3ZTMA

Cytochrome c prime from alcaligenes xylosoxidans: as isolated l16g variant at 0.9 a resolution: unrestraint refinement
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAGTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 52
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3ztmA00
3M15A 2YKZA 4JKVA 1EKYA 2YLDA 4NC3A 3C62A 3QW1A 3QW0A 1QPUA 3L1MA 1QQ3A 1S05A 1CPRA 2J9BA 4EIYA 1YZCA 4WGYA 1APCA 2YLIA 1RCPA 5AGFA 4CDYA 3NMKA 2YL0A 4CX9A 1CPQA 2XM4A 4ER9A 4CDVA 1E86A 3DE8A 4L6RA 2XM0A 4D4NA 2XLWA 3ZWIA 3M79A 2XLMA 2BC5A 3HNIA 3NMJA 4CDAA 4N6HA 2XLOA 3QVZA 5JSLA 3ZQYA 5JRAA 2YL3A 5JP7A 3DE9A 1E85A 1CGOA 256BA 4CIPA 3VRCA 1GQAA 1YYXA 2XLEA 2XL6A 3C63A 4WGZA 1NBBA 4U9EA 4CJOA 3TOMA 3HNJA 2XLHA 5JVEA 3HNKA 3M4BA 2CCYA 1YYJA 3IQ6A 1BBHA 2XLVA 3HNLA 4JEBA 1LM3B 3ZTMA 2YL7A 1A7VA 2J8WA 3ZTZA 3U8PA 1MQVA 4ULVA 4U9DA 3ZQVA 5JUAA 4N4WA 4JE9A 1YZAA 4JEAA 4IARA 2YLGA 2XLDA 3QVYA 5B3IA 1JAFA 3FOOA 4IAQA 4CJGA 4D4XA 2XL8A 3FOPA 1M6TA 3TOLA 1E83A 4IB4A 5JT4A 5JS5A 3IQ5A 1CGNA 3NMIA 2QLAA 5JLIA 1E84A 3M4CA 2YL1A
chains in the Genus database with same CATH superfamily
3ZSUA 1YA7O 2HMQA 2Y3GA 1YDIA 1OW7A 4YT8A 1EKYA 1D1CA 4K7BA 2L9JA 4YN0B 2L7AA 4KI2A 2EIKC 3C62A 3QW0A 3UMIA 4XQ1A 2NUPA 3K33A 1NZEA 5KYYB 1JRAA 1ZHWA 3GEEA 2CDQA 5E33A 4QI2A 2HKVA 2H7VC 3L8IA 4DRIB 1O87A 4YT4A 4O6MA 2XXAA 1J8YF 2AVKA 2Q3TA 2ZD9A 1QQ3A 3ABMC 1T5OA 4LDQA 4XEVA 3LESA 3MBGA 2P1AA 3JCUQ 4PFPA 1TFOB 3RVYA 1V54C 3POVA 1D0XA 3C8GD 2MHRA 3ITFA 1TWCA 1HW1A 2LIGA 3G50A 4LDKA 2D5RB 2NG1A 3AG3C 3EPVA 2Q9CA 3I5PA 4GYTA 1LS4A 3RYLA 1OR2A 1OCOC 2LCHA 3LUTB 1ZHTA 2KGOA 2XM4A 2H7BA 3CSKA 3G4XA 4CDVA 2ICWG 2XM0A 3IPMO 4J30B 3Q7LA 1YLMA 2IBFA 4E0IA 1SR2A 1RJ9B 3BRJA 2BC5A 1MMAA 2P6VA 4P6IC 3RW0A 1YARO 5EK0A 3RFYA 2YZSA 3AOUA 4K0DA 2XLOA 2HJMA 2VB6A 3DMDA 1JPJA 1VYIA 2V26A 1NLXA 1HW2A 3EGXB 5L0FA 2R05A 3DE9A 3S28A 3JYHA 5A6JA 3H2VA 4JZAA 2A1DD 3AG4C 3WAQA 5DS5A 3VRCA 5D91A 1GQAA 2P7VA 4PJMA 1VOMA 3G4ZA 5BQGA 1WWPA 3W2WA 2ZXRA 4O79A 4G7ZF 3DM9B 5BQIA 1HMDA 3PDMP 1ZVZA 1FR0A 4WGZA 3VF0A 1Z5ZA 2X0CA 2ZXOA 1SZIA 4CJOA 3B0VC 3NG1A 2OJQA 2A68F 2UUIA 4MVMA 3EHMA 3GORA 1Z23A 3C8GA 2KW3C 3X2QC 3HKKA 5JVEA 5KYUB 3GM1A 4AL1A 2A6HF 2PF4E 1TWHA 2KK1A 2A0UA 5L0DA 1BBHA 2XL4A 3GANA 4JEBA 3O10A 3ZDLA 1WN0A 5KYWA 4FX5A 1T9KA 1H9GA 2FFHA 2R03A 5L0HA 2EPMX 4I3MA 1T6IA 4EBBA 2VCCA 1VMAA 4U5BE 3VYWA 2FAPB 3KMIA 3WHNA 4U5HA 2J8WA 3FAJA 1O3UA 3L0IA 4N6CA 3W8HA 5KYNA 3NYLA 2R7UA 4PK4A 1LE4A 5E3CA 5BQHA 3US6A 4N4WA 1FMWA 2R25A 3FMSA 4JE9A 4KNVA 4MVOA 3RH3A 3SYNA 1RKEA 4JTCB 2NUPB 4IARA 2OKUA 4IJJA 4BJ6C 5DQTA 4CBEA 1F1MA 2J9UA 1N1CA 1EI7A 3OWTA 3U2LA 3V7OA 2WL8A 2YRFA 1YA9A 2VCAA 3FOOA 4I1OB 2EIJC 1FTSA 1LI7A 1BR4A 1RXQA 1OXBA 1WASA 1DOVA 3DXJF 3GODA 2OU6A 5BUOA 1YAUO 2KNHA 2AU5A 2MYSA 1QVXA 4AE4A 