3ZTMA

Cytochrome c prime from alcaligenes xylosoxidans: as isolated l16g variant at 0.9 a resolution: unrestraint refinement
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAGTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 52
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3ztmA00
2XM4A 1LM3B 3M15A 4N6HA 3ZTZA 256BA 3QW0A 3HNLA 4IAQA 1E86A 4IB4A 3HNKA 1JAFA 4U9DA 5JP7A 3VRCA 1CPRA 4ER9A 1CGNA 3ZWIA 1E85A 2YL1A 2YL3A 2YLGA 2QLAA 4NC3A 4WGZA 4JKVA 1YYJA 2XLHA 3C63A 3NMKA 3HNIA 2XLMA 1CPQA 4CJGA 4U9EA 5JT4A 3M4BA 4CDVA 3ZQVA 3HNJA 3QVZA 4CDYA 1BBHA 2YL0A 5JUAA 3QVYA 1MQVA 3NMJA 4JE9A 1RCPA 3FOPA 4CIPA 4WGYA 5JVEA 3IQ6A 5B3IA 2YKZA 3C62A 1CGOA 2BC5A 4CJOA 2XL6A 2YLDA 3ZQYA 3IQ5A 1YZAA 4JEBA 2XLWA 4IARA 2XL8A 1EKYA 4CX9A 4JEAA 1QPUA 2CCYA 3QW1A 4D4NA 1YZCA 2XM0A 3ZTMA 1APCA 4CDAA 3M4CA 5JRAA 1E83A 4D4XA 3DE9A 3M79A 3NMIA 1M6TA 4ULVA 5JSLA 5JLIA 1YYXA 3FOOA 1GQAA 2XLDA 4EIYA 2YL7A 5AGFA 2XLEA 2YLIA 2XLOA 3TOMA 4L6RA 4N4WA 3DE8A 2XLVA 3L1MA 1S05A 2J9BA 1NBBA 1QQ3A 1A7VA 5JS5A 2J8WA 1E84A 3TOLA 3U8PA
chains in the Genus database with same CATH superfamily
3EQLF 4YT4A 1T01A 3V5YA 2L6FA 3GEIA 4BEJA 3PDMP 3T6GB 1MNDA 4N6HA 3ZTZA 2B0HA 2FAPB 3KKBA 1BR2A 2A69F 5DVWA 2R7SA 1OKKA 4BEMJ 3WG7C 1JRAA 2LD6A 3HNLA 1WOLA 2Y39A 3W2WA 3PHF2 2HSQA 1A41A 2EPKX 4HFKB 5T3TA 5DLJA 3KH2A 4IB4A 3ITFA 3HNKA 5F28E 5JP7A 4OINF 4XEKA 1VLTA 1RKCA 2JX0A 5L0IA 1E2XA 4YN0B 2PNOA 1GM5A 3C8GA 1HW1A 2NUPB 2EINC 5L0JA 4HFFB 2PBEA 2Z15A 3RKOF 3T6JA 1FAPB 1ZU5A 2GFHA 2QUPA 3US6A 2A6HF 2W4MA 4YJWA 1J8MF 1JR8A 2AVKA 4DJ9A 1ZZPA 2J7PA 3U9MA 1Z3IX 3ZSUA 1QLEC 5KYWB 4Q5SF 3GORA 4DOZA 5T3WA 4MVSA 3NMKA 3HNIA 3SXKA 4JTDB 3B9QA 1IW7F 1PD0A 2KQ9A 5L0HA 4CJGA 3CEXA 1Q0KA 1C03A 1QSPA 5JT4A 1H6GA 3U3BA 1SZIA 1MMAA 2GA0A 3O39A 3ZQVA 4B6IA 3AGUA 1QZXA 4OIRF 1OQCA 1PV3A 3MYIA 2Q00A 5E2QA 3JSZA 4FWVA 3T6BA 5JUAA 2QE9A 2KW3C 2NG1A 3GWNA 2R7OA 2Q7RA 3RVYA 5D92A 2P0NA 3AG1C 4CS7A 3J06A 3LESA 1LI7A 4CIPA 4WGYA 5DS4A 1FFHA 4JVSA 5L3VA 1YARO 4JIOA 4DRIB 5JVEA 1BZ4A 2ICWG 2R7UA 2BE5F 1HW2A 3RVZA 3EG9A 4JTCB 2I15A 4JW1A 3AJMA 2KJGA 1AVOB 2YLDA 4AK9A 4PFOA 2W4BA 3ZQYA 2PX3A 3M1CB 4YL1A 4JEBA 2IOQA 2XLWA 1OCZC 4BJ1A 4IARA 3G4XA 1DOWA 5COGA 1ZHZA 4BJ5C 3LNMB 2XL8A 3UMIA 1Z63A 3OEOA 4CX9A 2LSEA 5KYUB 3R2PA 3QW1A 3TULA 5A6BD 4CSAA 1TWCA 2LQGA 2R9RB 4CBEA 2XM0A 1N1CA 1ZYRF 3R7CA 3V5ZA 1HMDA 4O6NA 2Y3HA 4OD5A 4RBNA 1TR2A 2PX0A 4X0RA 5DQZA 4BJ5A 4ZLDA 1NFOA 1D0YA 1YA9A 4MW3A 4PFPA 3NMIA 2OG2A 4KNWA 4E0HA 1JPNA 2LP4A 3DI5A 2VH3A 4ULVA 1NU9C 5JLIA 3FDQA 2R7TA 2A68F 4CS9C 4N06A 1S7ZA 1K40A 1YVIA 3V7OA 2KSFA 3EZHA 4Q4ZF 2IXNA 1ZVZA 4XEFA 3B0PA 2G62A 2XLEA 2YLIA 3FHDA 1LI5A 5AGFA 4YL3A 4NTBA 3TOMA 4CS9A 4L6RA 4N4WA 3SZRA 3ABKC 2CNWA 2GWWA 2ETSA 3C8GB 4XWJA 4EWCA 1L3PA 3S28A 1S05A 3DZAA 4XPYA 