2G3KA

Crystal structure of the c-terminal domain of vps28
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
94
structure length
94
Chain Sequence
FNAKYVAEATGNFITVMDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVRINKLSIGDTLTETQIRELLFDLELAYKSFYALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vacuolar protein sorting-associated protein VPS28
publication title The crystal structure of the C-terminal domain of Vps28 reveals a conserved surface required for Vps20 recruitment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 34
structure length 94
sequence length 94
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2006-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1130 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2g3kA00
2J9VA 2J9UA 2G3KA 2J9WA
chains in the Genus database with same CATH superfamily
2JX0A 3UMKA 3FHDA 3DAFA 2OJED 2J9BA 3G4ZA 3JT1A 3K6BA 1YYJA 4PFOA 3SP1A 3TQOA 4F4BA 1Q0FA 2L6HA 4K0DA 2LD6A 5KYXB 4FWVA 2GDCA 2H8AA 3IHUA 3MFNA 1FMWA 1SYQA 3ZQVA 4A4AA 2MYSA 2QE9A 256BA 4ULVA 2H7VC 1Z5ZA 4MW8A 3HNIA 1OKKA 1ORYA 3AJMA 1Z3IX 1O5HA 3MX3A 3Q7LA 4I1MA 4Q4ZF 2KYHA 2J7PD 1C03A 4MS2A 1K04A 5KYWB 4D4XA 3GWLA 2XRHA 3F47A 1ZYRF 1E84A 4U5GA 3U8VA 4L6RA 2JD3A 1JPJA 3O6XA 3I5PA 5F5HA 5E2QA 4U5FE 1GGQA 1H7IA 5TJ5E 5E3AA 1K40A 1JAFA 1LS4A 4MVOA 3U9MA 1S05A 2P61A 1QKRA 2GAQA 1OQCA 3TD7A 2ZXRA 2E87A 4WGZA 2R7WA 2YZSA 1D1BA 1PD0A 4W8PA 4IARA 4JRZA 4NTAA 1M2VB 4DVZA 3N24A 1ORSC 3AG1C 4DXWA 3TJ5A 3NRHA 2KJGA 4LLEA 3W2WA 2XLOA 3DAGA 3PCVA 4N6CA 3K66A 1MMGA 3RF3A 4AK9A 1JRAA 1LPEA 5A6JA 1RKEB 4J7TA 3E70C 4EKWA 4JURI 5GPGB 2ZD9A 4EIYA 2R7UA 3ECSA 1ZVZA 3AQCA 1YDIA 4KNWA 3FDQA 5AC5A 3V7OA 1LKXA 1QVXA 2L9JA 3O55A 5CIVA 4FX5A 2NUTB 2XLHA 2Y3BA 3EGXA 5B1AC 3V5ZA 1FNTc 2YVKA 2YLDA 2KSFA 1RCPA 3A11A 1H9GA 3SXZA 5A6BD 1EI7A 1LVKA 3S0XA 1GM5A 3N2ZB 5T3TA 3K33A 3DD7A 2IXNA 3RKOF 5L0FA 3GWNA 4KNVA 1N1CA 3GODA 4X0RA 2B0JA 5KYYA 1LI7A 3ASOC 5A6BA 1S7ZA 3VF0A 2XM4A 5L0JA 4N6HA 2A0UA 3DWWA 4WGYA 3A9CA 4AE4B 4ANJA 5B1BC 5DVWA 3O39A 1WWPA 1T6IA 3ZTMA 1JR8A 4JIOA 3ATPA 4BJ1A 3PDMP 1CPRA 4OIOF 1BBHA 5BQIA 4YT2A 4AX2A 3QZCA 4E0HA 4C3BA 3T6BA 1VYKA 2CDQA 3QMKA 3HKKA 1K05A 2VCCA 2M64A 1NBBA 3DXJF 4PR9A 2XXAB 1QSPA 3TJ6A 2W4MA 2YEVA 5IY5C 2OEVA 2XL4A 4NQFA 3CEXA 2X51A 1VLTA 2HS5A 2KQ9A 5HV9A 4BEJA 1WATA 3EG9B 2L6FA 1JOGA 1V54C 3ITFA 2L7AA 1LM3B 3JYHA 3V5YA 3W2VA 3IPMO 4WJ0A 2DYSC 1TQGA 1YA9A 2ZXWC 3OWTA 4JTDB 4MTFA 3DJNB 3S9OA 3W4YA 1HMOA 2IM8A 5D92A 3NYMA 4R32A 5COGA 1NG1A 3ZC4A 2XS1A 3RVYA 3M4CA 3G4XA 1AVOB 1FAPB 2D4UA 2KK1A 5DQZA 3AGUA 4KBLA 1RKCA 2LP4A 2IBFA 3Q6NA 1PV3A 1Y6DA 2VASA 3NMKA 4U9EA 4YL3A 1GS9A 2A6HF 3MYFA 3CZ6A 3C8GA 5JSLA 4K1OA 2YKZA 5JT4A 5KYNA 4GQHA 4U5BE 5L0DA 3WHNA 2YL0A 1MMAA 3LNRA 4U5CE 3GM1A 2Z15A 4Z9IA 4EWCA 3HJCA 4EBBA 2OKUA 4CIHA 3Q7GA 1M56C 1M57C 2MHRA 3L8JA 1BZ4A 4CS7A 3I5QA 1HW1A 2Y69C 3EH1A 1C02A 1RXQA 1MNDA 4XPYA 5HSWA 2HSQA 3QW0A 4IRUA 1M2OA 1HMDA 2XLVA 3QVYA 2NSGA 4OIRF 1D1CA 1OCOC 2AP3A 4H4KC 1W2WA 2P0NA 4K7BA 4YT4A 1Q0GA 3LEOA 1OR2A 2R7VA 3K7DA 2HZ8A 2LIGA 2R7XA 2EPOA 2WVQA 2R25A 3HNJA 1MNEA 2W4BA 1GQAA 1SZIA 4D4NA 3C63A 2HMQA 3KL4A 3QVZA 1ZU5A 4C7OA 2YHSA 3ZSUA 3JCUQ 3LUTB 1VOMA 1VB5A 2AWYA 4LDQA 4B6IA 1UG7A 3H2UA 4HFFB 3GEHA 1ST6A 3EGXB 2UUHA 5T3WA 3U3FA 3B0VC 5DS5A 2LCHA 2PNOA 3EGDA 5E3CA 3B9QA 3L0IA 3U2MA 4ER9A 3NDBB 3AG2C 3M15A 4QDLA 4BPMA 4CS8C 3FAPB 1Q0KA 2EIKC 1V55C 2EPLX 3KKBA 1OW8A 3JRTA 4G7HF 1Q0DA 3S29A 2M4EA 3LESA 2LK4A 3AOUA 