2YL0A

Cytochrome c prime from alcaligenes xylosoxidans: as isolated l16a variant at 0.95 a resolution
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
127
structure length
127
Chain Sequence
EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 54
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yl0A00
2QLAA 5B3IA 5JUAA 3QVZA 4CDVA 1GQAA 1S05A 1JAFA 3TOLA 2J8WA 2YLGA 1QQ3A 4JEAA 1CPQA 1M6TA 3QW1A 2XM4A 4WGYA 1MQVA 4CDYA 4D4XA 3ZQYA 4CJOA 2XLEA 1YZCA 2CCYA 3DE8A 2XLVA 1E83A 4IARA 3FOOA 3NMJA 4CIPA 2XL6A 3M15A 2YLIA 4N6HA 1LM3B 1NBBA 1YZAA 1CGNA 3DE9A 4JKVA 2J9BA 1CPRA 3VRCA 2XLWA 3HNLA 4L6RA 2YL1A 2YL7A 4NC3A 5JRAA 4N4WA 4CX9A 2XLDA 1CGOA 4IB4A 4WGZA 3ZQVA 3TOMA 1EKYA 4CJGA 1YYJA 1APCA 2XLMA 3ZWIA 5JT4A 3HNIA 2YL0A 2XL8A 3M79A 3M4CA 5AGFA 4JE9A 2BC5A 5JS5A 3QVYA 256BA 2XLHA 3L1MA 5JLIA 4EIYA 3NMIA 3FOPA 4U9EA 5JP7A 1QPUA 4ULVA 4U9DA 3ZTMA 3ZTZA 2XLOA 1A7VA 3IQ5A 1E86A 2YL3A 3HNKA 3QW0A 3C63A 1YYXA 2YKZA 3NMKA 4CDAA 3M4BA 1E85A 3C62A 2YLDA 1E84A 1RCPA 4D4NA 4JEBA 3U8PA 5JVEA 4ER9A 4IAQA 1BBHA 5JSLA 3HNJA 2XM0A 3IQ6A
chains in the Genus database with same CATH superfamily
2QLAA 5B3IA 3MFNA 1K04A 3U9MA 4CDVA 3EZIA 1L3PA 1S05A 3G4XA 1JAFA 4UDVA 5TJ5E 4YT2A 2VCAA 1QQ3A 3Q7GA 3H2VA 4JEAA 2YWAA 2XXAB 1FFHA 3KPHA 3WAQA 1BDJB 3QW1A 2XM4A 2ZD9A 2J9VA 3ZSUA 2HSQA 4D4XA 1U89A 3VM6A 1I4ZA 3NKEA 1O5HA 1YZCA 3GM2A 4GQHA 3Q7LA 4E7SA 5CIVA 3SZRA 3JZ0A 3KKBA 2HMQA 4YL3A 2XLVA 3C8ZA 4JTAB 2QNLA 4JJFA 3V5ZA 3NRHA 2LD6A 4YT5A 2L6HA 4Q7CA 4DXWA 4BJ6C 1E83A 3FOOA 3ABMC 4OINF 2WB7A 1OXBA 2X51A 5A6KA 5B3SC 5F5FA 1VYKA 1VLSA 1IZMA 2I8BA 1PD0A 3OWTA 2IXMA 3RQGA 4XPWA 4G0HA 1NBBA 4P9TA 2J46A 3DE9A 1OXKA 2G3VA 3LLKA 1HMDA 3NYJA 2OOCA 3NYMA 3M1CB 1QSPA 3L34A 1NFOA 5HSWA 3DJUB 2Q7RA 3CSKA 3RKOF 2HZ8A 3IHUA 3N2ZB 1ZZPA 2WZLA 3DJNB 4DJ9A 1QZXA 2W45A 3W8HA 3LS1A 5DLJA 1FFTC 4CX9A 4Q4ZF 1HE1A 1HE9A 2W4BA 3VAYA 4JW1A 1LIHA 4MVSA 2IXNA 2P61A 3W2VA 4YL1A 1VYIA 4IB4A 3LS0A 1HY5A 4PR9A 4WGZA 4JURI 3JSZA 3S9OA 2ETSA 4BPMA 3K1IA 5IY5C 5L0JA 2C04A 3RW0A 1Z3IX 2J0WA 4YL0A 1C03A 1LPEA 1OW8A 2HS5A 4MTGA 3S29A 3TOMA 5KYWA 2ASRA 4B6IA 4NTBA 1V4AA 3TJ6A 2GFHA 2YL0A 1XZPA 3EG9B 3H65A 4HEAJ 1OR2A 1Y4CA 2XL8A 2Q3TA 3K66A 1BR1A 5F28E 4XLNF 2A69F 5AGFA 3A11A 2KJGA 3EGDB 3K1IC 4JE9A 3QVYA 1N1CA 1R4TA 2DB4A 2QE9A 1L7CA 1RJ9A 1OKKA 4P9FA 2BE5F 2D5RB 4M63A 2NUPB 3B9QA 3S84A 1B68A 1A7DA 1OCOC 1Z5ZA 1ZYRF 2JD3A 2R9RB 2RSEB 3JSEO 3L8JA 5COFA 5D92A 5HV9A 2KYHA 3U0CA 1YJGA 1T5OA 3KYJA 2ZXOA 2XL4A 1G4WR 3ZTZA 4JTDB 2H7VC 1T01A 1WASA 1XZQA 2LSEA 3LESA 3J06A 3CZ6A 4CS8C 1LI7A 1K05A 5DQZA 4G7OF 3RH3A 4YK5A 1NU9C 2ICWG 3EH1A 4LERA 1YYXA 2M64A 1D1CA 3DM5A 1WGWA 2EPLX 5A6BD 5GPGB 3UGOA 2KNHA 3KL4A 4IAOA 1MMAA 2A0UA 2HKVA 2FGYA 5EK0A 3SNHA 3JTLO 4AL1A 2YLDA 4NTAA 3W8IA 1E84A 3C8GA 1RCPA 