2G3KA

Crystal structure of the c-terminal domain of vps28
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
94
structure length
94
Chain Sequence
FNAKYVAEATGNFITVMDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVRINKLSIGDTLTETQIRELLFDLELAYKSFYALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Vacuolar protein sorting-associated protein VPS28
publication title The crystal structure of the C-terminal domain of Vps28 reveals a conserved surface required for Vps20 recruitment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 34
structure length 94
sequence length 94
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2006-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1130 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2g3kA00
2J9WA 2J9VA 2J9UA 2G3KA
chains in the Genus database with same CATH superfamily
3ZIBA 3GM2A 2J9WA 3U2LA 4HFKB 1L7CA 1BZ4A 1R5ID 2HSQA 3DJUB 2HJ3A 3LESA 4LDKA 4JKVA 4MVMA 4U5EE 2LIGA 3GEHA 1YDIA 2KC3A 1NZEA 4JTCB 2XXAB 3B9QA 4GQHA 4PJLA 3M1CB 3ZQVA 4QI2A 1UFBA 2Y3BA 4ONSA 1SYQA 3BRJA 4JJFA 2I15A 1MMGA 1QLEC 4HEAJ 3SXMA 3U8PA 3NMJA 1H6GA 4CJOA 1YAUO 2R03A 3FOPA 4GYTA 5JS5A 3ATPA 3UMIA 2DGJA 2CDQA 1J8YF 2P0NA 3ZVRA 2EPKX 4I1MA 3LJBA 4A2NB 4DVZA 4N06A 3RVYA 1ZU5A 1D0XA 1LE2A 2LSEA 4O6YA 2KNHA 4BPMA 3ZSUA 3B0VC 3DMDA 3EFOB 1HY5A 1ST6A 3UMHA 3S28A 2G62A 4PFPA 2HSBA 1T9KA 1OR3A 4U5DE 3DAGA 3VF0A 2Q9CA 1ZHYA 4NCQA 2P6VA 2QNLA 3QW0A 3R7CA 1OXBA 5JT4A 2LQGA 4OD5A 5JLIA 3NKEA 4LLEA 3SYNA 3TJ5A 2GFHA 1BR1A 1VB5A 2YWAA 2CNWA 1SMYF 3L1MA 5JP7A 2IXPA 2KW3C 2HUJA 1HE1A 1KU2A 1A7DA 4MVZA 5COMA 4JJGA 4CDYA 2VH3A 4J7TA 2A6HF 1ORJA 2WB7A 2R7UA 3C18A 3W8HA 1M2VA 5D92A 1QPUA 4PJMA 1JPJA 3WAQA 4I1OB 3DE8A 3HNIA 3LNRA 4NQFA 4ULWA 3SXKA 4BJ6A 4KI2A 5A69A 2I8BA 1PD0A 4IB4A 4JIOA 3NYJA 256BA 1ORYA 3PCVA 1FR0A 3IQCA 1V4AA 1OKKD 1QSPA 3RIPA 5L0FA 1LS1A 3C8GA 1VMAA 4CDAA 3K7DA 4YT4A 1ZHXA 1BBHA 3B0PA 2UUHA 2OCCC 3EGDB 4WGZA 2LP4A 2KK1A 3MX3A 1T6IA 3OWTA 2OKUA 4MTGA 4ZLCA 1JPNA 2EPMX 2XLWA 2Y3GA 3SXYA 3MFNA 2TMVP 4CS9C 2PP4A 2J0XA 3LS0A 1JOGA 2J0WA 2L6HA 3F46A 5T3WA 4YT2A 3QTHA 4R32A 3LUTB 5DS5A 2VB6A 1WN0A 1O3UA 2P61A 4MVUA 4IWBA 4LERA 3ZQYA 3DZAA 1D1BA 4FESA 4NC3A 2YVKA 3CZ6A 4JCHA 3T4RA 4D4XA 2RSEB 1NU9C 1JAFA 4MTOA 4OINF 1MMAA 4OD4A 2NUPA 5DS4A 2J8WA 4I3MA 5BUOA 4U9EA 2ZD9A 2XL6A 1BDJB 1ZHZA 4KNWA 2H7VC 4U5FE 1H9TA 2AWCA 3E9VA 4B6IA 1YVIA 4O7GA 2J7PD 2XM4A 4L6RA 4LLCA 4MW3A 4XLNF 4BJ5A 1Z63A 4XPXA 1Z5ZA 4H54A 4YN0B 4EBKA 4CIPA 3N2ZB 2HMQA 1CGNA 1XZPA 3M4BA 5JVEA 1YA9A 5HSWA 1RMVA 1OW8A 4C3EA 4DRHB 4G7HF 2OJED 5FZTA 2Y39A 2NG1A 3NRHA 3H65A 1WTYA 3ABMC 3ABKC 1Q0GA 3JSEO 1K40A 2YHSA 5E3AA 3B0UX 2XXAA 1TWCA 3S90A 4XPWA 1FAPB 3T6JA 1OR2A 2WVQA 3PHF2 3FMSA 2Z15A 3I4UA 3B71A 2ETSA 5FCLA 2IYLD 1OCCC 5GPGB 4CSAA 1LIHA 1B68A 3HKKA 3K33A 4XEKA 5DVWA 1NG1A 5A6BD 2UUIA 2XLVA 3H2VA 5COFA 1OW7A 3L0IA 3PMRA 1ZVZA 4YL3A 4XTKA 2BL2A 5B3SC 2ICWG 3DI5A 4XQ1A 4DXWA 3U0CA 3EQLF 3ZG1A 3EGXB 3KYJA 1YZAA 3VYWA 3G50A 1PD1A 3NMIA 4MTFA 1E2XA 4E7SA 1TFKB 2X51A 1ZW2A 4E17A 3NYMA 1OCZC 3RH3A 3V7OA 1FMWA 1LVKA 4RDAA 4JTAB 2ZXWC 1O5HA 3U2MA 2R9RB 3AQCA 1S7ZA 4AE4A 1H9GA 3UR3C 1BR4A 1W2WA 2L81A 2XRHA 2CCYA 3FAPB 4JCZA 4N6CA 5T3TA 3W8IA 2R7OA 4ANJA 2V3CC 2CNWD 1ZU4A 3GWLA 1EQ1A 4DBRA 3DKAA 3AGTA 3DM5A 1HE9A 1NFOA 3RQFA 1A41A 1V55C 2WVNA 2ZXRA 2M4EA 3Q7LA 2CYDA 3C8ZA 1FTSA 1TKNA 2H7BA 4JTDB 4KC9A 4EHPA 2R7SA 4MQ9F 2H8AA 4YL1A 2MYSA 2ZXOA 4JURI 2B0HA 3ASNC 1ORSC 1T5OA 2IXOA 2PX3A 3C8GD 