3CSKA 4LDRA 1LE2A 1TWGA 4E17A 3K1IC 4DRHB 2V3CC 2J46A 3GEEA 2J7PA 2ZXPA 1VK5A 2G3VA 1FR0A 4NTBA 2AVKA 3FVYA 3NG1A 1EA8A 3S84A 5B3SC 4IGGA 2V26A 1KNYA 3KYJA 1E86A 1QPUA 3U0CA 3L1MA 4H54A 1Z23A 4JCHA 3GM2A 1G8XA 3LAYA 3IEEA 2EIMC 4JCZA 3S90A 1XZPA 1V74B 3DJUB 3H2VA 4P6IC 3QTHA 4EUKB 4MTOA 1A7EA 2OCCC 3AG3C 1YZAA 3JSEO 3LEVA 3M79A 2R7TA 2Q00A 1JPNA 5JVEA 1A0BA 3MLGA 1O3UA 2VCAA 4KC9A 3EJNA 4EBJA 2HFIA 3EH2A 2YL7A 2EPKX 1G5ZA 1U6HA 4MVZA 4C3DA 2WVOA 3EHMA 1L3PA 3CAXA 4CDAA 4G7ZF 4YK5A 4OD5A 4ZLDA 4E7SA 4BEMJ 3T6JA 1NU9C 2JPUA 4G0HA 1SF8A 2WL8A 3GORA 3KH2A 3NKDA 1I4ZA 4PJLA 1A7DA 2L6GA 1NSGB 1TFOB 4NY3A 4YN0B 3PHF2 3C8GB 3EZIA 5B3IA 1C17M 3NMIA 2HUJA 1DOVA 1NFOA 3FMSA 4CX9A 2AU5A 1EQ1A 2H7BA 2NUPA 3TOLA 4LACB 1OCZC 1ZHWA 1L7CA 4O6MA 4HEAJ 4YL1A 3DM9B 1OR3A 1HE9A 3UR3C 2L81A 3DM5A 3HNLA 3OA1A 1YJGA 2J0XA 2R03A 3MBGA 5KYUA 4BJ5C 5JUAA 4UDVA 4OIQF 4A2NB 3TK0A 2VH3A 2YRFA 3QW1A 2I15A 3EQLF 1TWCA 2WZFA 3RW0A 4CS8A 5A6KA 3DMDA 1CGOA 4CBEA 1HW2A 3EFOB 5KYXA 2O9XA 4YJWA 4XQ1A 5EGYA 4YWQA 1T6UA 3JZ0A 3IQ6A 3FXHA 5FCLA 3B71A 1ZU4A 4MNDA 5E33A 2PF4E 2P6VA 2Q4FA 2RD9A 5COMA 2R7OA 4XPXA 1Z7Qc 3K1IA 3JSZA 5JS5A 3L34A 4I3MA 2A68F 5AGFA 1APCA 2XLEA 4MVRA 1E85A 4PJMA 5CI9A 3EGDB 3SXMA 3WAQA 2Y3HA 4OIPF 2TMVP 3H65A 1YYXA 3NMJA 4JW1A 3IQ5A 3IQTA 4E7ZA 1WOLA 3S28A 3J06A 2R7SA 5JP7A 4DJ9A 4CJOA 2QTVA 1PD1A 4MVQA 1HE1A 4GYTA 2FGYA 1LS1A 2PP4A 2Q9CA 2XL6A 3AGTA 3V5XA 1QQ3A 1Z63A 2XS8A 1TFKB 3X1OA 2UUIA 3SZRA 3LLIA 1TR2A 2OOCA 4LDKA 5FZTA 3U8PA 3Q6MA 3VM6A 5BQGA 5K0IA 4IAQA 3U3BA 2R05A 4XEKA 3RQFA 3T6GB 1G4US 2KNHA 3R2PA 4ULWA 2NPUA 5DQTA 5JRAA 2CNWD 3ZIBA 2XLWA 4U5HA 2CCYA 2WVNA 1NLXA 5A69A 1Z6AA 4AL0A 1E2XA 2XLMA 4JKVA 4BJTA 3SXKA 3NYLA 2J9UA 4IJJA 1FFTC 2CNWA 3NYJA 3C8ZA 1U89A 1OCCC 3GEIA 4MVSA 3U2LA 3DE9A 3UNGC 1NU7D 3W8IA 2W9YA 2J9WA 1M6TA 4O79A 1QLEC 3W8HA 1J8YF 2A0BA 2HMZA 4FESA 4G78A 3SXYA 3TULA 3LNMB 1KTMA 2HSBA 4M63A 4CDYA 2R7QA 4O6YA 2J0WA 2CW0F 2EIJC 4BJ5A 4DVYP 2P7VA 3ZDLA 3RYLA 1I4YA 1PCXA 1ZW3A 3C62A 3VYWA 2OG2A 3N0TA 4CS9C 1YVIA 1YLMA 2R7RA 3AG4C 4BG0A 1DOWA 1WGWA 2RSEB 4JEBA 1EKYA 2LFDA 3TOMA 2P1AA 1T6QA 1ZHZA 2WZGA 4ZLCA 4CSAC 2Q9AA 5L0IA 5F5FA 1LE4A 1OCRC 1IZMA 4JVSA 4DOZA 2NUPB 5KYYB 2FFHA 2OU6A 4HE8D 4XEVA 4PACA 1MMDA 4AL1A 3ABKC 2EINC 4MW3A 1YZCA 3WG7C 1TKNA 4EHPA 1OXKA 1VMAA 3UMIA 3B0UX 2IXOA 5KYUB 1RMVA 2BC5A 2PBEA 3T9OA 2Y3DA 4JJGA 5BUOA 4Z9HA 1NZEA 2HKVA 2J9VA 2KC3A 2QUPA 1E83A 4GEHA 3ZQYA 3RVZA 4DBQA 4J32B 1OKKD 5D91A 4YT8A 4JZAA 2C04A 3HNKA 2G62A 2NSFA 4I1OB 4J30B 4CDVA 5JLIA 5L0GA 3FAJA 3IQCA 4NC3A 4Q7CA 1YARO 1ZHTA 2H7OA 1TWAA 1T5OA 2AWCA 5L0CA 4O6NA 2A1DD 3B29A 4NCQA 4XTKA 2CGEA 1WASA 3O10A 1YAUO 2MWQA 3ABLC 4RD9A 4PJJA 2ICWG 3T4RA 1ZHXA 1JMWA 1ZZPA 3KMIA 1O87A 1R5ID 3KYIA 3NKEA 1WTYA 2ETSA 4XLPF 2YL1A 2ZPAA 4MQ9F 5DLJA 2Y39A 3JRMO 4Z9JA 5A6AA 3DZAA 3ZTZA 2QLAA 3L8IA 4MTGA 5DS4A 3RFYA 3SEOA 1XWJA 3R7CA 2LFFA 3DE8A 3ZG1A 1A7VA 1SR2A 3BRJA 1KU2A 4JTCB 4U5EE 1NFNA 2DGJA 2GA0A 4XEFA 1D0XA 2BE5F 1T01A 2DI3A 2B0HA 4NTFA 1YA7O 5COFA 5EK0A 3RQGA 3EZHA 1F1MA 1OXBA 1RJ9A 2R9RB 4U9DA 3VRCA 1OW6A 2DYRC 3K1HA 4CS9A 5EHHA 1I5NA 3C7JA 1ZHYA 3C18A 5BQHA 4HFKB 4JE9A 2VB6A 4CSAA 3MYIA 1BDJB 4ONSA 2ASRA 2F22A 4QI0A 1R4TA 1CPQA 2LQGA 4WABA 2Q7RA 2XL8A 3VAYA 1VLSA 1D0YA 1A41A 2DB4A 1D0ZA 2YLIA 2GWWA 2YQYA 3DKAA 1ORJA 3E9VA 3FOPA 3LS0A 4I44A 3M1CB 3ASNC 1VYIA 3JYYA 4JEAA 4YT5A 4C7OB 2QNLA 4EBKA 2NG1A 1BR4A 4U5DE 5KYWA 4YL0A 3M4BA 4BJ6C 1AEPA 4JJFA 4DRJB 3X2QC 1WN0A 4IWBA 3ZWIA 2BL2A 1U0BB 1H6GA 