1FTSA 2KQ9A 1NLXA 4J7YA 2HFIA 2A6HF 3EGXA 2AWYA 3Q6MA 1Z23A 3TULA 4A4AA 3ZDLA 1BBHA 2EPMX 1DOWA 3DXJF 2OG2A 1VB5A 2L9JA 4NQFA 4O79A 5JSLA 1TR2A 1T9KA 2XS8A 4NCQA 4MW3A 4I1MA 4RDAA 4XPYA 4MVOA 1VOMA 2A68F 2IBFA 3ASNC 4LACB 1G4US 4O6MA 4PACA 1SR2A 3VYWA 1U6HA 2ZPAA 1BZ4A 1ORYA 3QVZA 3U5SA 3JYHA 4J7TA 4EWCA 2LFFA 2R7RA 2Y69C 1WTYA 1YLMA 3LEVA 5T1DB 2OKUA 3GEIA 3MYIA 3GEHA 1T6IA 3S0XA 4U5HA 3DMDA 5T3WA 4E17A 5AC5A 3S28A 3EQLF 3U3BA 2I15A 1OQCA 3CAXA 4CJOA 2P1AA 5BQHA 5DS5A 2YEVA 1Z63A 1U0BB 4XEKA 1AUEA 2MWQA 4FAPB 2CCYA 4IWBA 1YAUO 3DE8A 4JTCB 4G7HF 4C3BA 2QUPA 3B0PA 1Z7Qc 1NZEA 4IARA 1LKXA 3K6BA 3NMJA 4EKWA 1RKEA 2IXPA 3WODF 1M56C 4XWJA 1Q0DA 1OCZC 1ZHYA 2HSBA 2RD9A 1J8MF 1YZAA 2VH3A 1CGNA 4JKVA 3F47A 1OCRC 5KYWB 4OIPF 1NFNA 4BJ1A 4FX5A 1H6GA 1TFOB 3U8VA 3B0UX 4QI0A 5CI9A 3B71A 1ZW2A 3B29A 1Z6AA 3IQCA 3HNLA 4BJ6A 4BJTA 3HTKC 4MVZA 1Q0KA 1JOGA 3EHNA 1TWHA 4U5CE 4PK4A 5FCLA 3L8IA 4N4WA 4OIOF 3JRMO 2HV6A 2PP4A 3RVYA 4AK9A 1JPNA 4CBEA 2L6GA 1CGOA 1RMVA 1ZU4A 1IW7F 4U5GA 3PCVA 4G78A 3U2MA 1UG7A 1JR8A 3O10A 4YJWA 1Y6DA 3F46A 2HUJA 1MMNA 2XRHA 4O7GA 4DBRA 4MVQA 4PJNA 1O87A 2IOQA 2LP4A 3FVYA 4E0IA 1MNDA 4LLEA 1WOLA 1YYJA 1M2OA 3KYIA 2KSFA 2LQGA 4OD4A 2G3KA 4MVMA 3ZWIA 1Q0MA 3LLIA 2V26A 3EJNA 3AG1C 2XS1A 4DVYP 5DS6A 2GWWA 4C7OA 3TJ5A 1FMWA 3C8GB 2KK1A 1A7EA 1D1AA 1XWJA 256BA 2DGJA 2NPUA 3L1MA 4KNVA 4JC7A 4ONSA 3T6JA 1WN0A 4OIQF 2IXOA 1D0ZA 1SF8A 3EGXB 2J0XA 1YA9A 4IRUA 3NMIA 5COMA 4E18A 1KTMA 1GGQA 4U9EA 1JRAA 2TMVP 3OEOA 1OW6A 2H8AA 1J8YF 2Z15A 3EFOA 3GM3A 3G4ZA 3KMIA 4O6NA 4P6IC 3AQBA 3AGUA 2IYLD 3FHDA 2AWCA 4U5FE 4LDKA 3LUTB 4PFOA 3IQ5A 2VASA 3H2UA 5L0HA 2P7VA 3NKDA 3HNKA 3US6A 4E7ZA 1PV3A 3QW0A 5KYXA 4IGGA 5KYYB 3C63A 4K0DA 1VMAA 2YKZA 3DZAA 5B1BC 1SYQA 3FAJA 3U3FA 2EIMC 4I3MA 5COGA 3M4BA 2JX0A 4GYTA 3C7JA 4J30B 2QTVA 2MYSA 3AJMA 2NUTA 1EQ1A 4A2NB 5AC4A 2G62A 4CS8A 1Q0GA 3MYFA 2MHRA 3HKKA 4MNDA 3DM9B 1I5NA 3ITFA 4ER9A 2AP3A 5JVEA 5L0CA 1FR0A 3FAPB 3X2QC 1TQGA 2GDCA 2CNWA 2Q4FA 4YT8A 1FNTc 1UFBA 1LE2A 1RKEB 2J7PD 2XM0A 5A6BA 5L0DA 4KBLA 4JCHA 5JUAA 3FMSA 4AX2A 3JCUQ 4CS9C 1GQAA 4MW8A 1H9TA 3EH2A 3TOLA 2EPOA 2J8WA 2Y3GA 4U5EE 2B0JA 1YA7O 3CEXA 4R32A 2NSGA 2LIGA 3V7OA 2LFDA 1PCXA 4X0RA 2R7OA 1ZHTA 1MQVA 1SMYF 2OCCC 3QMKA 3UMHA 1DOVA 3V5XA 4CDYA 3B0VC 1KU2A 4DRJB 1S7ZA 5BUOA 1NSGB 2F22A 2KGOA 3OA1A 3ASOC 4U5BE 5E2QA 1ORSC 2PBEA 1G5ZA 1C02A 5L0IA 3O55A 1AVOB 3IPMO 2EILC 3RVZA 3W2WA 3TK0A 2EPNA 3I4UA 3MLGA 3LNMB 4ANJA 3M15A 4NY3A 2YLIA 4N6HA 1ORJA 4EBBA 2OQMA 1LM3B 2NSFA 3ECSA 2J9BA 3UNGC 3GODA 1M2VA 5K0IA 1OCCC 1CPRA 4LLCA 1ZW3A 2Q9CA 2OEXA 2UUIA 2CGEA 3RFYA 5BQGA 5L0GA 1V55C 2Y3DA 3AG4C 3VRCA 3UGPA 5DVWA 1E2XA 2DYRC 2EIJC 3PDMP 4C7OB 1C17M 3I5QA 1MMGA 3S27A 2O9XA 1A0BA 2B0HA 2YL7A 2J9WA 3LAYA 4IJJA 5JRAA 2P6VA 5T3TA 3AG3C 3O6XA 1M57C 4RBNA 1RKCA 