5A69A 1MNEA 3IQCA 1AUEA 2KSFA 3RVZA 4C7OB 1KTMA 3IQ5A 3ZC4A 1CGNA 3K1IC 3QMKA 1E84A 1T6QA 2UUHA 2VASA 3KYIA 5A6AA 3B29A 2Y3HA 3OEOA 3CEXA 3U5SA 2JPUA 5KYYA 3U0CA 1XWJA 3S27A 2C04A 3V5ZA 3DZAA 4NTFA 5JUAA 5F5FA 2R7VA 2OQMA 3QZCA 1Z6AA 4QI0A 1NG1A 5COMA 1OKKA 1VYKA 4BJTA 4JJFA 2HZ8A 4NC3A 1EA8A 3LJBA 1D0ZA 1M2VA 3Q6NA 2PBEA 3QW1A 5L0CA 1NFOA 1FFHA 2EINC 2YHSA 1MMGA 1I4YA 3GM3A 4A2NB 4NTBA 4IWBA 4C7OA 2F22A 2LSEA 3S9OA 5L0GA 4YK5A 3ZG1A 4XEFA 1CPRA 3UR3C 3KPHA 4A4AA 1UFBA 3KH2A 1TR2A 4G78A 4DXWA 4WGYA 2V3CC 1APCA 3SZRA 4DVZA 3W4YA 1BZ4A 2XS1A 1D1AA 3JT1A 1Q0FA 4CS8A 3FXHA 4U5CE 4RDAA 1TWAA 1JMWA 2HSQA 1R5ID 4P9FA 3LLIA 2P0NA 4J7YA 1ZHZA 1ZU4A 1H7IA 5KYXB 2M4EA 3O55A 1O5HA 3MFNA 4CX9A 2R7TA 4AX2A 2Z15A 1S7ZA 3K7DA 1E86A 1IW7F 3C18A 3JTLO 3EHNA 1LKXA 3C7JA 4XLPF 2KC3A 3CQZA 1OXKA 3T6GB 2XLWA 2R7QA 4P9TA 3DM5A 2NSFA 3M79A 2XRHA 3LEOA 1GM5A 3B9QA 3HNIA 4U5GA 2DB4A 1G5ZA 4IAOA 4CDAA 1V74B 4N6HA 2XSEA 1E2XA 3OA1A 3RIPA 5DQZA 2LK4A 3GEIA 4BPMA 1W2WA 3K1HA 5JRAA 5B1AC 2OG2A 1E85A 2R02A 4E0HA 4DVYP 5A6KA 2HSBA 256BA 3EH1A 4Z9JA 3NDBB 1ZYRF 2GA0A 3LEVA 5E2QA 1YYXA 3LAYA 3SXMA 5L3VA 2A69F 2OEXA 1BR2A 2VCBA 1Q0GA 2XL6A 3AG2C 1RJ9A 2VH3A 1RKCA 1Y6DA 2AWCA 4MNDA 4N06A 4XPYA 4U9EA 5HV9A 3U3FA 4MVQA 4HEAJ 3DAGA 4NY3A 4J32B 2GAQA 3B71A 2XLHA 3HNJA 4EBKA 1Z63A 4W8KA 1Q0KA 1TFKB 3PMRA 5A6BD 2J46A 2YQYA 2VC9A 1HMOA 4MQ9F 4DRJB 5D92A 2MWQA 2R7WA 1VK5A 3M4BA 1OCRC 3N0TA 2AWYA 3LS1A 4ZLDA 1Y4CA 1OQCA 1D1BA 4CS7A 2Q9BA 3F47A 5B3SC 4OIOF 2HV7A 1AVOB 4B6IA 4YL3A 5EHHA 4LACB 3R2PA 1LS1A 1MQVA 2J45A 2WVNA 3SNHA 3U3BA 1JOGA 1NFNA 2Q9AA 1MNDA 3LS0A 2XXAB 3E9VA 3W8IA 5KYWB 1TKNA 4IGGA 3UMHA 4AL0A 1YJGA 2CNWD 4CSAA 2KJGA 3QVYA 3A11A 4LDRA 1SMYF 4PFOA 1NU9C 2J9WA 2DGJA 2RSEB 1JAFA 2L81A 2RD9A 3IQTA 1LPEA 1AEPA 1M57C 3AGUA 3DD7A 4IAQA 4M63A 4ONSA 4U5FE 4CJGA 4D4XA 4EKWA 2EPKX 3DJNB 3FOPA 3TOLA 5B1BC 4CS8C 4Z9IA 2J9VA 2WB7A 2IM8A 1FNTc 4XTKA 5JS5A 3ABKC 1V4AA 3AJMA 4E7SA 3WG7C 2QNLA 4XEKA 5FCLA 2EPOA 2LQGA 2OOCA 2QY9A 2ZXWC 3DWWA 4YT5A 5JLIA 4JCZA 4EHPA 1ZW3A 4JRZA 1NBBA 2YL1A 3VAYA 3ZVRA 4OINF 3M15A 3Q6MA 1U89A 4JKVA 2QE9A 5E3AA 5K0IA 4YT2A 1M56C 3A9CA 2YLDA 2C03A 3B0PA 1V55C 1VLSA 1SF8A 4JCHA 4UDVA 3TD7A 2R7SA 3AQCA 4PR9A 2GFHA 2PX3A 4G0HA 4MTOA 3EFOB 3EG9A 3GWNA 2CYDA 1QPUA 3FVYA 3H65A 4H4KC 4FWVA 2Q7RA 1H9TA 2HJ3A 1A41A 4BJ1A 4HFFB 3NYMA 3Q7GA 1ZHXA 1GS9A 3J06A 1LVKA 1S05A 2HFIA 3L34A 4YWQA 2H8AA 5KYXA 2J9BA 2LD6A 4EIYA 2YVKA 1YZCA 1BR1A 4KC9A 4DBQA 2YLIA 1M2OA 3UMKA 4OIPF 1WGWA 4FESA 5COFA 4BJ5A 3RKOF 4I44A 3H2UA 4CDYA 2PP4A 4MVUA 3EQLF 3NMKA 2ZXPA 1QKRA 1ZU5A 3GWLA 1Q0MA 1ORYA 1CPQA 1VLTA 4YL1A 4QDLA 3O6XA 4ER9A 1FFTC 3BEHA 4JURI 4L6RA 1MMNA 4X0RA 3MX3A 1HY5A 3SEOA 4DJ9A 5AC4A 3SXKA 1LI5A 2PX0A 1JPNA 4MVSA 5IY5C 4G7OF 2X51A 3JZ0A 4AE4B 2XLMA 3EGXA 2LP4A 5F5HA 