1VOMA 2ZD9A 2LCHA 1RKEA 1B68A 2J9BA 2Y3GA 1NBBA 2EPOA 1Z5ZA 1EI7A 2HFIA 2MWQA 3F46A 4MVZA 3T4RA 2Y3DA 4IJJA 1FFTC 3QTHA 2EPLX 2P61A 2PP4A 3U8VA 2V26A 1EQ1A 2IM8A 3U8PA 4XPXA 3C18A 2JD3A 1OCOC 2G3KA 4YT2A 5DS5A 3EJNA 2HZ8A 3S0XA 2F22A 3AQCA 2EPMX 1R5ID 4KI2A 1FTSA 3OWTA 2J9WA 4IRUA 1KU2A 256BA 1WASA 1Q0MA 1YJGA 3QW0A 4I44A 1E86A 5CIVA 1JAFA 3KL4A 2XXAA 4J7YA 3IQTA 2YEVA 4U9DA 1OR3A 1TWAA 2WL8A 3RIPA 2UUHA 2ZPAA 1ZU4A 2I8BA 2L6GA 3K1HA 2C04A 3RF3A 3VRCA 2ZXRA 3GODA 1A7EA 4NQFA 1G4US 4MVMA 2JPUA 4R32A 2M64A 3AQBA 3NRHA 5B1BC 2P7VA 4U5EE 2XS8A 2YLGA 1JPJA 2QLAA 4NC3A 4I1MA 3SP1A 2YRFA 1YA7O 1OW6A 5AC5A 3ECSA 2H7OA 3NG1A 4YWQA 4ZLCA 2WZLA 1ZHXA 3EG9B 1H7IA 3AG4C 1XZQA 2YWAA 2OJED 2W9YA 3LUTB 2DB4A 2OCCC 1A7DA 1NFNA 1LIHA 1SYQA 2EIKC 4U9EA 2OQMA 3FAJA 4U5FE 4YK5A 4JJGA 2LFFA 2HMQA 5DQTA 3EHMA 2L81A 3AG3C 3FMSA 5B1AC 1BBHA 5GPGB 4I3MA 3UR3C 3EFOA 3B29A 3WAQA 4AE4A 1BDJB 1MMDA 1MQVA 3S84A 4C7OA 1V74B 3SYNA 1F1MA 3MFNA 4K7BA 3DJNB 1M56C 4PJMA 4J32B 3V5XA 4IGGA 3HJCA 2OJQA 5E3CA 2G3VA 3U2LA 2R7XA 3A11A 1D0ZA 2YKZA 4BPMA 4IAOA 3CAXA 4QDLA 2WZFA 3SEOA 3L8IA 3UNGC 2XRHA 3JTLO 3PCVA 3SXMA 3SXYA 1V4AA 4E7SA 1FMWA 2BC5A 4HEAJ 1ORSC 3PMRA 2OEXA 2BL2A 3IQ5A 5K0IA 5KYYA 4MS2A 1YZAA 4XLNF 3WODF 1VLSA 2CGEA 1ZW3A 3Q7GA 4FESA 4PJJA 5IY5C 2X51A 3JRTA 2YZSA 3UMHA 4J30B 1LE4A 1FR0A 1EA8A 1XZPA 1HMOA 3CSKA 5COMA 1U0BB 1QVXA 4G0HA 1QPUA 2CCYA 3NYMA 3RQGA 3H2UA 2H8AA 2KGOA 1LE2A 4MVQA 4C3EA 1RKEB 2OU6A 3N2ZB 1D1BA 1APCA 3QMKA 1I4YA 3LJBA 3E9VA 1W2WA 2RSEB 3F47A 2EILC 3M79A 3EGXA 1NSGB 2P1AA 1M6TA 3GM2A 2IYLD 2KC3A 2W45A 3BEHA 4K0DA 3RFYA 3RYLA 3U2MA 2O9XA 5HV9A 2R25A 3Q7LA 5L0GA 4EHPA 3ABMC 3VM6A 3K66A 1NG1A 3DKAA 3DAGA 1NZEA 3ZG1A 3EHNA 3MX3A 4JJFA 1KNYA 4DVYP 5A69A 5A6KA 2TMVP 4ANJA 4CSAC 1AEPA 1HE1A 4AL1A 2Q9CA 2XXAB 3DE8A 1OW8A 3L34A 3Q6NA 5F5HA 3TK0A 4C3BA 4MVOA 1DOVA 2L6HA 2WVNA 3ZVRA 3AOUA 3FAPB 2KK1A 2IXOA 4P6IC 4OIQF 3KYIA 1TFKB 5JS5A 2P6VA 5L3QA 5KYXA 4DRJB 1SF8A 3HKKA 3DM5A 1IZMA 3GWLA 3KYJA 3O6XA 3RQFA 2XM4A 2XL4A 1XWJA 4BG0A 2HKVA 2WVQA 4U5CE 1C02A 2VCBA 2MYSA 1SMYF 5EGYA 3DWWA 4N6CA 4WJ0A 5BUOA 3ATPA 3RH3A 2ZXWC 4A2NB 5A6BA 4XTKA 1I4ZA 4IAQA 4K1OA 4ONSA 2D5RB 2B0JA 3G50A 3EH1A 4PJLA 1M2OA 2E87A 4O6YA 1LKXA 2XSEA 1U89A 1ZHYA 1JMWA 2CDQA 4BJTA 3C8ZA 3EFOB 3FVYA 4AE4B 5A6AA 2DI3A 2V3CC 4C7OB 2YQYA 3DMDA 3JRMO 4P9TA 3EPVA 3LEOA 3ZWIA 1E85A 3ASOC 4MTOA 1G4WR 3ABLC 5E3AA 1ZW2A 2AWYA 2HV6A 4WGZA 3IQCA 4AL0A 2VCCA 4JKVA 1NU7D 2D4UA 5FZTA 1H9GA 3LS1A 3JSEO 1YYJA 3Q6MA 3NDBB 4HE8D 3K7DA 4FAPB 2XLHA 1OW7A 3C63A 1Z23A 1Q0DA 1VTMP 5KYYB 5L0CA 2VCAA 1CPQA 2XLMA 3O55A 5CI9A 4JURI 2Q3TA 3M4BA 1H9TA 2OKUA 4CDVA 4PR9A 2HS5A 4Q7CA 3VF0A 3NKDA 3QVZA 1T6IA 4LACB 4CDYA 3DJUB 1TFOB 1WWPA 1OR2A 2CYDA 2H7VC 3I5QA 4O6MA 2NUTA 2YL0A 2YVKA 3QVYA 3TJ5A 4LERA 2DYRC 1G8XA 