1Q0KA 3DWWA 4K0DA 2R7RA 1PV3A 1LS4A 1RCPA 2FGYA 3C62A 3EZIA 3W4YA 3W2VA 1TQGA 2E87A 2V26A 3GORA 4CSAC 4MVRA 3WODF 3ZTMA 2Q4FA 4BJ1A 2A69F 2IXMA 4P6IC 4CIHA 2GWWA 2LD6A 3DE9A 1QZXA 2XLOA 2P1AA 4Z9HA 3UNGC 4M63A 5KYWB 2A0UA 3NG1A 2OJQA 1RXQA 2HV7A 2XS1A 3TK0A 4CS9A 5T1DB 5A6BA 2XL4A 4DRIB 2PX0A 4Z9IA 1TWAA 2QTVA 2XLEA 1VOMA 3EG9B 3Q7GA 3FOOA 4IJJA 3JYHA 1R4TA 5IY5C 1RKEB 3ZWIA 3E70C 3S0XA 1A0BA 1D0ZA 1RJ9A 2YZSA 2C03A 1VTMP 2QLAA 2OG2A 1WOLA 2OEXA 2VCAA 4CDVA 4C3BA 3DM9B 2OQMA 3O6XA 4HE8D 4EUKB 4Q5SF 3SEOA 3KL4A 3GANA 3Q6MA 2Q00A 1OW6A 2EIJC 1M57C 2IM8A 5L0GA 2VC9A 3V5YA 3UGOA 2AWYA 3OEOA 4O79A 3U8VA 3EHMA 1D1CA 2HS5A 3SXZA 1YZCA 5BQGA 5JSLA 1NFNA 4NTBA 3RF3A 5AC4A 4W8PA 1CPQA 1BR2A 1G4US 1YYJA 4PJNA 5HV9A 3HLZA 3LEVA 2L7AA 2L9JA 1TFOB 4U5BE 2J9VA 2EPOA 1WATA 1YYXA 3CEXA 1C17M 5JRAA 1CPRA 2XLDA 1VLTA 3GEEA 4G0HA 3ZTZA 2M64A 2YKZA 3ASOC 5A6AA 2LCHA 3U9MA 3M4CA 1LM3B 4MVQA 1SF8A 2RD9A 3QVZA 1MMDA 3A9CA 3FVYA 1DOWA 5E2QA 4K7BA 4PACA 3HJCA 3L8JA 3LLIA 2W45A 4E7ZA 4XLPF 2ZXPA 5E3CA 4CJGA 3AOUA 2R25A 4PR9A 3EH2A 3VM6A 3IQ6A 1VYIA 1HMDA 2R7QA 2XSEA 4AK9A 4IARA 4C7OA 3RYLA 1LI7A 2NUTA 5KYUB 3EZHA 3U3BA 2G3VA 2GAQA 1C03A 2NSGA 1MNDA 2EIMC 4U9DA 3AJMA 5F5HA 1QVXA 5DS6A 4JC7A 2C04A 3O10A 1EI7A 2VCBA 3G4XA 3M15A 2Q9AA 4NY3A 1T01A 4JEBA 3CSKA 3IEEA 3WG7C 2PF4E 3K6BA 4BG0A 3VAYA 1AEPA 3T6GB 1YARO 1RKCA 3JRMO 3S27A 4A4AA 3FDQA 3LLKA 1OCOC 2J45A 3KPHA 1O87A 2L6GA 3S84A 1FFTC 3A11A 3GODA 1WWPA 4YL0A 4JW1A 3BEHA 2D5RB 3V5ZA 3I5PA 2JX0A 2WZFA 3TOLA 1F1MA 3AG3C 4CS8A 5L0JA 1A7EA 2DI3A 3S9OA 3X1OA 4DRJB 2IOQA 3PDMP 4MVSA 2GDCA 1JRAA 2A6EF 4CBEA 2A68F 3EFOA 1WASA 1M2VB 2O9XA 3K1HA 5CI9A 3TQOA 1I5NA 4WJ0A 1EA8A 3EJNA 3T6BA 5AGFA 3RVZA 3JT1A 3QMKA 5L0IA 1KTMA 1FMVA 2CW0F 4XPYA 4EBJA 1NSGB 4ULVA 2P7VA 3C8GB 4EWCA 1C02A 1Y4CA 4MS2A 1E83A 2X0CA 2G3KA 1FFHA 2OOCA 3HNJA 3LEOA 1AUEA 4AL0A 1N1CA 2A0BA 5F5FA 3DD7A 2J46A 2PFDA 2PNOA 5CIVA 1K04A 3US6A 1G8XA 2YL3A 3FHDA 3IQ5A 1TWGA 3KMIA 4MNDA 4BJTA 1YJGA 1Z23A 2VCCA 1TWHA 3W2WA 4G7OF 1E86A 3JTLO 4XEFA 3WHNA 5DLJA 1HW1A 3J06A 3MBGA 3N0TA 5L3QA 1Y6DA 4IRUA 2PBEA 2XM0A 4WABA 5A6KA 3HNKA 3TD7A 2FAPB 3B29A 3TJ6A 1Q0MA 5L0CA 2NUPB 3I5QA 3EGDA 4W8KA 4PK4A 5B1AC 3ZDLA 1MQVA 2R7TA 2KJGA 4GEHA 4CS8C 2YL0A 4YK5A 1VLSA 2R05A 1AVOB 1L3PA 2QY9A 3NDBB 4J7YA 1G5ZA 1V54C 2HV6A 3KYIA 3OA1A 4Z9JA 3FAJA 3MYFA 3C63A 4LDRA 4IAQA 3T9OA 4G78A 3X2QC 4MVOA 4CS7A 5KYNA 3H2UA 3RFYA 4E0IA 1U89A 4D4NA 5BQIA 3POVA 2HKVA 3CAXA 1NU7D 1V74B 3IHUA 1J8MF 1JR8A 4E0HA 2ZPAA 2Q9BA 2BC5A 5F28E 1T6UA 4Q4ZF 3HNLA 3V5XA 2R7XA 1YLMA 2EPLX 3L8IA 5KYUA 1YA7O 3VRCA 3IPMO 4IGGA 1M2OA 4LACB 3JYYA 1Z7Qc 2DYRC 4QI0A 2GA0A 1M56C 2MWQA 2HFIA 1ZZPA 1DOVA 3QVYA 4Q7CA 1LI5A 2EPNA 1GQAA 2EILC 2LFFA 3JSZA 4OIOF 2EINC 4DBQA 5KYYB 2XS8A 3LAYA 1E84A 1HW2A 1WGWA 2WZLA 5B1BC 2H7OA 4H4KC 4O6MA 2LFDA 1QQ3A 3ABLC 3NYLA 4JVSA 3K1IA 1ZHWA 1MNEA 4JRZA 4ER9A 4MW8A 3LNMB 3U9JA 4N6HA 4YWQA 4AE4B 2J9BA 2WZGA 1A7VA 3GWNA 4K1OA 4P9TA 3MYIA 3AGUA 2ASRA 3TULA 2R7VA 4HFFB 2Y69C 1E85A 3ITFA 5KYXB 3EHNA 4YJWA 5EHHA 2JPUA 3KKBA 3SZRA 4I44A 3EGXA 4JEAA 2NSFA 3NMKA 1LKXA 1U0BB 1K05A 2A1DD 1XZQA 4KBLA 4X0RA 2J7PA 2R7WA 4F4BA 4EKWA 3U5SA 4ZLDA 2XL8A 1NLXA 4RBNA 3GM1A 3ZC4A 5L0DA 5L0HA 1LE4A 3AG2C 4U5GA 1D1AA 2WL8A 5DQTA 3K66A 4DVYP 1GM5A 5A6JA 4FX5A 2YEVA 5L3VA 2R02A 1NBBA 3NKDA 2YRFA 4J32B 5EGYA 3JCUQ 2W4BA 5B3IA 1IW7F 4CX9A 5DQZA 1XWJA 4O6NA 2IBFA 1Q0DA 2OU6A 4FAPB 2BE5F 4U5CE 2LK4A 2YQYA 3C7JA 3N24A 2AP3A 3QZCA 3K1IC 5D91A 1EKYA 4OIRF 2W4MA 