2YL0A

Cytochrome c prime from alcaligenes xylosoxidans: as isolated l16a variant at 0.95 a resolution
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
127
structure length
127
Chain Sequence
EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 54
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yl0A00
1E83A 1QPUA 1E85A 3DE8A 3M4CA 5JSLA 4CJOA 2YKZA 3HNJA 3C62A 3M79A 2YL3A 4CJGA 3ZTMA 1YYXA 1CPRA 2XLVA 1RCPA 2CCYA 1JAFA 1EKYA 4EIYA 2J8WA 4D4NA 4IB4A 1YZAA 4IARA 3TOMA 1CGNA 3QVZA 4CDYA 4JEAA 1S05A 4U9EA 4D4XA 1E84A 1BBHA 2BC5A 2XM4A 1CPQA 3FOPA 3HNLA 5JS5A 1E86A 3HNIA 4CDAA 4L6RA 5JVEA 3ZQVA 256BA 1APCA 2XL8A 2YL7A 2YLIA 2XL6A 2YL0A 2YLGA 5JRAA 3C63A 4JKVA 1YYJA 3QVYA 3DE9A 4N6HA 2XM0A 1A7VA 3VRCA 3NMJA 3QW1A 4CX9A 5JUAA 2XLMA 2XLHA 2YLDA 4JE9A 2QLAA 4WGYA 3IQ6A 4CIPA 3IQ5A 3M4BA 4N4WA 5JP7A 3ZQYA 4ULVA 4NC3A 3M15A 2YL1A 1LM3B 1NBBA 3NMKA 5JT4A 1CGOA 4WGZA 5AGFA 3NMIA 2XLOA 1QQ3A 1MQVA 5JLIA 3ZWIA 3U8PA 1YZCA 2XLWA 3FOOA 5B3IA 3QW0A 3HNKA 3TOLA 2XLEA 4U9DA 4IAQA 4JEBA 3ZTZA 1GQAA 4CDVA 1M6TA 4ER9A 3L1MA 2J9BA 2XLDA
chains in the Genus database with same CATH superfamily
5F5HA 5A69A 1E2XA 3L8JA 4GYTA 4XWJA 2YWAA 2YZSA 3NDBB 1QPUA 2EPOA 1D0ZA 2JD3A 1ST6A 3Q7LA 4NCQA 4MVUA 5HSWA 3ZVRA 2ZD9A 4C3DA 3SXKA 3ABKC 2ICWG 1D0YA 2HKVA 3R7CA 4ANJA 1VLSA 3IQTA 2XXAB 1K40A 5E2QA 1V4AA 1OCOC 2BL2A 3EQLF 4G0HA 4U5BE 5B3SC 2R7TA 1A7EA 4JIOA 2W9YA 1NU9C 3HJCA 1DOWA 3TQOA 2Q3TA 1OR2A 1A41A 1EKYA 3NKEA 2J8WA 4HEAJ 4U5FE 1LS4A 5F28E 1XWJA 3RW0A 4EIYA 2RD9A 2KSFA 3PDMP 5EHHA 2IXMA 4XEKA 2L81A 3U5SA 4NTAA 4CDYA 1XZPA 4JEAA 4MNDA 2OG2A 1M2OA 4D4XA 4AL1A 4MW3A 3AQCA 1CPQA 3RH3A 4DBQA 2BE5F 4CDAA 5B1BC 2GFHA 1IW7F 3IPMO 2R03A 4E7SA 3A9CA 3SZRA 1PD1A 3FHDA 4HE8D 2J7PD 2YL7A 3C8GD 3DD7A 2IXPA 2Y3HA 3HTKC 1OKKD 2GWWA 2YL0A 2IBFA 5JRAA 3C63A 3N2ZB 2OU6A 4FWVA 1YYJA 3EGXA 2A69F 3QVYA 4U5DE 2LP4A 4N6HA 3OWTA 3JZ0A 4JC7A 1HMDA 1VYIA 5DS5A 4E0IA 1FAPB 4CX9A 3WAQA 3X1OA 4H54A 2AP3A 1FMVA 1YA7O 4JE9A 3O39A 3RQFA 1ZW3A 2J9VA 2R02A 4O6MA 2QUPA 3JSEO 2QNLA 3M4BA 3EZIA 3KYJA 4H4KC 4JTCB 1BR1A 4XLPF 4C3BA 1BR4A 1OCRC 1VTMP 4G7OF 2EPNA 1M2VA 1LIHA 3U9MA 1LKXA 4CSAC 1HY5A 2P61A 3HLZA 1TFKB 5BQHA 4YL0A 3C8GB 4WGZA 3IQCA 1Q0KA 2ZPAA 4EWCA 3S90A 3MLGA 5CIVA 1OCCC 4G7ZF 1UG7A 2M4EA 3E70C 2HS5A 1ZZPA 3TJ5A 2CGEA 1Y4CA 3RFYA 1IZMA 4FX5A 3W2WA 1RXQA 2EIMC 2HMZA 5JLIA 3U8PA 2HJMA 5BQIA 2DB4A 3S84A 2VCAA 1EI7A 4LLEA 5TJ5E 4PFOA 4QI2A 2HUJA 4EBBA 1FMWA 3FOOA 5B3IA 4CIHA 1RKEA 2OOCA 2LFDA 3EFOA 4JTDB 4MVSA 3EGDA 2G3KA 1QLEC 5KYWA 3TOLA 2P7VA 4DRIB 3QZCA 3GM3A 4JEBA 2B0HA 3JCUQ 1GQAA 4PFPA 4IRUA 2NG1A 4NTFA 3RQGA 3RVZA 3MFNA 1TQGA 1YAUO 1YDIA 1ORJA 3U2MA 4BPMA 5KYYB 4PK4A 1ORSC 3Q6MA 4W8PA 5KYUA 3U2LA 5D92A 1M6TA 3AG1C 1NSGB 3K66A 4UDVA 5DVWA 2NUPB 4YJWA 2KYHA 5L3QA 3O55A 