1T6QA 3EGDA 4JE9A 4CS8A 4EBKA 3UGPA 4U5HA 3UMKA 1LPEA 3GM3A 3FOPA 1TKNA 4M63A 1Q0GA 1MNEA 3IQ6A 4E18A 3LEVA 1MMNA 1K04A 4NCQA 1M2VA 4J7TA 4JTAB 3MLGA 4MVRA 3C62A 2NSGA 1L7CA 3KPHA 1AUEA 4O79A 1CGOA 3W4YA 1O5HA 4W8PA 3S9OA 4MW8A 4CJOA 4GYTA 4GQHA 2PFDA 2XL6A 5COFA 1FNTc 1HY5A 4XLPF 4JZAA 3RQEA 3C7JA 1TQGA 2J46A 3MYFA 3DM9B 2HV7A 1Z7Qc 1ORJA 2Q9BA 1OKKD 3G4ZA 4JEAA 2QTVA 3U0CA 4LLEA 1V55C 4KNVA 4FX5A 1RMVA 1J8YF 3IEEA 4YT5A 1YZCA 4LDRA 4PK4A 1Q0FA 1R4TA 2ASRA 3N0TA 3ZTMA 2FFHA 2Y3BA 3BRJA 2M4EA 3S90A 3JYYA 4U5GA 3M4CA 1D1CA 3W8IA 5KYXB 3QZCA 4D4XA 3DE9A 3C8GD 2AU5A 1ORYA 1OXBA 4XQ1A 1ST6A 3DAFA 3GEEA 4QI0A 5CI8A 3LLIA 2OEVA 4DXWA 4JCZA 1GGQA 1BR1A 1TWGA 3X1OA 2J9UA 4LDKA 2R03A 3RW0A 4G7ZF 2J7PD 2R7VA 1JOGA 3JYHA 3S29A 1LVKA 3FXHA 3NYLA 4JCHA 4DRHB 2A1DD 2XLVA 4MVUA 4RD9A 4MNDA 5BQIA 1RJ9A 2VB6A 2ZXOA 2C03A 3X2QC 2Y69C 4WABA 4YT8A 3L1MA 4Z9IA 4NTFA 3LAYA 3SXZA 2WB7A 2WZGA 3O10A 4EKWA 2LK4A 3HTKC 1VYKA 4F4BA 2KNHA 1QQ3A 2RD9A 3K33A 1A7VA 3EZIA 2DYSC 1E84A 1VMAA 2L9JA 4A4AA 1TWHA 3LS0A 4D4NA 4PACA 2HSBA 1M57C 1O3UA 5FCLA 1LM3B 3M15A 4OD4A 3VYWA 1LS1A 2AP3A 2EPNA 1O87A 2J9VA 5HSWA 1RXQA 2X0CA 3B0VC 3GEHA 3U9JA 3IPMO 4U5DE 1SR2A 1WGWA 4GEHA 2UUIA 2R05A 3B71A 4DVZA 4XEVA 4DBQA 2NUTB 2PF4E 4RDAA 3POVA 3EGDB 1CPRA 1HE9A 2EIJC 4ER9A 1CGNA 4I1OB 2Q4FA 3SNHA 1K05A 2IXMA 2YL1A 2YL3A 1G5ZA 2VC9A 3NYJA 4G78A 4PJNA 1M2VB 3K1IA 3IHUA 3JZ0A 3H2VA 1ZHTA 5BQHA 1ZHWA 1T9KA 2LIGA 4ULWA 2AWCA 1GS9A 3ZIBA 3S27A 1Y4CA 2A6EF 2CW0F 1YLMA 3HLZA 2FGYA 4IWBA 4AX2A 4MTGA 4LLCA 4KC9A 2A0BA 4KBLA 2R7QA 1A0BA 4MQ9F 4JC7A 3KMIA 5E33A 4QI2A 2R02A 3W8HA 3HNJA 2IBFA 1V54C 3A9CA 2MHRA 3L8JA 1WN0A 3LNRA 4LDQA 3VAYA 5EHHA 2DGJA 5A6JA 5DS6A 3UGOA 4JRZA 2R7RA 1C17M 1WTYA 3NMJA 2NUPA 3JCUQ 2XS1A 2CNWD 1RCPA 3H65A 4MTFA 5EK0A 4E17A 4G7HF 2H7BA 2EIMC 2HUJA 2QNLA 4XPWA 3U5SA 3TD7A 4EBJA 3LLKA 4U5BE 1KTMA 4CIHA 1LS4A 4NTAA 1I5NA 1D1AA 2J45A 5KYWA 2NSFA 1MMGA 2GAQA 2LFDA 3I5PA 4P9FA 4Z9HA 5L0DA 1YAUO 3NKEA 3MBGA 3OA1A 4C3DA 3DXJF 1CGME 4CS8C 1RJ9B 3U3FA 1EKYA 1T6UA 2VASA 5D91A 1YDIA 1T5OA 3GM1A 1NLXA 3L0IA 5BQGA 3DD7A 3CQZA 4H54A 2R7WA 4UDVA 2J0WA 2A0UA 1VYIA 1WATA 2WVOA 2HJ3A 3K6BA 4CDAA 1E83A 2Q9AA 5JRAA 2NPUA 5AC4A 4OIPF 5F5FA 1QKRA 5B3SC 2L7AA 3EGXB 1UG7A 1PD1A 4O7GA 3TJ6A 5JSLA 3JT1A 3WHNA 4OIOF 1VB5A 1YYXA 2HJMA 2YHSA 3FOOA 1GQAA 3T9OA 3ZDLA 3E70C 5B3IA 2OOCA 2XLDA 3ASNC 2YL7A 4NY3A 4EIYA 5L0FA 5T1DB 4G7OF 1VK5A 3AGTA 1BR4A 2XLOA 1U6HA 2GDCA 1OCRC 3ZC4A 1D0XA 2IXPA 3EH2A 2ZXPA 5KYNA 3CZ6A 4DBRA 2QY9A 3AG2C 4E7ZA 5KYUA 1OCCC 4BJ6C 1FMVA 3K1IC 1Y6DA 3N24A 2KYHA 3W2VA 4Z9JA 4E0IA 1Z6AA 3I4UA 4H4KC 2HMZA 4YL0A 1PCXA 1OXKA 5TJ5E 3B0UX 2J8WA 4EUKB 3TQOA 1UFBA 4EBBA 4W8KA 3TOLA 4BJ6A 3GANA 2J0XA
chains in the Genus database with same CATH topology
