2YL0A

Cytochrome c prime from alcaligenes xylosoxidans: as isolated l16a variant at 0.95 a resolution
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
127
structure length
127
Chain Sequence
EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 54
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yl0A00
2XLMA 2YL0A 4L6RA 4CX9A 4U9EA 4IAQA 3C63A 4N4WA 4ER9A 1YYJA 2YL7A 1E86A 4CDVA 4ULVA 2XL6A 3HNIA 3VRCA 5JUAA 4WGZA 3HNLA 1CPQA 3ZTMA 3M79A 3C62A 2YLGA 3IQ5A 1MQVA 3M4CA 2CCYA 1E83A 4EIYA 1BBHA 3TOLA 4N6HA 3ZTZA 3DE8A 2XM0A 3M4BA 3U8PA 3M15A 4D4XA 4CDAA 3HNKA 2YKZA 1GQAA 2XL8A 5JT4A 4CDYA 2YL3A 2BC5A 2J9BA 3NMIA 1YZAA 4D4NA 5JLIA 1LM3B 5AGFA 2YL1A 3FOOA 1A7VA 5JRAA 4CIPA 5JSLA 2YLDA 1JAFA 3NMJA 2XLWA 3QW1A 4CJGA 3ZQVA 2QLAA 2XLEA 4JEAA 4WGYA 1QQ3A 1S05A 1YYXA 3TOMA 4JEBA 5B3IA 5JP7A 4IARA 2XLHA 2J8WA 3ZQYA 1RCPA 4JKVA 3NMKA 2XM4A 3FOPA 2XLVA 1YZCA 5JS5A 1EKYA 3L1MA 3ZWIA 256BA 1E84A 3DE9A 1CGNA 4JE9A 4NC3A 4U9DA 3IQ6A 2XLDA 3QW0A 4IB4A 1CGOA 2XLOA 1M6TA 3HNJA 4CJOA 3QVZA 5JVEA 1APCA 1NBBA 3QVYA 1QPUA 2YLIA 1CPRA 1E85A
chains in the Genus database with same CATH superfamily
3U3BA 3EH1A 3FXHA 1ZVZA 2XLMA 1HE9A 1QSPA 1RJ9A 3X2QC 1AUEA 1VB5A 2Q9BA 3SXZA 5A6BD 2HSBA 4U9EA 2OJQA 4XLPF 3V5ZA 2NPUA 2YL7A 2Y69C 3DWWA 4U5EE 1YDIA 5A6KA 2R7XA 2KK1A 3FDQA 1FFTC 2XL4A 3C7JA 4WGZA 4DJ9A 4C7OB 3EPVA 3H2UA 3U5SA 4MVSA 4U5GA 4LDKA 4XEVA 4CS8A 1PCXA 2QNLA 2YLGA 1VOMA 4BJ5A 3FMSA 4W8KA 2DYSC 2ETSA 4JCHA 2WZLA 4C3EA 4NTAA 1XZPA 5E3AA 3SP1A 3SXYA 4JURI 3H2VA 3UMKA 1AVOB 3M4CA 2YZSA 4E0HA 1I5NA 3TOLA 3ABLC 2XXAB 3VAYA 3F47A 1PV3A 2PP4A 2HSQA 3G50A 2NUTB 5T3TA 2Y39A 1R4TA 1K05A 3DI5A 1SMYF 2WVNA 3U8PA 1KNYA 3HNKA 5CI9A 3Q7LA 5E2QA 5A6JA 3MLGA 1GQAA 5COGA 4A2NB 1A0BA 2AWCA 5D91A 4YWQA 2NSFA 5L0FA 5F5FA 5JT4A 4BG0A 3JCUQ 1D1BA 5CIVA 1LI7A 5L0HA 1F1MA 1NG1A 3T4RA 5COMA 4I1MA 1EI7A 2BC5A 1ORSC 3JSZA 3RW0A 3SEOA 2X51A 3EFOB 2I8BA 3JRMO 5DQZA 5L0JA 4D4NA 2JD3A 3UR3C 2D5RB 4JVSA 1C17M 2UUHA 5AGFA 3MYFA 1ZHTA 1A7VA 2O9XA 4J7TA 4K7BA 2L9JA 2OU6A 4XPWA 2EINC 1YJGA 4CIPA 5JRAA 5JSLA 1LKXA 4AE4B 1JAFA 4O6YA 3QTHA 2Y3GA 3UGPA 1XZQA 4LLEA 1W2WA 2XLWA 1BR1A 4MQ9F 4G7HF 5CI8A 3VYWA 4BJ1A 4MVMA 1XWJA 5L0GA 3PDMP 1HY5A 1ZHZA 2XLEA 2R7VA 4LDRA 2YQYA 2VCCA 3NYMA 4HE8D 4YT2A 4CSAA 2R7TA 2KGOA 3N2ZB 4P9TA 2XS8A 2HJMA 1MNEA 2WL8A 5FZTA 2QE9A 2Y3DA 4WABA 5F5HA 3WAQA 5KYWB 3RFYA 4JRZA 2B0HA 2BE5F 2FGYA 5JP7A 4MTOA 2XLHA 3LS1A 1HW1A 4DRIB 5DS5A 2XSEA 3EZHA 1EA8A 3JSEO 3DKAA 1OR3A 1T6UA 3ECSA 1H7IA 2F22A 4JJGA 4N6CA 4U5BE 4C3DA 5A6BA 1OXKA 2HUJA 3JT1A 1YZCA 3WG7C 1D1AA 2GDCA 5JS5A 4LDQA 1YA7O 1Z7Qc 2A6HF 4HFKB 4EBKA 1Y6DA 2Q9AA 1T01A 4JJFA 4EHPA 3HLZA 2NUPA 3AOUA 2J45A 1E2XA 4O79A 4QI0A 3K1IA 4PJMA 2LD6A 3LEOA 2J46A 1K04A 4DXWA 3EGXA 3S27A 2KC3A 3V5XA 3V5YA 5B1AC 2J9UA 