5DLJA 4JCHA 4KNVA 1L3PA 2WVOA 3S0XA 3DKAA 4P6IC 2J9BA 1D1CA 2IXOA 2W4MA 3L0IA 4EUKB 4MTFA 4DVZA 5KYNA 2LCHA 1E85A 3M4CA 3I5QA 2R7OA 1FFHA 1D0XA 1TWHA 2FAPB 2YKZA 4MVZA 3Q7GA 3V7OA 1ZHYA 2YL3A 1J8MF 4R32A 1C03A 1D1AA 1WWPA 3DI5A 4XLNF 4CJGA 2IYLD 5DS4A 5DQZA 1NFOA 1Y6DA 1VMAA 3V5XA 1JPNA 2PFDA 4C7OA 3VM6A 4EHPA 3PMRA 3R2PA 2EIKC 1MNEA 2CNWD 3EG9B 1JAFA 1R4TA 3S29A 5KYXA 1BDJB 4D4NA 2MYSA 1Z6AA 3A11A 4LACB 1VK5A 3DM9B 3SXMA 5L0FA 1O3UA 1BZ4A 3G4ZA 4DJ9A 3SXZA 5A6JA 2AU5A 4IARA 2EPLX 3TJ6A 1QZXA 3ITFA 3QVZA 3TOMA 5A6AA 1I4ZA 4OIQF 2AVKA 1TWGA 1S05A 3DJNB 1ZYRF 2AWCA 3GEEA 4N06A 5T3TA 3B71A 2Y3BA 4G7HF 1SYQA 4FAPB 2R7WA 2BC5A 2NUTB 2XM4A 4X0RA 3HNLA 5JT4A 3K1IA 3HNIA 1G4WR 4YK5A 1Z7Qc 3ZIBA 3G4XA 2FFHA 4L6RA 5L0GA 4YT4A 3B0VC 2LFFA 5E3CA 3ZG1A 4BJ5A 3SEOA 4KBLA 4A4AA 3WODF 2RSEB 2KC3A 3CSKA 3T6GB 3GM2A 3HKKA 4PJMA 2UUIA 5CI9A 4Z9HA 2QTVA 3DE9A 3T6BA 1U89A 3X2QC 1A7VA 4NQFA 4E17A 1RMVA 3MX3A 4C3EA 3RQEA 5JUAA 3QW1A 1GGQA 1I4YA 4FESA 2XLHA 2YLDA 3H65A 1B68A 4JVSA 2TMVP 1H9TA 2J0XA 4PJNA 3ASNC 3TK0A 5HV9A 3K7DA 4BJ6C 2XXAA 3DZAA 3IQ5A 2LK4A 3MYFA 3FDQA 1ZU4A 4HFFB 2Q9AA 1YARO 3AJMA 3AG4C 2EPKX 1U6HA 3C7JA 5AC5A 1R5ID 1VLTA 1QVXA 2WZFA 4ULVA 1RKCA 1MNDA 3RKOF 4YWQA 3U8VA 3EJNA 1JPJA 1KNYA 1LM3B 1NLXA 1NBBA 1TFOB 3EZHA 3GWLA 1Q0FA 2PBEA 3AGUA 3LLIA 1CGOA 2HFIA 3NMKA 1KU2A 4MQ9F 1HE1A 2EPMX 1AUEA 2NSFA 4U5GA 4CS8C 3W8IA 2MWQA 2XL4A 4O7GA 4RD9A 1SF8A 3NMIA 1QQ3A 3C18A 1NU7D 3TULA 1WOLA 1FR0A 2Q00A 3AG2C 1HE9A 4YL3A 3S27A 2VH3A 2M64A 5DS6A 2O9XA 4JTAB 5E33A 4CS9A 4OIPF 1EA8A 4BJ5C 3B0PA 1WATA 2DI3A 3V5YA 3U0CA 1LPEA 2YEVA 3DXJF 3N24A 2PF4E 4XEVA 1Q0DA 1WTYA 3W2VA 4MVOA 3CQZA 1OW7A 2XS1A 3RIPA 4AL0A 2A0BA 2G3VA 3ZTZA 2OCCC 4EBKA 1Q0MA 3DAFA 4LDRA 4Z9JA 2Y39A 4MTGA 3J06A 1L7CA 2JX0A 2NPUA 4KI2A 1ZW2A 2HZ8A 2NSGA 5B1AC 1W2WA 2DGJA 3ZDLA 2QY9A 4JW1A 3GORA 1M2VB 1YVIA 4J30B 1FTSA 2XS8A 3ABMC 2P1AA 2A68F 2H7OA 2WVQA 2YHSA 4MVQA 5L0DA 4ER9A 1M57C 3OEOA 1Z23A 2IM8A 4OIOF 3I5PA 2J0WA 4KC9A 2PP4A 3LEOA 1RJ9B 4Z9IA 1A0BA 4MW8A 3AOUA 1E83A 2R7SA 2OEXA 4MVMA 1Z3IX 5L3VA 4KNWA 2GAQA 3HNJA 5COMA 3KKBA 3Q6NA 4ZLDA 3C62A 1D1BA 1F1MA 4N6CA 3M79A 4E18A 2ZXOA 1DOVA 3EGDB 1G5ZA 3ZTMA 4DRJB 1YYXA 2AWYA 2WVNA 1CPRA 3KL4A 3RF3A 2A6EF 4I1OB 1RCPA 1HW2A 4J7TA 3US6A 2C04A 2J7PA 5A6BA 5L0HA 2HJ3A 4K1OA 3U9JA 3BRJA 1YZAA 1V54C 1MMNA 3B9QA 4IB4A 1QKRA 3UMKA 5BUOA 2JPUA 3RVYA 1CGNA 1SZIA 1Q0GA 2HSQA 2KQ9A 4E7ZA 1AEPA 2H8AA 1XZQA 4OD5A 1LVKA 4P9FA 5FZTA 4PJJA 4YT5A 2R7XA 3W8HA 3JRTA 1ORYA 1VOMA 3ATPA 4G78A 1BBHA 4XPYA 1E84A 3IHUA 3LJBA 3O10A 3FOPA 2HV7A 5COFA 4BJ1A 4LDKA 1I5NA 4I1MA 1E86A 2X51A 3K33A 5JVEA 1MMDA 4JURI 256BA 2P0NA 5KYYA 3GODA 2J45A 3CZ6A 2XL8A 2CYDA 4OINF 3PHF2 2CDQA 2YLIA 4XQ1A 3UMHA 1OXKA 1ZHXA 4LERA 2XSEA 3ZC4A 3ZSUA 4C7OB 4O6NA 2DYSC 4JKVA 4YT8A 2Y3GA 3CEXA 