4YWQA 4N6CA 3T6GB 2XLDA 4QI2A 1EA8A 2H7OA 3JYYA 4JJGA 3GWLA 4PJJA 3CQZA 1TFKB 2DI3A 3EFOB 3C8GD 4MTOA 5A6JA 2DYSC 4G7ZF 3TQOA 4RD9A 4FWVA 3WHNA 4GEHA 4LDRA 4H4KC 1D0YA 1YDIA 2WZGA 3ZQVA 3NDBB 4DRIB 2R7WA 2AU5A 1EKYA 4CJGA 1APCA 5KYXB 2VCCA 5JT4A 4PFPA 2W4MA 2R7SA 1TWAA 1ZHWA 3NYLA 1RXQA 2A1DD 5A69A 4AE4A 1TKNA 2H7BA 3ABLC 1HW1A 2AVKA 2Y39A 3ZIBA 4CIHA 3DAFA 2BC5A 1KNYA 4KNWA 2YVKA 3EZHA 4U5DE 1ZHZA 2WZFA 1JMWA 2NUTB 5JLIA 2XSEA 4EIYA 1TWCA 1RJ9B 1H7IA 2NUPA 3U9JA 1YARO 3RQEA 3ZVRA 4EBKA 4Z9IA 2R7QA 1QPUA 3U2LA 3GORA 4HE8D 1VTMP 2NG1A 2Q00A 2CYDA 3K7DA 2XLOA 3EHMA 1TWGA 4HFFB 1A7VA 1ZHXA 1ZU5A 3G50A 2P0NA 4K7BA 3QZCA 2L81A 3RIPA 2YL3A 1LI5A 2KC3A 3FXHA 3R7CA 2YQYA 3K1HA 3GANA 3NMKA 2GA0A 4BEJA 3BRJA 5KYUA 4MS2A 5DS4A 2R25A 4KC9A 4CS7A 1BR4A 2OEVA 4D4NA 4MVUA 3VF0A 3AG2C 1FAPB 2YZSA 4CSAA 4I1OB 1LVKA 4IAQA 3X1OA 4E0HA 2LCHA 3AOUA 2JPUA 4XEVA 4PJLA 1QKRA 2J45A 2GAQA 3LJBA 5E3CA 1I4YA 1G8XA 2LK4A 3S90A 4JZAA 5L0FA 1Q0FA 2ZXRA 2R7TA 3DI5A 1HW2A 4K1OA 1M2VB 3PHF2 5F5HA 4CSAC 4KI2A 3QTHA 2YLGA 3I5PA 4BJ5A 2J9UA 1CPQA 1M6TA 3BEHA 3N24A 4BEMJ 4Z9HA 4WGYA 4DOZA 1H9GA 1T6UA 2FFHA 3RF3A 3L0IA 2J7PA 5B1AC 1D0XA 2QY9A 3ZQYA 3ATPA 5L3VA 1A41A 2XLEA 1QVXA 2EIKC 2CW0F 2FAPB 3E70C 4DRHB 2R03A 3DAGA 4EUKB 1AEPA 4CS9A 2Y3BA 2VC9A 3K33A 1CGME 2R05A 3NG1A 3POVA 1GM5A 3KH2A 3FDQA 1QLEC 2OJED 4BJ5C 4MQ9F 3GM1A 1ZVZA 1MNEA 2CDQA 4J32B 4JIOA 4AL0A 4CIPA 2XL6A 3EPVA 1ST6A 1V54C 4XEFA 5E33A 3SXKA 3JRTA 2UUHA 3N0TA 2WVOA 1PD1A 5E3AA 1D1BA 1EI7A 2M4EA 2IM8A 2XXAA 2D4UA 3RQFA 2PNOA 3TD7A 3V5YA 4AE4B 2XLWA 1GS9A 5L3QA 3DWWA 4L6RA 4PJMA 4EHPA 2R7VA 3HJCA 2YL1A 4NC3A 3W4YA 2PX3A 3R2PA 3SXZA 1OR3A 1YVIA 2L6FA 4C3EA 4OD5A 2Y3HA 3AQCA 1W2WA 2R7XA 3GEEA 4HFKB 2R02A 2YHSA 4QDLA 3ZG1A 3T4RA 1LS1A 1MMDA 3AGTA 2KW3C 3LNRA 4WJ0A 4NTFA 3SXYA 4C3DA 2BL2A 5BQIA 4O6YA 2ZXWC 1T6QA 1OKKD 4I44A 1VLTA 4WABA 4DVZA 3ABKC 1BR2A 2XLMA 2CNWD 2Q9BA 3JT1A 4YT4A 3HNIA 3UMKA 2E87A 2A0BA 2VB6A 3SEOA 3SXMA 5CI8A 4ZLDA 4EBJA 2WVQA 4XTKA 5EGYA 2PX0A 3M79A 4BG0A 5KYUB 3M4CA 3DD7A 4MVRA 3LEOA 1WWPA 3UMIA 3WG7C 5JS5A 3PMRA 2EPKX 2XLHA 3IEEA 2OU6A 5DQTA 1V74B 2W9YA 3T9OA 2HJMA 3GWNA 3Q6NA 2V3CC 1SZIA 1VK5A 5A6AA 4N06A 2HMZA 1F1MA 3FOPA 2A6EF 5JP7A 2R7UA 4JRZA 3C18A 4ULVA 2HV7A 2PF4E 1OW7A 4U9DA 3MBGA 4JVSA 1NG1A 4LDQA 4W8KA 1K40A 3ZTMA 4XLPF 3E9VA 4FESA 1E86A 3IQTA 2X0CA 2ZXPA 1HMOA 4H54A 3SP1A 1NU7D 4MTFA 5KYYA 3RYLA 3A9CA 2WL8A 2C03A 5EHHA 3UR3C 4F4BA 3EG9A 4OIRF 2Q9AA 1LS4A 2EINC 3MX3A 4XQ1A 3ZC4A 4CDAA 1JPJA 4W8PA 1E85A 2HJ3A 2L7AA 2WVNA 3C62A 1LE4A 3EGDA 4JCZA 5D91A 4Z9JA 2YRFA 4DBQA 1WATA 4Q5SF 3DKAA 4JEBA 3U8PA 3O39A 1O3UA 1R5ID 4ZLCA 3T6BA 4YN0B 2VCBA 3HLZA 2OJQA 2PFDA 1FMVA 5FZTA 5KYNA 4ULWA 3HNJA 4XPXA 3SYNA 3IQ6A
chains in the Genus database with same CATH topology