3SNHA 2DB4A 2XLMA 4AL1A 3TOMA 1H7IA 3UMKA 1GS9A 5BQHA 3MLGA 2WVOA 5E33A 1UG7A 1I4ZA 4XWJA 2Q7RA 3GM3A 3G4ZA 3HTKC 1ZW3A 1ZYRF 4P9FA 3UGPA 1RJ9B 1CGME 2NPUA 4N4WA 1S05A 4KNVA 3FXHA 3CQZA 5KYWA 2KGOA 4IAOA 5COGA 4BEMJ 3QW1A 3DAFA 2Y3DA 1OCRC 2Y3HA 4G7ZF 2HJMA 2XLHA 3L34A 4BJ6C 1Z6AA 2W9YA 3EG9A 4PFOA 4AX2A 2IXNA 2YLIA 4C3DA 2Q3TA 3IQTA 3RKOF 1RKEA 4DOZA 1FNTc 1OQCA 4UDVA 4JE9A 4PJJA 4EIYA 5JUAA 1LPEA 2D4UA 2YLGA 3AG1C 3O39A 2QUPA 4RD9A 4YT5A 3U3FA 4QDLA 3JRTA 3ECSA 2VASA 2B0JA 4JZAA 4BEJA 3M79A 2CGEA 2YL7A 1ZHTA 3EH1A 1OKKA 2L6FA 3JZ0A 2YLDA 3RQEA 4OIQF 3LS1A 2OEVA 1I4YA 4LDQA 3O55A 2AU5A 4EBBA 5KYYA 1OXKA 3RW0A 5TJ5E 3AG4C 3DXJF 4WGYA 1SZIA 1IZMA 5EK0A 3R2PA 3S29A 2J9UA 5AC5A 1G4WR 2MHRA 1CGOA 1D0YA 4YT8A 2JD3A 1GGQA 1Q0FA 2KSFA 3AQBA 4J30B 4DJ9A 1T6QA 3Q6NA 2HZ8A 2KYHA 1KNYA 3GEIA 2YL1A 3F47A 2KQ9A 4U5HA 1HMOA 1VK5A 2AVKA 4NTFA 1M6TA 3SP1A 5K0IA 4C7OB 2NUTB 5CI8A 1QKRA 1U6HA 2FFHA 3EPVA 5KYXA 4BJ5C 3KH2A 1Z3IX 2HMZA 4NTAA 2QE9A 3DJNB 1TR2A 4FWVA 1MMNA 2EIKC 1APCA 1JMWA 2DYSC 4XEVA 2F22A 1PCXA 3RQGA 1SR2A 4E18A 4OIPF 1VYKA
chains in the Genus database with same CATH topology
3ZIBA 2J9WA 4HFKB 3DJUB 3LESA 4U5EE 1NZEA 2XXAB 3B9QA 4PJLA 3M1CB 4QI2A 2Y3BA 4JJFA 1MMGA 1QLEC 4HEAJ 4GYTA 3UMIA 2DGJA 2CDQA 1J8YF 3ZVRA 4DVZA 4I1MA 4A2NB 3LJBA 4N06A 1ZU5A 1D0XA 2LSEA 4O6YA 2KNHA 3ZSUA 3B0VC 3DMDA 3EFOB 1ST6A 3UMHA 3S28A 2G62A 4PFPA 4U5DE 3DAGA 2Q9CA 1ZHYA 2P6VA 4OD5A 3NKEA 4LLEA 3SYNA 2GFHA 1BR1A 2CNWA 1SMYF 2IXPA 2KW3C 1KU2A 4JJGA 2VH3A 2A6HF 2WB7A 3W8HA 1M2VA 5D92A 4G7OF 4PJMA 1JPJA 4KI2A 4I1OB 4BJ6A 3LNRA 4ULWA 2I8BA 1PD0A 3NYJA 1OKKD 3RIPA 1LS1A 1VMAA 3K7DA 4YT4A 1ZHXA 3B0PA 2OCCC 3EGDB 3MX3A 3OWTA 4ZLCA 1JPNA 2Y3GA 4CS9C 2PP4A 2J0XA 3LS0A 2J0WA 3F46A 5T3WA 4YT2A 5DS5A 2VB6A 4IWBA 4LERA 3DZAA 1D1BA 4FESA 4JCHA 3CZ6A 3T4RA 1NU9C 4OINF 1MMAA 4OD4A 2NUPA 5DS4A 4I3MA 5BUOA 1ZHZA 4U5FE 4KNWA 2H7VC 3E9VA 4B6IA 4O7GA 1Z63A 4LLCA 4XLNF 4BJ5A 1Z5ZA 4YN0B 3N2ZB 5HSWA 4C3EA 4G7HF 2Y39A 2NG1A 3NRHA 3H65A 3ABKC 3ABMC 5E3AA 3B0UX 2YHSA 2XXAA 1TWCA 1PCXA 3T6JA 2WVQA 3PHF2 3I4UA 2Z15A 5FCLA 2IYLD 1OCCC 4CSAA 3K33A 5DVWA 1NG1A 2R7UA 4Q4ZF 5B3SC 3L0IA 3PMRA 4XTKA 3EQLF 3ZG1A 3EGXB 4E7SA 3VYWA 1PD1A 2X51A 3NYMA 1OCZC 3RH3A 3V7OA 1FMWA 1LVKA 4RDAA 2ZXWC 1O5HA 3AQCA 1S7ZA 4AE4A 3UR3C 1BR4A 1W2WA 2L81A 2XRHA 5T3TA 3W8IA 2R7OA 4ANJA 2V3CC 2CNWD 1ZU4A 3DM5A 1V55C 2WVNA 2ZXRA 2M4EA 3Q7LA 1FTSA 1TKNA 2H7BA 4KC9A 2R7SA 4MQ9F 2MYSA 2ZXOA 4JURI 4W8KA 3ASNC 2IXOA 2PX3A 4K0DA 2R7RA 2FGYA 3EZIA 3W2VA 2E87A 2V26A 4CSAC 3WODF 4BJ1A 2A69F 2IXMA 4P6IC 4CIHA 1QZXA 3UNGC 4M63A 5KYWB 3NG1A 4CS9A 5T1DB 2XL4A 2PX0A 1TWAA 2QTVA 1VOMA 3EG9B 3Q7GA 4IJJA 3JYHA 5IY5C 3E70C 3S0XA 1D0ZA 1RJ9A 2YZSA 2C03A 2OG2A 4C3BA 3DM9B 3O6XA 4HE8D 4Q5SF 3SEOA 3KL4A 3GANA 3Q6MA 2EIJC 1M57C 3UGOA 3OEOA 4O79A 3EHMA 1D1CA 1BR2A 4PJNA 3HLZA 3LEVA 2L9JA 4U5BE 2J9VA 4G0HA 3ASOC 1SF8A 1MMDA 3FVYA 5E2QA 4K7BA 3HJCA 3LLIA 2W45A 4E7ZA 4XLPF 2ZXPA 5E3CA 3EH2A 1VYIA 2XSEA 2R7QA 4AK9A 4C7OA 3RYLA 2NUTA 5KYUB 3EZHA 2G3VA 1MNDA 2EIMC 5F5HA 5DS6A 2C04A 4NY3A 2Q9AA 3CSKA 3IEEA 3WG7C 2PF4E 3K6BA 4BG0A 3VAYA 3FDQA 3S27A 3LLKA 1OCOC 2J45A 1O87A 1FFTC 3GODA 4JW1A 2D5RB 3I5PA 2WZFA 4CS8A 3AG3C 3X1OA 2IOQA 2A6EF 4CBEA 2A68F 3EFOA 2O9XA 1M2VB 5CI9A 3K1HA 4WJ0A 3EJNA 3T6BA 3JT1A 3QMKA 1FMVA 2CW0F 2P7VA 4EWCA 2G3KA 1FFHA 1N1CA 5F5FA 3DD7A 2J46A 2PFDA 1G8XA 3FHDA 3KMIA 1TWGA 4MNDA 4BJTA 1Z23A 1TWHA 3W2WA 5DLJA 3N0TA 5L3QA 4IRUA 3TD7A 2NUPB 3I5QA 3EGDA 4PK4A 5B1AC 2R7TA 