1FFTC 5A6KA 3JYHA 5KYXB 1NFNA 4GQHA 2PNOA 4B6IA 1T6IA 3S9OA 5EGYA 5FCLA 2R7QA 4NY3A 3NMJA 3VRCA 4YN0B 4ONSA 1WGWA 2HSBA 3GWNA 4AX2A 4WGYA 1LS1A 1J8YF 1HW1A 2WZLA 3H2UA 3LESA 1C17M 3SP1A 3JT1A 4AE4A 3IQ6A 4DXWA 1WN0A 1UFBA 3FVYA 4J7YA 4WJ0A 2Q7RA 2F22A 4CIPA 3LS1A 2D5RB 2ASRA 2GDCA 4N4WA 1OW8A 1CGME 1KTMA 5JP7A 1K04A 1K05A 2KJGA 4P9TA 3OA1A 1JR8A 2UUHA 2LSEA 3VYWA 1TR2A 2QE9A 2Y69C 1LI7A 2VCCA 3KH2A 3SXYA 3AGTA 3L34A 3TD7A 5AGFA 1VYKA 4I44A 3V5ZA 2V26A 1TWAA 3UNGC 1MQVA 1YA9A 2NUTA 1LI5A 3GANA 4DRHB 3NG1A 2YRFA 4BEMJ 3S28A 4WABA 1NZEA 1OQCA 3HNKA 3F47A 3KYIA 3ASOC 4U9DA 2PX3A 3F46A 4QDLA 4ULWA 3LUTB 3UMIA 3WHNA 2R25A 1OR3A 1SR2A 2KGOA 3EH2A 2CW0F 3FAPB 1T9KA 5COGA 1S7ZA 5IY5C 2EILC 5D91A 1FNTc 4YL1A 1ZVZA 4A2NB 4EBJA 1EQ1A 2GA0A 1YLMA 3VAYA 3UGOA 1H7IA 2CNWA 1H6GA 3EGXB 3DAGA 3GM1A 3IEEA 3L1MA 4YT2A 4CSAA 3G50A 3O6XA 4PJLA 2XLDA 3MBGA 2Q4FA 3N0TA 3I4UA 4OIRF 1SMYF 3K1IC 2IXNA 5T1DB 3ABLC 1OW6A 3DE8A 5JSLA 3NKDA 2OEVA 1M56C 3LLKA 4JCZA 4J32B 4CJOA 2R05A 1O87A 5BQGA 5K0IA 3BEHA 3QMKA 4O79A 4JRZA 5A6BD 3UR3C 2XLVA 1GS9A 2H7VC 4BJTA 1PCXA 2YQYA 2LIGA 4BG0A 2Q9BA 4DOZA 2CCYA 1BR2A 3KPHA 1O5HA 5L0JA 4AK9A 1AVOB 4U5EE 4IJJA 3E9VA 2G62A 2Q9CA 2YVKA 4K0DA 4U5CE 3LAYA 1U0BB 4Q5SF 2KK1A 3LS0A 3CAXA 4F4BA 4O6YA 2KW3C 4DBRA 2R7RA 3K1HA 2Z15A 1A7DA 1JOGA 1T5OA 4M63A 2ZXRA 2WZGA 4U9EA 2A0UA 4GEHA 2J9UA 4JJFA 1HMOA 5F5FA 2KNHA 1PV3A 2I8BA 4LDQA 3C8ZA 3B29A 2VC9A 3JSZA 2LQGA 2L7AA 2EIJC 3MYIA 1T01A 4K7BA 3JTLO 5JS5A 4IAOA 4I3MA 1V74B 2VCBA 3FAJA 2WB7A 3NRHA 1T6UA 3ZQVA 1RKEB 3EFOB 4LLCA 5KYWB 1APCA 1LE4A 2IOQA 3L8IA 4XPXA 2OKUA 3GEIA 2VB6A 2XL6A 4ZLCA 3NYJA 2YLGA 4JJGA 4EKWA 5GPGB 3SYNA 3VF0A 3AG3C 2W4BA 3NYMA 5L0IA 2D4UA 2XM0A 3C8GA 4NTBA 2R7UA 1JMWA 1OKKA 1WASA 3ECSA 5KYUB 2R7VA 4XTKA 2HV6A 2PX0A 1ZHWA 1RJ9A 1MMAA 4MVRA 2MHRA 4PACA 2XLMA 1N1CA 4IGGA 1ZHTA 4CS9C 2V3CC 2QLAA 1GM5A 1G8XA 3T4RA 2VASA 5CI8A 2L6GA 2A1DD 3QTHA 3U3BA 2C03A 4HFKB 1ZU5A 4E0HA 1OXBA 4XPWA 2L6FA 3JRMO 5E3AA 2ZXWC 4PR9A 4MS2A 2XRHA 3ZQYA 2FGYA 4NC3A 1OCZC 2I15A 3M15A 4XEFA 3LEVA 1Z5ZA 1ZHZA 2X0CA 3JYYA 3W4YA 2P6VA 2YL1A 1PD0A 5L0CA 1NG1A 3SNHA 2NUPA 2LD6A 2E87A 4RBNA 3UGPA 1MMGA 1Z63A 3EH1A 3DWWA 3K6BA 3DJUB 1G4US 5DQTA 2XLOA 4RDAA 3U3FA 3EPVA 3WG7C 4IWBA 3T9OA 3RYLA 3ZWIA 1YZCA 2J9WA 4CS7A 2L9JA 3FMSA 3T6JA 2XLWA 3AQBA 5AC4A 4AE4B 4DVYP 1H9GA 2W45A 5T3WA 2ZXPA 3QW0A 2A6HF 3NYLA 4QI0A 3EHMA 1T6QA 3H2VA 1TKNA 2XLEA 3B0UX 3FXHA 2OJQA 4IAQA 1VB5A 4BJ6A 3EHNA 4W8KA 3LNRA 2ETSA 2EINC 2Y3DA 2J46A 4Q7CA 1JRAA 3EG9A 4OD4A 3KMIA 5EK0A 4U5HA 2OQMA 4CDVA 3POVA 2OJED 3DM5A 4MTOA 1LE2A 4CBEA 3GEHA 1C02A 2DYRC 1V55C 1TWCA 3DMDA 4JZAA 2HMQA 1QSPA 2B0JA 4BEJA 4Q4ZF 2WL8A 2R9RB 3M1CB 2L6HA 3PCVA 3LNMB 4CS8A 1YJGA 2H7BA
chains in the Genus database with same CATH topology