2QLAA 5B3IA 5JUAA 3QVZA 4CDVA 1GQAA 1S05A 1JAFA 3TOLA 2J8WA 2YLGA 1QQ3A 4JEAA 1CPQA 1M6TA 3QW1A 2XM4A 4WGYA 1MQVA 4CDYA 4D4XA 3ZQYA 4CJOA 2XLEA 1YZCA 2CCYA 3DE8A 2XLVA 1E83A 4IARA 3FOOA 3NMJA 4CIPA 2XL6A 3M15A 2YLIA 4N6HA 1LM3B 1NBBA 1YZAA 1CGNA 3DE9A 4JKVA 2J9BA 1CPRA 3VRCA 2XLWA 3HNLA 4L6RA 2YL1A 2YL7A 4NC3A 5JRAA 4N4WA 4CX9A 2XLDA 1CGOA 4IB4A 4WGZA 3ZQVA 3TOMA 1EKYA 4CJGA 1YYJA 1APCA 2XLMA 3ZWIA 5JT4A 3HNIA 2YL0A 2XL8A 3M79A 3M4CA 5AGFA 4JE9A 2BC5A 5JS5A 3QVYA 256BA 2XLHA 3L1MA 5JLIA 4EIYA 3NMIA 3FOPA 4U9EA 5JP7A 1QPUA 4ULVA 4U9DA 3ZTMA 3ZTZA 2XLOA 1A7VA 3IQ5A 1E86A 2YL3A 3HNKA 3QW0A 3C63A 1YYXA 2YKZA 3NMKA 4CDAA 3M4BA 1E85A 3C62A 2YLDA 1E84A 1RCPA 4D4NA 4JEBA 3U8PA 5JVEA 4ER9A 4IAQA 1BBHA 5JSLA 3HNJA 2XM0A 3IQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QLA A;  5B3I A;  5JUA A;  3QVZ A;  4CDV A;  1GQA A;  1S05 A;  1JAF A;  3TOL A;  2J8W A;  2YLG A;  1QQ3 A;  4JEA A;  1CPQ A;  1M6T A;  3QW1 A;  2XM4 A;  4WGY A;  1MQV A;  4CDY A;  4D4X A;  3ZQY A;  4CJO A;  2XLE A;  1YZC A;  2CCY A;  3DE8 A;  2XLV A;  1E83 A;  4IAR A;  3FOO A;  3NMJ A;  4CIP A;  2XL6 A;  3M15 A;  2YLI A;  4N6H A;  1LM3 B;  1NBB A;  1YZA A;  1CGN A;  3DE9 A;  4JKV A;  2J9B A;  1CPR A;  3VRC A;  2XLW A;  3HNL A;  4L6R A;  2YL1 A;  2YL7 A;  4NC3 A;  5JRA A;  4N4W A;  4CX9 A;  2XLD A;  1CGO A;  4IB4 A;  4WGZ A;  3ZQV A;  3TOM A;  1EKY A;  4CJG A;  1YYJ A;  1APC A;  2XLM A;  3ZWI A;  5JT4 A;  3HNI A;  2YL0 A;  2XL8 A;  3M79 A;  3M4C A;  5AGF A;  4JE9 A;  2BC5 A;  5JS5 A;  3QVY A;  256B A;  2XLH A;  3L1M A;  5JLI A;  4EIY A;  3NMI A;  3FOP A;  4U9E A;  5JP7 A;  1QPU A;  4ULV A;  4U9D A;  3ZTM A;  3ZTZ A;  2XLO A;  1A7V A;  3IQ5 A;  1E86 A;  2YL3 A;  3HNK A;  3QW0 A;  3C63 A;  1YYX A;  2YKZ A;  3NMK A;  4CDA A;  3M4B A;  1E85 A;  3C62 A;  2YLD A;  1E84 A;  1RCP A;  4D4N A;  4JEB A;  3U8P A;  5JVE A;  4ER9 A;  4IAQ A;  1BBH A;  5JSL A;  3HNJ A;  2XM0 A;  3IQ6 A; 
#chains in the Genus database with same CATH topology
 2QLA A;  5B3I A;  3MFN A;  1K04 A;  3U9M A;  4CDV A;  3EZI A;  1L3P A;  1S05 A;  3G4X A;  1JAF A;  4UDV A;  5TJ5 E;  4YT2 A;  2VCA A;  1QQ3 A;  3Q7G A;  3H2V A;  4JEA A;  2YWA A;  2XXA B;  1FFH A;  3KPH A;  3WAQ A;  1BDJ B;  3QW1 A;  2XM4 A;  2ZD9 A;  2J9V A;  3ZSU A;  2HSQ A;  4D4X A;  1U89 A;  3VM6 A;  1I4Z A;  3NKE A;  1O5H A;  1YZC A;  3GM2 A;  4GQH A;  3Q7L A;  4E7S A;  5CIV A;  3SZR A;  3JZ0 A;  3KKB A;  2HMQ A;  4YL3 A;  2XLV A;  3C8Z A;  4JTA B;  2QNL A;  4JJF A;  3V5Z A;  3NRH A;  2LD6 A;  4YT5 A;  2L6H A;  4Q7C A;  4DXW A;  4BJ6 C;  1E83 A;  3FOO A;  3ABM C;  4OIN F;  2WB7 A;  1OXB A;  2X51 A;  5A6K A;  5B3S C;  5F5F A;  1VYK A;  1VLS A;  1IZM A;  2I8B A;  1PD0 A;  3OWT A;  2IXM A;  3RQG A;  4XPW A;  4G0H A;  1NBB A;  4P9T A;  2J46 A;  3DE9 A;  1OXK A;  2G3V