3NMJA 3WODF 2NSGA 3E70C 4JC7A 1C02A 4RD9A 3EZHA 3RQGA 3DAFA 2IYLD 3QVZA 5FZTA 5JSLA 3EFOA 3EG9B 2YL3A 4JJGA 4U5EE 5JP7A 3UGOA 1EQ1A 1A0BA 3JSZA 4CSAC 3UNGC 1CGOA 3GM2A 4CIPA 3T4RA 4CS9C 2FGYA 2G3KA 4DBRA 4KNWA 3S84A 5T3WA 2DYRC 3C63A 4PJJA 3LNMB 1TWGA 4O7GA 3NYJA 4EWCA 5DS6A 2J7PD 1LE2A 2IXOA 4LLEA 4OIRF 3TOMA 1U0BB 3ABLC 2ETSA 3T6JA 1G4US 4PJLA 1UG7A 4C3DA 5F28E 3NKEA 3HNKA 1T01A 2EILC 5EGYA 2J7PA 2Y69C 2CCYA 3LLKA 3EGDA 4O6YA 3T6BA 1YYJA 3HJCA 4NQFA 1ZW2A 2XLVA 3HNLA 1LM3B 1NU7D 1FAPB 2DI3A 1A7DA 4PACA 1NSGB 1QSPA 2R7OA 4BJ6A 2EIMC 5L0IA 1PV3A 1R4TA 3RF3A 3UGPA 1A7VA 2L6FA 3ZIBA 3MYFA 3JRMO 1ORSC 1BDJB 3X1OA 2Q00A 4U9DA 1MMDA 3ZQVA 2CNWA 2E87A 2EPNA 3K6BA 1YZAA 4MVRA 2DYSC 3JSEO 2G3VA 4JEAA 3W2VA 1CGME 1PD1A 1JR8A 1IZMA 3AG1C 3CAXA 1KNYA 5HSWA 3FDQA 1ORJA 4J7TA 2WVQA 3IEEA 4ANJA 4CS9A 1T6UA 4W8PA 3R7CA 5DS4A 2A6EF 3S0XA 3U8VA 5CI9A 2KYHA 4GQHA 1TQGA 1DOWA 2W4MA 4BEJA 1KU2A 5CIVA 2M64A 4IB4A 3ASOC 1VB5A 2W9YA 5JT4A 2ASRA 1H6GA 2BL2A 5L0JA 4Q5SF 3RQEA 1L3PA 2QLAA 3JYYA 2L6HA 3LNRA 4DRHB 3RQFA 3K66A 3KL4A 2AP3A 5CI8A 3N24A 2WZFA 4WJ0A 5DLJA 2NPUA 2YKZA 2L6GA 2EPLX 1C17M 4I1MA 2IOQA 2QUPA 3K1IA 3TJ6A 4KBLA 1B68A 4Q7CA 3TK0A 1L7CA 3L1MA 4JIOA 4YL0A 3N2ZB 2WVOA 3AQBA 2W4BA 4BJ5C 2B0HA 1VTMP 1OKKD 1ST6A 3I4UA 4NCQA 1RMVA 2ZPAA 3KKBA 3CZ6A 4K1OA 3FHDA 4XWJA 3EZIA 2B0JA 2BE5F 2O9XA 2J0WA 3EGDB 4IRUA 3MYIA 4R32A 5T1DB 3S29A 5A6BA 3U9MA 1ZHYA 5T3TA 2HMZA 1RCPA 2JD3A 2D4UA 3VM6A 5TJ5E 5AGFA 1Z7Qc 4OD4A 4F4BA 4DOZA 1Q0DA 3L8JA 3F46A 3JRTA 2YL0A 5KYUA 3NRHA 4EBJA 4PJNA 4Z9HA 2G62A 2OJED 2OEVA 2W45A 3DE8A 1PCXA 2Y3BA 3O39A 3QTHA 4FAPB 4MTGA 4D4NA 3NKDA 4XPWA 1HE1A 3KYJA 1OW8A 4ULWA 3ZWIA 1Z3IX 1WTYA 4NTAA 3SP1A 2HUJA 5AC5A 1J8MF 3TQOA 1OCCC 2IXPA 3MLGA 4YJWA 3U2MA 4E7ZA 1QLEC 4OIQF 3ZQYA 2LFDA 1A7EA 2Y39A 4JW1A 4MW3A 4JTAB 1K04A 2QTVA 3EH2A 4G7HF 1U6HA 2TMVP 2I8BA 3C8GB 4BG0A 1G4WR 3HLZA 2IXNA 2XLEA 1XZQA 2CW0F 2WZGA 3AGTA 3I5QA 3IHUA 1ZZPA 3ATPA 4U5DE 1OW6A 1LIHA 4H54A 3EJNA 4OD5A 4AK9A 3FAPB 1FMVA 4HE8D 5L3QA 2PNOA 4MVZA 3V5YA 3U9JA 5DVWA 1WATA 2JX0A 1YVIA 2NUTB 2YWAA 3C8ZA 1D0YA 2GWWA 3IQ6A 4GEHA 1RKEB 4JVSA 1HE9A 3T9OA 1QZXA 4JTDB 4BEMJ 4XPXA 4ZLCA 4E17A 2Q4FA 4LLCA 2WZLA 3SXYA 3ZTMA 4LERA 1C03A 3SXZA 3V5XA 2YL7A 1GGQA 3ASNC 3ZTZA 3PCVA 4MW8A 3U8PA 4E18A 2P61A 4WABA 4C3EA 4EUKB 1OCZC 1I4ZA 4ULVA 3DI5A 2Y3DA 1M2VB 4C3BA 3TULA 2LFFA 1K40A 1WOLA 2HV6A 3PHF2 4MTFA 4Q4ZF 2YLGA 2XLDA 3B0UX 2NUTA 2IXMA 4HFKB 5B3IA 4MS2A 2R7XA 1SYQA 3ECSA 2XS8A 4O6NA 1I5NA 1PD0A 1K05A 2XL8A 5GPGB 3DJUB 4XLNF 3S90A 1M6TA 2R7RA 1E83A 2YEVA 1G8XA 3TJ5A 1OR3A 2A0BA 2HS5A 2CGEA 2GDCA 3M1CB 4RBNA 1XZPA 2OCCC 2KQ9A 3NMIA 2R9RB 2I15A 3GEHA 4CIHA 3DKAA 2J0XA 3M4CA 2PFDA 3HTKC 2H7OA 5COGA
chains in the Genus database with same CATH topology