2KJGA 4GEHA 4CS8C 2QY9A 3NDBB 2HV6A 1V54C 3OA1A 3FAJA 3X2QC 4CS7A 5KYNA 3RFYA 3POVA 1NU7D 1J8MF 2ZPAA 2Q9BA 2R7XA 5KYUA 1M2OA 4LACB 2DYRC 4QI0A 4DBRA 1M56C 2MWQA 4Q7CA 2EILC 3JSZA 4OIOF 2EINC 4DBQA 5KYYB 3LAYA 1WGWA 2WZLA 5B1BC 2H7OA 4H4KC 4O6MA 3ABLC 3NYLA 4JVSA 1ZHWA 1MNEA 4YWQA 4AE4B 2WZGA 2R7VA 4HFFB 2Y69C 3ITFA 5KYXB 3EHNA 4YJWA 5EHHA 3KKBA 3SZRA 4I44A 3EGXA 1LKXA 2A1DD 4KBLA 4X0RA 2J7PA 2R7WA 4F4BA 4ZLDA 4RBNA 3ZC4A 3AG2C 4U5GA 1D1AA 2WL8A 5DQTA 3K66A 4DVYP 4FX5A 2YEVA 5L3VA 3NKDA 4J32B 5EGYA 3JCUQ 2W4BA 1IW7F 5DQZA 4O6NA 2BE5F 4U5CE 3N24A 3QZCA 3K1IC 5D91A 4OIRF 2W4MA 3SNHA 3UMKA 3MLGA 2WVOA 5E33A 4XWJA 3HTKC 1ZYRF 3UGPA 1RJ9B 4KNVA 3CQZA 5KYWA 2KGOA 4IAOA 3DAFA 2Y3DA 1OCRC 2Y3HA 4G7ZF 3L34A 4BJ6C 1Z6AA 2W9YA 3EG9A 4PFOA 4AX2A 2IXNA 4C3DA 2Q3TA 3RKOF 4DOZA 4PJJA 3AG1C 3O39A 4YT5A 4RD9A 4QDLA 3JRTA 3ECSA 2VASA 2B0JA 4JZAA 4BEJA 2CGEA 1ZHTA 3EH1A 1OKKA 4OIQF 3LS1A 4EBBA 5KYYA 3AG4C 3DXJF 1SZIA 1IZMA 3S29A 2J9UA 4YT8A 1D0YA 2JD3A 3AQBA 4J30B 3Q6NA 3F47A 2KQ9A 4U5HA 1VK5A 3SP1A 4C7OB 2NUTB 5CI8A 2FFHA 3EPVA 5KYXA 4BJ5C 3KH2A 1Z3IX 3DJNB 1TR2A 4FWVA 1MMNA 2EIKC 2DYSC 4OIPF 2J7PD 2HV7A 1VYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9W A;  2J9V A;  2J9U A;  2G3K A; 
#chains in the Genus database with same CATH topology
 3ZIB A;  3GM2 A;  2J9W A;  3U2L A;  4HFK B;  1L7C A;  1BZ4 A;  1R5I D;  2HSQ A;  3DJU B;  2HJ3 A;  3LES A;  4LDK A;  4JKV A;  4MVM A;  4U5E E;  2LIG A;  3GEH A;  1YDI A;  2KC3 A;  1NZE A;  4JTC B;  2XXA B;  3B9Q A;  4GQH A;  4PJL A;  3M1C B;  3ZQV A;  4QI2 A;  1UFB A;  2Y3B A;  4ONS A;  1SYQ A;  3BRJ A;  4JJF A;  2I15 A;  1MMG A;  1QLE C;  4HEA J;  3SXM A;  3U8P A;  3NMJ A;  1H6G A;  4CJO A;  1YAU O;  2R03 A;  3FOP A;  4GYT A;  5JS5 A;  3ATP A;  3UMI A;  2DGJ A;  2CDQ A;  1J8Y F;  2P0N A;  3ZVR A;  2EPK X;  4I1M A;  3LJB A;  4A2N B;  4DVZ A;  4N06 A;  3RVY A;  1ZU5 A;  1D0X A;  1LE2 A;  2LSE A;  4O6Y A;  2KNH A;  4BPM A;  3ZSU A;  3B0V C;  3DMD A;  3EFO B;  1HY5 A;  1ST6 A;  3UMH A;  3S28 A;  2G62 A;  4PFP A;  2HSB A;  1T9K A;  1OR3 A;  4U5D E;  3DAG A;  3VF0 A;  2Q9C A;  1ZHY A;  4NCQ A;  2P6V A;  2QNL A;  3QW0 A;  3R7C A;  1OXB A;  5JT4 A;  2LQG A;  4OD5 A;  5JLI A;  3NKE A;  4LLE A;  3SYN A;  3TJ5 A;  2GFH A;  1BR1 A;  1VB5 A;  2YWA A;  2CNW A;  1SMY F;  3L1M A;  5JP7 A;  2IXP A;  2KW3 C;  2HUJ A;  1HE1 A;  1KU2 A;  1A7D A;  4MVZ A;  5COM A;  4JJG A;  4CDY A;  2VH3 A;  4J7T A;  2A6H F;  1ORJ A;  2WB7 A;  2R7U A;  3C18 A;  3W8H A;  1M2V A;  5D92 A;  1QPU A;  4PJM A;  1JPJ A;  3WAQ A;  4I1O B;  3DE8 A;  3HNI A;  3LNR A;  4NQF A;  4ULW A;  3SXK A;  4BJ6 A;  4KI2 A;  5A69 A;  2I8B A;  1PD0 A;  4IB4 A;  4JIO A;  3NYJ A;  256B A;  1ORY A;  3PCV A;  1FR0 A;  3IQC A;  1V4A A;  1OKK D;  1QSP A;  3RIP A;  5L0F A;  1LS1 A;  3C8G A;  1VMA A;  4CDA A;  3K7D A;  4YT4 A;  1ZHX A;  1BBH A;  3B0P A;  2UUH A;  2OCC C;  3EGD B;  4WGZ A;  2LP4 A;  2KK1 A;  3MX3 A;  1T6I A;  3OWT A;  2OKU A;  4MTG A;  4ZLC A;  1JPN A;  2EPM X;  2XLW A;  2Y3G A;  3SXY A;  3MFN A;  2TMV P;  4CS9 C;  2PP4 A;  2J0X A;  3LS0 A;  1JOG A;  2J0W A;  2L6H A;  3F46 A;  5T3W A;  4YT2 A;  3QTH A;  4R32 A;  3LUT B;  5DS5 A;  2VB6 A;  1WN0 A;  1O3U A;  2P61 A;  4MVU A;  4IWB A;  4LER A;  3ZQY A;  3DZA A;  1D1B A;  4FES A;  4NC3 A;  2YVK A;  3CZ6 A;  4JCH A;  3T4R A;  4D4X A;  2RSE B;  1NU9 C;  1JAF A;  4MTO A;  4OIN F;  1MMA A;  4OD4 A;  2NUP A;  5DS4 A;  2J8W A;  4I3M A;  5BUO A;  4U9E A;  2ZD9 A;  