2XM4A 1LM3B 3M15A 4N6HA 3ZTZA 256BA 3QW0A 3HNLA 4IAQA 1E86A 4IB4A 3HNKA 1JAFA 4U9DA 5JP7A 3VRCA 1CPRA 4ER9A 1CGNA 3ZWIA 1E85A 2YL1A 2YL3A 2YLGA 2QLAA 4NC3A 4WGZA 4JKVA 1YYJA 2XLHA 3C63A 3NMKA 3HNIA 2XLMA 1CPQA 4CJGA 4U9EA 5JT4A 3M4BA 4CDVA 3ZQVA 3HNJA 3QVZA 4CDYA 1BBHA 2YL0A 5JUAA 3QVYA 1MQVA 3NMJA 4JE9A 1RCPA 3FOPA 4CIPA 4WGYA 5JVEA 3IQ6A 5B3IA 2YKZA 3C62A 1CGOA 2BC5A 4CJOA 2XL6A 2YLDA 3ZQYA 3IQ5A 1YZAA 4JEBA 2XLWA 4IARA 2XL8A 1EKYA 4CX9A 4JEAA 1QPUA 2CCYA 3QW1A 4D4NA 1YZCA 2XM0A 3ZTMA 1APCA 4CDAA 3M4CA 5JRAA 1E83A 4D4XA 3DE9A 3M79A 3NMIA 1M6TA 4ULVA 5JSLA 5JLIA 1YYXA 3FOOA 1GQAA 2XLDA 4EIYA 2YL7A 5AGFA 2XLEA 2YLIA 2XLOA 3TOMA 4L6RA 4N4WA 3DE8A 2XLVA 3L1MA 1S05A 2J9BA 1NBBA 1QQ3A 1A7VA 5JS5A 2J8WA 1E84A 3TOLA 3U8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XM4 A;  1LM3 B;  3M15 A;  4N6H A;  3ZTZ A;  256B A;  3QW0 A;  3HNL A;  4IAQ A;  1E86 A;  4IB4 A;  3HNK A;  1JAF A;  4U9D A;  5JP7 A;  3VRC A;  1CPR A;  4ER9 A;  1CGN A;  3ZWI A;  1E85 A;  2YL1 A;  2YL3 A;  2YLG A;  2QLA A;  4NC3 A;  4WGZ A;  4JKV A;  1YYJ A;  2XLH A;  3C63 A;  3NMK A;  3HNI A;  2XLM A;  1CPQ A;  4CJG A;  4U9E A;  5JT4 A;  3M4B A;  4CDV A;  3ZQV A;  3HNJ A;  3QVZ A;  4CDY A;  1BBH A;  2YL0 A;  5JUA A;  3QVY A;  1MQV A;  3NMJ A;  4JE9 A;  1RCP A;  3FOP A;  4CIP A;  4WGY A;  5JVE A;  3IQ6 A;  5B3I A;  2YKZ A;  3C62 A;  1CGO A;  2BC5 A;  4CJO A;  2XL6 A;  2YLD A;  3ZQY A;  3IQ5 A;  1YZA A;  4JEB A;  2XLW A;  4IAR A;  2XL8 A;  1EKY A;  4CX9 A;  4JEA A;  1QPU A;  2CCY A;  3QW1 A;  4D4N A;  1YZC A;  2XM0 A;  3ZTM A;  1APC A;  4CDA A;  3M4C A;  5JRA A;  1E83 A;  4D4X A;  3DE9 A;  3M79 A;  3NMI A;  1M6T A;  4ULV A;  5JSL A;  5JLI A;  1YYX A;  3FOO A;  1GQA A;  2XLD A;  4EIY A;  2YL7 A;  5AGF A;  2XLE A;  2YLI A;  2XLO A;  3TOM A;  4L6R A;  4N4W A;  3DE8 A;  2XLV A;  3L1M A;  1S05 A;  2J9B A;  1NBB A;  1QQ3 A;  1A7V A;  5JS5 A;  2J8W A;  1E84 A;  3TOL A;  3U8P A; 
#chains in the Genus database with same CATH topology
 3EQL F;  4YT4 A;  1T01 A;  3V5Y A;  2L6F A;  3GEI A;  4BEJ A;  3PDM P;  3T6G B;  1MND A;  4N6H A;  3ZTZ A;  2B0H A;  2FAP B;  3KKB A;  1BR2 A;  2A69 F;  5DVW A;  2R7S A;  1OKK A;  4BEM J;  3WG7 C;  1JRA A;  2LD6 A;  3HNL A;  1WOL A;  2Y39 A;  3W2W A;  3PHF 2;  2HSQ A;  1A41 A;  2EPK X;  4HFK B;  5T3T A;  5DLJ A;  3KH2 A;  4IB4 A;  3ITF A;  3HNK A;  5F28 E;  5JP7 A;  4OIN F;  4XEK A;  1VLT A;  1RKC A;  2JX0 A;  5L0I A;  1E2X A;  4YN0 B;  2PNO A;  1GM5 A;  3C8G A;  1HW1 A;  2NUP B;  2EIN C;  5L0J A;  4HFF B;  2PBE A;  2Z15 A;  3RKO F;  3T6J A;  1FAP B;  1ZU5 A;  2GFH A;  2QUP A;  3US6 A;  2A6H F;  2W4M A;  4YJW A;  1J8M F;  1JR8 A;  2AVK A;  4DJ9 A;  1ZZP A;  2J7P A;  3U9M A;  1Z3I X;  3ZSU A;  1QLE C;  5KYW B;  4Q5S F;  3GOR A;  4DOZ A;  5T3W A;  4MVS A;  3NMK A;  3HNI A;  3SXK