3M15A 2YKZA 4JKVA 1EKYA 2YLDA 4NC3A 3C62A 3QW1A 3QW0A 1QPUA 3L1MA 1QQ3A 1S05A 1CPRA 2J9BA 4EIYA 1YZCA 4WGYA 1APCA 2YLIA 1RCPA 5AGFA 4CDYA 3NMKA 2YL0A 4CX9A 1CPQA 2XM4A 4ER9A 4CDVA 1E86A 3DE8A 4L6RA 2XM0A 4D4NA 2XLWA 3ZWIA 3M79A 2XLMA 2BC5A 3HNIA 3NMJA 4CDAA 4N6HA 2XLOA 3QVZA 5JSLA 3ZQYA 5JRAA 2YL3A 5JP7A 3DE9A 1E85A 1CGOA 256BA 4CIPA 3VRCA 1GQAA 1YYXA 2XLEA 2XL6A 3C63A 4WGZA 1NBBA 4U9EA 4CJOA 3TOMA 3HNJA 2XLHA 5JVEA 3HNKA 3M4BA 2CCYA 1YYJA 3IQ6A 1BBHA 2XLVA 3HNLA 4JEBA 1LM3B 3ZTMA 2YL7A 1A7VA 2J8WA 3ZTZA 3U8PA 1MQVA 4ULVA 4U9DA 3ZQVA 5JUAA 4N4WA 4JE9A 1YZAA 4JEAA 4IARA 2YLGA 2XLDA 3QVYA 5B3IA 1JAFA 3FOOA 4IAQA 4CJGA 4D4XA 2XL8A 3FOPA 1M6TA 3TOLA 1E83A 4IB4A 5JT4A 5JS5A 3IQ5A 1CGNA 3NMIA 2QLAA 5JLIA 1E84A 3M4CA 2YL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M15 A;  2YKZ A;  4JKV A;  1EKY A;  2YLD A;  4NC3 A;  3C62 A;  3QW1 A;  3QW0 A;  1QPU A;  3L1M A;  1QQ3 A;  1S05 A;  1CPR A;  2J9B A;  4EIY A;  1YZC A;  4WGY A;  1APC A;  2YLI A;  1RCP A;  5AGF A;  4CDY A;  3NMK A;  2YL0 A;  4CX9 A;  1CPQ A;  2XM4 A;  4ER9 A;  4CDV A;  1E86 A;  3DE8 A;  4L6R A;  2XM0 A;  4D4N A;  2XLW A;  3ZWI A;  3M79 A;  2XLM A;  2BC5 A;  3HNI A;  3NMJ A;  4CDA A;  4N6H A;  2XLO A;  3QVZ A;  5JSL A;  3ZQY A;  5JRA A;  2YL3 A;  5JP7 A;  3DE9 A;  1E85 A;  1CGO A;  256B A;  4CIP A;  3VRC A;  1GQA A;  1YYX A;  2XLE A;  2XL6 A;  3C63 A;  4WGZ A;  1NBB A;  4U9E A;  4CJO A;  3TOM A;  3HNJ A;  2XLH A;  5JVE A;  3HNK A;  3M4B A;  2CCY A;  1YYJ A;  3IQ6 A;  1BBH A;  2XLV A;  3HNL A;  4JEB A;  1LM3 B;  3ZTM A;  2YL7 A;  1A7V A;  2J8W A;  3ZTZ A;  3U8P A;  1MQV A;  4ULV A;  4U9D A;  3ZQV A;  5JUA A;  4N4W A;  4JE9 A;  1YZA A;  4JEA A;  4IAR A;  2YLG A;  2XLD A;  3QVY A;  5B3I A;  1JAF A;  3FOO A;  4IAQ A;  4CJG A;  4D4X A;  2XL8 A;  3FOP A;  1M6T A;  3TOL A;  1E83 A;  4IB4 A;  5JT4 A;  5JS5 A;  3IQ5 A;  1CGN A;  3NMI A;  2QLA A;  5JLI A;  1E84 A;  3M4C A;  2YL1 A; 
#chains in the Genus database with same CATH topology
 3ZSU A;  1YA7 O;  2HMQ A;  2Y3G A;  1YDI A;  1OW7 A;  4YT8 A;  1EKY A;  1D1C A;  4K7B A;  2L9J A;  4YN0 B;  2L7A A;  4KI2 A;  2EIK C;  3C62 A;  3QW0 A;  3UMI A;  4XQ1 A;  2NUP A;  3K33 A;  1NZE A;  5KYY B;  1JRA A;  1ZHW A;  3GEE A;  2CDQ A;  5E33 A;  4QI2 A;  2HKV A;  2H7V C;  3L8I A;  4DRI B;  1O87 A;  4YT4 A;  4O6M A;  2XXA A;  1J8Y F;  2AVK A;  2Q3T A;  2ZD9 A;  1QQ3 A;  3ABM C;  1T5O A;  4LDQ A;  4XEV A;  3LES A;  3MBG A;  2P1A A;  3JCU Q;  4PFP A;  1TFO B;  3RVY A;  1V54 C;  3POV A;  1D0X A;  3C8G D;  2MHR A;  3ITF A;  1TWC A;  1HW1 A;  2LIG A;  3G50 A;  4LDK A;  2D5R B;  2NG1 A;  3AG3 C;  3EPV A;  2Q9C A;  3I5P A;  4GYT A;  1LS4 A;  3RYL A;  1OR2 A;  1OCO C;  2LCH A;  3LUT B;  1ZHT A;  2KGO A;  2XM4 A;  2H7B A;  3CSK A;  3G4X A;  4CDV A;  2ICW G;  2XM0 A;  3IPM O;  4J30 