A;  1ZYR F;  2NSF A;  4WJ0 A;  3RVZ A;  2XRH A;  1Y6D A;  4LDR A;  2PBE A;  3KYI A;  1NZE A;  4NY3 A;  2FGY A;  2KSF A;  3QZC A;  3FDQ A;  2A1D D;  1QVX A;  3F46 A;  3B0V C;  1OW7 A;  3T9O A;  1AEP A;  2G3V A;  3GOR A;  1G4U S;  2AU5 A;  2L81 A;  1RJ9 B;  2Q4F A;  3HJC A;  3EQL F;  3K66 A;  3JZ0 A;  4IGG A;  4AX2 A;  2YLG A;  3AG3 C;  1VYI A;  2YL1 A;  1YZC A;  3NMJ A;  2YLI A; 
#chains in the Genus database with same CATH homology
 1E2X A;  3FMS A;  1H9T A;  2DI3 A;  3SXY A;  1HW2 A;  3SXM A;  2HS5 A;  3C7J A;  3SXK A;  3SXZ A;  4P9F A;  3IHU A;  1HW1 A;  1H9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...