1E83A 1QPUA 1E85A 3DE8A 3M4CA 5JSLA 4CJOA 2YKZA 3HNJA 3C62A 3M79A 2YL3A 4CJGA 3ZTMA 1YYXA 1CPRA 2XLVA 1RCPA 2CCYA 1JAFA 1EKYA 4EIYA 2J8WA 4D4NA 4IB4A 1YZAA 4IARA 3TOMA 1CGNA 3QVZA 4CDYA 4JEAA 1S05A 4U9EA 4D4XA 1E84A 1BBHA 2BC5A 2XM4A 1CPQA 3FOPA 3HNLA 5JS5A 1E86A 3HNIA 4CDAA 4L6RA 5JVEA 3ZQVA 256BA 1APCA 2XL8A 2YL7A 2YLIA 2XL6A 2YL0A 2YLGA 5JRAA 3C63A 4JKVA 1YYJA 3QVYA 3DE9A 4N6HA 2XM0A 1A7VA 3VRCA 3NMJA 3QW1A 4CX9A 5JUAA 2XLMA 2XLHA 2YLDA 4JE9A 2QLAA 4WGYA 3IQ6A 4CIPA 3IQ5A 3M4BA 4N4WA 5JP7A 3ZQYA 4ULVA 4NC3A 3M15A 2YL1A 1LM3B 1NBBA 3NMKA 5JT4A 1CGOA 4WGZA 5AGFA 3NMIA 2XLOA 1QQ3A 1MQVA 5JLIA 3ZWIA 3U8PA 1YZCA 2XLWA 3FOOA 5B3IA 3QW0A 3HNKA 3TOLA 2XLEA 4U9DA 4IAQA 4JEBA 3ZTZA 1GQAA 4CDVA 1M6TA 4ER9A 3L1MA 2J9BA 2XLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E83 A;  1QPU A;  1E85 A;  3DE8 A;  3M4C A;  5JSL A;  4CJO A;  2YKZ A;  3HNJ A;  3C62 A;  3M79 A;  2YL3 A;  4CJG A;  3ZTM A;  1YYX A;  1CPR A;  2XLV A;  1RCP A;  2CCY A;  1JAF A;  1EKY A;  4EIY A;  2J8W A;  4D4N A;  4IB4 A;  1YZA A;  4IAR A;  3TOM A;  1CGN A;  3QVZ A;  4CDY A;  4JEA A;  1S05 A;  4U9E A;  4D4X A;  1E84 A;  1BBH A;  2BC5 A;  2XM4 A;  1CPQ A;  3FOP A;  3HNL A;  5JS5 A;  1E86 A;  3HNI A;  4CDA A;  4L6R A;  5JVE A;  3ZQV A;  256B A;  1APC A;  2XL8 A;  2YL7 A;  2YLI A;  2XL6 A;  2YL0 A;  2YLG A;  5JRA A;  3C63 A;  4JKV A;  1YYJ A;  3QVY A;  3DE9 A;  4N6H A;  2XM0 A;  1A7V A;  3VRC A;  3NMJ A;  3QW1 A;  4CX9 A;  5JUA A;  2XLM A;  2XLH A;  2YLD A;  4JE9 A;  2QLA A;  4WGY A;  3IQ6 A;  4CIP A;  3IQ5 A;  3M4B A;  4N4W A;  5JP7 A;  3ZQY A;  4ULV A;  4NC3 A;  3M15 A;  2YL1 A;  1LM3 B;  1NBB A;  3NMK A;  5JT4 A;  1CGO A;  4WGZ A;  5AGF A;  3NMI A;  2XLO A;  1QQ3 A;  1MQV A;  5JLI A;  3ZWI A;  3U8P A;  1YZC A;  2XLW A;  3FOO A;  5B3I A;  3QW0 A;  3HNK A;  3TOL A;  2XLE A;  4U9D A;  4IAQ A;  4JEB A;  3ZTZ A;  1GQA A;  4CDV A;  1M6T A;  4ER9 A;  3L1M A;  2J9B A;  2XLD A; 
#chains in the Genus database with same CATH topology
 5F5H A;  5A69 A;  1E2X A;  3L8J A;  4GYT A;  4XWJ A;  2YWA A;  2YZS A;  3NDB B;  1QPU A;  2EPO A;  1D0Z A;  2JD3 A;  1ST6 A;  3Q7L A;  4NCQ A;  4MVU A;  5HSW A;  3ZVR A;  2ZD9 A;  4C3D A;  3SXK A;  3ABK C;  2ICW G;  1D0Y A;  2HKV A;  3R7C A;  4ANJ A;  1VLS A;  3IQT A;  2XXA B;  1K40 A;  5E2Q A;  1V4A A;  1OCO C;  2BL2 A;  3EQL F;  4G0H A;  4U5B E;  5B3S C;  2R7T A;  1A7E A;  4JIO A;  2W9Y A;  1NU9 C;  3HJC A;  1DOW A;  3TQO A;  2Q3T A;  1OR2 A;  1A41 A;  1EKY A;  3NKE A;  2J8W A;  4HEA J;  4U5F E;  1LS4 A;  5F28 E;  1XWJ A;  3RW0 A;  4EIY A;  2RD9 A;  2KSF A;  3PDM P;  5EHH A;  2IXM A;  4XEK A;  2L81 A;  3U5S A;  4NTA A;  4CDY A;  1XZP A;  4JEA A;  4MND A;  2OG2 A;  1M2O A;  4D4X A;  4AL1 A;  4MW3 A;  3AQC A;  1CPQ A;  3RH3 A;  4DBQ A;  2BE5 F;  4CDA A;  5B1B C;  2GFH