A;  4JTD B;  3B9Q A;  1IW7 F;  1PD0 A;  2KQ9 A;  5L0H A;  4CJG A;  3CEX A;  1Q0K A;  1C03 A;  1QSP A;  5JT4 A;  1H6G A;  3U3B A;  1SZI A;  1MMA A;  2GA0 A;  3O39 A;  3ZQV A;  4B6I A;  3AGU A;  1QZX A;  4OIR F;  1OQC A;  1PV3 A;  3MYI A;  2Q00 A;  5E2Q A;  3JSZ A;  4FWV A;  3T6B A;  5JUA A;  2QE9 A;  2KW3 C;  2NG1 A;  3GWN A;  2R7O A;  2Q7R A;  3RVY A;  5D92 A;  2P0N A;  3AG1 C;  4CS7 A;  3J06 A;  3LES A;  1LI7 A;  4CIP A;  4WGY A;  5DS4 A;  1FFH A;  4JVS A;  5L3V A;  1YAR O;  4JIO A;  4DRI B;  5JVE A;  1BZ4 A;  2ICW G;  2R7U A;  2BE5 F;  1HW2 A;  3RVZ A;  3EG9 A;  4JTC B;  2I15 A;  4JW1 A;  3AJM A;  2KJG A;  1AVO B;  2YLD A;  4AK9 A;  4PFO A;  2W4B A;  3ZQY A;  2PX3 A;  3M1C B;  4YL1 A;  4JEB A;  2IOQ A;  2XLW A;  1OCZ C;  4BJ1 A;  4IAR A;  3G4X A;  1DOW A;  5COG A;  1ZHZ A;  4BJ5 C;  3LNM B;  2XL8 A;  3UMI A;  1Z63 A;  3OEO A;  4CX9 A;  2LSE A;  5KYU B;  3R2P A;  3QW1 A;  3TUL A;  5A6B D;  4CSA A;  1TWC A;  2LQG A;  2R9R B;  4CBE A;  2XM0 A;  1N1C A;  1ZYR F;  3R7C A;  3V5Z A;  1HMD A;  4O6N A;  2Y3H A;  4OD5 A;  4RBN A;  1TR2 A;  2PX0 A;  4X0R A;  5DQZ A;  4BJ5 A;  4ZLD A;  1NFO A;  1D0Y A;  1YA9 A;  4MW3 A;  4PFP A;  3NMI A;  2OG2 A;  4KNW A;  4E0H A;  1JPN A;  2LP4 A;  3DI5 A;  2VH3 A;  4ULV A;  1NU9 C;  5JLI A;  3FDQ A;  2R7T A;  2A68 F;  4CS9 C;  4N06 A;  1S7Z A;  1K40 A;  1YVI A;  3V7O A;  2KSF A;  3EZH A;  4Q4Z F;  2IXN A;  1ZVZ A;  4XEF A;  3B0P A;  2G62 A;  2XLE A;  2YLI A;  3FHD A;  1LI5 A;  5AGF A;  4YL3 A;  4NTB A;  3TOM A;  4CS9 A;  4L6R A;  4N4W A;  3SZR A;  3ABK C;  2CNW A;  2GWW A;  2ETS A;  3C8G B;  4XWJ A;  4EWC A;  1L3P A;  3S28 A;  1S05 A;  3DZA A;  4XPY A;  1VOM A;  2ZD9 A;  2LCH A;  1RKE A;  1B68 A;  2J9B A;  2Y3G A;  1NBB A;  2EPO A;  1Z5Z A;  1EI7 A;  2HFI A;  2MWQ A;  3F46 A;  4MVZ A;  3T4R A;  2Y3D A;  4IJJ A;  1FFT C;  3QTH A;  2EPL X;  2P61 A;  2PP4 A;  3U8V A;  2V26 A;  1EQ1 A;  2IM8 A;  3U8P A;  4XPX A;  3C18 A;  2JD3 A;  1OCO C;  2G3K A;  4YT2 A;  5DS5 A;  3EJN A;  2HZ8 A;  3S0X A;  2F22 A;  3AQC A;  2EPM X;  1R5I D;  4KI2 A;  1FTS A;  3OWT A;  2J9W A;  4IRU A;  1KU2 A;  256B A;  1WAS A;  1Q0M A;  1YJG A;  3QW0 A;  4I44 A;  1E86 A;  5CIV A;  1JAF A;  3KL4 A;  2XXA A;  4J7Y A;  3IQT A;  2YEV A;  4U9D A;  1OR3 A;  1TWA A;  2WL8 A;  3RIP A;  2UUH A;  2ZPA A;  1ZU4 A;  2I8B A;  2L6G A;  3K1H A;  2C04 A;  3RF3 A;  3VRC A;  2ZXR A;  3GOD A;  1A7E A;  4NQF A;  1G4U S;  4MVM A;  2JPU A;  4R32 A;  2M64 A;  3AQB A;  3NRH A;  5B1B C;  2P7V A;  4U5E E;  2XS8 A;  2YLG A;  1JPJ A;  2QLA A;  4NC3 A;  4I1M A;  3SP1 A;  2YRF A;  1YA7 O;  1OW6 A;  5AC5 A;  3ECS A;  2H7O A;  3NG1 A;  4YWQ A;  4ZLC A;  2WZL A;  1ZHX A;  3EG9 B;  1H7I A;  3AG4 C;  1XZQ A;  2YWA A;  2OJE D;  2W9Y A;  3LUT B;  2DB4 A;  2OCC C;  1A7D