2VC9A 3BEHA 4P9FA 2KGOA 3F46A 4N4WA 4QI2A 2WZLA 4RDAA 2PFDA 1BR2A 4LLCA 4RBNA 2IYLD 3U9JA 2YWAA 4O7GA 2A69F 5DS6A 4Q5SF 2HV6A 2KW3C 2Q9BA 1ZW2A 2G3KA 1AUEA 2HV7A 1SMYF 2Q3TA 4IB4A 3S27A 3EPVA 4P9TA 2EILC 1T9KA 1M2VA 4DRIB 4CIPA 2LSEA 3HTKC 1V4AA 4KI2A 5T1DB 4W8KA 3FOOA 4MVUA 4XPWA 2IXMA 2GFHA 1RKEA 1OW7A 3UMHA 3G50A 1H9TA 1B68A 2PX3A 3HLZA 3LS1A 4N06A 4OINF 3UGPA 4PJNA 3ABMC 3OEOA 3WODF 4E18A 1IW7F 5L3VA 4FAPB 3LLKA 3UGOA 2D5RB 2IXPA 2YL3A 3C8GD 2IOQA 2OQMA 2PX0A 1J8MF 2J8WA 2NUTA 2R02A 3SNHA 2CYDA 1CGNA 2C03A 3EHNA 3GM3A 2FAPB 5CI8A 2XLDA 3DI5A 4LERA 4JTAB 3U5SA 1FFHA 1LIHA 1QZXA 2EPNA 2WB7A 1CGME 3CQZA 2HJ3A 2QY9A 3I4UA 4MVMA 1UFBA 2VCBA 2Y3GA 3AQBA 4J7YA 3US6A 1TWHA 4DBRA 2EPMX 1D1AA 2XSEA 4OD4A 4PFPA 4G7OF 2HJMA 1Y4CA 3LJBA 4AE4A 3JTLO 2J45A 1MMNA 1LI5A 3B0PA 4IAOA 3RIPA 3ZVRA 1HY5A 2YLGA 4C3EA 5L3QA 3POVA 1FTSA 1G4WR 2XM0A 2X0CA 4JC7A 2W45A 1VTMP 4XWJA 1XZQA 2A6EF 5AC4A 5F28E 4XLNF 5L0HA 4E0IA 2OEXA 3RH3A 1BR1A 2I8BA 2OJQA 3EFOA 2XXAA 3GANA 3SYNA 1MQVA 4CJGA 3PMRA 3KPHA 1Q0MA 1FMVA 1RJ9B 2ZXOA 3RQEA 4PK4A 3EG9A 4BJ6A
chains in the Genus database with same CATH topology
3UMKA 3FHDA 3DAFA 3JT1A 3K6BA 3SP1A 4PFOA 4F4BA 4K0DA 5KYXB 4FWVA 1FMWA 2MYSA 2H7VC 1Z5ZA 4U5HA 1OKKA 3MX3A 3Q7LA 1Z3IX 1O5HA 4I1MA 4Q4ZF 2J7PD 5KYWB 2XRHA 3F47A 1ZYRF 4U5GA 2JD3A 1JPJA 3O6XA 3I5PA 5F5HA 5E2QA 4U5FE 5E3AA 3TD7A 2ZXRA 2E87A 2R7WA 2YZSA 1D1BA 1PD0A 4DVZA 1M2VB 3N24A 3AG1C 3NRHA 2KJGA 4LLEA 3W2WA 3DAGA 3K66A 1MMGA 4AK9A 3E70C 4JURI 2R7UA 3ECSA 3AQCA 4KNWA 3FDQA 3V7OA 1LKXA 2L9JA 4FX5A 2NUTB 2Y3BA 3EGXA 5B1AC 3S0XA 1LVKA 3N2ZB 5T3TA 3K33A 3DD7A 2IXNA 3RKOF 4KNVA 1N1CA 3GODA 4X0RA 2B0JA 5KYYA 3ASOC 1S7ZA 4ANJA 4AE4B 5B1BC 5DVWA 3O39A 4BJ1A 4OIOF 4YT2A 4AX2A 3QZCA 4C3BA 3T6BA 1VYKA 2CDQA 3QMKA 3DXJF 2XXAB 5IY5C 2W4MA 2YEVA 2XL4A 2X51A 2KQ9A 4BEJA 3EG9B 1V54C 3ITFA 3JYHA 3W2VA 4WJ0A 2DYSC 3OWTA 2ZXWC 3DJNB 5D92A 3NYMA 1NG1A 3ZC4A 5DQZA 4KBLA 3Q6NA 2VASA 2A6HF 3CZ6A 5KYNA 4U5BE 1MMAA 3LNRA 4U5CE 2Z15A 4EWCA 3HJCA 4EBBA 4CIHA 3Q7GA 1M56C 1M57C 4CS7A 3I5QA 2Y69C 3EH1A 1MNDA 5HSWA 4IRUA 1M2OA 4OIRF 1D1CA 1OCOC 4H4KC 1W2WA 4K7BA 4YT4A 2R7VA 3K7DA 2R7XA 2WVQA 1MNEA 2W4BA 1SZIA 3KL4A 4C7OA 1ZU5A 2YHSA 3ZSUA 3JCUQ 1VOMA 4B6IA 4HFFB 5DS5A 1ST6A 3EGXB 5T3WA 3B0VC 3EGDA 5E3CA 3B9QA 3L0IA 3NDBB 3AG2C 4QDLA 4CS8C 2EIKC 1V55C 3KKBA 3JRTA 4G7HF 3S29A 2M4EA 3LESA 3CSKA 1TWGA 3K1IC 2V3CC 2J46A 2J7PA 2ZXPA 1VK5A 2G3VA 3FVYA 3NG1A 5B3SC 2V26A 4JCHA 1Z23A 1G8XA 3LAYA 3IEEA 2EIMC 3DJUB 4P6IC 2OCCC 3AG3C 3LEVA 2R7TA 1JPNA 3MLGA 4KC9A 3EJNA 3EH2A 4C3DA 2WVOA 3EHMA 4G7ZF 4OD5A 4ZLDA 4E7SA 3T6JA 1NU9C 4G0HA 1SF8A 2WL8A 3KH2A 3NKDA 4PJLA 4PFPA 4XLPF 3PHF2 3B0UX 4NY3A 4YN0B 3EZIA 2H7BA 2NUPA 4LACB 1OCZC 1ZHWA 4O6MA 4HEAJ 3DM9B 3UR3C 2L81A 3DM5A 3OA1A 5KYUA 2J0XA 4OIQF 4BJ5C 4A2NB 2VH3A 3EQLF 1TWCA 2WZFA 4CS8A 3DMDA 4CBEA 3EFOB 5KYXA 2O9XA 4YJWA 5EGYA 4YWQA 5FCLA 4MNDA 1ZU4A 5E33A 2PF4E 2P6VA 2R7OA 3JSZA 3L34A 4I3MA 2A68F 4PJMA 5CI9A 3EGDB 4OIPF 2Y3HA 3H65A 4JW1A 4E7ZA 3S28A 2R7SA 2QTVA 1PD1A 4GYTA 2FGYA 1LS1A 2PP4A 2Q9CA 1Z63A 3X1OA 3SZRA 3LLIA 1TR2A 3Q6MA 4ULWA 2KNHA 5DQTA 2CNWD 3ZIBA 2WVNA 1Z6AA 4BJTA 3NYLA 2J9UA 4IJJA 1FFTC 2CNWA 3NYJA 1OCCC 3UNGC 1NU7D 3W8IA 2W9YA 2J9WA 4O79A 3W8HA 1QLEC 1J8YF 4FESA 4M63A 2R7QA 4O6YA 2J0WA 2CW0F 2EIJC 4BJ5A 4DVYP 2P7VA 3RYLA 1PCXA 3VYWA 2OG2A 3N0TA 4CS9C 2R7RA 3AG4C 4BG0A 1WGWA 2WZGA 4CSAC 1ZHZA 4ZLCA 2Q9AA 5F5FA 1OCRC 1IZMA 4JVSA 4DOZA 2NUPB 5KYYB 2FFHA 4HE8D 1MMDA 3ABKC 2EINC 3WG7C 