2XL6 A;  1BDJ B;  1ZHZ A;  4KNW A;  2H7V C;  4U5F E;  1H9T A;  2AWC A;  3E9V A;  4B6I A;  1YVI A;  4O7G A;  2J7P D;  2XM4 A;  4L6R A;  4LLC A;  4MW3 A;  4XLN F;  4BJ5 A;  1Z63 A;  4XPX A;  1Z5Z A;  4H54 A;  4YN0 B;  4EBK A;  4CIP A;  3N2Z B;  2HMQ A;  1CGN A;  1XZP A;  3M4B A;  5JVE A;  1YA9 A;  5HSW A;  1RMV A;  1OW8 A;  4C3E A;  4DRH B;  4G7H F;  2OJE D;  5FZT A;  2Y39 A;  2NG1 A;  3NRH A;  3H65 A;  1WTY A;  3ABM C;  3ABK C;  1Q0G A;  3JSE O;  1K40 A;  2YHS A;  5E3A A;  3B0U X;  2XXA A;  1TWC A;  3S90 A;  4XPW A;  1FAP B;  3T6J A;  1OR2 A;  2WVQ A;  3PHF 2;  3FMS A;  2Z15 A;  3I4U A;  3B71 A;  2ETS A;  5FCL A;  2IYL D;  1OCC C;  5GPG B;  4CSA A;  1LIH A;  1B68 A;  3HKK A;  3K33 A;  4XEK A;  5DVW A;  1NG1 A;  5A6B D;  2UUI A;  2XLV A;  3H2V A;  5COF A;  1OW7 A;  3L0I A;  3PMR A;  1ZVZ A;  4YL3 A;  4XTK A;  2BL2 A;  5B3S C;  2ICW G;  3DI5 A;  4XQ1 A;  4DXW A;  3U0C A;  3EQL F;  3ZG1 A;  3EGX B;  3KYJ A;  1YZA A;  3VYW A;  3G50 A;  1PD1 A;  3NMI A;  4MTF A;  1E2X A;  4E7S A;  1TFK B;  2X51 A;  1ZW2 A;  4E17 A;  3NYM A;  1OCZ C;  3RH3 A;  3V7O A;  1FMW A;  1LVK A;  4RDA A;  4JTA B;  2ZXW C;  1O5H A;  3U2M A;  2R9R B;  3AQC A;  1S7Z A;  4AE4 A;  1H9G A;  3UR3 C;  1BR4 A;  1W2W A;  2L81 A;  2XRH A;  2CCY A;  3FAP B;  4JCZ A;  4N6C A;  5T3T A;  3W8I A;  2R7O A;  4ANJ A;  2V3C C;  2CNW D;  1ZU4 A;  3GWL A;  1EQ1 A;  4DBR A;  3DKA A;  3AGT A;  3DM5 A;  1HE9 A;  1NFO A;  3RQF A;  1A41 A;  1V55 C;  2WVN A;  2ZXR A;  2M4E A;  3Q7L A;  2CYD A;  3C8Z A;  1FTS A;  1TKN A;  2H7B A;  4JTD B;  4KC9 A;  4EHP A;  2R7S A;  4MQ9 F;  2H8A A;  4YL1 A;  2MYS A;  2ZXO A;  4JUR I;  2B0H A;  3ASN C;  1ORS C;  1T5O A;  2IXO A;  2PX3 A;  3C8G D;  1Q0K A;  3DWW A;  4K0D A;  2R7R A;  1PV3 A;  1LS4 A;  1RCP A;  2FGY A;  3C62 A;  3EZI A;  3W4Y A;  3W2V A;  1TQG A;  2E87 A;  2V26 A;  3GOR A;  4CSA C;  4MVR A;  3WOD F;  3ZTM A;  2Q4F A;  4BJ1 A;  2A69 F;  2IXM A;  4P6I C;  4CIH A;  2GWW A;  2LD6 A;  3DE9 A;  1QZX A;  2XLO A;  2P1A A;  4Z9H A;  3UNG C;  4M63 A;  5KYW B;  2A0U A;  3NG1 A;  2OJQ A;  1RXQ A;  2HV7 A;  2XS1 A;  3TK0 A;  4CS9 A;  5T1D B;  5A6B A;  2XL4 A;  4DRI B;  2PX0 A;  4Z9I A;  1TWA A;  2QTV A;  2XLE A;  1VOM A;  3EG9 B;  3Q7G A;  3FOO A;  4IJJ A;  3JYH A;  1R4T A;  5IY5 C;  1RKE B;  3ZWI A;  3E70 C;  3S0X A;  1A0B A;  1D0Z A;  1RJ9 A;  2YZS A;  2C03 A;  1VTM P;  2QLA A;  2OG2 A;  1WOL A;  2OEX A;  2VCA A;  4CDV A;  4C3B A;  3DM9 B;  2OQM A;  3O6X A;  4HE8 D;  4EUK B;  4Q5S F;  3SEO A;  3KL4 A;  3GAN A;  3Q6M A;  2Q00 A;  1OW6 A;  2EIJ C;  1M57 C;  2IM8 A;  5L0G A;  2VC9 A;  3V5Y A;  3UGO A;  2AWY A;  3OEO A;  4O79 A;  3U8V A;  3EHM A;  1D1C A;  2HS5 A;  3SXZ A;  1YZC A;  5BQG A;  5JSL A;  1NFN A;  4NTB A;  3RF3 A;  5AC4 A;  4W8P A;  1CPQ A;  1BR2 A;  1G4U S;  1YYJ A;  4PJN A;  5HV9 A;  3HLZ A;  3LEV A;  2L7A A;  2L9J A;  1TFO B;  4U5B E;  2J9V A;  2EPO A;  1WAT A;  1YYX A;  3CEX A;  1C17 M;  5JRA A;  1CPR A;  2XLD A;  1VLT A;  3GEE A;  4G0H A;  3ZTZ A;  2M64 A;  2YKZ A;  3ASO C;  5A6A A;  2LCH A;  3U9M A;  3M4C A;  1LM3 B;  4MVQ A;  1SF8 A;  2RD9 A;  3QVZ A;  1MMD A;  3A9C A;  3FVY A;  1DOW A;  5E2Q A;  4K7B A;  4PAC A;  3HJC A;  3L8J A;  3LLI A;  2W45 A;  4E7Z A;  4XLP F;  2ZXP A;  5E3C A;  4CJG A;  3AOU A;  2R25 A;  4PR9 A;  3EH2 A;  3VM6 A;  3IQ6 A;  1VYI A;  1HMD A;  2R7Q A;  2XSE A;  4AK9 A;  4IAR A;  4C7O A;  3RYL A;  1LI7 A;  2NUT A;  5KYU B;  3EZH A;  3U3B A;  2G3V A;  2GAQ A;  1C03 