A;  1NFN A;  1LIH A;  1SYQ A;  2EIK C;  4U9E A;  2OQM A;  3FAJ A;  4U5F E;  4YK5 A;  4JJG A;  2LFF A;  2HMQ A;  5DQT A;  3EHM A;  2L81 A;  3AG3 C;  3FMS A;  5B1A C;  1BBH A;  5GPG B;  4I3M A;  3UR3 C;  3EFO A;  3B29 A;  3WAQ A;  4AE4 A;  1BDJ B;  1MMD A;  1MQV A;  3S84 A;  4C7O A;  1V74 B;  3SYN A;  1F1M A;  3MFN A;  4K7B A;  3DJN B;  1M56 C;  4PJM A;  4J32 B;  3V5X A;  4IGG A;  3HJC A;  2OJQ A;  5E3C A;  2G3V A;  3U2L A;  2R7X A;  3A11 A;  1D0Z A;  2YKZ A;  4BPM A;  4IAO A;  3CAX A;  4QDL A;  2WZF A;  3SEO A;  3L8I A;  3UNG C;  2XRH A;  3JTL O;  3PCV A;  3SXM A;  3SXY A;  1V4A A;  4E7S A;  1FMW A;  2BC5 A;  4HEA J;  1ORS C;  3PMR A;  2OEX A;  2BL2 A;  3IQ5 A;  5K0I A;  5KYY A;  4MS2 A;  1YZA A;  4XLN F;  3WOD F;  1VLS A;  2CGE A;  1ZW3 A;  3Q7G A;  4FES A;  4PJJ A;  5IY5 C;  2X51 A;  3JRT A;  2YZS A;  3UMH A;  4J30 B;  1LE4 A;  1FR0 A;  1EA8 A;  1XZP A;  1HMO A;  3CSK A;  5COM A;  1U0B B;  1QVX A;  4G0H A;  1QPU A;  2CCY A;  3NYM A;  3RQG A;  3H2U A;  2H8A A;  2KGO A;  1LE2 A;  4MVQ A;  4C3E A;  1RKE B;  2OU6 A;  3N2Z B;  1D1B A;  1APC A;  3QMK A;  1I4Y A;  3LJB A;  3E9V A;  1W2W A;  2RSE B;  3F47 A;  2EIL C;  3M79 A;  3EGX A;  1NSG B;  2P1A A;  1M6T A;  3GM2 A;  2IYL D;  2KC3 A;  2W45 A;  3BEH A;  4K0D A;  3RFY A;  3RYL A;  3U2M A;  2O9X A;  5HV9 A;  2R25 A;  3Q7L A;  5L0G A;  4EHP A;  3ABM C;  3VM6 A;  3K66 A;  1NG1 A;  3DKA A;  3DAG A;  1NZE A;  3ZG1 A;  3EHN A;  3MX3 A;  4JJF A;  1KNY A;  4DVY P;  5A69 A;  5A6K A;  2TMV P;  4ANJ A;  4CSA C;  1AEP A;  1HE1 A;  4AL1 A;  2Q9C A;  2XXA B;  3DE8 A;  1OW8 A;  3L34 A;  3Q6N A;  5F5H A;  3TK0 A;  4C3B A;  4MVO A;  1DOV A;  2L6H A;  2WVN A;  3ZVR A;  3AOU A;  3FAP B;  2KK1 A;  2IXO A;  4P6I C;  4OIQ F;  3KYI A;  1TFK B;  5JS5 A;  2P6V A;  5L3Q A;  5KYX A;  4DRJ B;  1SF8 A;  3HKK A;  3DM5 A;  1IZM A;  3GWL A;  3KYJ A;  3O6X A;  3RQF A;  2XM4 A;  2XL4 A;  1XWJ A;  4BG0 A;  2HKV A;  2WVQ A;  4U5C E;  1C02 A;  2VCB A;  2MYS A;  1SMY F;  5EGY A;  3DWW A;  4N6C A;  4WJ0 A;  5BUO A;  3ATP A;  3RH3 A;  2ZXW C;  4A2N B;  5A6B A;  4XTK A;  1I4Z A;  4IAQ A;  4K1O A;  4ONS A;  2D5R B;  2B0J A;  3G50 A;  3EH1 A;  4PJL A;  1M2O A;  2E87 A;  4O6Y A;  1LKX A;  2XSE A;  1U89 A;  1ZHY A;  1JMW A;  2CDQ A;  4BJT A;  3C8Z A;  3EFO B;  3FVY A;  4AE4 B;  5A6A A;  2DI3 A;  2V3C C;  4C7O B;  2YQY A;  3DMD A;  3JRM O;  4P9T A;  3EPV A;  3LEO A;  3ZWI A;  1E85 A;  3ASO C;  4MTO A;  1G4W R;  3ABL C;  5E3A A;  1ZW2 A;  2AWY A;  2HV6 A;  4WGZ A;  3IQC A;  4AL0 A;  2VCC A;  4JKV A;  1NU7 D;  2D4U A;  5FZT A;  1H9G A;  3LS1 A;  3JSE O;  1YYJ A;  3Q6M A;  3NDB B;  4HE8 D;  3K7D A;  4FAP B;  2XLH A;  1OW7 A;  3C63 A;  1Z23 A;  1Q0D A;  1VTM P;  5KYY B;  5L0C A;  2VCA A;  1CPQ A;  2XLM A;  3O55 A;  5CI9 A;  4JUR I;  