1TKNA 1VMAA 3UMIA 2IXOA 5KYUB 2Y3DA 4JJGA 5BUOA 1NZEA 2J9VA 4GEHA 4DBQA 4J32B 1OKKD 5D91A 4YT8A 4JZAA 2C04A 2G62A 4I1OB 4J30B 3FAJA 4Q7CA 1ZHTA 2H7OA 1TWAA 4O6NA 2A1DD 4XTKA 2CGEA 2MWQA 3ABLC 4RD9A 4PJJA 3T4RA 1ZHXA 3KMIA 1O87A 3NKEA 2ZPAA 4MQ9F 5DLJA 2Y39A 3DZAA 5DS4A 3RFYA 3SEOA 3ZG1A 4U5EE 1KU2A 2DGJA 1D0XA 2BE5F 3EZHA 1RJ9A 5EHHA 2DYRC 4CS9A 3K1HA 1ZHYA 4HFKB 2VB6A 4CSAA 4QI0A 3VAYA 1D0YA 1D0ZA 3E9VA 3LS0A 4OINF 4I44A 4YT5A 3M1CB 3ASNC 1VYIA 4C7OB 2NG1A 1BR4A 4U5DE 5KYWA 4BJ6C 4JJFA 3X2QC 4IWBA 2KGOA 3F46A 4QI2A 2WZLA 4RDAA 2PFDA 1BR2A 4LLCA 4RBNA 2IYLD 4O7GA 2A69F 5DS6A 4Q5SF 2HV6A 2KW3C 2Q9BA 2G3KA 2HV7A 2Q3TA 1SMYF 3S27A 3EPVA 2EILC 1M2VA 2LSEA 3HTKC 4KI2A 5T1DB 4W8KA 2IXMA 2GFHA 3UMHA 3HLZA 2PX3A 3LS1A 4N06A 3UGPA 4PJNA 3ABMC 3OEOA 3WODF 1IW7F 5L3VA 3UGOA 3LLKA 2D5RB 2IXPA 2IOQA 2PX0A 1J8MF 2NUTA 3SNHA 5CI8A 2C03A 3EHNA 4LERA 1FFHA 1QZXA 2WB7A 3CQZA 2QY9A 3I4UA 2Y3GA 3AQBA 4DBRA 1TWHA 1D1AA 2XSEA 4OD4A 4G7OF 3LJBA 4AE4A 2J45A 1MMNA 4IAOA 3B0PA 3RIPA 3ZVRA 4C3EA 5L3QA 3POVA 1FTSA 2W45A 4XWJA 2A6EF 4XLNF 3RH3A 1BR1A 2I8BA 3EFOA 2XXAA 3GANA 3SYNA 3PMRA 1FMVA 1RJ9B 2ZXOA 4PK4A 3EG9A 4BJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9V A;  2J9U A;  2G3K A;  2J9W A; 
#chains in the Genus database with same CATH topology
 2JX0 A;  3UMK A;  3FHD A;  3DAF A;  2OJE D;  2J9B A;  3G4Z A;  3JT1 A;  3K6B A;  1YYJ A;  4PFO A;  3SP1 A;  3TQO A;  4F4B A;  1Q0F A;  2L6H A;  4K0D A;  2LD6 A;  5KYX B;  4FWV A;  2GDC A;  2H8A A;  3IHU A;  3MFN A;  1FMW A;  1SYQ A;  3ZQV A;  4A4A A;  2MYS A;  2QE9 A;  256B A;  4ULV A;  2H7V C;  1Z5Z A;  4MW8 A;  3HNI A;  1OKK A;  1ORY A;  3AJM A;  1Z3I X;  1O5H A;  3MX3 A;  3Q7L A;  4I1M A;  4Q4Z F;  2KYH A;  2J7P D;  1C03 A;  4MS2 A;  1K04 A;  5KYW B;  4D4X A;  3GWL A;  2XRH A;  3F47 A;  1ZYR F;  1E84 A;  4U5G A;  3U8V A;  4L6R A;  2JD3 A;  1JPJ A;  3O6X A;  3I5P A;  5F5H A;  5E2Q A;  4U5F E;  1GGQ A;  1H7I A;  5TJ5 E;  5E3A A;  1K40 A;  1JAF A;  1LS4 A;  4MVO A;  3U9M A;  1S05 A;  2P61 A;  1QKR A;  2GAQ A;  1OQC A;  3TD7 A;  2ZXR A;  2E87 A;  4WGZ A;  2R7W A;  2YZS A;  1D1B A;  1PD0 A;  4W8P A;  4IAR A;  4JRZ A;  4NTA A;  1M2V B;  4DVZ A;  3N24 A;  1ORS C;  3AG1 C;  4DXW A;  3TJ5 A;  3NRH A;  2KJG A;  4LLE A;  3W2W A;  2XLO A;  3DAG A;  3PCV A;  4N6C A;  3K66 A;  1MMG A;  3RF3 A;  4AK9 A;  1JRA A;  1LPE A;  5A6J A;  1RKE B;  4J7T A;  3E70 C;  4EKW A;  4JUR I;  5GPG B;  2ZD9 A;  4EIY A;  2R7U A;  3ECS A;  1ZVZ A;  3AQC A;  1YDI A;  4KNW A;  3FDQ A;  5AC5 A;  3V7O A;  1LKX A;  1QVX A;  2L9J A;  3O55 A;  5CIV A;  4FX5 A;  2NUT B;  2XLH A;  2Y3B A;  3EGX A;  5B1A C;  3V5Z A;  1FNT c;  2YVK A;  2YLD A;  2KSF A;  1RCP A;  3A11 A;  1H9G A;  3SXZ A;  5A6B D;  1EI7 A;  1LVK A;  3S0X A;  1GM5 A;  3N2Z B;  5T3T A;  3K33 A;  3DD7 A;  2IXN A;  3RKO F;  5L0F A;  3GWN A;  4KNV A;  1N1C A;  3GOD A;  4X0R A;  2B0J A;  5KYY A;  1LI7 A;  3ASO C;  5A6B A;  1S7Z A;  3VF0 A;  2XM4 A;  5L0J A;  4N6H A;  2A0U A;  3DWW A;  4WGY A;  3A9C A;  4AE4 B;  4ANJ A;  5B1B C;  5DVW A;  3O39 A;  1WWP A;  1T6I A;  3ZTM A;  1JR8 A;  4JIO A;  3ATP A;  4BJ1 A;  3PDM P;  1CPR A;  4OIO F;  1BBH A;  5BQI A;  4YT2 A;  4AX2 A;  3QZC A;  4E0H A;  4C3B A;  3T6B A;  1VYK A;  2CDQ A;  3QMK A;  3HKK A;  1K05 A;  2VCC A;  2M64 A;  1NBB A;  3DXJ F;  4PR9 A;  2XXA B;  1QSP A;  3TJ6 A;  2W4M A;  2YEV A;  5IY5 C;  2OEV A;  2XL4 A;  4NQF A;  3CEX A;  2X51 A;  1VLT A;  2HS5 A;  2KQ9 A;  5HV9 A;  4BEJ A;  