A;  3LLK A;  1HMD A;  3NYJ A;  2OOC A;  3NYM A;  3M1C B;  1QSP A;  3L34 A;  1NFO A;  5HSW A;  3DJU B;  2Q7R A;  3CSK A;  3RKO F;  2HZ8 A;  3IHU A;  3N2Z B;  1ZZP A;  2WZL A;  3DJN B;  4DJ9 A;  1QZX A;  2W45 A;  3W8H A;  3LS1 A;  5DLJ A;  1FFT C;  4CX9 A;  4Q4Z F;  1HE1 A;  1HE9 A;  2W4B A;  3VAY A;  4JW1 A;  1LIH A;  4MVS A;  2IXN A;  2P61 A;  3W2V A;  4YL1 A;  1VYI A;  4IB4 A;  3LS0 A;  1HY5 A;  4PR9 A;  4WGZ A;  4JUR I;  3JSZ A;  3S9O A;  2ETS A;  4BPM A;  3K1I A;  5IY5 C;  5L0J A;  2C04 A;  3RW0 A;  1Z3I X;  2J0W A;  4YL0 A;  1C03 A;  1LPE A;  1OW8 A;  2HS5 A;  4MTG A;  3S29 A;  3TOM A;  5KYW A;  2ASR A;  4B6I A;  4NTB A;  1V4A A;  3TJ6 A;  2GFH A;  2YL0 A;  1XZP A;  3EG9 B;  3H65 A;  4HEA J;  1OR2 A;  1Y4C A;  2XL8 A;  2Q3T A;  3K66 A;  1BR1 A;  5F28 E;  4XLN F;  2A69 F;  5AGF A;  3A11 A;  2KJG A;  3EGD B;  3K1I C;  4JE9 A;  3QVY A;  1N1C A;  1R4T A;  2DB4 A;  2QE9 A;  1L7C A;  1RJ9 A;  1OKK A;  4P9F A;  2BE5 F;  2D5R B;  4M63 A;  2NUP B;  3B9Q A;  3S84 A;  1B68 A;  1A7D A;  1OCO C;  1Z5Z A;  1ZYR F;  2JD3 A;  2R9R B;  2RSE B;  3JSE O;  3L8J A;  5COF A;  5D92 A;  5HV9 A;  2KYH A;  3U0C A;  1YJG A;  1T5O A;  3KYJ A;  2ZXO A;  2XL4 A;  1G4W R;  3ZTZ A;  4JTD B;  2H7V C;  1T01 A;  1WAS A;  1XZQ A;  2LSE A;  3LES A;  3J06 A;  3CZ6 A;  4CS8 C;  1LI7 A;  1K05 A;  5DQZ A;  4G7O F;  3RH3 A;  4YK5 A;  1NU9 C;  2ICW G;  3EH1 A;  4LER A;  1YYX A;  2M64 A;  1D1C A;  3DM5 A;  1WGW A;  2EPL X;  5A6B D;  5GPG B;  3UGO A;  2KNH A;  3KL4 A;  4IAO A;  1MMA A;  2A0U A;  2HKV A;  2FGY A;  5EK0 A;  3SNH A;  3JTL O;  4AL1 A;  2YLD A;  4NTA A;  3W8I A;  1E84 A;  3C8G A;  1RCP A;  1FTS A;  2KQ9 A;  1NLX A;  4J7Y A;  2HFI A;  2A6H F;  3EGX A;  2AWY A;  3Q6M A;  1Z23 A;  3TUL A;  4A4A A;  3ZDL A;  1BBH A;  2EPM X;  1DOW A;  3DXJ F;  2OG2 A;  1VB5 A;  2L9J A;  4NQF A;  4O79 A;  5JSL A;  1TR2 A;  1T9K A;  2XS8 A;  4NCQ A;  4MW3 A;  4I1M A;  4RDA A;  4XPY A;  4MVO A;  1VOM A;  2A68 F;  2IBF A;  3ASN C;  4LAC B;  1G4U S;  4O6M A;  4PAC A;  1SR2 A;  3VYW A;  1U6H A;  2ZPA A;  1BZ4 A;  1ORY A;  3QVZ A;  3U5S A;  3JYH A;  4J7T A;  4EWC A;  2LFF A;  2R7R A;  2Y69 C;  1WTY A;  1YLM A;  3LEV A;  5T1D B;  2OKU A;  3GEI A;  3MYI A;  3GEH A;  1T6I A;  3S0X A;  4U5H A;  3DMD A;  5T3W A;  4E17 A;  5AC5 A;  3S28 A;  3EQL F;  3U3B A;  2I15 A;  1OQC A;  3CAX A;  4CJO A;  2P1A A;  5BQH A;  5DS5 A;  2YEV A;  1Z63 A;  1U0B B;  4XEK A;  1AUE A;  2MWQ A;  4FAP B;  2CCY A;  4IWB A;  1YAU O;  3DE8 A;  4JTC B;  4G7H F;  4C3B A;  2QUP A;  3B0P A;  1Z7Q c;  1NZE A;  4IAR A;  1LKX A;  3K6B A;  3NMJ A;  4EKW A;  1RKE A;  2IXP A;  3WOD F;  1M56 C;  4XWJ A;  1Q0D A;  1OCZ C;  1ZHY A;  2HSB A;  2RD9 A;  1J8M F;  1YZA A;  2VH3 A;  1CGN A;  4JKV A;  3F47 A;  1OCR C;  5KYW B;  4OIP F;  