3CSKA 1CGOA 2ZD9A 3K1HA 3S29A 5DS4A 1OCCC 1GS9A 1T6QA 2BL2A 2VH3A 3HNJA 3IHUA 4KNVA 3AG2C 5DQTA 4Z9JA 5JVEA 3R7CA 5L0CA 1APCA 3QVYA 3EQLF 4ANJA 4MVQA 4BJ6A 1U6HA 2NG1A 1V54C 3HJCA 1QPUA 2YLIA 3ITFA 2RSEB 5EHHA 1JRAA 5KYYA 1J8MF 3LJBA 4DVZA 1QKRA 1L3PA 3IEEA 2PF4E 4JTCB 2IXNA 2G62A 1V74B 1QZXA 3MYIA 4FX5A 1VMAA 2ZXRA 3ZSUA 1VYIA 1ZU5A 2DI3A 2PBEA 3H65A 1BR2A 4U5FE 3R2PA 4ULVA 4YL1A 3W4YA 1ZW2A 2P1AA 4CS8C 3C8GD 5FCLA 2MHRA 3HNLA 3ZTMA 5HV9A 2VCBA 2P61A 3UGOA 3NG1A 1G4US 3C62A 2YWAA 4YK5A 4YT4A 1FNTc 4PJNA 4YN0B 1NSGB 1YA9A 2VB6A 3N0TA 3ZVRA 1SYQA 5DVWA 3TK0A 1ZHWA 1G4WR 1VTMP 3JRTA 4EIYA 2PFDA 1VYKA 4G78A 1TWCA 1V4AA 2H7OA 2AU5A 3EJNA 4J30B 1YAUO 3NDBB 2CDQA 3B0PA 3U9JA 3LLKA 4A4AA 3DE8A 2XM0A 1BR4A 3K7DA 4JTDB 2KYHA 3M15A 4D4XA 3DM9B 4IGGA 3T6JA 3GM2A 2DYRC 4U5DE 2EPKX 2P7VA 2V3CC 2GWWA 4F4BA 3Q6NA 1MMAA 2VASA 1NU7D 1QVXA 3HTKC 3GWLA 1ZYRF 1JPJA 2CGEA 2YL3A 2D4UA 4O6MA 2Q9CA 3NMIA 2YVKA 1YZAA 4HFFB 4LLCA 1LVKA 1ZZPA 1M2VA 5E3CA 1KU2A 2W4BA 1TWHA 4ZLCA 3TJ5A 3U2MA 2NUPB 2YLDA 2LCHA 1OW8A 3KH2A 3NMJA 4DRHB 5IY5C 2FAPB 3GWNA 2GAQA 5KYXA 1OKKA 4MNDA 1LE2A 4CSAC 3EGXB 3QW1A 3E9VA 4XEFA 5EK0A 4K1OA 3RYLA 1EQ1A 4J7YA 4EUKB 4CIHA 2QLAA 3DAGA 2EILC 4GEHA 4N06A 3CEXA 4RDAA 1NLXA 1ZU4A 4KNWA 4OIRF 2A68F 4EBJA 4Q4ZF 4Q5SF 4DBRA 2AP3A 1V55C 3KL4A 3JYYA 1WWPA 1S05A 4E7ZA 3A9CA 3T6BA 4JEBA 2P0NA 3G4ZA 1T9KA 1LI5A 3LLIA 5B1BC 5B3IA 2EPOA 3DJNB 5KYUB 2TMVP 4K0DA 2LQGA 1WGWA 5BUOA 3ZC4A 5GPGB 3CAXA 4JKVA 4YT8A 4G7OF 2E87A 3FOPA 3NRHA 2EIKC 4QDLA 4DOZA 2R7WA 3K1IC 1C02A 3AQBA 2R03A 1YVIA 4JZAA 1LS4A 1Q0MA 4IWBA 3B0VC 1A7EA 1H9TA 1DOWA 1NZEA 1ORYA 1RKEB 1C03A 256BA 2A0UA 3DE9A 3EGDB 1N1CA 4MVZA 4NCQA 1RMVA 4X0RA 4JTAB 3KYJA 2OJED 3PHF2 3SXKA 2IYLD 3C8GA 4JCZA 1B68A 1IW7F 1HE1A 2KNHA 2WZFA 1Z6AA 4PJLA 2M64A 4ULWA 4BJ6C 2EPLX 2EPNA 4MVUA 1M6TA 1ZHYA 1FMWA 1Q0KA 1TR2A 4EWCA 2I15A 5L0IA 3DD7A 1RJ9B 3AG4C 1Q0FA 1WATA 2H7VC 1M57C 1O5HA 2HV7A 1TFOB 3DJUB 1LPEA 3EH2A 3JTLO 4W8PA 4GQHA 2WB7A 4MTFA 1CPRA 4FESA 3U8VA 3SZRA 3LAYA 2A1DD 2HV6A 3RVYA 3S28A 2L6FA 3VF0A 1G8XA 4P9FA 3K33A 3KPHA 4CX9A 1OW7A 4FWVA 1H6GA 2Q3TA 2LFDA 1H9GA 3EHMA 4IAQA 2HMZA 2QTVA 4XQ1A 3C63A 4N4WA 2R7RA 1OKKD 4ER9A 2LSEA 1M56C 2R25A 1E86A 4CDVA 4MVOA 5JUAA 1M2VB 2FFHA 3FAPB 4XPXA 1K40A 1GM5A 2HFIA 1FMVA 2R7OA 3IPMO 4XPYA 1HW2A 2P6VA 3UNGC 3JYHA 3ZDLA 4XWJA 4U5CE 5KYXB 1TKNA 3G4XA 3IQ5A 1MQVA 3M1CB 2J0XA 1SF8A 1OCZC 5AC4A 4JIOA 1AEPA 4E7SA 3L8JA 3GEEA 4PFPA 3EG9A 3SNHA 4AL1A 4NQFA 1E83A 2AWYA 2IXMA 4NY3A 2OKUA 2R9RB 2JX0A 4N6HA 2W9YA 3C18A 2A6EF 3NKDA 4KBLA 4RBNA 3AGTA 5E33A 4MTGA 3V7OA 1T6IA 2GFHA 3LUTB 4PK4A 3RQGA 3M4BA 5K0IA 2ZXWC 1FFHA 3B0UX 4CDAA 3QZCA 2CNWD 4YL3A 2KW3C 4PR9A 2PNOA 2R02A 4LACB 4CS9A 1T5OA 4WJ0A 1O87A 4BJ5C 1U89A 1Q0GA 3U2LA 3W2WA 2V26A 1G5ZA 3IQCA 2X0CA 1DOVA 5EGYA 2J9BA 