A;  2NSG A;  1MND A;  2EIM C;  4U9D A;  3AJM A;  5F5H A;  1QVX A;  5DS6 A;  4JC7 A;  2C04 A;  3O10 A;  1EI7 A;  2VCB A;  3G4X A;  3M15 A;  2Q9A A;  4NY3 A;  1T01 A;  4JEB A;  3CSK A;  3IEE A;  3WG7 C;  2PF4 E;  3K6B A;  4BG0 A;  3VAY A;  1AEP A;  3T6G B;  1YAR O;  1RKC A;  3JRM O;  3S27 A;  4A4A A;  3FDQ A;  3LLK A;  1OCO C;  2J45 A;  3KPH A;  1O87 A;  2L6G A;  3S84 A;  1FFT C;  3A11 A;  3GOD A;  1WWP A;  4YL0 A;  4JW1 A;  3BEH A;  2D5R B;  3V5Z A;  3I5P A;  2JX0 A;  2WZF A;  3TOL A;  1F1M A;  3AG3 C;  4CS8 A;  5L0J A;  1A7E A;  2DI3 A;  3S9O A;  3X1O A;  4DRJ B;  2IOQ A;  3PDM P;  4MVS A;  2GDC A;  1JRA A;  2A6E F;  4CBE A;  2A68 F;  3EFO A;  1WAS A;  1M2V B;  2O9X A;  3K1H A;  5CI9 A;  3TQO A;  1I5N A;  4WJ0 A;  1EA8 A;  3EJN A;  3T6B A;  5AGF A;  3RVZ A;  3JT1 A;  3QMK A;  5L0I A;  1KTM A;  1FMV A;  2CW0 F;  4XPY A;  4EBJ A;  1NSG B;  4ULV A;  2P7V A;  3C8G B;  4EWC A;  1C02 A;  1Y4C A;  4MS2 A;  1E83 A;  2X0C A;  2G3K A;  1FFH A;  2OOC A;  3HNJ A;  3LEO A;  1AUE A;  4AL0 A;  1N1C A;  2A0B A;  5F5F A;  3DD7 A;  2J46 A;  2PFD A;  2PNO A;  5CIV A;  1K04 A;  3US6 A;  1G8X A;  2YL3 A;  3FHD A;  3IQ5 A;  1TWG A;  3KMI A;  4MND A;  4BJT A;  1YJG A;  1Z23 A;  2VCC A;  1TWH A;  3W2W A;  4G7O F;  1E86 A;  3JTL O;  4XEF A;  3WHN A;  5DLJ A;  1HW1 A;  3J06 A;  3MBG A;  3N0T A;  5L3Q A;  1Y6D A;  4IRU A;  2PBE A;  2XM0 A;  4WAB A;  5A6K A;  3HNK A;  3TD7 A;  2FAP B;  3B29 A;  3TJ6 A;  1Q0M A;  5L0C A;  2NUP B;  3I5Q A;  3EGD A;  4W8K A;  4PK4 A;  5B1A C;  3ZDL A;  1MQV A;  2R7T A;  2KJG A;  4GEH A;  4CS8 C;  2YL0 A;  4YK5 A;  1VLS A;  2R05 A;  1AVO B;  1L3P A;  2QY9 A;  3NDB B;  4J7Y A;  1G5Z A;  1V54 C;  2HV6 A;  3KYI A;  3OA1 A;  4Z9J A;  3FAJ A;  3MYF A;  3C63 A;  4LDR A;  4IAQ A;  3T9O A;  4G78 A;  3X2Q C;  4MVO A;  4CS7 A;  5KYN A;  3H2U A;  3RFY A;  4E0I A;  1U89 A;  4D4N A;  5BQI A;  3POV A;  2HKV A;  3CAX A;  1NU7 D;  1V74 B;  3IHU A;  1J8M F;  1JR8 A;  4E0H A;  2ZPA A;  2Q9B A;  2BC5 A;  5F28 E;  1T6U A;  4Q4Z F;  3HNL A;  3V5X A;  2R7X A;  1YLM A;  2EPL X;  3L8I A;  5KYU A;  1YA7 O;  3VRC A;  3IPM O;  4IGG A;  1M2O A;  4LAC B;  3JYY A;  1Z7Q c;  2DYR C;  4QI0 A;  2GA0 A;  1M56 C;  2MWQ A;  2HFI A;  1ZZP A;  1DOV A;  3QVY A;  4Q7C A;  1LI5 A;  2EPN A;  1GQA A;  2EIL C;  2LFF A;  3JSZ A;  4OIO F;  2EIN C;  4DBQ A;  5KYY B;  2XS8 A;  3LAY A;  1E84 A;  1HW2 A;  1WGW A;  2WZL A;  5B1B C;  2H7O A;  4H4K C;  4O6M A;  2LFD A;  1QQ3 A;  3ABL C;  3NYL A;  4JVS A;  3K1I A;  1ZHW A;  1MNE A;  4JRZ A;  4ER9 A;  4MW8 A;  3LNM B;  3U9J A;  4N6H A;  4YWQ A;  4AE4 B;  2J9B A;  2WZG A;  1A7V A;  3GWN A;  4K1O A;  4P9T A;  3MYI A;  3AGU A;  2ASR A;  3TUL A;  2R7V A;  4HFF B;  2Y69 C;  1E85 A;  3ITF A;  5KYX B;  3EHN A;  4YJW A;  5EHH A;  2JPU A;  3KKB A;  3SZR A;  4I44 A;  3EGX A;  4JEA A;  2NSF A;  3NMK A;  1LKX A;  1U0B B;  1K05 A;  2A1D D;  1XZQ A;  4KBL A;  4X0R A;  2J7P A;  2R7W A;  4F4B A;  4EKW A;  3U5S A;  4ZLD A;  2XL8 A;  1NLX A;  4RBN A;  3GM1 A;  3ZC4 A;  5L0D A;  5L0H A;  1LE4 A;  3AG2 C;  4U5G A;  1D1A A;  2WL8 A;  5DQT A;  3K66 A;  4DVY P;  1GM5 A;  5A6J A;  4FX5 A;  2YEV A;  5L3V A;  2R02 A;  1NBB A;  3NKD A;  2YRF A;  4J32 B;  5EGY A;  3JCU Q;  2W4B A;  5B3I A;  1IW7 F;  4CX9 A;  5DQZ A;  1XWJ A;  4O6N A;  2IBF A;  1Q0D A;  2OU6 A;  4FAP B;  2BE5 F;  4U5C E;  2LK4 A;  2YQY A;  3C7J A;  3N24 A;  2AP3 A;  3QZC A;  3K1I C;  5D91 A;  1EKY A;  4OIR F;  2W4M A;  3SNH A;  2DB4 A;  2XLM