1NFN A;  4BJ1 A;  4FX5 A;  1H6G A;  1TFO B;  3U8V A;  3B0U X;  4QI0 A;  5CI9 A;  3B71 A;  1ZW2 A;  3B29 A;  1Z6A A;  3IQC A;  3HNL A;  4BJ6 A;  4BJT A;  3HTK C;  4MVZ A;  1Q0K A;  1JOG A;  3EHN A;  1TWH A;  4U5C E;  4PK4 A;  5FCL A;  3L8I A;  4N4W A;  4OIO F;  3JRM O;  2HV6 A;  2PP4 A;  3RVY A;  4AK9 A;  1JPN A;  4CBE A;  2L6G A;  1CGO A;  1RMV A;  1ZU4 A;  1IW7 F;  4U5G A;  3PCV A;  4G78 A;  3U2M A;  1UG7 A;  1JR8 A;  3O10 A;  4YJW A;  1Y6D A;  3F46 A;  2HUJ A;  1MMN A;  2XRH A;  4O7G A;  4DBR A;  4MVQ A;  4PJN A;  1O87 A;  2IOQ A;  2LP4 A;  3FVY A;  4E0I A;  1MND A;  4LLE A;  1WOL A;  1YYJ A;  1M2O A;  3KYI A;  2KSF A;  2LQG A;  4OD4 A;  2G3K A;  4MVM A;  3ZWI A;  1Q0M A;  3LLI A;  2V26 A;  3EJN A;  3AG1 C;  2XS1 A;  4DVY P;  5DS6 A;  2GWW A;  4C7O A;  3TJ5 A;  1FMW A;  3C8G B;  2KK1 A;  1A7E A;  1D1A A;  1XWJ A;  256B A;  2DGJ A;  2NPU A;  3L1M A;  4KNV A;  4JC7 A;  4ONS A;  3T6J A;  1WN0 A;  4OIQ F;  2IXO A;  1D0Z A;  1SF8 A;  3EGX B;  2J0X A;  1YA9 A;  4IRU A;  3NMI A;  5COM A;  4E18 A;  1KTM A;  1GGQ A;  4U9E A;  1JRA A;  2TMV P;  3OEO A;  1OW6 A;  2H8A A;  1J8Y F;  2Z15 A;  3EFO A;  3GM3 A;  3G4Z A;  3KMI A;  4O6N A;  4P6I C;  3AQB A;  3AGU A;  2IYL D;  3FHD A;  2AWC A;  4U5F E;  4LDK A;  3LUT B;  4PFO A;  3IQ5 A;  2VAS A;  3H2U A;  5L0H A;  2P7V A;  3NKD A;  3HNK A;  3US6 A;  4E7Z A;  1PV3 A;  3QW0 A;  5KYX A;  4IGG A;  5KYY B;  3C63 A;  4K0D A;  1VMA A;  2YKZ A;  3DZA A;  5B1B C;  1SYQ A;  3FAJ A;  3U3F A;  2EIM C;  4I3M A;  5COG A;  3M4B A;  2JX0 A;  4GYT A;  3C7J A;  4J30 B;  2QTV A;  2MYS A;  3AJM A;  2NUT A;  1EQ1 A;  4A2N B;  5AC4 A;  2G62 A;  4CS8 A;  1Q0G A;  3MYF A;  2MHR A;  3HKK A;  4MND A;  3DM9 B;  1I5N A;  3ITF A;  4ER9 A;  2AP3 A;  5JVE A;  5L0C A;  1FR0 A;  3FAP B;  3X2Q C;  1TQG A;  2GDC A;  2CNW A;  2Q4F A;  4YT8 A;  1FNT c;  1UFB A;  1LE2 A;  1RKE B;  2J7P D;  2XM0 A;  5A6B A;  5L0D A;  4KBL A;  4JCH A;  5JUA A;  3FMS A;  4AX2 A;  3JCU Q;  4CS9 C;  1GQA A;  4MW8 A;  1H9T A;  3EH2 A;  3TOL A;  2EPO A;  2J8W A;  2Y3G A;  4U5E E;  2B0J A;  1YA7 O;  3CEX A;  4R32 A;  2NSG A;  2LIG A;  3V7O A;  2LFD A;  1PCX A;  4X0R A;  2R7O A;  1ZHT A;  1MQV A;  1SMY F;  2OCC C;  3QMK A;  3UMH A;  1DOV A;  3V5X A;  4CDY A;  3B0V C;  1KU2 A;  4DRJ B;  1S7Z A;  5BUO A;  1NSG B;  2F22 A;  2KGO A;  3OA1 A;  3ASO C;  4U5B E;  5E2Q A;  1ORS C;  2PBE A;  1G5Z A;  1C02 A;  5L0I A;  3O55 A;  1AVO B;  3IPM O;  2EIL C;  3RVZ A;  3W2W A;  3TK0 A;  2EPN A;  3I4U A;  3MLG A;  3LNM B;  4ANJ A;  3M15 A;  4NY3 A;  2YLI A;  4N6H A;  1ORJ A;  4EBB A;  2OQM A;  1LM3 B;  2NSF A;  3ECS A;  2J9B A;  3UNG C;  3GOD A;  1M2V A;  5K0I A;  1OCC C;  1CPR A;  4LLC A;  1ZW3 A;  2Q9C A;  2OEX A;  2UUI A;  2CGE A;  3RFY A;  5BQG A;  5L0G A;  1V55 C;  2Y3D