B;  3Q7L A;  1YLM A;  2IBF A;  4E0I A;  1SR2 A;  1RJ9 B;  3BRJ A;  2BC5 A;  1MMA A;  2P6V A;  4P6I C;  3RW0 A;  1YAR O;  5EK0 A;  3RFY A;  2YZS A;  3AOU A;  4K0D A;  2XLO A;  2HJM A;  2VB6 A;  3DMD A;  1JPJ A;  1VYI A;  2V26 A;  1NLX A;  1HW2 A;  3EGX B;  5L0F A;  2R05 A;  3DE9 A;  3S28 A;  3JYH A;  5A6J A;  3H2V A;  4JZA A;  2A1D D;  3AG4 C;  3WAQ A;  5DS5 A;  3VRC A;  5D91 A;  1GQA A;  2P7V A;  4PJM A;  1VOM A;  3G4Z A;  5BQG A;  1WWP A;  3W2W A;  2ZXR A;  4O79 A;  4G7Z F;  3DM9 B;  5BQI A;  1HMD A;  3PDM P;  1ZVZ A;  1FR0 A;  4WGZ A;  3VF0 A;  1Z5Z A;  2X0C A;  2ZXO A;  1SZI A;  4CJO A;  3B0V C;  3NG1 A;  2OJQ A;  2A68 F;  2UUI A;  4MVM A;  3EHM A;  3GOR A;  1Z23 A;  3C8G A;  2KW3 C;  3X2Q C;  3HKK A;  5JVE A;  5KYU B;  3GM1 A;  4AL1 A;  2A6H F;  2PF4 E;  1TWH A;  2KK1 A;  2A0U A;  5L0D A;  1BBH A;  2XL4 A;  3GAN A;  4JEB A;  3O10 A;  3ZDL A;  1WN0 A;  5KYW A;  4FX5 A;  1T9K A;  1H9G A;  2FFH A;  2R03 A;  5L0H A;  2EPM X;  4I3M A;  1T6I A;  4EBB A;  2VCC A;  1VMA A;  4U5B E;  3VYW A;  2FAP B;  3KMI A;  3WHN A;  4U5H A;  2J8W A;  3FAJ A;  1O3U A;  3L0I A;  4N6C A;  3W8H A;  5KYN A;  3NYL A;  2R7U A;  4PK4 A;  1LE4 A;  5E3C A;  5BQH A;  3US6 A;  4N4W A;  1FMW A;  2R25 A;  3FMS A;  4JE9 A;  4KNV A;  4MVO A;  3RH3 A;  3SYN A;  1RKE A;  4JTC B;  2NUP B;  4IAR A;  2OKU A;  4IJJ A;  4BJ6 C;  5DQT A;  4CBE A;  1F1M A;  2J9U A;  1N1C A;  1EI7 A;  3OWT A;  3U2L A;  3V7O A;  2WL8 A;  2YRF A;  1YA9 A;  2VCA A;  3FOO A;  4I1O B;  2EIJ C;  1FTS A;  1LI7 A;  1BR4 A;  1RXQ A;  1OXB A;  1WAS A;  1DOV A;  3DXJ F;  3GOD A;  2OU6 A;  5BUO A;  1YAU O;  2KNH A;  2AU5 A;  2MYS A;  1QVX A;  4AE4 A;  5A69 A;  1MNE A;  3IQC A;  1AUE A;  2KSF A;  3RVZ A;  4C7O B;  1KTM A;  3IQ5 A;  3ZC4 A;  1CGN A;  3K1I C;  3QMK A;  1E84 A;  1T6Q A;  2UUH A;  2VAS A;  3KYI A;  5A6A A;  3B29 A;  2Y3H A;  3OEO A;  3CEX A;  3U5S A;  2JPU A;  5KYY A;  3U0C A;  1XWJ A;  3S27 A;  2C04 A;  3V5Z A;  3DZA A;  4NTF A;  5JUA A;  5F5F A;  2R7V A;  2OQM A;  3QZC A;  1Z6A A;  4QI0 A;  1NG1 A;  5COM A;  1OKK A;  1VYK A;  4BJT A;  4JJF A;  2HZ8 A;  4NC3 A;  1EA8 A;  3LJB A;  1D0Z A;  1M2V A;  3Q6N A;  2PBE A;  3QW1 A;  5L0C A;  1NFO A;  1FFH A;  2EIN C;  2YHS A;  1MMG A;  1I4Y A;  3GM3 A;  4A2N B;  4NTB A;  4IWB A;  4C7O A;  2F22 A;  2LSE A;  3S9O A;  5L0G A;  4YK5 A;  3ZG1 A;  4XEF A;  1CPR A;  3UR3 C;  3KPH A;  4A4A A;  1UFB A;  3KH2 A;  1TR2 A;  4G78 A;  4DXW A;  4WGY A;  2V3C C;  1APC A;  3SZR A;  4DVZ A;  3W4Y A;  1BZ4 A;  2XS1 A;  1D1A A;  3JT1 A;  1Q0F A;  4CS8 A;  3FXH A;  4U5C E;  4RDA A;  1TWA A;  1JMW A;  2HSQ A;  1R5I D;  4P9F A;  3LLI A;  2P0N A;  4J7Y A;  1ZHZ A;  1ZU4 A;  1H7I A;  5KYX B;  2M4E A;  3O55 A;  1O5H A;  3MFN A;  4CX9 A;  2R7T A;  4AX2 A;  2Z15 A;  1S7Z