1GGQA 4MW8A 2L7AA 3RQEA 2OQMA 5JLIA 5D92A 3S9OA 1LM3B 1OQCA 2ZPAA 3KKBA 1TWAA 1MMDA 1TFKB 4CBEA 3ABMC 3ASOC 3BEHA 3EFOA 4AK9A 2JPUA 1VK5A 3RVZA 1TWGA 2MWQA 3PCVA 5T1DB 1FAPB 4OINF 3C8GB 3RF3A 1I4ZA 4G0HA 1Z63A 3POVA 4ZLDA 4JEAA 1D0ZA 1QQ3A 1Z5ZA 2G3VA 3JZ0A 3O39A 4R32A 1VLTA 5F28E 3X1OA 1JMWA 1D0XA 3ASNC 3ZG1A 2A0BA 3LS0A 4OIOF 3DMDA 3F46A 3RH3A 2EPMX 2KQ9A 2R7QA 3U0CA 3KYIA 4PJJA 1OCRC 2RD9A 2OG2A 2EIMC 3AG1C 2MYSA 2R05A 1A41A 3IQTA 3ZQYA 2G3KA 1ST6A 4H4KC 2J9WA 1VLSA 3DZAA 3LNRA 2CW0F 2XM4A 1D1CA 1U0BB 4OIPF 1S7ZA 4NTBA 3US6A 1MMGA 4I44A 3UMHA 3AJMA 3VM6A 2OEVA 4EBBA 4O6NA 5BQHA 1TQGA 3ABKC 3W2VA 3FAJA 3EZIA 3GM3A 4DBQA 2J0WA 2LK4A 1NFOA 2W4MA 4GYTA 1FTSA 4OIQF 2C04A 3ATPA 2LIGA 3DM5A 4NC3A 4U9DA 3S90A 4AX2A 2VC9A 4G7ZF 3IQ6A 2QY9A 2XLDA 4YJWA 3A11A 4IB4A 2WZGA 2CYDA 2PX0A 2L6HA 2IXOA 2J7PD 3EG9B 4ONSA 3GM1A 3LESA 5BQGA 2YRFA 2W45A 1NU9C 5KYYB 2OEXA 2HMQA 1SZIA 4MVRA 4BJTA 1OW6A 2A69F 3AGUA 1JPNA 2IBFA 5DS6A 3AQCA 1BZ4A 2H7BA 1M2OA 2HZ8A 3GODA 3TJ6A 3S0XA 4JW1A 1JR8A 2VCAA 1OR2A 1RXQA 1WN0A 2YL0A 4L6RA 5BQIA 3Q7GA 3Q6MA 2IM8A 2OOCA 5L3QA 3KMIA 2DGJA 2CNWA 5L0DA 4Q7CA 1YYJA 1FR0A 1ZHXA 4BPMA 2ASRA 4KC9A 2XL6A 3HNIA 1BDJB 1PD0A 3I5PA 4JC7A 4U5HA 5TJ5E 3VRCA 4YL0A 3LEVA 1OXBA 3L34A 2M4EA 2WVOA 1CPQA 5T3WA 1R5ID 1WASA 3M79A 1KTMA 1ZW3A 3W8HA 2IOQA 3RIPA 2XRHA 2Z15A 1Y4CA 3EHNA 3GANA 1WTYA 4LERA 1J8YF 1ORJA 1LIHA 2Q4FA 4AL0A 2CCYA 4IRUA 4EKWA 1MMNA 4C3BA 1BBHA 4E0IA 2QUPA 5A6AA 3ZTZA 4HEAJ 3OWTA 3GEHA 4CS9C 1HMDA 3K6BA 3QMKA 1RKCA 2HS5A 5COFA 2ZXPA 1UG7A 3E70C 2YKZA 3DAFA 4BEJA 2XL8A 3N24A 5AC5A 2Y3HA 3PMRA 4M63A 2EIJC 3LNMB 4CDYA 4Z9IA 3B9QA 4I1OB 3CZ6A 2HKVA 3NYJA 2HJ3A 3UMIA 5KYNA 1D0YA 1YLMA 1O3UA 1YARO 3MBGA 2LFFA 2Q00A 3DXJF 2YL1A 3FHDA 1MNDA 2LP4A 2GA0A 1CGME 4C7OA 3FOOA 1L7CA 5A69A 3OEOA 3MFNA 4DRJB 2Y3BA 2XS1A 4YT5A 3RKOF 2L6GA 2KJGA 4I3MA 4XTKA 3GEIA 4MS2A 2UUIA 4MW3A 3C8ZA 3TD7A 3TQOA 5DLJA 4BEMJ 1SR2A 4CJGA 2YEVA 3ZQVA 3ZWIA 1WOLA 2B0JA 4KI2A 1HMOA 4B6IA 2H8AA 4IAOA 4WGYA 4FAPB 3I4UA 2XXAA 3S84A 1IZMA 3O6XA 2NUTA 3WODF 1I4YA 2KSFA 3L0IA 1YYXA 1QLEC 2J7PA 3I5QA 4O7GA 1OCOC 3SXMA 3B71A 3OA1A 2C03A 3MX3A 3T9OA 4XEKA 2ZXOA 3TOMA 1PD1A 3ZIBA 5B3SC 5HSWA 3J06A 1Z23A 4IARA 4Z9HA 2Q7RA 3U3FA 2IXPA 2ICWG 3TULA 2R7SA 4RD9A 2J8WA 3W8IA 1RCPA 4IJJA 2PX3A 4PFOA 5L3VA 3CQZA 4E17A 3NMKA 3FVYA 4OD4A 5KYUA 2WVQA 3NYLA 1JOGA 3O55A 4P6IC 3SYNA 2XLVA 3BRJA 2L81A 1EKYA 1LE4A 2DB4A 1Z3IX 4E18A 4H54A 3L1MA 1A7DA 1E84A 4OD5A 1CGNA 4JE9A 1Q0DA 2NSGA 3WHNA 3NKEA 4PACA 2YHSA 4AE4A 2OCCC 3AG3C 3RQFA 4CS7A 4DVYP 3T6GB 1RKEA 1UFBA 3EGDA 3B29A 3GORA 3O10A 4NTFA 3QW0A 3U9MA 3K66A 3L8IA 2XLOA 1NFNA 4CJOA 3QVZA 2J9VA 4XLNF 1LS1A 1NBBA 2AVKA 4J32B 3HKKA 4QI2A 2R7UA 5KYWA 4UDVA 1E85A
chains in the Genus database with same CATH topology