A;  1IW7 F;  3IPM O;  2R03 A;  4E7S A;  3A9C A;  3SZR A;  1PD1 A;  3FHD A;  4HE8 D;  2J7P D;  2YL7 A;  3C8G D;  3DD7 A;  2IXP A;  2Y3H A;  3HTK C;  1OKK D;  2GWW A;  2YL0 A;  2IBF A;  5JRA A;  3C63 A;  3N2Z B;  2OU6 A;  4FWV A;  1YYJ A;  3EGX A;  2A69 F;  3QVY A;  4U5D E;  2LP4 A;  4N6H A;  3OWT A;  3JZ0 A;  4JC7 A;  1HMD A;  1VYI A;  5DS5 A;  4E0I A;  1FAP B;  4CX9 A;  3WAQ A;  3X1O A;  4H54 A;  2AP3 A;  1FMV A;  1YA7 O;  4JE9 A;  3O39 A;  3RQF A;  1ZW3 A;  2J9V A;  2R02 A;  4O6M A;  2QUP A;  3JSE O;  2QNL A;  3M4B A;  3EZI A;  3KYJ A;  4H4K C;  4JTC B;  1BR1 A;  4XLP F;  4C3B A;  1BR4 A;  1OCR C;  1VTM P;  4G7O F;  2EPN A;  1M2V A;  1LIH A;  3U9M A;  1LKX A;  4CSA C;  1HY5 A;  2P61 A;  3HLZ A;  1TFK B;  5BQH A;  4YL0 A;  3C8G B;  4WGZ A;  3IQC A;  1Q0K A;  2ZPA A;  4EWC A;  3S90 A;  3MLG A;  5CIV A;  1OCC C;  4G7Z F;  1UG7 A;  2M4E A;  3E70 C;  2HS5 A;  1ZZP A;  3TJ5 A;  2CGE A;  1Y4C A;  3RFY A;  1IZM A;  4FX5 A;  3W2W A;  1RXQ A;  2EIM C;  2HMZ A;  5JLI A;  3U8P A;  2HJM A;  5BQI A;  2DB4 A;  3S84 A;  2VCA A;  1EI7 A;  4LLE A;  5TJ5 E;  4PFO A;  4QI2 A;  2HUJ A;  4EBB A;  1FMW A;  3FOO A;  5B3I A;  4CIH A;  1RKE A;  2OOC A;  2LFD A;  3EFO A;  4JTD B;  4MVS A;  3EGD A;  2G3K A;  1QLE C;  5KYW A;  3TOL A;  2P7V A;  4DRI B;  3QZC A;  3GM3 A;  4JEB A;  2B0H A;  3JCU Q;  1GQA A;  4PFP A;  4IRU A;  2NG1 A;  4NTF A;  3RQG A;  3RVZ A;  3MFN A;  1TQG A;  1YAU O;  1YDI A;  1ORJ A;  3U2M A;  4BPM A;  5KYY B;  4PK4 A;  1ORS C;  3Q6M A;  4W8P A;  5KYU A;  3U2L A;  5D92 A;  1M6T A;  3AG1 C;  1NSG B;  3K66 A;  4UDV A;  5DVW A;  2NUP B;  4YJW A;  2KYH A;  5L3Q A;  3O55 A;  5DLJ A;  4JCH A;  4KNV A;  1L3P A;  2WVO A;  3S0X A;  3DKA A;  4P6I C;  2J9B A;  1D1C A;  2IXO A;  2W4M A;  3L0I A;  4EUK B;  4MTF A;  4DVZ A;  5KYN A;  2LCH A;  1E85 A;  3M4C A;  3I5Q A;  2R7O A;  1FFH A;  1D0X A;  1TWH A;  2FAP B;  2YKZ A;  4MVZ A;  3Q7G A;  3V7O A;  1ZHY A;  2YL3 A;  1J8M F;  4R32 A;  1C03 A;  1D1A A;  1WWP A;  3DI5 A;  4XLN F;  4CJG A;  2IYL D;  5DS4 A;  5DQZ A;  1NFO A;  1Y6D A;  1VMA A;  3V5X A;  1JPN A;  2PFD A;  4C7O A;  3VM6 A;  4EHP A;  3PMR A;  3R2P A;  2EIK C;  1MNE A;  2CNW D;  3EG9 B;  1JAF A;  1R4T A;  3S29 A;  5KYX A;  1BDJ B;  4D4N A;  2MYS A;  1Z6A A;  3A11 A;  4LAC B;  1VK5 A;  3DM9 B;  3SXM A;  5L0F A;  1O3U A;  1BZ4 A;  3G4Z A;  4DJ9 A;  3SXZ A;  5A6J A;  2AU5 A;  4IAR A;  2EPL X;  3TJ6 A;  1QZX A;  3ITF A;  3QVZ A;  3TOM A;  5A6A A;  1I4Z A;  4OIQ F;  2AVK A;  1TWG A;  1S05 A;  3DJN B;  1ZYR F;  2AWC A;  3GEE A;  4N06 A;  5T3T A;  3B71 A;  2Y3B A;  4G7H F;  1SYQ A;  4FAP B;  2R7W A;  2BC5 A;  2NUT B;  2XM4 A;  4X0R A;  3HNL A;  5JT4 A;  3K1I A;  3HNI A;  1G4W R;  4YK5 A;  1Z7Q c;  3ZIB A;  3G4X A;  2FFH A;  4L6R A;  5L0G A;  4YT4 A;  