A;  3K7D A;  1E86 A;  1IW7 F;  3C18 A;  3JTL O;  3EHN A;  1LKX A;  3C7J A;  4XLP F;  2KC3 A;  3CQZ A;  1OXK A;  3T6G B;  2XLW A;  2R7Q A;  4P9T A;  3DM5 A;  2NSF A;  3M79 A;  2XRH A;  3LEO A;  1GM5 A;  3B9Q A;  3HNI A;  4U5G A;  2DB4 A;  1G5Z A;  4IAO A;  4CDA A;  1V74 B;  4N6H A;  2XSE A;  1E2X A;  3OA1 A;  3RIP A;  5DQZ A;  2LK4 A;  3GEI A;  4BPM A;  1W2W A;  3K1H A;  5JRA A;  5B1A C;  2OG2 A;  1E85 A;  2R02 A;  4E0H A;  4DVY P;  5A6K A;  2HSB A;  256B A;  3EH1 A;  4Z9J A;  3NDB B;  1ZYR F;  2GA0 A;  3LEV A;  5E2Q A;  1YYX A;  3LAY A;  3SXM A;  5L3V A;  2A69 F;  2OEX A;  1BR2 A;  2VCB A;  1Q0G A;  2XL6 A;  3AG2 C;  1RJ9 A;  2VH3 A;  1RKC A;  1Y6D A;  2AWC A;  4MND A;  4N06 A;  4XPY A;  4U9E A;  5HV9 A;  3U3F A;  4MVQ A;  4HEA J;  3DAG A;  4NY3 A;  4J32 B;  2GAQ A;  3B71 A;  2XLH A;  3HNJ A;  4EBK A;  1Z63 A;  4W8K A;  1Q0K A;  1TFK B;  3PMR A;  5A6B D;  2J46 A;  2YQY A;  2VC9 A;  1HMO A;  4MQ9 F;  4DRJ B;  5D92 A;  2MWQ A;  2R7W A;  1VK5 A;  3M4B A;  1OCR C;  3N0T A;  2AWY A;  3LS1 A;  4ZLD A;  1Y4C A;  1OQC A;  1D1B A;  4CS7 A;  2Q9B A;  3F47 A;  5B3S C;  4OIO F;  2HV7 A;  1AVO B;  4B6I A;  4YL3 A;  5EHH A;  4LAC B;  3R2P A;  1LS1 A;  1MQV A;  2J45 A;  2WVN A;  3SNH A;  3U3B A;  1JOG A;  1NFN A;  2Q9A A;  1MND A;  3LS0 A;  2XXA B;  3E9V A;  3W8I A;  5KYW B;  1TKN A;  4IGG A;  3UMH A;  4AL0 A;  1YJG A;  2CNW D;  4CSA A;  2KJG A;  3QVY A;  3A11 A;  4LDR A;  1SMY F;  4PFO A;  1NU9 C;  2J9W A;  2DGJ A;  2RSE B;  1JAF A;  2L81 A;  2RD9 A;  3IQT A;  1LPE A;  1AEP A;  1M57 C;  3AGU A;  3DD7 A;  4IAQ A;  4M63 A;  4ONS A;  4U5F E;  4CJG A;  4D4X A;  4EKW A;  2EPK X;  3DJN B;  3FOP A;  3TOL A;  5B1B C;  4CS8 C;  4Z9I A;  2J9V A;  2WB7 A;  2IM8 A;  1FNT c;  4XTK A;  5JS5 A;  3ABK C;  1V4A A;  3AJM A;  4E7S A;  3WG7 C;  2QNL A;  4XEK A;  5FCL A;  2EPO A;  2LQG A;  2OOC A;  2QY9 A;  2ZXW C;  3DWW A;  4YT5 A;  5JLI A;  4JCZ A;  4EHP A;  1ZW3 A;  4JRZ A;  1NBB A;  2YL1 A;  3VAY A;  3ZVR A;  4OIN F;  3M15 A;  3Q6M A;  1U89 A;  4JKV A;  2QE9 A;  5E3A A;  5K0I A;  4YT2 A;  1M56 C;  3A9C A;  2YLD A;  2C03 A;  3B0P A;  1V55 C;  1VLS A;  1SF8 A;  4JCH A;  4UDV A;  3TD7 A;  2R7S A;  3AQC A;  4PR9 A;  2GFH A;  2PX3 A;  4G0H A;  4MTO A;  3EFO B;  3EG9 A;  3GWN A;  2CYD A;  1QPU A;  3FVY A;  3H65 A;  4H4K C;  4FWV A;  2Q7R A;  1H9T A;  2HJ3 A;  1A41 A;  4BJ1 A;  4HFF B;  3NYM A;  3Q7G A;  1ZHX A;  1GS9 A;  3J06 A;  1LVK A;  1S05 A;  2HFI A;  3L34 A;  4YWQ A;  2H8A A;  5KYX A;  2J9B A;  2LD6 A;  4EIY A;  2YVK A;  1YZC A;  1BR1 A;  4KC9 A;  4DBQ A;  2YLI A;  1M2O A;  3UMK A;  4OIP F;  1WGW A;  4FES A;  5COF A;  4BJ5 A;  3RKO F;  4I44 A;  3H2U A;  4CDY A;  2PP4 A;  4MVU A;  3EQL F;  3NMK A;  2ZXP A;  1QKR A;  1ZU5 A;  3GWL A;  1Q0M A;  1ORY A;  1CPQ A;  