1WAT A;  3EG9 B;  2L6F A;  1JOG A;  1V54 C;  3ITF A;  2L7A A;  1LM3 B;  3JYH A;  3V5Y A;  3W2V A;  3IPM O;  4WJ0 A;  2DYS C;  1TQG A;  1YA9 A;  2ZXW C;  3OWT A;  4JTD B;  4MTF A;  3DJN B;  3S9O A;  3W4Y A;  1HMO A;  2IM8 A;  5D92 A;  3NYM A;  4R32 A;  5COG A;  1NG1 A;  3ZC4 A;  2XS1 A;  3RVY A;  3M4C A;  3G4X A;  1AVO B;  1FAP B;  2D4U A;  2KK1 A;  5DQZ A;  3AGU A;  4KBL A;  1RKC A;  2LP4 A;  2IBF A;  3Q6N A;  1PV3 A;  1Y6D A;  2VAS A;  3NMK A;  4U9E A;  4YL3 A;  1GS9 A;  2A6H F;  3MYF A;  3CZ6 A;  3C8G A;  5JSL A;  4K1O A;  2YKZ A;  5JT4 A;  5KYN A;  4GQH A;  4U5B E;  5L0D A;  3WHN A;  2YL0 A;  1MMA A;  3LNR A;  4U5C E;  3GM1 A;  2Z15 A;  4Z9I A;  4EWC A;  3HJC A;  4EBB A;  2OKU A;  4CIH A;  3Q7G A;  1M56 C;  1M57 C;  2MHR A;  3L8J A;  1BZ4 A;  4CS7 A;  3I5Q A;  1HW1 A;  2Y69 C;  3EH1 A;  1C02 A;  1RXQ A;  1MND A;  4XPY A;  5HSW A;  2HSQ A;  3QW0 A;  4IRU A;  1M2O A;  1HMD A;  2XLV A;  3QVY A;  2NSG A;  4OIR F;  1D1C A;  1OCO C;  2AP3 A;  4H4K C;  1W2W A;  2P0N A;  4K7B A;  4YT4 A;  1Q0G A;  3LEO A;  1OR2 A;  2R7V A;  3K7D A;  2HZ8 A;  2LIG A;  2R7X A;  2EPO A;  2WVQ A;  2R25 A;  3HNJ A;  1MNE A;  2W4B A;  1GQA A;  1SZI A;  4D4N A;  3C63 A;  2HMQ A;  3KL4 A;  3QVZ A;  1ZU5 A;  4C7O A;  2YHS A;  3ZSU A;  3JCU Q;  3LUT B;  1VOM A;  1VB5 A;  2AWY A;  4LDQ A;  4B6I A;  1UG7 A;  3H2U A;  4HFF B;  3GEH A;  1ST6 A;  3EGX B;  2UUH A;  5T3W A;  3U3F A;  3B0V C;  5DS5 A;  2LCH A;  2PNO A;  3EGD A;  5E3C A;  3B9Q A;  3L0I A;  3U2M A;  4ER9 A;  3NDB B;  3AG2 C;  3M15 A;  4QDL A;  4BPM A;  4CS8 C;  3FAP B;  1Q0K A;  2EIK C;  1V55 C;  2EPL X;  3KKB A;  1OW8 A;  3JRT A;  4G7H F;  1Q0D A;  3S29 A;  2M4E A;  3LES A;  2LK4 A;  3AOU A;  3CSK A;  4LDR A;  1LE2 A;  1TWG A;  4E17 A;  3K1I C;  4DRH B;  2V3C C;  2J46 A;  3GEE A;  2J7P A;  2ZXP A;  1VK5 A;  2G3V A;  1FR0 A;  4NTB A;  2AVK A;  3FVY A;  3NG1 A;  1EA8 A;  3S84 A;  5B3S C;  4IGG A;  2V26 A;  1KNY A;  3KYJ A;  1E86 A;  1QPU A;  3U0C A;  3L1M A;  4H54 A;  1Z23 A;  4JCH A;  3GM2 A;  1G8X A;  3LAY A;  3IEE A;  2EIM C;  4JCZ A;  3S90 A;  1XZP A;  1V74 B;  3DJU B;  3H2V A;  4P6I C;  3QTH A;  4EUK B;  4MTO A;  1A7E A;  2OCC C;  3AG3 C;  1YZA A;  3JSE O;  3LEV A;  3M79 A;  2R7T A;  2Q00 A;  1JPN A;  5JVE A;  1A0B A;  3MLG A;  1O3U A;  2VCA A;  4KC9 A;  3EJN A;  4EBJ A;  2HFI A;  3EH2 A;  2YL7 A;  2EPK X;  1G5Z A;  1U6H A;  4MVZ A;  4C3D A;  2WVO A;  3EHM A;  1L3P A;  3CAX A;  4CDA A;  4G7Z F;  4YK5 A;  4OD5 A;  4ZLD A;  4E7S A;  4BEM J;  3T6J A;  1NU9 C;  2JPU A;  4G0H A;  1SF8 A;  2WL8 A;  3GOR A;  3KH2 A;  3NKD A;  1I4Z A;  4PJL A;  1A7D A;  2L6G A;  1NSG B;  1TFO B;  4NY3 A;  4YN0 B;  3PHF 2;  3C8G B;  3EZI A;  5B3I A;  1C17 M;  3NMI A;  2HUJ A;  1DOV A;  1NFO A;  3FMS A;  4CX9 A;  2AU5 A;  1EQ1 A;  2H7B A;  2NUP A;  3TOL A;  4LAC B;  1OCZ C;  1ZHW A;  1L7C A;  4O6M A;  4HEA J;  4YL1 A;  3DM9 B;  1OR3 A;  1HE9 A;  3UR3 C;  2L81 A;  3DM5 A;  3HNL A;  3OA1 A;  1YJG A;  2J0X A;  2R03 A;  3MBG A;  5KYU A;  4BJ5 C;  5JUA A;  4UDV A;  4OIQ F;  4A2N B;  3TK0 A;  2VH3 A;  2YRF A;  3QW1 A;  2I15 A;  3EQL F;  1TWC A;  2WZF A;  3RW0 A;  4CS8 A;  5A6K A;  3DMD A;  1CGO A;  4CBE A;  1HW2 A;  3EFO B;  5KYX A;  2O9X A;  4YJW A;  4XQ1 A;  5EGY A;  4YWQ A;  1T6U A;  3JZ0 A;  3IQ6 A;  3FXH A;  5FCL A;  3B71 A;  1ZU4 A;  4MND A;  5E33 A;  2PF4 E;  2P6V A;  2Q4F A;  2RD9 A;  5COM A;  2R7O A;  4XPX A;  1Z7Q c;  3K1I A;  3JSZ A;  5JS5 A;  3L34 A;  4I3M A;  2A68 