3B0V C;  2LFF A;  5E3C A;  3ZG1 A;  4BJ5 A;  3SEO A;  4KBL A;  4A4A A;  3WOD F;  2RSE B;  2KC3 A;  3CSK A;  3T6G B;  3GM2 A;  3HKK A;  4PJM A;  2UUI A;  5CI9 A;  4Z9H A;  2QTV A;  3DE9 A;  3T6B A;  1U89 A;  3X2Q C;  1A7V A;  4NQF A;  4E17 A;  1RMV A;  3MX3 A;  4C3E A;  3RQE A;  5JUA A;  3QW1 A;  1GGQ A;  1I4Y A;  4FES A;  2XLH A;  2YLD A;  3H65 A;  1B68 A;  4JVS A;  2TMV P;  1H9T A;  2J0X A;  4PJN A;  3ASN C;  3TK0 A;  5HV9 A;  3K7D A;  4BJ6 C;  2XXA A;  3DZA A;  3IQ5 A;  2LK4 A;  3MYF A;  3FDQ A;  1ZU4 A;  4HFF B;  2Q9A A;  1YAR O;  3AJM A;  3AG4 C;  2EPK X;  1U6H A;  3C7J A;  5AC5 A;  1R5I D;  1VLT A;  1QVX A;  2WZF A;  4ULV A;  1RKC A;  1MND A;  3RKO F;  4YWQ A;  3U8V A;  3EJN A;  1JPJ A;  1KNY A;  1LM3 B;  1NLX A;  1NBB A;  1TFO B;  3EZH A;  3GWL A;  1Q0F A;  2PBE A;  3AGU A;  3LLI A;  1CGO A;  2HFI A;  3NMK A;  1KU2 A;  4MQ9 F;  1HE1 A;  2EPM X;  1AUE A;  2NSF A;  4U5G A;  4CS8 C;  3W8I A;  2MWQ A;  2XL4 A;  4O7G A;  4RD9 A;  1SF8 A;  3NMI A;  1QQ3 A;  3C18 A;  1NU7 D;  3TUL A;  1WOL A;  1FR0 A;  2Q00 A;  3AG2 C;  1HE9 A;  4YL3 A;  3S27 A;  2VH3 A;  2M64 A;  5DS6 A;  2O9X A;  4JTA B;  5E33 A;  4CS9 A;  4OIP F;  1EA8 A;  4BJ5 C;  3B0P A;  1WAT A;  2DI3 A;  3V5Y A;  3U0C A;  1LPE A;  2YEV A;  3DXJ F;  3N24 A;  2PF4 E;  4XEV A;  1Q0D A;  1WTY A;  3W2V A;  4MVO A;  3CQZ A;  1OW7 A;  2XS1 A;  3RIP A;  4AL0 A;  2A0B A;  2G3V A;  3ZTZ A;  2OCC C;  4EBK A;  1Q0M A;  3DAF A;  4LDR A;  4Z9J A;  2Y39 A;  4MTG A;  3J06 A;  1L7C A;  2JX0 A;  2NPU A;  4KI2 A;  1ZW2 A;  2HZ8 A;  2NSG A;  5B1A C;  1W2W A;  2DGJ A;  3ZDL A;  2QY9 A;  4JW1 A;  3GOR A;  1M2V B;  1YVI A;  4J30 B;  1FTS A;  2XS8 A;  3ABM C;  2P1A A;  2A68 F;  2H7O A;  2WVQ A;  2YHS A;  4MVQ A;  5L0D A;  4ER9 A;  1M57 C;  3OEO A;  1Z23 A;  2IM8 A;  4OIO F;  3I5P A;  2J0W A;  4KC9 A;  2PP4 A;  3LEO A;  1RJ9 B;  4Z9I A;  1A0B A;  4MW8 A;  3AOU A;  1E83 A;  2R7S A;  2OEX A;  4MVM A;  1Z3I X;  5L3V A;  4KNW A;  2GAQ A;  3HNJ A;  5COM A;  3KKB A;  3Q6N A;  4ZLD A;  3C62 A;  1D1B A;  1F1M A;  4N6C A;  3M79 A;  4E18 A;  2ZXO A;  1DOV A;  3EGD B;  1G5Z A;  3ZTM A;  4DRJ B;  1YYX A;  2AWY A;  2WVN A;  1CPR A;  3KL4 A;  3RF3 A;  2A6E F;  4I1O B;  1RCP A;  1HW2 A;  4J7T A;  3US6 A;  2C04 A;  2J7P A;  5A6B A;  5L0H A;  2HJ3 A;  4K1O A;  3U9J A;  3BRJ A;  1YZA A;  1V54 C;  1MMN A;  3B9Q A;  4IB4 A;  1QKR A;  3UMK A;  5BUO A;  2JPU A;  3RVY A;  1CGN A;  1SZI A;  1Q0G A;  2HSQ A;  2KQ9 A;  4E7Z A;  1AEP A;  2H8A A;  1XZQ A;  4OD5 A;  1LVK A;  4P9F A;  5FZT A;  4PJJ A;  4YT5 A;  2R7X A;  3W8H A;  3JRT A;  1ORY A;  1VOM A;  3ATP A;  4G78 A;  1BBH A;  4XPY A;  1E84 A;  3IHU A;  3LJB A;  3O10 A;  3FOP A;  2HV7 A;  5COF A;  4BJ1 A;  4LDK A;  1I5N A;  4I1M A;  1E86 A;  2X51 A;  3K33 A;  5JVE A;  1MMD