1VLT A;  4YL1 A;  4QDL A;  3O6X A;  4ER9 A;  1FFT C;  3BEH A;  4JUR I;  4L6R A;  1MMN A;  4X0R A;  3MX3 A;  1HY5 A;  3SEO A;  4DJ9 A;  5AC4 A;  3SXK A;  1LI5 A;  2PX0 A;  1JPN A;  4MVS A;  5IY5 C;  4G7O F;  2X51 A;  3JZ0 A;  4AE4 B;  2XLM A;  3EGX A;  2LP4 A;  5F5H A;  3NMJ A;  3WOD F;  2NSG A;  3E70 C;  4JC7 A;  1C02 A;  4RD9 A;  3EZH A;  3RQG A;  3DAF A;  2IYL D;  3QVZ A;  5FZT A;  5JSL A;  3EFO A;  3EG9 B;  2YL3 A;  4JJG A;  4U5E E;  5JP7 A;  3UGO A;  1EQ1 A;  1A0B A;  3JSZ A;  4CSA C;  3UNG C;  1CGO A;  3GM2 A;  4CIP A;  3T4R A;  4CS9 C;  2FGY A;  2G3K A;  4DBR A;  4KNW A;  3S84 A;  5T3W A;  2DYR C;  3C63 A;  4PJJ A;  3LNM B;  1TWG A;  4O7G A;  3NYJ A;  4EWC A;  5DS6 A;  2J7P D;  1LE2 A;  2IXO A;  4LLE A;  4OIR F;  3TOM A;  1U0B B;  3ABL C;  2ETS A;  3T6J A;  1G4U S;  4PJL A;  1UG7 A;  4C3D A;  5F28 E;  3NKE A;  3HNK A;  1T01 A;  2EIL C;  5EGY A;  2J7P A;  2Y69 C;  2CCY A;  3LLK A;  3EGD A;  4O6Y A;  3T6B A;  1YYJ A;  3HJC A;  4NQF A;  1ZW2 A;  2XLV A;  3HNL A;  1LM3 B;  1NU7 D;  1FAP B;  2DI3 A;  1A7D A;  4PAC A;  1NSG B;  1QSP A;  2R7O A;  4BJ6 A;  2EIM C;  5L0I A;  1PV3 A;  1R4T A;  3RF3 A;  3UGP A;  1A7V A;  2L6F A;  3ZIB A;  3MYF A;  3JRM O;  1ORS C;  1BDJ B;  3X1O A;  2Q00 A;  4U9D A;  1MMD A;  3ZQV A;  2CNW A;  2E87 A;  2EPN A;  3K6B A;  1YZA A;  4MVR A;  2DYS C;  3JSE O;  2G3V A;  4JEA A;  3W2V A;  1CGM E;  1PD1 A;  1JR8 A;  1IZM A;  3AG1 C;  3CAX A;  1KNY A;  5HSW A;  3FDQ A;  1ORJ A;  4J7T A;  2WVQ A;  3IEE A;  4ANJ A;  4CS9 A;  1T6U A;  4W8P A;  3R7C A;  5DS4 A;  2A6E F;  3S0X A;  3U8V A;  5CI9 A;  2KYH A;  4GQH A;  1TQG A;  1DOW A;  2W4M A;  4BEJ A;  1KU2 A;  5CIV A;  2M64 A;  4IB4 A;  3ASO C;  1VB5 A;  2W9Y A;  5JT4 A;  2ASR A;  1H6G A;  2BL2 A;  5L0J A;  4Q5S F;  3RQE A;  1L3P A;  2QLA A;  3JYY A;  2L6H A;  3LNR A;  4DRH B;  3RQF A;  3K66 A;  3KL4 A;  2AP3 A;  5CI8 A;  3N24 A;  2WZF A;  4WJ0 A;  5DLJ A;  2NPU A;  2YKZ A;  2L6G A;  2EPL X;  1C17 M;  4I1M A;  2IOQ A;  2QUP A;  3K1I A;  3TJ6 A;  4KBL A;  1B68 A;  4Q7C A;  3TK0 A;  1L7C A;  3L1M A;  4JIO A;  4YL0 A;  3N2Z B;  2WVO A;  3AQB A;  2W4B A;  4BJ5 C;  2B0H A;  1VTM P;  1OKK D;  1ST6 A;  3I4U A;  4NCQ A;  1RMV A;  2ZPA A;  3KKB A;  3CZ6 A;  4K1O A;  3FHD A;  4XWJ A;  3EZI A;  2B0J A;  2BE5 F;  2O9X A;  2J0W A;  3EGD B;  4IRU A;  3MYI A;  4R32 A;  5T1D B;  3S29 A;  5A6B A;  3U9M A;  1ZHY A;  5T3T A;  2HMZ A;  1RCP A;  2JD3 A;  2D4U A;  3VM6 A;  5TJ5 E;  5AGF A;  1Z7Q c;  4OD4 A;  4F4B A;  4DOZ A;  1Q0D A;  3L8J A;  3F46 A;  3JRT A;  2YL0 A;  5KYU A;  3NRH A;  4EBJ A;  4PJN A;  4Z9H A;  2G62 A;  2OJE D;  2OEV A;  2W45 A;  3DE8 A;  1PCX A;  2Y3B A;  3O39 A;  3QTH A;  4FAP B;  4MTG A;  4D4N A;  3NKD A;  4XPW A;  1HE1 A;  3KYJ A;  1OW8 A;  4ULW A;  3ZWI A;  1Z3I