2XLMA 2YL0A 4L6RA 4CX9A 4U9EA 4IAQA 3C63A 4N4WA 4ER9A 1YYJA 2YL7A 1E86A 4CDVA 4ULVA 2XL6A 3HNIA 3VRCA 5JUAA 4WGZA 3HNLA 1CPQA 3ZTMA 3M79A 3C62A 2YLGA 3IQ5A 1MQVA 3M4CA 2CCYA 1E83A 4EIYA 1BBHA 3TOLA 4N6HA 3ZTZA 3DE8A 2XM0A 3M4BA 3U8PA 3M15A 4D4XA 4CDAA 3HNKA 2YKZA 1GQAA 2XL8A 5JT4A 4CDYA 2YL3A 2BC5A 2J9BA 3NMIA 1YZAA 4D4NA 5JLIA 1LM3B 5AGFA 2YL1A 3FOOA 1A7VA 5JRAA 4CIPA 5JSLA 2YLDA 1JAFA 3NMJA 2XLWA 3QW1A 4CJGA 3ZQVA 2QLAA 2XLEA 4JEAA 4WGYA 1QQ3A 1S05A 1YYXA 3TOMA 4JEBA 5B3IA 5JP7A 4IARA 2XLHA 2J8WA 3ZQYA 1RCPA 4JKVA 3NMKA 2XM4A 3FOPA 2XLVA 1YZCA 5JS5A 1EKYA 3L1MA 3ZWIA 256BA 1E84A 3DE9A 1CGNA 4JE9A 4NC3A 4U9DA 3IQ6A 2XLDA 3QW0A 4IB4A 1CGOA 2XLOA 1M6TA 3HNJA 4CJOA 3QVZA 5JVEA 1APCA 1NBBA 3QVYA 1QPUA 2YLIA 1CPRA 1E85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLM A;  2YL0 A;  4L6R A;  4CX9 A;  4U9E A;  4IAQ A;  3C63 A;  4N4W A;  4ER9 A;  1YYJ A;  2YL7 A;  1E86 A;  4CDV A;  4ULV A;  2XL6 A;  3HNI A;  3VRC A;  5JUA A;  4WGZ A;  3HNL A;  1CPQ A;  3ZTM A;  3M79 A;  3C62 A;  2YLG A;  3IQ5 A;  1MQV A;  3M4C A;  2CCY A;  1E83 A;  4EIY A;  1BBH A;  3TOL A;  4N6H A;  3ZTZ A;  3DE8 A;  2XM0 A;  3M4B A;  3U8P A;  3M15 A;  4D4X A;  4CDA A;  3HNK A;  2YKZ A;  1GQA A;  2XL8 A;  5JT4 A;  4CDY A;  2YL3 A;  2BC5 A;  2J9B A;  3NMI A;  1YZA A;  4D4N A;  5JLI A;  1LM3 B;  5AGF A;  2YL1 A;  3FOO A;  1A7V A;  5JRA A;  4CIP A;  5JSL A;  2YLD A;  1JAF A;  3NMJ A;  2XLW A;  3QW1 A;  4CJG A;  3ZQV A;  2QLA A;  2XLE A;  4JEA A;  4WGY A;  1QQ3 A;  1S05 A;  1YYX A;  3TOM A;  4JEB A;  5B3I A;  5JP7 A;  4IAR A;  2XLH A;  2J8W A;  3ZQY A;  1RCP A;  4JKV A;  3NMK A;  2XM4 A;  3FOP A;  2XLV A;  1YZC A;  5JS5 A;  1EKY A;  3L1M A;  3ZWI A;  256B A;  1E84 A;  3DE9 A;  1CGN A;  4JE9 A;  4NC3 A;  4U9D A;  3IQ6 A;  2XLD A;  3QW0 A;  4IB4 A;  1CGO A;  2XLO A;  1M6T A;  3HNJ A;  4CJO A;  3QVZ A;  5JVE A;  1APC A;  1NBB A;  3QVY A;  1QPU A;  2YLI A;  1CPR A;  1E85 A; 
#chains in the Genus database with same CATH topology
 3U3B A;  3EH1 A;  3FXH A;  1ZVZ A;  2XLM A;  1HE9 A;  1QSP A;  1RJ9 A;  3X2Q C;  1AUE A;  1VB5 A;  2Q9B A;  3SXZ A;  5A6B D;  2HSB A;  4U9E A;  2OJQ A;  4XLP F;  3V5Z A;  2NPU A;  2YL7 A;  2Y69 C;  3DWW A;  4U5E E;  1YDI A;  5A6K A;  2R7X A;  2KK1 A;  3FDQ A;  1FFT C;  2XL4 A;  3C7J A;  4WGZ A;  4DJ9 A;  4C7O B;  3EPV A;  3H2U A;  3U5S A;  4MVS A;  4U5G A;  4LDK A;  4XEV A;  4CS8 A;  1PCX A;  2QNL A;  2YLG A;  1VOM A;  4BJ5 A;  3FMS A;  4W8K A;  2DYS C;  2ETS A;  4JCH A;  2WZL A;  4C3E A;  4NTA A;  1XZP A;  5E3A A;  3SP1 A;  3SXY A;  4JUR I;  3H2V A;  3UMK A;  1AVO B;  3M4C A;  2YZS A;  4E0H A;  1I5N A;  3TOL A;  3ABL C;  2XXA B;  3VAY A;  3F47 A;  1PV3 A;  2PP4 A;  2HSQ A;  3G50 A;  2NUT B;  5T3T A;  2Y39 A;  1R4T A;  1K05 A;  3DI5 A;  1SMY F;  2WVN A;  3U8P A;  1KNY