A;  4JUR I;  256B A;  2P0N A;  5KYY A;  3GOD A;  2J45 A;  3CZ6 A;  2XL8 A;  2CYD A;  4OIN F;  3PHF 2;  2CDQ A;  2YLI A;  4XQ1 A;  3UMH A;  1OXK A;  1ZHX A;  4LER A;  2XSE A;  3ZC4 A;  3ZSU A;  4C7O B;  4O6N A;  2DYS C;  4JKV A;  4YT8 A;  2Y3G A;  3CEX A;  1FFT C;  5A6K A;  3JYH A;  5KYX B;  1NFN A;  4GQH A;  2PNO A;  4B6I A;  1T6I A;  3S9O A;  5EGY A;  5FCL A;  2R7Q A;  4NY3 A;  3NMJ A;  3VRC A;  4YN0 B;  4ONS A;  1WGW A;  2HSB A;  3GWN A;  4AX2 A;  4WGY A;  1LS1 A;  1J8Y F;  1HW1 A;  2WZL A;  3H2U A;  3LES A;  1C17 M;  3SP1 A;  3JT1 A;  4AE4 A;  3IQ6 A;  4DXW A;  1WN0 A;  1UFB A;  3FVY A;  4J7Y A;  4WJ0 A;  2Q7R A;  2F22 A;  4CIP A;  3LS1 A;  2D5R B;  2ASR A;  2GDC A;  4N4W A;  1OW8 A;  1CGM E;  1KTM A;  5JP7 A;  1K04 A;  1K05 A;  2KJG A;  4P9T A;  3OA1 A;  1JR8 A;  2UUH A;  2LSE A;  3VYW A;  1TR2 A;  2QE9 A;  2Y69 C;  1LI7 A;  2VCC A;  3KH2 A;  3SXY A;  3AGT A;  3L34 A;  3TD7 A;  5AGF A;  1VYK A;  4I44 A;  3V5Z A;  2V26 A;  1TWA A;  3UNG C;  1MQV A;  1YA9 A;  2NUT A;  1LI5 A;  3GAN A;  4DRH B;  3NG1 A;  2YRF A;  4BEM J;  3S28 A;  4WAB A;  1NZE A;  1OQC A;  3HNK A;  3F47 A;  3KYI A;  3ASO C;  4U9D A;  2PX3 A;  3F46 A;  4QDL A;  4ULW A;  3LUT B;  3UMI A;  3WHN A;  2R25 A;  1OR3 A;  1SR2 A;  2KGO A;  3EH2 A;  2CW0 F;  3FAP B;  1T9K A;  5COG A;  1S7Z A;  5IY5 C;  2EIL C;  5D91 A;  1FNT c;  4YL1 A;  1ZVZ A;  4A2N B;  4EBJ A;  1EQ1 A;  2GA0 A;  1YLM A;  3VAY A;  3UGO A;  1H7I A;  2CNW A;  1H6G A;  3EGX B;  3DAG A;  3GM1 A;  3IEE A;  3L1M A;  4YT2 A;  4CSA A;  3G50 A;  3O6X A;  4PJL A;  2XLD A;  3MBG A;  2Q4F A;  3N0T A;  3I4U A;  4OIR F;  1SMY F;  3K1I C;  2IXN A;  5T1D B;  3ABL C;  1OW6 A;  3DE8 A;  5JSL A;  3NKD A;  2OEV A;  1M56 C;  3LLK A;  4JCZ A;  4J32 B;  4CJO A;  2R05 A;  1O87 A;  5BQG A;  5K0I A;  3BEH A;  3QMK A;  4O79 A;  4JRZ A;  5A6B D;  3UR3 C;  2XLV A;  1GS9 A;  2H7V C;  4BJT A;  1PCX A;  2YQY A;  2LIG A;  4BG0 A;  2Q9B A;  4DOZ A;  2CCY A;  1BR2 A;  3KPH A;  1O5H A;  5L0J A;  4AK9 A;  1AVO B;  4U5E E;  4IJJ A;  3E9V A;  2G62 A;  2Q9C A;  2YVK A;  4K0D A;  4U5C E;  3LAY A;  1U0B B;  4Q5S F;  2KK1 A;  3LS0 A;  3CAX A;  4F4B A;  4O6Y A;  2KW3 C;  4DBR A;  2R7R A;  3K1H A;  2Z15 A;  1A7D A;  1JOG A;  1T5O A;  4M63 A;  2ZXR A;  2WZG A;  4U9E A;  2A0U A;  4GEH A;  2J9U A;  4JJF A;  1HMO A;  5F5F A;  2KNH A;  1PV3 A;  2I8B A;  4LDQ A;  3C8Z A;  3B29 A;  2VC9 A;  3JSZ A;  2LQG A;  2L7A A;  2EIJ C;  3MYI A;  1T01 A;  4K7B A;  3JTL O;  5JS5 A;  4IAO A;  4I3M A;  1V74 B;  2VCB A;  3FAJ A;  2WB7 A;  3NRH A;  1T6U A;  3ZQV A;  1RKE B;  3EFO B;  4LLC A;  5KYW B;  1APC A;  1LE4 A;  2IOQ A;  3L8I A;  4XPX A;  2OKU A;  3GEI A;  2VB6 A;  2XL6 A;  4ZLC A;  3NYJ A;  2YLG A;  4JJG A;  4EKW A;  5GPG B;  3SYN A;  3VF0 A;  3AG3 C;  2W4B A;  