F;  5AGF A;  1APC A;  2XLE A;  4MVR A;  1E85 A;  4PJM A;  5CI9 A;  3EGD B;  3SXM A;  3WAQ A;  2Y3H A;  4OIP F;  2TMV P;  3H65 A;  1YYX A;  3NMJ A;  4JW1 A;  3IQ5 A;  3IQT A;  4E7Z A;  1WOL A;  3S28 A;  3J06 A;  2R7S A;  5JP7 A;  4DJ9 A;  4CJO A;  2QTV A;  1PD1 A;  4MVQ A;  1HE1 A;  4GYT A;  2FGY A;  1LS1 A;  2PP4 A;  2Q9C A;  2XL6 A;  3AGT A;  3V5X A;  1QQ3 A;  1Z63 A;  2XS8 A;  1TFK B;  3X1O A;  2UUI A;  3SZR A;  3LLI A;  1TR2 A;  2OOC A;  4LDK A;  5FZT A;  3U8P A;  3Q6M A;  3VM6 A;  5BQG A;  5K0I A;  4IAQ A;  3U3B A;  2R05 A;  4XEK A;  3RQF A;  3T6G B;  1G4U S;  2KNH A;  3R2P A;  4ULW A;  2NPU A;  5DQT A;  5JRA A;  2CNW D;  3ZIB A;  2XLW A;  4U5H A;  2CCY A;  2WVN A;  1NLX A;  5A69 A;  1Z6A A;  4AL0 A;  1E2X A;  2XLM A;  4JKV A;  4BJT A;  3SXK A;  3NYL A;  2J9U A;  4IJJ A;  1FFT C;  2CNW A;  3NYJ A;  3C8Z A;  1U89 A;  1OCC C;  3GEI A;  4MVS A;  3U2L A;  3DE9 A;  3UNG C;  1NU7 D;  3W8I A;  2W9Y A;  2J9W A;  1M6T A;  4O79 A;  1QLE C;  3W8H A;  1J8Y F;  2A0B A;  2HMZ A;  4FES A;  4G78 A;  3SXY A;  3TUL A;  3LNM B;  1KTM A;  2HSB A;  4M63 A;  4CDY A;  2R7Q A;  4O6Y A;  2J0W A;  2CW0 F;  2EIJ C;  4BJ5 A;  4DVY P;  2P7V A;  3ZDL A;  3RYL A;  1I4Y A;  1PCX A;  1ZW3 A;  3C62 A;  3VYW A;  2OG2 A;  3N0T A;  4CS9 C;  1YVI A;  1YLM A;  2R7R A;  3AG4 C;  4BG0 A;  1DOW A;  1WGW A;  2RSE B;  4JEB A;  1EKY A;  2LFD A;  3TOM A;  2P1A A;  1T6Q A;  1ZHZ A;  2WZG A;  4ZLC A;  4CSA C;  2Q9A A;  5L0I A;  5F5F A;  1LE4 A;  1OCR C;  1IZM A;  4JVS A;  4DOZ A;  2NUP B;  5KYY B;  2FFH A;  2OU6 A;  4HE8 D;  4XEV A;  4PAC A;  1MMD A;  4AL1 A;  3ABK C;  2EIN C;  4MW3 A;  1YZC A;  3WG7 C;  1TKN A;  4EHP A;  1OXK A;  1VMA A;  3UMI A;  3B0U X;  2IXO A;  5KYU B;  1RMV A;  2BC5 A;  2PBE A;  3T9O A;  2Y3D A;  4JJG A;  5BUO A;  4Z9H A;  1NZE A;  2HKV A;  2J9V A;  2KC3 A;  2QUP A;  1E83 A;  4GEH A;  3ZQY A;  3RVZ A;  4DBQ A;  4J32 B;  1OKK D;  5D91 A;  4YT8 A;  4JZA A;  2C04 A;  3HNK A;  2G62 A;  2NSF A;  4I1O B;  4J30 B;  4CDV A;  5JLI A;  5L0G A;  3FAJ A;  3IQC A;  4NC3 A;  4Q7C A;  1YAR O;  1ZHT A;  2H7O A;  1TWA A;  1T5O A;  2AWC A;  5L0C A;  4O6N A;  2A1D D;  3B29 A;  4NCQ A;  4XTK A;  2CGE A;  1WAS A;  3O10 A;  1YAU O;  2MWQ A;  3ABL C;  4RD9 A;  4PJJ A;  2ICW G;  3T4R A;  1ZHX A;  1JMW A;  1ZZP A;  3KMI A;  1O87 A;  1R5I D;  3KYI A;  3NKE A;  1WTY A;  2ETS A;  4XLP F;  2YL1 A;  2ZPA A;  4MQ9 F;  5DLJ A;  2Y39 A;  3JRM O;  4Z9J A;  5A6A A;  3DZA A;  3ZTZ A;  2QLA A;  3L8I A;  4MTG A;  5DS4 A;  3RFY A;  3SEO A;  1XWJ A;  3R7C A;  2LFF A;  3DE8 A;  3ZG1 A;  1A7V A;  1SR2 A;  3BRJ A;  1KU2 A;  4JTC B;  4U5E E;  1NFN A;  2DGJ A;  2GA0 A;  4XEF A;  1D0X A;  2BE5 F;  1T01 A;  2DI3 A;  2B0H A;  4NTF A;  1YA7 O;  5COF A;  5EK0 A;  3RQG A;  3EZH A;  1F1M A;  1OXB A;  1RJ9 A;  2R9R B;  4U9D A;  3VRC A;  1OW6 A;  2DYR C;  3K1H A;  4CS9 A;  5EHH A;  1I5N A;  3C7J A;  1ZHY A;  3C18 A;  5BQH A;  4HFK B;  4JE9 A;  2VB6 A;  4CSA A;  3MYI A;  1BDJ B;  4ONS A;  2ASR A;  2F22 A;  4QI0 A;  1R4T A;  1CPQ A;  2LQG A;  4WAB A;  2Q7R A;  2XL8 A;  3VAY A;  1VLS A;  1D0Y A;  1A41 A;  2DB4 A;  1D0Z A;  2YLI A;  2GWW A;  2YQY A;  3DKA A;  1ORJ A;  3E9V A;  3FOP A;  3LS0 A;  4I44 A;  3M1C B;  3ASN C;  1VYI A;  3JYY A;  4JEA A;  4YT5 A;  4C7O B;  2QNL A;  4EBK A;  2NG1 A;  1BR4 A;  4U5D E;  5KYW A;  4YL0 A;  3M4B A;  4BJ6 C;  1AEP A;  4JJF A;  4DRJ B;  3X2Q C;  1WN0 A;  4IWB A;  3ZWI A;  2BL2 A;  1U0B B;  1H6G A;  2VC9 A;  3BEH A;  4P9F