A;  3AG4 C;  3VRC A;  3UGP A;  5DVW A;  1E2X A;  2DYR C;  2EIJ C;  3PDM P;  4C7O B;  1C17 M;  3I5Q A;  1MMG A;  3S27 A;  2O9X A;  1A0B A;  2B0H A;  2YL7 A;  2J9W A;  3LAY A;  4IJJ A;  5JRA A;  2P6V A;  5T3T A;  3AG3 C;  3O6X A;  1M57 C;  4RBN A;  1RKC A;  4YWQ A;  4N6C A;  3T6G B;  2XLD A;  4QI2 A;  1EA8 A;  2H7O A;  3JYY A;  4JJG A;  3GWL A;  4PJJ A;  3CQZ A;  1TFK B;  2DI3 A;  3EFO B;  3C8G D;  4MTO A;  5A6J A;  2DYS C;  4G7Z F;  3TQO A;  4RD9 A;  4FWV A;  3WHN A;  4GEH A;  4LDR A;  4H4K C;  1D0Y A;  1YDI A;  2WZG A;  3ZQV A;  3NDB B;  4DRI B;  2R7W A;  2AU5 A;  1EKY A;  4CJG A;  1APC A;  5KYX B;  2VCC A;  5JT4 A;  4PFP A;  2W4M A;  2R7S A;  1TWA A;  1ZHW A;  3NYL A;  1RXQ A;  2A1D D;  5A69 A;  4AE4 A;  1TKN A;  2H7B A;  3ABL C;  1HW1 A;  2AVK A;  2Y39 A;  3ZIB A;  4CIH A;  3DAF A;  2BC5 A;  1KNY A;  4KNW A;  2YVK A;  3EZH A;  4U5D E;  1ZHZ A;  2WZF A;  1JMW A;  2NUT B;  5JLI A;  2XSE A;  4EIY A;  1TWC A;  1RJ9 B;  1H7I A;  2NUP A;  3U9J A;  1YAR O;  3RQE A;  3ZVR A;  4EBK A;  4Z9I A;  2R7Q A;  1QPU A;  3U2L A;  3GOR A;  4HE8 D;  1VTM P;  2NG1 A;  2Q00 A;  2CYD A;  3K7D A;  2XLO A;  3EHM A;  1TWG A;  4HFF B;  1A7V A;  1ZHX A;  1ZU5 A;  3G50 A;  2P0N A;  4K7B A;  3QZC A;  2L81 A;  3RIP A;  2YL3 A;  1LI5 A;  2KC3 A;  3FXH A;  3R7C A;  2YQY A;  3K1H A;  3GAN A;  3NMK A;  2GA0 A;  4BEJ A;  3BRJ A;  5KYU A;  4MS2 A;  5DS4 A;  2R25 A;  4KC9 A;  4CS7 A;  1BR4 A;  2OEV A;  4D4N A;  4MVU A;  3VF0 A;  3AG2 C;  1FAP B;  2YZS A;  4CSA A;  4I1O B;  1LVK A;  4IAQ A;  3X1O A;  4E0H A;  2LCH A;  3AOU A;  2JPU A;  4XEV A;  4PJL A;  1QKR A;  2J45 A;  2GAQ A;  3LJB A;  5E3C A;  1I4Y A;  1G8X A;  2LK4 A;  3S90 A;  4JZA A;  5L0F A;  1Q0F A;  2ZXR A;  2R7T A;  3DI5 A;  1HW2 A;  4K1O A;  1M2V B;  3PHF 2;  5F5H A;  4CSA C;  4KI2 A;  3QTH A;  2YLG A;  3I5P A;  4BJ5 A;  2J9U A;  1CPQ A;  1M6T A;  3BEH A;  3N24 A;  4BEM J;  4Z9H A;  4WGY A;  4DOZ A;  1H9G A;  1T6U A;  2FFH A;  3RF3 A;  3L0I A;  2J7P A;  5B1A C;  1D0X A;  2QY9 A;  3ZQY A;  3ATP A;  5L3V A;  1A41 A;  2XLE A;  1QVX A;  2EIK C;  2CW0 F;  2FAP B;  3E70 C;  4DRH B;  2R03 A;  3DAG A;  4EUK B;  1AEP A;  4CS9 A;  2Y3B A;  2VC9 A;  3K33 A;  1CGM E;  2R05 A;  3NG1 A;  3POV A;  1GM5 A;  3KH2 A;  3FDQ A;  1QLE C;  2OJE D;  4BJ5 C;  4MQ9 F;  3GM1 A;  1ZVZ A;  1MNE A;  2CDQ A;  4J32 B;  4JIO A;  4AL0 A;  4CIP A;  2XL6 A;  3EPV A;  1ST6 A;  1V54 C;  4XEF A;  5E33 A;  3SXK A;  3JRT A;  2UUH A;  3N0T A;  2WVO A;  1PD1 A;  5E3A A;  1D1B A;  1EI7 A;  2M4E A;  2IM8 A;  2XXA A;  2D4U A;  3RQF A;  2PNO A;  3TD7 A;  3V5Y A;  4AE4 B;  2XLW A;  1GS9 A;  5L3Q A;  3DWW A;  4L6R A;  4PJM A;  4EHP A;  2R7V A;  3HJC A;  2YL1 A;  4NC3 A;  3W4Y A;  2PX3 A;  3R2P A;  3SXZ A;  1OR3 A;  1YVI A;  2L6F A;  4C3E A;  4OD5 A;  