A;  3HNK A;  5CI9 A;  3Q7L A;  5E2Q A;  5A6J A;  3MLG A;  1GQA A;  5COG A;  4A2N B;  1A0B A;  2AWC A;  5D91 A;  4YWQ A;  2NSF A;  5L0F A;  5F5F A;  5JT4 A;  4BG0 A;  3JCU Q;  1D1B A;  5CIV A;  1LI7 A;  5L0H A;  1F1M A;  1NG1 A;  3T4R A;  5COM A;  4I1M A;  1EI7 A;  2BC5 A;  1ORS C;  3JSZ A;  3RW0 A;  3SEO A;  2X51 A;  3EFO B;  2I8B A;  3JRM O;  5DQZ A;  5L0J A;  4D4N A;  2JD3 A;  3UR3 C;  2D5R B;  4JVS A;  1C17 M;  2UUH A;  5AGF A;  3MYF A;  1ZHT A;  1A7V A;  2O9X A;  4J7T A;  4K7B A;  2L9J A;  2OU6 A;  4XPW A;  2EIN C;  1YJG A;  4CIP A;  5JRA A;  5JSL A;  1LKX A;  4AE4 B;  1JAF A;  4O6Y A;  3QTH A;  2Y3G A;  3UGP A;  1XZQ A;  4LLE A;  1W2W A;  2XLW A;  1BR1 A;  4MQ9 F;  4G7H F;  5CI8 A;  3VYW A;  4BJ1 A;  4MVM A;  1XWJ A;  5L0G A;  3PDM P;  1HY5 A;  1ZHZ A;  2XLE A;  2R7V A;  4LDR A;  2YQY A;  2VCC A;  3NYM A;  4HE8 D;  4YT2 A;  4CSA A;  2R7T A;  2KGO A;  3N2Z B;  4P9T A;  2XS8 A;  2HJM A;  1MNE A;  2WL8 A;  5FZT A;  2QE9 A;  2Y3D A;  4WAB A;  5F5H A;  3WAQ A;  5KYW B;  3RFY A;  4JRZ A;  2B0H A;  2BE5 F;  2FGY A;  5JP7 A;  4MTO A;  2XLH A;  3LS1 A;  1HW1 A;  4DRI B;  5DS5 A;  2XSE A;  3EZH A;  1EA8 A;  3JSE O;  3DKA A;  1OR3 A;  1T6U A;  3ECS A;  1H7I A;  2F22 A;  4JJG A;  4N6C A;  4U5B E;  4C3D A;  5A6B A;  1OXK A;  2HUJ A;  3JT1 A;  1YZC A;  3WG7 C;  1D1A A;  2GDC A;  5JS5 A;  4LDQ A;  1YA7 O;  1Z7Q c;  2A6H F;  4HFK B;  4EBK A;  1Y6D A;  2Q9A A;  1T01 A;  4JJF A;  4EHP A;  3HLZ A;  2NUP A;  3AOU A;  2J45 A;  1E2X A;  4O79 A;  4QI0 A;  3K1I A;  4PJM A;  2LD6 A;  3LEO A;  2J46 A;  1K04 A;  4DXW A;  3EGX A;  3S27 A;  2KC3 A;  3V5X A;  3V5Y A;  5B1A C;  2J9U A;  3CSK A;  1CGO A;  2ZD9 A;  3K1H A;  3S29 A;  5DS4 A;  1OCC C;  1GS9 A;  1T6Q A;  2BL2 A;  2VH3 A;  3HNJ A;  3IHU A;  4KNV A;  3AG2 C;  5DQT A;  4Z9J A;  5JVE A;  3R7C A;  5L0C A;  1APC A;  3QVY A;  3EQL F;  4ANJ A;  4MVQ A;  4BJ6 A;  1U6H A;  2NG1 A;  1V54 C;  3HJC A;  1QPU A;  2YLI A;  3ITF A;  2RSE B;  5EHH A;  1JRA A;  5KYY A;  1J8M F;  3LJB A;  4DVZ A;  1QKR A;  1L3P A;  3IEE A;  2PF4 E;  4JTC B;  2IXN A;  2G62 A;  1V74 B;  1QZX A;  3MYI A;  4FX5 A;  1VMA A;  2ZXR A;  3ZSU A;  1VYI A;  1ZU5 A;  2DI3 A;  2PBE A;  3H65 A;  1BR2 A;  4U5F E;  3R2P A;  4ULV A;  4YL1 A;  3W4Y A;  1ZW2 A;  2P1A A;  4CS8 C;  3C8G D;  5FCL A;  2MHR A;  3HNL A;  3ZTM A;  5HV9 A;  2VCB A;  2P61 A;  3UGO A;  3NG1 A;  1G4U S;  3C62 A;  2YWA A;  4YK5 A;  4YT4 A;  1FNT c;  4PJN A;  4YN0 B;  1NSG B;  1YA9 A;  2VB6 A;  3N0T A;  3ZVR A;  1SYQ A;  5DVW A;  3TK0 A;  1ZHW A;  1G4W R;  1VTM P;  3JRT A;  4EIY A;  2PFD A;  1VYK A;  4G78 A;  1TWC A;  1V4A A;  2H7O A;  2AU5 A;  3EJN A;  4J30 B;  1YAU O;  3NDB B;  2CDQ A;  3B0P A;  3U9J A;  3LLK A;  4A4A A;  3DE8 A;  2XM0 A;  1BR4 A;  3K7D A;  4JTD B;  2KYH A;  