A;  2KGO A;  3F46 A;  4N4W A;  4QI2 A;  2WZL A;  4RDA A;  2PFD A;  1BR2 A;  4LLC A;  4RBN A;  2IYL D;  3U9J A;  2YWA A;  4O7G A;  2A69 F;  5DS6 A;  4Q5S F;  2HV6 A;  2KW3 C;  2Q9B A;  1ZW2 A;  2G3K A;  1AUE A;  2HV7 A;  1SMY F;  2Q3T A;  4IB4 A;  3S27 A;  3EPV A;  4P9T A;  2EIL C;  1T9K A;  1M2V A;  4DRI B;  4CIP A;  2LSE A;  3HTK C;  1V4A A;  4KI2 A;  5T1D B;  4W8K A;  3FOO A;  4MVU A;  4XPW A;  2IXM A;  2GFH A;  1RKE A;  1OW7 A;  3UMH A;  3G50 A;  1H9T A;  1B68 A;  2PX3 A;  3HLZ A;  3LS1 A;  4N06 A;  4OIN F;  3UGP A;  4PJN A;  3ABM C;  3OEO A;  3WOD F;  4E18 A;  1IW7 F;  5L3V A;  4FAP B;  3LLK A;  3UGO A;  2D5R B;  2IXP A;  2YL3 A;  3C8G D;  2IOQ A;  2OQM A;  2PX0 A;  1J8M F;  2J8W A;  2NUT A;  2R02 A;  3SNH A;  2CYD A;  1CGN A;  2C03 A;  3EHN A;  3GM3 A;  2FAP B;  5CI8 A;  2XLD A;  3DI5 A;  4LER A;  4JTA B;  3U5S A;  1FFH A;  1LIH A;  1QZX A;  2EPN A;  2WB7 A;  1CGM E;  3CQZ A;  2HJ3 A;  2QY9 A;  3I4U A;  4MVM A;  1UFB A;  2VCB A;  2Y3G A;  3AQB A;  4J7Y A;  3US6 A;  1TWH A;  4DBR A;  2EPM X;  1D1A A;  2XSE A;  4OD4 A;  4PFP A;  4G7O F;  2HJM A;  1Y4C A;  3LJB A;  4AE4 A;  3JTL O;  2J45 A;  1MMN A;  1LI5 A;  3B0P A;  4IAO A;  3RIP A;  3ZVR A;  1HY5 A;  2YLG A;  4C3E A;  5L3Q A;  3POV A;  1FTS A;  1G4W R;  2XM0 A;  2X0C A;  4JC7 A;  2W45 A;  1VTM P;  4XWJ A;  1XZQ A;  2A6E F;  5AC4 A;  5F28 E;  4XLN F;  5L0H A;  4E0I A;  2OEX A;  3RH3 A;  1BR1 A;  2I8B A;  2OJQ A;  3EFO A;  2XXA A;  3GAN A;  3SYN A;  1MQV A;  4CJG A;  3PMR A;  3KPH A;  1Q0M A;  1FMV A;  1RJ9 B;  2ZXO A;  3RQE A;  4PK4 A;  3EG9 A;  4BJ6 A; 
#chains in the Genus database with same CATH homology
 3UMK A;  3FHD A;  3DAF A;  3JT1 A;  3K6B A;  3SP1 A;  4PFO A;  4F4B A;  4K0D A;  5KYX B;  4FWV A;  1FMW A;  2MYS A;  2H7V C;  1Z5Z A;  4U5H A;  1OKK A;  3MX3 A;  3Q7L A;  1Z3I X;  1O5H A;  4I1M A;  4Q4Z F;  2J7P D;  5KYW B;  2XRH A;  3F47 A;  1ZYR F;  4U5G A;  2JD3 A;  1JPJ A;  3O6X A;  3I5P A;  5F5H A;  5E2Q A;  4U5F E;  5E3A A;  3TD7 A;  2ZXR A;  2E87 A;  2R7W A;  2YZS A;  1D1B A;  1PD0 A;  4DVZ A;  1M2V B;  3N24 A;  3AG1 C;  3NRH A;  2KJG A;  4LLE A;  3W2W A;  3DAG A;  3K66 A;  1MMG A;  4AK9 A;  3E70 C;  4JUR I;  2R7U A;  3ECS A;  3AQC A;  4KNW A;  3FDQ A;  3V7O A;  1LKX A;  2L9J A;  4FX5 A;  2NUT B;  2Y3B A;  3EGX A;  5B1A C;  3S0X A;  1LVK A;  3N2Z B;  5T3T A;  3K33 A;  3DD7 A;  2IXN A;  3RKO F;  4KNV A;  1N1C A;  3GOD A;  4X0R A;  2B0J A;  5KYY A;  3ASO C;  1S7Z A;  4ANJ A;  4AE4 B;  5B1B C;  5DVW A;  3O39 A;  4BJ1 A;  4OIO F;  4YT2 A;  4AX2 A;  3QZC A;  4C3B A;  3T6B A;  1VYK A;  2CDQ A;  3QMK A;  3DXJ F;  2XXA B;  5IY5 C;  2W4M A;  2YEV A;  2XL4 A;  2X51 A;  2KQ9 A;  4BEJ A;  3EG9 B;  1V54 C;  3ITF A;  3JYH A;  3W2V A;  4WJ0 A;  2DYS C;  3OWT A;  2ZXW C;  3DJN B;  5D92 A;  3NYM A;  1NG1 A;  3ZC4 A;  5DQZ A;  4KBL A;  3Q6N A;  2VAS A;  2A6H F;  3CZ6 A;  5KYN A;  4U5B E;  1MMA A;  3LNR A;  4U5C E;  2Z15 A;  4EWC A;  3HJC A;  4EBB A;  4CIH A;  3Q7G A;  1M56 C;  1M57 C;  4CS7 A;  3I5Q A;  2Y69 C;  3EH1 A;  1MND A;  5HSW A;  4IRU A;  1M2O A;  4OIR F;  1D1C A;  1OCO C;  4H4K C;  1W2W A;  4K7B A;  4YT4 A;  2R7V A;  3K7D A;  2R7X A;  2WVQ A;  1MNE A;  2W4B A;  1SZI A;  3KL4 A;  4C7O A;  1ZU5 A;  2YHS A;  3ZSU A;  3JCU Q;  1VOM A;  4B6I A;  4HFF B;  5DS5 A;  1ST6 A;  3EGX B;  5T3W A;  3B0V C;  3EGD A;  5E3C A;  3B9Q A;  3L0I A;  3NDB B;  3AG2 C;  4QDL A;  4CS8 C;  2EIK C;  1V55 C;  3KKB A;  3JRT A;  4G7H F;  3S29 A;  