X;  1WTY A;  4NTA A;  3SP1 A;  2HUJ A;  5AC5 A;  1J8M F;  3TQO A;  1OCC C;  2IXP A;  3MLG A;  4YJW A;  3U2M A;  4E7Z A;  1QLE C;  4OIQ F;  3ZQY A;  2LFD A;  1A7E A;  2Y39 A;  4JW1 A;  4MW3 A;  4JTA B;  1K04 A;  2QTV A;  3EH2 A;  4G7H F;  1U6H A;  2TMV P;  2I8B A;  3C8G B;  4BG0 A;  1G4W R;  3HLZ A;  2IXN A;  2XLE A;  1XZQ A;  2CW0 F;  2WZG A;  3AGT A;  3I5Q A;  3IHU A;  1ZZP A;  3ATP A;  4U5D E;  1OW6 A;  1LIH A;  4H54 A;  3EJN A;  4OD5 A;  4AK9 A;  3FAP B;  1FMV A;  4HE8 D;  5L3Q A;  2PNO A;  4MVZ A;  3V5Y A;  3U9J A;  5DVW A;  1WAT A;  2JX0 A;  1YVI A;  2NUT B;  2YWA A;  3C8Z A;  1D0Y A;  2GWW A;  3IQ6 A;  4GEH A;  1RKE B;  4JVS A;  1HE9 A;  3T9O A;  1QZX A;  4JTD B;  4BEM J;  4XPX A;  4ZLC A;  4E17 A;  2Q4F A;  4LLC A;  2WZL A;  3SXY A;  3ZTM A;  4LER A;  1C03 A;  3SXZ A;  3V5X A;  2YL7 A;  1GGQ A;  3ASN C;  3ZTZ A;  3PCV A;  4MW8 A;  3U8P A;  4E18 A;  2P61 A;  4WAB A;  4C3E A;  4EUK B;  1OCZ C;  1I4Z A;  4ULV A;  3DI5 A;  2Y3D A;  1M2V B;  4C3B A;  3TUL A;  2LFF A;  1K40 A;  1WOL A;  2HV6 A;  3PHF 2;  4MTF A;  4Q4Z F;  2YLG A;  2XLD A;  3B0U X;  2NUT A;  2IXM A;  4HFK B;  5B3I A;  4MS2 A;  2R7X A;  1SYQ A;  3ECS A;  2XS8 A;  4O6N A;  1I5N A;  1PD0 A;  1K05 A;  2XL8 A;  5GPG B;  3DJU B;  4XLN F;  3S90 A;  1M6T A;  2R7R A;  1E83 A;  2YEV A;  1G8X A;  3TJ5 A;  1OR3 A;  2A0B A;  2HS5 A;  2CGE A;  2GDC A;  3M1C B;  4RBN A;  1XZP A;  2OCC C;  2KQ9 A;  3NMI A;  2R9R B;  2I15 A;  3GEH A;  4CIH A;  3DKA A;  2J0X A;  3M4C A;  2PFD A;  3HTK C;  2H7O A;  5COG A; 
#chains in the Genus database with same CATH homology
 3M15 A;  2YKZ A;  4JKV A;  1EKY A;  2YLD A;  4NC3 A;  3C62 A;  3QW1 A;  3QW0 A;  1QPU A;  3L1M A;  1QQ3 A;  1S05 A;  1CPR A;  2J9B A;  4EIY A;  1YZC A;  4WGY A;  1APC A;  2YLI A;  1RCP A;  5AGF A;  4CDY A;  3NMK A;  2YL0 A;  4CX9 A;  1CPQ A;  2XM4 A;  4ER9 A;  4CDV A;  1E86 A;  3DE8 A;  4L6R A;  2XM0 A;  4D4N A;  2XLW A;  3ZWI A;  3M79 A;  2XLM A;  2BC5 A;  3HNI A;  3NMJ A;  4CDA A;  4N6H A;  2XLO A;  3QVZ A;  5JSL A;  3ZQY A;  5JRA A;  2YL3 A;  5JP7 A;  3DE9 A;  1E85 A;  1CGO A;  256B A;  4CIP A;  3VRC A;  1GQA A;  1YYX A;  2XLE A;  2XL6 A;  3C63 A;  4WGZ A;  1NBB A;  4U9E A;  4CJO A;  3TOM A;  3HNJ A;  2XLH A;  5JVE A;  3HNK A;  3M4B A;  2CCY A;  1YYJ A;  3IQ6 A;  1BBH A;  2XLV A;  3HNL A;  4JEB A;  1LM3 B;  3ZTM A;  2YL7 A;  1A7V A;  2J8W A;  3ZTZ A;  3U8P A;  1MQV A;  4ULV A;  4U9D A;  3ZQV A;  5JUA A;  4N4W A;  4JE9 A;  1YZA A;  4JEA A;  4IAR A;  2YLG A;  2XLD A;  3QVY A;  5B3I A;  1JAF A;  3FOO A;  4IAQ A;  4CJG A;  4D4X A;  2XL8 A;  3FOP A;  1M6T A;  3TOL A;  1E83 A;  4IB4 A;  5JT4 A;  5JS5 A;  3IQ5 A;  1CGN A;  3NMI A;  2QLA A;  5JLI A;  1E84 A;  3M4C A;  2YL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...