2Y3H A;  3AQC A;  1W2W A;  2R7X A;  3GEE A;  4HFK B;  2R02 A;  2YHS A;  4QDL A;  3ZG1 A;  3T4R A;  1LS1 A;  1MMD A;  3AGT A;  2KW3 C;  3LNR A;  4WJ0 A;  4NTF A;  3SXY A;  4C3D A;  2BL2 A;  5BQI A;  4O6Y A;  2ZXW C;  1T6Q A;  1OKK D;  4I44 A;  1VLT A;  4WAB A;  4DVZ A;  3ABK C;  1BR2 A;  2XLM A;  2CNW D;  2Q9B A;  3JT1 A;  4YT4 A;  3HNI A;  3UMK A;  2E87 A;  2A0B A;  2VB6 A;  3SEO A;  3SXM A;  5CI8 A;  4ZLD A;  4EBJ A;  2WVQ A;  4XTK A;  5EGY A;  2PX0 A;  3M79 A;  4BG0 A;  5KYU B;  3M4C A;  3DD7 A;  4MVR A;  3LEO A;  1WWP A;  3UMI A;  3WG7 C;  5JS5 A;  3PMR A;  2EPK X;  2XLH A;  3IEE A;  2OU6 A;  5DQT A;  1V74 B;  2W9Y A;  3T9O A;  2HJM A;  3GWN A;  3Q6N A;  2V3C C;  1SZI A;  1VK5 A;  5A6A A;  4N06 A;  2HMZ A;  1F1M A;  3FOP A;  2A6E F;  5JP7 A;  2R7U A;  4JRZ A;  3C18 A;  4ULV A;  2HV7 A;  2PF4 E;  1OW7 A;  4U9D A;  3MBG A;  4JVS A;  1NG1 A;  4LDQ A;  4W8K A;  1K40 A;  3ZTM A;  4XLP F;  3E9V A;  4FES A;  1E86 A;  3IQT A;  2X0C A;  2ZXP A;  1HMO A;  4H54 A;  3SP1 A;  1NU7 D;  4MTF A;  5KYY A;  3RYL A;  3A9C A;  2WL8 A;  2C03 A;  5EHH A;  3UR3 C;  4F4B A;  3EG9 A;  4OIR F;  2Q9A A;  1LS4 A;  2EIN C;  3MX3 A;  4XQ1 A;  3ZC4 A;  4CDA A;  1JPJ A;  4W8P A;  1E85 A;  2HJ3 A;  2L7A A;  2WVN A;  3C62 A;  1LE4 A;  3EGD A;  4JCZ A;  5D91 A;  4Z9J A;  2YRF A;  4DBQ A;  1WAT A;  4Q5S F;  3DKA A;  4JEB A;  3U8P A;  3O39 A;  1O3U A;  1R5I D;  4ZLC A;  3T6B A;  4YN0 B;  2VCB A;  3HLZ A;  2OJQ A;  2PFD A;  1FMV A;  5FZT A;  5KYN A;  4ULW A;  3HNJ A;  4XPX A;  3SYN A;  3IQ6 A; 
#chains in the Genus database with same CATH homology
 2QLA A;  5B3I A;  5JUA A;  3QVZ A;  4CDV A;  1GQA A;  1S05 A;  1JAF A;  3TOL A;  2J8W A;  2YLG A;  1QQ3 A;  4JEA A;  1CPQ A;  1M6T A;  3QW1 A;  2XM4 A;  4WGY A;  1MQV A;  4CDY A;  4D4X A;  3ZQY A;  4CJO A;  2XLE A;  1YZC A;  2CCY A;  3DE8 A;  2XLV A;  1E83 A;  4IAR A;  3FOO A;  3NMJ A;  4CIP A;  2XL6 A;  3M15 A;  2YLI A;  4N6H A;  1LM3 B;  1NBB A;  1YZA A;  1CGN A;  3DE9 A;  4JKV A;  2J9B A;  1CPR A;  3VRC A;  2XLW A;  3HNL A;  4L6R A;  2YL1 A;  2YL7 A;  4NC3 A;  5JRA A;  4N4W A;  4CX9 A;  2XLD A;  1CGO A;  4IB4 A;  4WGZ A;  3ZQV A;  3TOM A;  1EKY A;  4CJG A;  1YYJ A;  1APC A;  2XLM A;  3ZWI A;  5JT4 A;  3HNI A;  2YL0 A;  2XL8 A;  3M79 A;  3M4C A;  5AGF A;  4JE9 A;  2BC5 A;  5JS5 A;  3QVY A;  256B A;  2XLH A;  3L1M A;  5JLI A;  4EIY A;  3NMI A;  3FOP A;  4U9E A;  5JP7 A;  1QPU A;  4ULV A;  4U9D A;  3ZTM A;  3ZTZ A;  2XLO A;  1A7V A;  3IQ5 A;  1E86 A;  2YL3 A;  3HNK A;  3QW0 A;  3C63 A;  1YYX A;  2YKZ A;  3NMK A;  4CDA A;  3M4B A;  1E85 A;  3C62 A;  2YLD A;  1E84 A;  1RCP A;  4D4N A;  4JEB A;  3U8P A;  5JVE A;  4ER9 A;  4IAQ A;  1BBH A;  5JSL A;  3HNJ A;  2XM0 A;  3IQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...