3M15 A;  4D4X A;  3DM9 B;  4IGG A;  3T6J A;  3GM2 A;  2DYR C;  4U5D E;  2EPK X;  2P7V A;  2V3C C;  2GWW A;  4F4B A;  3Q6N A;  1MMA A;  2VAS A;  1NU7 D;  1QVX A;  3HTK C;  3GWL A;  1ZYR F;  1JPJ A;  2CGE A;  2YL3 A;  2D4U A;  4O6M A;  2Q9C A;  3NMI A;  2YVK A;  1YZA A;  4HFF B;  4LLC A;  1LVK A;  1ZZP A;  1M2V A;  5E3C A;  1KU2 A;  2W4B A;  1TWH A;  4ZLC A;  3TJ5 A;  3U2M A;  2NUP B;  2YLD A;  2LCH A;  1OW8 A;  3KH2 A;  3NMJ A;  4DRH B;  5IY5 C;  2FAP B;  3GWN A;  2GAQ A;  5KYX A;  1OKK A;  4MND A;  1LE2 A;  4CSA C;  3EGX B;  3QW1 A;  3E9V A;  4XEF A;  5EK0 A;  4K1O A;  3RYL A;  1EQ1 A;  4J7Y A;  4EUK B;  4CIH A;  2QLA A;  3DAG A;  2EIL C;  4GEH A;  4N06 A;  3CEX A;  4RDA A;  1NLX A;  1ZU4 A;  4KNW A;  4OIR F;  2A68 F;  4EBJ A;  4Q4Z F;  4Q5S F;  4DBR A;  2AP3 A;  1V55 C;  3KL4 A;  3JYY A;  1WWP A;  1S05 A;  4E7Z A;  3A9C A;  3T6B A;  4JEB A;  2P0N A;  3G4Z A;  1T9K A;  1LI5 A;  3LLI A;  5B1B C;  5B3I A;  2EPO A;  3DJN B;  5KYU B;  2TMV P;  4K0D A;  2LQG A;  1WGW A;  5BUO A;  3ZC4 A;  5GPG B;  3CAX A;  4JKV A;  4YT8 A;  4G7O F;  2E87 A;  3FOP A;  3NRH A;  2EIK C;  4QDL A;  4DOZ A;  2R7W A;  3K1I C;  1C02 A;  3AQB A;  2R03 A;  1YVI A;  4JZA A;  1LS4 A;  1Q0M A;  4IWB A;  3B0V C;  1A7E A;  1H9T A;  1DOW A;  1NZE A;  1ORY A;  1RKE B;  1C03 A;  256B A;  2A0U A;  3DE9 A;  3EGD B;  1N1C A;  4MVZ A;  4NCQ A;  1RMV A;  4X0R A;  4JTA B;  3KYJ A;  2OJE D;  3PHF 2;  3SXK A;  2IYL D;  3C8G A;  4JCZ A;  1B68 A;  1IW7 F;  1HE1 A;  2KNH A;  2WZF A;  1Z6A A;  4PJL A;  2M64 A;  4ULW A;  4BJ6 C;  2EPL X;  2EPN A;  4MVU A;  1M6T A;  1ZHY A;  1FMW A;  1Q0K A;  1TR2 A;  4EWC A;  2I15 A;  5L0I A;  3DD7 A;  1RJ9 B;  3AG4 C;  1Q0F A;  1WAT A;  2H7V C;  1M57 C;  1O5H A;  2HV7 A;  1TFO B;  3DJU B;  1LPE A;  3EH2 A;  3JTL O;  4W8P A;  4GQH A;  2WB7 A;  4MTF A;  1CPR A;  4FES A;  3U8V A;  3SZR A;  3LAY A;  2A1D D;  2HV6 A;  3RVY A;  3S28 A;  2L6F A;  3VF0 A;  1G8X A;  4P9F A;  3K33 A;  3KPH A;  4CX9 A;  1OW7 A;  4FWV A;  1H6G A;  2Q3T A;  2LFD A;  1H9G A;  3EHM A;  4IAQ A;  2HMZ A;  2QTV A;  4XQ1 A;  3C63 A;  4N4W A;  2R7R A;  1OKK D;  4ER9 A;  2LSE A;  1M56 C;  2R25 A;  1E86 A;  4CDV A;  4MVO A;  5JUA A;  1M2V B;  2FFH A;  3FAP B;  4XPX A;  1K40 A;  1GM5 A;  2HFI A;  1FMV A;  2R7O A;  3IPM O;  4XPY A;  1HW2 A;  2P6V A;  3UNG C;  3JYH A;  3ZDL A;  4XWJ A;  4U5C E;  5KYX B;  1TKN A;  3G4X A;  3IQ5 A;  1MQV A;  3M1C B;  2J0X A;  1SF8 A;  1OCZ C;  5AC4 A;  4JIO A;  1AEP A;  4E7S A;  3L8J A;  3GEE A;  4PFP A;  3EG9 A;  3SNH A;  4AL1 A;  4NQF A;  1E83 A;  2AWY A;  2IXM A;  4NY3 A;  2OKU A;  2R9R B;  2JX0 A;  4N6H A;  2W9Y A;  3C18 A;  2A6E F;  3NKD A;  4KBL A;  4RBN A;  3AGT A;  5E33 A;  4MTG A;  3V7O A;  1T6I A;  2GFH A;  3LUT B;  4PK4 A;  3RQG A;  3M4B A;  5K0I