3NYM A;  5L0I A;  2D4U A;  2XM0 A;  3C8G A;  4NTB A;  2R7U A;  1JMW A;  1OKK A;  1WAS A;  3ECS A;  5KYU B;  2R7V A;  4XTK A;  2HV6 A;  2PX0 A;  1ZHW A;  1RJ9 A;  1MMA A;  4MVR A;  2MHR A;  4PAC A;  2XLM A;  1N1C A;  4IGG A;  1ZHT A;  4CS9 C;  2V3C C;  2QLA A;  1GM5 A;  1G8X A;  3T4R A;  2VAS A;  5CI8 A;  2L6G A;  2A1D D;  3QTH A;  3U3B A;  2C03 A;  4HFK B;  1ZU5 A;  4E0H A;  1OXB A;  4XPW A;  2L6F A;  3JRM O;  5E3A A;  2ZXW C;  4PR9 A;  4MS2 A;  2XRH A;  3ZQY A;  2FGY A;  4NC3 A;  1OCZ C;  2I15 A;  3M15 A;  4XEF A;  3LEV A;  1Z5Z A;  1ZHZ A;  2X0C A;  3JYY A;  3W4Y A;  2P6V A;  2YL1 A;  1PD0 A;  5L0C A;  1NG1 A;  3SNH A;  2NUP A;  2LD6 A;  2E87 A;  4RBN A;  3UGP A;  1MMG A;  1Z63 A;  3EH1 A;  3DWW A;  3K6B A;  3DJU B;  1G4U S;  5DQT A;  2XLO A;  4RDA A;  3U3F A;  3EPV A;  3WG7 C;  4IWB A;  3T9O A;  3RYL A;  3ZWI A;  1YZC A;  2J9W A;  4CS7 A;  2L9J A;  3FMS A;  3T6J A;  2XLW A;  3AQB A;  5AC4 A;  4AE4 B;  4DVY P;  1H9G A;  2W45 A;  5T3W A;  2ZXP A;  3QW0 A;  2A6H F;  3NYL A;  4QI0 A;  3EHM A;  1T6Q A;  3H2V A;  1TKN A;  2XLE A;  3B0U X;  3FXH A;  2OJQ A;  4IAQ A;  1VB5 A;  4BJ6 A;  3EHN A;  4W8K A;  3LNR A;  2ETS A;  2EIN C;  2Y3D A;  2J46 A;  4Q7C A;  1JRA A;  3EG9 A;  4OD4 A;  3KMI A;  5EK0 A;  4U5H A;  2OQM A;  4CDV A;  3POV A;  2OJE D;  3DM5 A;  4MTO A;  1LE2 A;  4CBE A;  3GEH A;  1C02 A;  2DYR C;  1V55 C;  1TWC A;  3DMD A;  4JZA A;  2HMQ A;  1QSP A;  2B0J A;  4BEJ A;  4Q4Z F;  2WL8 A;  2R9R B;  3M1C B;  2L6H A;  3PCV A;  3LNM B;  4CS8 A;  1YJG A;  2H7B A; 
#chains in the Genus database with same CATH homology
 1E83 A;  1QPU A;  1E85 A;  3DE8 A;  3M4C A;  5JSL A;  4CJO A;  2YKZ A;  3HNJ A;  3C62 A;  3M79 A;  2YL3 A;  4CJG A;  3ZTM A;  1YYX A;  1CPR A;  2XLV A;  1RCP A;  2CCY A;  1JAF A;  1EKY A;  4EIY A;  2J8W A;  4D4N A;  4IB4 A;  1YZA A;  4IAR A;  3TOM A;  1CGN A;  3QVZ A;  4CDY A;  4JEA A;  1S05 A;  4U9E A;  4D4X A;  1E84 A;  1BBH A;  2BC5 A;  2XM4 A;  1CPQ A;  3FOP A;  3HNL A;  5JS5 A;  1E86 A;  3HNI A;  4CDA A;  4L6R A;  5JVE A;  3ZQV A;  256B A;  1APC A;  2XL8 A;  2YL7 A;  2YLI A;  2XL6 A;  2YL0 A;  2YLG A;  5JRA A;  3C63 A;  4JKV A;  1YYJ A;  3QVY A;  3DE9 A;  4N6H A;  2XM0 A;  1A7V A;  3VRC A;  3NMJ A;  3QW1 A;  4CX9 A;  5JUA A;  2XLM A;  2XLH A;  2YLD A;  4JE9 A;  2QLA A;  4WGY A;  3IQ6 A;  4CIP A;  3IQ5 A;  3M4B A;  4N4W A;  5JP7 A;  3ZQY A;  4ULV A;  4NC3 A;  3M15 A;  2YL1 A;  1LM3 B;  1NBB A;  3NMK A;  5JT4 A;  1CGO A;  4WGZ A;  5AGF A;  3NMI A;  2XLO A;  1QQ3 A;  1MQV A;  5JLI A;  3ZWI A;  3U8P A;  1YZC A;  2XLW A;  3FOO A;  5B3I A;  3QW0 A;  3HNK A;  3TOL A;  2XLE A;  4U9D A;  4IAQ A;  4JEB A;  3ZTZ A;  1GQA A;  4CDV A;  1M6T A;  4ER9 A;  3L1M A;  2J9B A;  2XLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...