2Q3T A;  3M4B A;  1H9T A;  2OKU A;  4CDV A;  4PR9 A;  2HS5 A;  4Q7C A;  3VF0 A;  3NKD A;  3QVZ A;  1T6I A;  4LAC B;  4CDY A;  3DJU B;  1TFO B;  1WWP A;  1OR2 A;  2CYD A;  2H7V C;  3I5Q A;  4O6M A;  2NUT A;  2YL0 A;  2YVK A;  3QVY A;  3TJ5 A;  4LER A;  2DYR C;  1G8X A;  1T6Q A;  3EGD A;  4JE9 A;  4CS8 A;  4EBK A;  3UGP A;  4U5H A;  3UMK A;  1LPE A;  3GM3 A;  3FOP A;  1TKN A;  4M63 A;  1Q0G A;  1MNE A;  3IQ6 A;  4E18 A;  3LEV A;  1MMN A;  1K04 A;  4NCQ A;  1M2V A;  4J7T A;  4JTA B;  3MLG A;  4MVR A;  3C62 A;  2NSG A;  1L7C A;  3KPH A;  1AUE A;  4O79 A;  1CGO A;  3W4Y A;  1O5H A;  4W8P A;  3S9O A;  4MW8 A;  4CJO A;  4GYT A;  4GQH A;  2PFD A;  2XL6 A;  5COF A;  1FNT c;  1HY5 A;  4XLP F;  4JZA A;  3RQE A;  3C7J A;  1TQG A;  2J46 A;  3MYF A;  3DM9 B;  2HV7 A;  1Z7Q c;  1ORJ A;  2Q9B A;  1OKK D;  3G4Z A;  4JEA A;  2QTV A;  3U0C A;  4LLE A;  1V55 C;  4KNV A;  4FX5 A;  1RMV A;  1J8Y F;  3IEE A;  4YT5 A;  1YZC A;  4LDR A;  4PK4 A;  1Q0F A;  1R4T A;  2ASR A;  3N0T A;  3ZTM A;  2FFH A;  2Y3B A;  3BRJ A;  2M4E A;  3S90 A;  3JYY A;  4U5G A;  3M4C A;  1D1C A;  3W8I A;  5KYX B;  3QZC A;  4D4X A;  3DE9 A;  3C8G D;  2AU5 A;  1ORY A;  1OXB A;  4XQ1 A;  1ST6 A;  3DAF A;  3GEE A;  4QI0 A;  5CI8 A;  3LLI A;  2OEV A;  4DXW A;  4JCZ A;  1GGQ A;  1BR1 A;  1TWG A;  3X1O A;  2J9U A;  4LDK A;  2R03 A;  3RW0 A;  4G7Z F;  2J7P D;  2R7V A;  1JOG A;  3JYH A;  3S29 A;  1LVK A;  3FXH A;  3NYL A;  4JCH A;  4DRH B;  2A1D D;  2XLV A;  4MVU A;  4RD9 A;  4MND A;  5BQI A;  1RJ9 A;  2VB6 A;  2ZXO A;  2C03 A;  3X2Q C;  2Y69 C;  4WAB A;  4YT8 A;  3L1M A;  4Z9I A;  4NTF A;  3LAY A;  3SXZ A;  2WB7 A;  2WZG A;  3O10 A;  4EKW A;  2LK4 A;  3HTK C;  1VYK A;  4F4B A;  2KNH A;  1QQ3 A;  2RD9 A;  3K33 A;  1A7V A;  3EZI A;  2DYS C;  1E84 A;  1VMA A;  2L9J A;  4A4A A;  1TWH A;  3LS0 A;  4D4N A;  4PAC A;  2HSB A;  1M57 C;  1O3U A;  5FCL A;  1LM3 B;  3M15 A;  4OD4 A;  3VYW A;  1LS1 A;  2AP3 A;  2EPN A;  1O87 A;  2J9V A;  5HSW A;  1RXQ A;  2X0C A;  3B0V C;  3GEH A;  3U9J A;  3IPM O;  4U5D E;  1SR2 A;  1WGW A;  4GEH A;  2UUI A;  2R05 A;  3B71 A;  4DVZ A;  4XEV A;  4DBQ A;  2NUT B;  2PF4 E;  4RDA A;  3POV A;  3EGD B;  1CPR A;  1HE9 A;  2EIJ C;  4ER9 A;  1CGN A;  4I1O B;  2Q4F A;  3SNH A;  1K05 A;  2IXM A;  2YL1 A;  2YL3 A;  1G5Z A;  2VC9 A;  3NYJ A;  4G78 A;  4PJN A;  1M2V B;  3K1I A;  3IHU A;  3JZ0 A;  3H2V A;  1ZHT A;  5BQH A;  1ZHW A;  1T9K A;  2LIG A;  4ULW A;  2AWC A;  1GS9 A;  3ZIB A;  3S27 A;  1Y4C A;  2A6E F;  2CW0 F;  1YLM A;  3HLZ A;  2FGY A;  4IWB A;  4AX2 A;  4MTG A;  4LLC A;  4KC9 A;  2A0B A;  4KBL A;  2R7Q A;  1A0B A;  4MQ9 F;  4JC7 A;  3KMI A;  5E33 A;  4QI2 A;  2R02 A;  3W8H A;  3HNJ A;  2IBF A;  1V54 C;  3A9C A;  2MHR A;  3L8J A;  1WN0 A;  3LNR A;  4LDQ A;  3VAY A;  5EHH