A;  2ZXW C;  1FFH A;  3B0U X;  4CDA A;  3QZC A;  2CNW D;  4YL3 A;  2KW3 C;  4PR9 A;  2PNO A;  2R02 A;  4LAC B;  4CS9 A;  1T5O A;  4WJ0 A;  1O87 A;  4BJ5 C;  1U89 A;  1Q0G A;  3U2L A;  3W2W A;  2V26 A;  1G5Z A;  3IQC A;  2X0C A;  1DOV A;  5EGY A;  2J9B A;  1GGQ A;  4MW8 A;  2L7A A;  3RQE A;  2OQM A;  5JLI A;  5D92 A;  3S9O A;  1LM3 B;  1OQC A;  2ZPA A;  3KKB A;  1TWA A;  1MMD A;  1TFK B;  4CBE A;  3ABM C;  3ASO C;  3BEH A;  3EFO A;  4AK9 A;  2JPU A;  1VK5 A;  3RVZ A;  1TWG A;  2MWQ A;  3PCV A;  5T1D B;  1FAP B;  4OIN F;  3C8G B;  3RF3 A;  1I4Z A;  4G0H A;  1Z63 A;  3POV A;  4ZLD A;  4JEA A;  1D0Z A;  1QQ3 A;  1Z5Z A;  2G3V A;  3JZ0 A;  3O39 A;  4R32 A;  1VLT A;  5F28 E;  3X1O A;  1JMW A;  1D0X A;  3ASN C;  3ZG1 A;  2A0B A;  3LS0 A;  4OIO F;  3DMD A;  3F46 A;  3RH3 A;  2EPM X;  2KQ9 A;  2R7Q A;  3U0C A;  3KYI A;  4PJJ A;  1OCR C;  2RD9 A;  2OG2 A;  2EIM C;  3AG1 C;  2MYS A;  2R05 A;  1A41 A;  3IQT A;  3ZQY A;  2G3K A;  1ST6 A;  4H4K C;  2J9W A;  1VLS A;  3DZA A;  3LNR A;  2CW0 F;  2XM4 A;  1D1C A;  1U0B B;  4OIP F;  1S7Z A;  4NTB A;  3US6 A;  1MMG A;  4I44 A;  3UMH A;  3AJM A;  3VM6 A;  2OEV A;  4EBB A;  4O6N A;  5BQH A;  1TQG A;  3ABK C;  3W2V A;  3FAJ A;  3EZI A;  3GM3 A;  4DBQ A;  2J0W A;  2LK4 A;  1NFO A;  2W4M A;  4GYT A;  1FTS A;  4OIQ F;  2C04 A;  3ATP A;  2LIG A;  3DM5 A;  4NC3 A;  4U9D A;  3S90 A;  4AX2 A;  2VC9 A;  4G7Z F;  3IQ6 A;  2QY9 A;  2XLD A;  4YJW A;  3A11 A;  4IB4 A;  2WZG A;  2CYD A;  2PX0 A;  2L6H A;  2IXO A;  2J7P D;  3EG9 B;  4ONS A;  3GM1 A;  3LES A;  5BQG A;  2YRF A;  2W45 A;  1NU9 C;  5KYY B;  2OEX A;  2HMQ A;  1SZI A;  4MVR A;  4BJT A;  1OW6 A;  2A69 F;  3AGU A;  1JPN A;  2IBF A;  5DS6 A;  3AQC A;  1BZ4 A;  2H7B A;  1M2O A;  2HZ8 A;  3GOD A;  3TJ6 A;  3S0X A;  4JW1 A;  1JR8 A;  2VCA A;  1OR2 A;  1RXQ A;  1WN0 A;  2YL0 A;  4L6R A;  5BQI A;  3Q7G A;  3Q6M A;  2IM8 A;  2OOC A;  5L3Q A;  3KMI A;  2DGJ A;  2CNW A;  5L0D A;  4Q7C A;  1YYJ A;  1FR0 A;  1ZHX A;  4BPM A;  2ASR A;  4KC9 A;  2XL6 A;  3HNI A;  1BDJ B;  1PD0 A;  3I5P A;  4JC7 A;  4U5H A;  5TJ5 E;  3VRC A;  4YL0 A;  3LEV A;  1OXB A;  3L34 A;  2M4E A;  2WVO A;  1CPQ A;  5T3W A;  1R5I D;  1WAS A;  3M79 A;  1KTM A;  1ZW3 A;  3W8H A;  2IOQ A;  3RIP A;  2XRH A;  2Z15 A;  1Y4C A;  3EHN A;  3GAN A;  1WTY A;  4LER A;  1J8Y F;  1ORJ A;  1LIH A;  2Q4F A;  4AL0 A;  2CCY A;  4IRU A;  4EKW A;  1MMN A;  4C3B A;  1BBH A;  4E0I A;  2QUP A;  5A6A A;  3ZTZ A;  4HEA J;  3OWT A;  3GEH A;  4CS9 C;  1HMD A;  3K6B A;  3QMK A;  1RKC A;  2HS5 A;  5COF A;  2ZXP A;  1UG7 A;  3E70 C;  2YKZ A;  3DAF A;  4BEJ A;  2XL8 A;  3N24 A;  5AC5 A;  2Y3H A;  3PMR A;  4M63 A;  2EIJ C;  3LNM B;  4CDY A;  4Z9I A;  3B9Q A;  4I1O B;  3CZ6 A;  2HKV A;  3NYJ A;  2HJ3 A;  3UMI A;  5KYN A;  1D0Y A;  