A;  4AL1 A;  3TOM A;  1H7I A;  3UMK A;  1GS9 A;  5BQH A;  3MLG A;  2WVO A;  5E33 A;  1UG7 A;  1I4Z A;  4XWJ A;  2Q7R A;  3GM3 A;  3G4Z A;  3HTK C;  1ZW3 A;  1ZYR F;  4P9F A;  3UGP A;  1RJ9 B;  1CGM E;  2NPU A;  4N4W A;  1S05 A;  4KNV A;  3FXH A;  3CQZ A;  5KYW A;  2KGO A;  4IAO A;  5COG A;  4BEM J;  3QW1 A;  3DAF A;  2Y3D A;  1OCR C;  2Y3H A;  4G7Z F;  2HJM A;  2XLH A;  3L34 A;  4BJ6 C;  1Z6A A;  2W9Y A;  3EG9 A;  4PFO A;  4AX2 A;  2IXN A;  2YLI A;  4C3D A;  2Q3T A;  3IQT A;  3RKO F;  1RKE A;  4DOZ A;  1FNT c;  1OQC A;  4UDV A;  4JE9 A;  4PJJ A;  4EIY A;  5JUA A;  1LPE A;  2D4U A;  2YLG A;  3AG1 C;  3O39 A;  2QUP A;  4RD9 A;  4YT5 A;  3U3F A;  4QDL A;  3JRT A;  3ECS A;  2VAS A;  2B0J A;  4JZA A;  4BEJ A;  3M79 A;  2CGE A;  2YL7 A;  1ZHT A;  3EH1 A;  1OKK A;  2L6F A;  3JZ0 A;  2YLD A;  3RQE A;  4OIQ F;  3LS1 A;  2OEV A;  1I4Y A;  4LDQ A;  3O55 A;  2AU5 A;  4EBB A;  5KYY A;  1OXK A;  3RW0 A;  5TJ5 E;  3AG4 C;  3DXJ F;  4WGY A;  1SZI A;  1IZM A;  5EK0 A;  3R2P A;  3S29 A;  2J9U A;  5AC5 A;  1G4W R;  2MHR A;  1CGO A;  1D0Y A;  4YT8 A;  2JD3 A;  1GGQ A;  1Q0F A;  2KSF A;  3AQB A;  4J30 B;  4DJ9 A;  1T6Q A;  3Q6N A;  2HZ8 A;  2KYH A;  1KNY A;  3GEI A;  2YL1 A;  3F47 A;  2KQ9 A;  4U5H A;  1HMO A;  1VK5 A;  2AVK A;  4NTF A;  1M6T A;  3SP1 A;  5K0I A;  4C7O B;  2NUT B;  5CI8 A;  1QKR A;  1U6H A;  2FFH A;  3EPV A;  5KYX A;  4BJ5 C;  3KH2 A;  1Z3I X;  2HMZ A;  4NTA A;  2QE9 A;  3DJN B;  1TR2 A;  4FWV A;  1MMN A;  2EIK C;  1APC A;  1JMW A;  2DYS C;  4XEV A;  2F22 A;  1PCX A;  3RQG A;  1SR2 A;  4E18 A;  4OIP F;  1VYK A; 
#chains in the Genus database with same CATH homology
 3ZIB A;  2J9W A;  4HFK B;  3DJU B;  3LES A;  4U5E E;  1NZE A;  2XXA B;  3B9Q A;  4PJL A;  3M1C B;  4QI2 A;  2Y3B A;  4JJF A;  1MMG A;  1QLE C;  4HEA J;  4GYT A;  3UMI A;  2DGJ A;  2CDQ A;  1J8Y F;  3ZVR A;  4DVZ A;  4I1M A;  4A2N B;  3LJB A;  4N06 A;  1ZU5 A;  1D0X A;  2LSE A;  4O6Y A;  2KNH A;  3ZSU A;  3B0V C;  3DMD A;  3EFO B;  1ST6 A;  3UMH A;  3S28 A;  2G62 A;  4PFP A;  4U5D E;  3DAG A;  2Q9C A;  1ZHY A;  2P6V A;  4OD5 A;  3NKE A;  4LLE A;  3SYN A;  2GFH A;  1BR1 A;  2CNW A;  1SMY F;  2IXP A;  2KW3 C;  1KU2 A;  4JJG A;  2VH3 A;  2A6H F;  2WB7 A;  3W8H A;  1M2V A;  5D92 A;  4G7O F;  4PJM A;  1JPJ A;  4KI2 A;  4I1O B;  4BJ6 A;  3LNR A;  4ULW A;  2I8B A;  1PD0 A;  3NYJ A;  1OKK D;  3RIP A;  1LS1 A;  1VMA A;  3K7D A;  4YT4 A;  1ZHX A;  3B0P A;  2OCC C;  3EGD B;  3MX3 A;  3OWT A;  4ZLC A;  1JPN A;  2Y3G A;  4CS9 C;  2PP4 A;  2J0X A;  3LS0 A;  2J0W A;  3F46 A;  5T3W A;  4YT2 A;  5DS5 A;  2VB6 A;  4IWB A;  4LER A;  3DZA A;  1D1B A;  4FES A;  4JCH A;  3CZ6 A;  3T4R A;  1NU9 C;  4OIN F;  1MMA A;  4OD4 A;  2NUP A;  5DS4 A;  4I3M A;  5BUO A;  1ZHZ A;  4U5F E;  4KNW A;  2H7V C;  3E9V A;  4B6I A;  4O7G A;  1Z63 A;  4LLC A;  4XLN F;  4BJ5 A;  1Z5Z A;  4YN0 B;  3N2Z B;  5HSW A;  4C3E A;  4G7H F;  2Y39 A;  2NG1 A;  3NRH A;  3H65 A;  3ABK C;  3ABM C;  5E3A A;  3B0U X;  2YHS A;  2XXA A;  1TWC A;  1PCX A;  3T6J A;  2WVQ A;  3PHF 2;  3I4U A;  2Z15 A;  5FCL A;  2IYL D;  1OCC C;  4CSA A;  3K33 A;  5DVW A;  1NG1 A;  2R7U A;  4Q4Z F;  5B3S C;  3L0I A;  3PMR A;  4XTK A;  3EQL F;  3ZG1 A;  3EGX B;  4E7S A;  3VYW A;  1PD1 A;  2X51 A;  3NYM A;  1OCZ C;  3RH3 A;  3V7O A;  1FMW A;  1LVK A;  4RDA A;  2ZXW C;  1O5H A;  3AQC A;  1S7Z A;  4AE4 A;  3UR3 C;  1BR4 A;  1W2W A;  2L81 A;  2XRH A;  5T3T A;  3W8I A;  2R7O A;  4ANJ A;  2V3C C;  2CNW D;  