2M4E A;  3LES A;  3CSK A;  1TWG A;  3K1I C;  2V3C C;  2J46 A;  2J7P A;  2ZXP A;  1VK5 A;  2G3V A;  3FVY A;  3NG1 A;  5B3S C;  2V26 A;  4JCH A;  1Z23 A;  1G8X A;  3LAY A;  3IEE A;  2EIM C;  3DJU B;  4P6I C;  2OCC C;  3AG3 C;  3LEV A;  2R7T A;  1JPN A;  3MLG A;  4KC9 A;  3EJN A;  3EH2 A;  4C3D A;  2WVO A;  3EHM A;  4G7Z F;  4OD5 A;  4ZLD A;  4E7S A;  3T6J A;  1NU9 C;  4G0H A;  1SF8 A;  2WL8 A;  3KH2 A;  3NKD A;  4PJL A;  4PFP A;  4XLP F;  3PHF 2;  3B0U X;  4NY3 A;  4YN0 B;  3EZI A;  2H7B A;  2NUP A;  4LAC B;  1OCZ C;  1ZHW A;  4O6M A;  4HEA J;  3DM9 B;  3UR3 C;  2L81 A;  3DM5 A;  3OA1 A;  5KYU A;  2J0X A;  4OIQ F;  4BJ5 C;  4A2N B;  2VH3 A;  3EQL F;  1TWC A;  2WZF A;  4CS8 A;  3DMD A;  4CBE A;  3EFO B;  5KYX A;  2O9X A;  4YJW A;  5EGY A;  4YWQ A;  5FCL A;  4MND A;  1ZU4 A;  5E33 A;  2PF4 E;  2P6V A;  2R7O A;  3JSZ A;  3L34 A;  4I3M A;  2A68 F;  4PJM A;  5CI9 A;  3EGD B;  4OIP F;  2Y3H A;  3H65 A;  4JW1 A;  4E7Z A;  3S28 A;  2R7S A;  2QTV A;  1PD1 A;  4GYT A;  2FGY A;  1LS1 A;  2PP4 A;  2Q9C A;  1Z63 A;  3X1O A;  3SZR A;  3LLI A;  1TR2 A;  3Q6M A;  4ULW A;  2KNH A;  5DQT A;  2CNW D;  3ZIB A;  2WVN A;  1Z6A A;  4BJT A;  3NYL A;  2J9U A;  4IJJ A;  1FFT C;  2CNW A;  3NYJ A;  1OCC C;  3UNG C;  1NU7 D;  3W8I A;  2W9Y A;  2J9W A;  4O79 A;  3W8H A;  1QLE C;  1J8Y F;  4FES A;  4M63 A;  2R7Q A;  4O6Y A;  2J0W A;  2CW0 F;  2EIJ C;  4BJ5 A;  4DVY P;  2P7V A;  3RYL A;  1PCX A;  3VYW A;  2OG2 A;  3N0T A;  4CS9 C;  2R7R A;  3AG4 C;  4BG0 A;  1WGW A;  2WZG A;  4CSA C;  1ZHZ A;  4ZLC A;  2Q9A A;  5F5F A;  1OCR C;  1IZM A;  4JVS A;  4DOZ A;  2NUP B;  5KYY B;  2FFH A;  4HE8 D;  1MMD A;  3ABK C;  2EIN C;  3WG7 C;  1TKN A;  1VMA A;  3UMI A;  2IXO A;  5KYU B;  2Y3D A;  4JJG A;  5BUO A;  1NZE A;  2J9V A;  4GEH A;  4DBQ A;  4J32 B;  1OKK D;  5D91 A;  4YT8 A;  4JZA A;  2C04 A;  2G62 A;  4I1O B;  4J30 B;  3FAJ A;  4Q7C A;  1ZHT A;  2H7O A;  1TWA A;  4O6N A;  2A1D D;  4XTK A;  2CGE A;  2MWQ A;  3ABL C;  4RD9 A;  4PJJ A;  3T4R A;  1ZHX A;  3KMI A;  1O87 A;  3NKE A;  2ZPA A;  4MQ9 F;  5DLJ A;  2Y39 A;  3DZA A;  5DS4 A;  3RFY A;  3SEO A;  3ZG1 A;  4U5E E;  1KU2 A;  2DGJ A;  1D0X A;  2BE5 F;  3EZH A;  1RJ9 A;  5EHH A;  2DYR C;  4CS9 A;  3K1H A;  1ZHY A;  4HFK B;  2VB6 A;  4CSA A;  4QI0 A;  3VAY A;  1D0Y A;  1D0Z A;  3E9V A;  3LS0 A;  4OIN F;  4I44 A;  4YT5 A;  3M1C B;  3ASN C;  1VYI A;  4C7O B;  2NG1 A;  1BR4 A;  4U5D E;  5KYW A;  4BJ6 C;  4JJF A;  3X2Q C;  4IWB A;  2KGO A;  3F46 A;  4QI2 A;  2WZL A;  4RDA A;  2PFD A;  1BR2 A;  4LLC A;  4RBN A;  2IYL D;  4O7G A;  2A69 F;  5DS6 A;  4Q5S F;  2HV6 A;  2KW3 C;  2Q9B A;  2G3K A;  2HV7 A;  2Q3T A;  1SMY F;  3S27 A;  3EPV A;  2EIL C;  1M2V A;  2LSE A;  3HTK C;  4KI2 A;  5T1D B;  4W8K A;  2IXM A;  2GFH A;  3UMH A;  3HLZ A;  2PX3 A;  3LS1 A;  4N06 A;  3UGP A;  4PJN A;  3ABM C;  3OEO A;  3WOD F;  1IW7 F;  5L3V A;  3UGO A;  3LLK A;  2D5R B;  2IXP A;  2IOQ A;  2PX0 A;  1J8M F;  2NUT A;  3SNH A;  5CI8 A;  2C03 A;  3EHN A;  4LER A;  1FFH A;  1QZX A;  2WB7 A;  3CQZ A;  2QY9 A;  3I4U A;  2Y3G A;  3AQB A;  4DBR A;  1TWH A;  1D1A A;  2XSE A;  4OD4 A;  4G7O F;  3LJB A;  4AE4 A;  2J45 A;  1MMN A;  4IAO A;  3B0P A;  3RIP A;  3ZVR A;  4C3E A;  5L3Q A;  3POV A;  1FTS A;  2W45 A;  4XWJ A;  2A6E F;  4XLN F;  3RH3 A;  1BR1 A;  2I8B A;  3EFO A;  2XXA A;  3GAN A;  3SYN A;  3PMR A;  1FMV A;  1RJ9 B;  2ZXO A;  4PK4 A;  3EG9 A;  4BJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...