1YLM A;  1O3U A;  1YAR O;  3MBG A;  2LFF A;  2Q00 A;  3DXJ F;  2YL1 A;  3FHD A;  1MND A;  2LP4 A;  2GA0 A;  1CGM E;  4C7O A;  3FOO A;  1L7C A;  5A69 A;  3OEO A;  3MFN A;  4DRJ B;  2Y3B A;  2XS1 A;  4YT5 A;  3RKO F;  2L6G A;  2KJG A;  4I3M A;  4XTK A;  3GEI A;  4MS2 A;  2UUI A;  4MW3 A;  3C8Z A;  3TD7 A;  3TQO A;  5DLJ A;  4BEM J;  1SR2 A;  4CJG A;  2YEV A;  3ZQV A;  3ZWI A;  1WOL A;  2B0J A;  4KI2 A;  1HMO A;  4B6I A;  2H8A A;  4IAO A;  4WGY A;  4FAP B;  3I4U A;  2XXA A;  3S84 A;  1IZM A;  3O6X A;  2NUT A;  3WOD F;  1I4Y A;  2KSF A;  3L0I A;  1YYX A;  1QLE C;  2J7P A;  3I5Q A;  4O7G A;  1OCO C;  3SXM A;  3B71 A;  3OA1 A;  2C03 A;  3MX3 A;  3T9O A;  4XEK A;  2ZXO A;  3TOM A;  1PD1 A;  3ZIB A;  5B3S C;  5HSW A;  3J06 A;  1Z23 A;  4IAR A;  4Z9H A;  2Q7R A;  3U3F A;  2IXP A;  2ICW G;  3TUL A;  2R7S A;  4RD9 A;  2J8W A;  3W8I A;  1RCP A;  4IJJ A;  2PX3 A;  4PFO A;  5L3V A;  3CQZ A;  4E17 A;  3NMK A;  3FVY A;  4OD4 A;  5KYU A;  2WVQ A;  3NYL A;  1JOG A;  3O55 A;  4P6I C;  3SYN A;  2XLV A;  3BRJ A;  2L81 A;  1EKY A;  1LE4 A;  2DB4 A;  1Z3I X;  4E18 A;  4H54 A;  3L1M A;  1A7D A;  1E84 A;  4OD5 A;  1CGN A;  4JE9 A;  1Q0D A;  2NSG A;  3WHN A;  3NKE A;  4PAC A;  2YHS A;  4AE4 A;  2OCC C;  3AG3 C;  3RQF A;  4CS7 A;  4DVY P;  3T6G B;  1RKE A;  1UFB A;  3EGD A;  3B29 A;  3GOR A;  3O10 A;  4NTF A;  3QW0 A;  3U9M A;  3K66 A;  3L8I A;  2XLO A;  1NFN A;  4CJO A;  3QVZ A;  2J9V A;  4XLN F;  1LS1 A;  1NBB A;  2AVK A;  4J32 B;  3HKK A;  4QI2 A;  2R7U A;  5KYW A;  4UDV A;  1E85 A; 
#chains in the Genus database with same CATH homology
 2XLM A;  2YL0 A;  4L6R A;  4CX9 A;  4U9E A;  4IAQ A;  3C63 A;  4N4W A;  4ER9 A;  1YYJ A;  2YL7 A;  1E86 A;  4CDV A;  4ULV A;  2XL6 A;  3HNI A;  3VRC A;  5JUA A;  4WGZ A;  3HNL A;  1CPQ A;  3ZTM A;  3M79 A;  3C62 A;  2YLG A;  3IQ5 A;  1MQV A;  3M4C A;  2CCY A;  1E83 A;  4EIY A;  1BBH A;  3TOL A;  4N6H A;  3ZTZ A;  3DE8 A;  2XM0 A;  3M4B A;  3U8P A;  3M15 A;  4D4X A;  4CDA A;  3HNK A;  2YKZ A;  1GQA A;  2XL8 A;  5JT4 A;  4CDY A;  2YL3 A;  2BC5 A;  2J9B A;  3NMI A;  1YZA A;  4D4N A;  5JLI A;  1LM3 B;  5AGF A;  2YL1 A;  3FOO A;  1A7V A;  5JRA A;  4CIP A;  5JSL A;  2YLD A;  1JAF A;  3NMJ A;  2XLW A;  3QW1 A;  4CJG A;  3ZQV A;  2QLA A;  2XLE A;  4JEA A;  4WGY A;  1QQ3 A;  1S05 A;  1YYX A;  3TOM A;  4JEB A;  5B3I A;  5JP7 A;  4IAR A;  2XLH A;  2J8W A;  3ZQY A;  1RCP A;  4JKV A;  3NMK A;  2XM4 A;  3FOP A;  2XLV A;  1YZC A;  5JS5 A;  1EKY A;  3L1M A;  3ZWI A;  256B A;  1E84 A;  3DE9 A;  1CGN A;  4JE9 A;  4NC3 A;  4U9D A;  3IQ6 A;  2XLD A;  3QW0 A;  4IB4 A;  1CGO A;  2XLO A;  1M6T A;  3HNJ A;  4CJO A;  3QVZ A;  5JVE A;  1APC A;  1NBB A;  3QVY A;  1QPU A;  2YLI A;  1CPR A;  1E85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...