1ZU4 A;  3DM5 A;  1V55 C;  2WVN A;  2ZXR A;  2M4E A;  3Q7L A;  1FTS A;  1TKN A;  2H7B A;  4KC9 A;  2R7S A;  4MQ9 F;  2MYS A;  2ZXO A;  4JUR I;  4W8K A;  3ASN C;  2IXO A;  2PX3 A;  4K0D A;  2R7R A;  2FGY A;  3EZI A;  3W2V A;  2E87 A;  2V26 A;  4CSA C;  3WOD F;  4BJ1 A;  2A69 F;  2IXM A;  4P6I C;  4CIH A;  1QZX A;  3UNG C;  4M63 A;  5KYW B;  3NG1 A;  4CS9 A;  5T1D B;  2XL4 A;  2PX0 A;  1TWA A;  2QTV A;  1VOM A;  3EG9 B;  3Q7G A;  4IJJ A;  3JYH A;  5IY5 C;  3E70 C;  3S0X A;  1D0Z A;  1RJ9 A;  2YZS A;  2C03 A;  2OG2 A;  4C3B A;  3DM9 B;  3O6X A;  4HE8 D;  4Q5S F;  3SEO A;  3KL4 A;  3GAN A;  3Q6M A;  2EIJ C;  1M57 C;  3UGO A;  3OEO A;  4O79 A;  3EHM A;  1D1C A;  1BR2 A;  4PJN A;  3HLZ A;  3LEV A;  2L9J A;  4U5B E;  2J9V A;  4G0H A;  3ASO C;  1SF8 A;  1MMD A;  3FVY A;  5E2Q A;  4K7B A;  3HJC A;  3LLI A;  2W45 A;  4E7Z A;  4XLP F;  2ZXP A;  5E3C A;  3EH2 A;  1VYI A;  2XSE A;  2R7Q A;  4AK9 A;  4C7O A;  3RYL A;  2NUT A;  5KYU B;  3EZH A;  2G3V A;  1MND A;  2EIM C;  5F5H A;  5DS6 A;  2C04 A;  4NY3 A;  2Q9A A;  3CSK A;  3IEE A;  3WG7 C;  2PF4 E;  3K6B A;  4BG0 A;  3VAY A;  3FDQ A;  3S27 A;  3LLK A;  1OCO C;  2J45 A;  1O87 A;  1FFT C;  3GOD A;  4JW1 A;  2D5R B;  3I5P A;  2WZF A;  4CS8 A;  3AG3 C;  3X1O A;  2IOQ A;  2A6E F;  4CBE A;  2A68 F;  3EFO A;  2O9X A;  1M2V B;  5CI9 A;  3K1H A;  4WJ0 A;  3EJN A;  3T6B A;  3JT1 A;  3QMK A;  1FMV A;  2CW0 F;  2P7V A;  4EWC A;  2G3K A;  1FFH A;  1N1C A;  5F5F A;  3DD7 A;  2J46 A;  2PFD A;  1G8X A;  3FHD A;  3KMI A;  1TWG A;  4MND A;  4BJT A;  1Z23 A;  1TWH A;  3W2W A;  5DLJ A;  3N0T A;  5L3Q A;  4IRU A;  3TD7 A;  2NUP B;  3I5Q A;  3EGD A;  4PK4 A;  5B1A C;  2R7T A;  2KJG A;  4GEH A;  4CS8 C;  2QY9 A;  3NDB B;  2HV6 A;  1V54 C;  3OA1 A;  3FAJ A;  3X2Q C;  4CS7 A;  5KYN A;  3RFY A;  3POV A;  1NU7 D;  1J8M F;  2ZPA A;  2Q9B A;  2R7X A;  5KYU A;  1M2O A;  4LAC B;  2DYR C;  4QI0 A;  4DBR A;  1M56 C;  2MWQ A;  4Q7C A;  2EIL C;  3JSZ A;  4OIO F;  2EIN C;  4DBQ A;  5KYY B;  3LAY A;  1WGW A;  2WZL A;  5B1B C;  2H7O A;  4H4K C;  4O6M A;  3ABL C;  3NYL A;  4JVS A;  1ZHW A;  1MNE A;  4YWQ A;  4AE4 B;  2WZG A;  2R7V A;  4HFF B;  2Y69 C;  3ITF A;  5KYX B;  3EHN A;  4YJW A;  5EHH A;  3KKB A;  3SZR A;  4I44 A;  3EGX A;  1LKX A;  2A1D D;  4KBL A;  4X0R A;  2J7P A;  2R7W A;  4F4B A;  4ZLD A;  4RBN A;  3ZC4 A;  3AG2 C;  4U5G A;  1D1A A;  2WL8 A;  5DQT A;  3K66 A;  4DVY P;  4FX5 A;  2YEV A;  5L3V A;  3NKD A;  4J32 B;  5EGY A;  3JCU Q;  2W4B A;  1IW7 F;  5DQZ A;  4O6N A;  2BE5 F;  4U5C E;  3N24 A;  3QZC A;  3K1I C;  5D91 A;  4OIR F;  2W4M A;  3SNH A;  3UMK A;  3MLG A;  2WVO A;  5E33 A;  4XWJ A;  3HTK C;  1ZYR F;  3UGP A;  1RJ9 B;  4KNV A;  3CQZ A;  5KYW A;  2KGO A;  4IAO A;  3DAF A;  2Y3D A;  1OCR C;  2Y3H A;  4G7Z F;  3L34 A;  4BJ6 C;  1Z6A A;  2W9Y A;  3EG9 A;  4PFO A;  4AX2 A;  2IXN A;  4C3D A;  2Q3T A;  3RKO F;  4DOZ A;  4PJJ A;  3AG1 C;  3O39 A;  4YT5 A;  4RD9 A;  4QDL A;  3JRT A;  3ECS A;  2VAS A;  2B0J A;  4JZA A;  4BEJ A;  2CGE A;  1ZHT A;  3EH1 A;  1OKK A;  4OIQ F;  3LS1 A;  4EBB A;  5KYY A;  3AG4 C;  3DXJ F;  1SZI A;  1IZM A;  3S29 A;  2J9U A;  4YT8 A;  1D0Y A;  2JD3 A;  3AQB A;  4J30 B;  3Q6N A;  3F47 A;  2KQ9 A;  4U5H A;  1VK5 A;  3SP1 A;  4C7O B;  2NUT B;  5CI8 A;  2FFH A;  3EPV A;  5KYX A;  4BJ5 C;  3KH2 A;  1Z3I X;  3DJN B;  1TR2 A;  4FWV A;  1MMN A;  2EIK C;  2DYS C;  4OIP F;  2J7P D;  2HV7 A;  1VYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...