A;  2DGJ A;  5A6J A;  5DS6 A;  3UGO A;  4JRZ A;  2R7R A;  1C17 M;  1WTY A;  3NMJ A;  2NUP A;  3JCU Q;  2XS1 A;  2CNW D;  1RCP A;  3H65 A;  4MTF A;  5EK0 A;  4E17 A;  4G7H F;  2H7B A;  2EIM C;  2HUJ A;  2QNL A;  4XPW A;  3U5S A;  3TD7 A;  4EBJ A;  3LLK A;  4U5B E;  1KTM A;  4CIH A;  1LS4 A;  4NTA A;  1I5N A;  1D1A A;  2J45 A;  5KYW A;  2NSF A;  1MMG A;  2GAQ A;  2LFD A;  3I5P A;  4P9F A;  4Z9H A;  5L0D A;  1YAU O;  3NKE A;  3MBG A;  3OA1 A;  4C3D A;  3DXJ F;  1CGM E;  4CS8 C;  1RJ9 B;  3U3F A;  1EKY A;  1T6U A;  2VAS A;  5D91 A;  1YDI A;  1T5O A;  3GM1 A;  1NLX A;  3L0I A;  5BQG A;  3DD7 A;  3CQZ A;  4H54 A;  2R7W A;  4UDV A;  2J0W A;  2A0U A;  1VYI A;  1WAT A;  2WVO A;  2HJ3 A;  3K6B A;  4CDA A;  1E83 A;  2Q9A A;  5JRA A;  2NPU A;  5AC4 A;  4OIP F;  5F5F A;  1QKR A;  5B3S C;  2L7A A;  3EGX B;  1UG7 A;  1PD1 A;  4O7G A;  3TJ6 A;  5JSL A;  3JT1 A;  3WHN A;  4OIO F;  1VB5 A;  1YYX A;  2HJM A;  2YHS A;  3FOO A;  1GQA A;  3T9O A;  3ZDL A;  3E70 C;  5B3I A;  2OOC A;  2XLD A;  3ASN C;  2YL7 A;  4NY3 A;  4EIY A;  5L0F A;  5T1D B;  4G7O F;  1VK5 A;  3AGT A;  1BR4 A;  2XLO A;  1U6H A;  2GDC A;  1OCR C;  3ZC4 A;  1D0X A;  2IXP A;  3EH2 A;  2ZXP A;  5KYN A;  3CZ6 A;  4DBR A;  2QY9 A;  3AG2 C;  4E7Z A;  5KYU A;  1OCC C;  4BJ6 C;  1FMV A;  3K1I C;  1Y6D A;  3N24 A;  2KYH A;  3W2V A;  4Z9J A;  4E0I A;  1Z6A A;  3I4U A;  4H4K C;  2HMZ A;  4YL0 A;  1PCX A;  1OXK A;  5TJ5 E;  3B0U X;  2J8W A;  4EUK B;  3TQO A;  1UFB A;  4EBB A;  4W8K A;  3TOL A;  4BJ6 A;  3GAN A;  2J0X A; 
#chains in the Genus database with same CATH homology
 2XM4 A;  1LM3 B;  3M15 A;  4N6H A;  3ZTZ A;  256B A;  3QW0 A;  3HNL A;  4IAQ A;  1E86 A;  4IB4 A;  3HNK A;  1JAF A;  4U9D A;  5JP7 A;  3VRC A;  1CPR A;  4ER9 A;  1CGN A;  3ZWI A;  1E85 A;  2YL1 A;  2YL3 A;  2YLG A;  2QLA A;  4NC3 A;  4WGZ A;  4JKV A;  1YYJ A;  2XLH A;  3C63 A;  3NMK A;  3HNI A;  2XLM A;  1CPQ A;  4CJG A;  4U9E A;  5JT4 A;  3M4B A;  4CDV A;  3ZQV A;  3HNJ A;  3QVZ A;  4CDY A;  1BBH A;  2YL0 A;  5JUA A;  3QVY A;  1MQV A;  3NMJ A;  4JE9 A;  1RCP A;  3FOP A;  4CIP A;  4WGY A;  5JVE A;  3IQ6 A;  5B3I A;  2YKZ A;  3C62 A;  1CGO A;  2BC5 A;  4CJO A;  2XL6 A;  2YLD A;  3ZQY A;  3IQ5 A;  1YZA A;  4JEB A;  2XLW A;  4IAR A;  2XL8 A;  1EKY A;  4CX9 A;  4JEA A;  1QPU A;  2CCY A;  3QW1 A;  4D4N A;  1YZC A;  2XM0 A;  3ZTM A;  1APC A;  4CDA A;  3M4C A;  5JRA A;  1E83 A;  4D4X A;  3DE9 A;  3M79 A;  3NMI A;  1M6T A;  4ULV A;  5JSL A;  5JLI A;  1YYX A;  3FOO A;  1GQA A;  2XLD A;  4EIY A;  2YL7 A;  5AGF A;  2XLE A;  2YLI A;  2XLO A;  3TOM A;  4L6R A;  4N4W A;  3DE8 A;  2XLV A;  3L1M A;  1S05 A;  2J9B A;  1NBB A;  1QQ3 A;  1A7V A;  5JS5 A;  2J8W A;  1E84 A;  3TOL A;  3U8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...