2PNOA

Crystal structure of human leukotriene c4 synthase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
146
structure length
146
Chain Sequence
KDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
publication title Crystal structure of a human membrane protein involved in cysteinyl leukotriene biosynthesis
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 146
sequence length 146
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 2pnoA00
4JCZA 3PCVA 4J7TA 2Q7RA 2H8AA 4AL0A 3DWWA 4YK5A 5BQIA 4WABA 4YL1A 4YL3A 2UUIA 4YL0A 4JRZA 5HV9A 5BQGA 5K0IA 2PNOA 4NTFA 5BQHA 4BPMA 4J7YA 3LEOA 4NTBA 3B29A 4NTAA 3HKKA 4AL1A 4JC7A 2UUHA
chains in the Genus database with same CATH superfamily
1Z7Qc 3C7JA 3C62A 4O6YA 3U2LA 3I5PA 1CGME 3DJUB 3JZ0A 5B3SC 3ZQYA 1RJ9B 2XLWA 2KC3A 4E7SA 1FMVA 2UUIA 4A4AA 2W9YA 2A0UA 3LESA 1J8YF 1Z6AA 1TKNA 4BG0A 5JVEA 1LKXA 1W2WA 5A6JA 2PX0A 1WGWA 3V5ZA 2YLIA 3TOLA 2YZSA 3DAGA 5IY5C 4JKVA 1VYIA 1H6GA 4U5GA 1D1AA 1WTYA 5BUOA 4JEBA 5L3QA 4XEFA 1F1MA 1OXKA 4CSAA 2YWAA 3RKOF 2QY9A 4WJ0A 2EPOA 1T9KA 1LI5A 3LEVA 1T6IA 3GEHA 5T3WA 4IJJA 3U3BA 2OEVA 1E85A 1OCOC 4XPWA 5L3VA 4YK5A 2LFDA 3VF0A 4HEAJ 2X0CA 3W2VA 3JSEO 1OW7A 2LCHA 3NYMA 3PMRA 2ASRA 3ZTZA 1FFTC 3E9VA 3RQGA 1XWJA 2IOQA 2OEXA 2X51A 3BEHA 3G4XA 3IHUA 3JYYA 4CDAA 2DYRC 2H7OA 3Q6NA 1ZU4A 1T6UA 1WATA 3L0IA 4ULWA 1ZHXA 2P7VA 2YL7A 3LJBA 3K66A 4LDQA 4JE9A 1A7EA 1B68A 2L6GA 2YKZA 4NTBA 3TD7A 4D4XA 2W45A 3DAFA 2CGEA 3B0PA 3GM1A 2BC5A 4MNDA 4DOZA 3U5SA 1I5NA 1FMWA 1O5HA 2WVQA 3KKBA 4Q7CA 5L0CA 1VTMP 3LS0A 1RMVA 1VOMA 4EBKA 4N4WA 4HE8D 2CYDA 2XXAA 3GEEA 3HNJA 1BR2A 3SXYA 4BJ6C 1QKRA 3AG2C 3DD7A 1WN0A 2XLEA 2HUJA 1NLXA 2HSBA 3HLZA 4JCHA 4O6MA 1D0XA 2B0JA 5L0IA 1PD0A 1ZZPA 3BRJA 1HW1A 2YLGA 2QUPA 3O39A 4JIOA 3X1OA 3G50A 5B1BC 4AX2A 2Y3DA 4CDYA 1Y6DA 1ORSC 1WASA 2GFHA 4I3MA 2D4UA 4MVMA 3TK0A 4NCQA 4F4BA 1U6HA 2PF4E 2NUTA 3R2PA 2YHSA 2R7RA 1OXBA 2Q9BA 5KYXB 1HMDA 1YVIA 3T6BA 4Q5SF 4C3DA 3V5XA 4JURI 3ITFA 3GWNA 5F5HA 5AC5A 3AG1C 3GODA 3L1MA 2R7QA 1A0BA 3IEEA 4JJGA 2RSEB 4W8KA 2NUTB 5L0GA 5JUAA 1LE4A 1ZHTA 3O6XA 4ULVA 1TWHA 3DWWA 4XWJA 3SXMA 2R03A 3QW1A 3DI5A 4MW3A 3S27A 3R7CA 3ASOC 1K40A 4NC3A 2D5RB 5A6BD 2W4MA 3EH1A 4G0HA 1G4US 1OR3A 1FFHA 1YZAA 3ZSUA 3L34A 1VK5A 1XZQA 1E2XA 2NUPA 4QI2A 1EKYA 1A41A 4BEJA 1SZIA 2XLHA 2J46A 4J30B 4R32A 3FAPB 3NG1A 3TJ6A 2HJ3A 1AVOB 3UMIA 4AE4B 3ZVRA 1LIHA 1GM5A 4U5DE 5DQZA 2FGYA 3PHF2 5KYWA 3AGUA 3GANA 4I1OB 4J32B 2DB4A 2B0HA 4MTOA 4E18A 3M79A 1M57C 4MTGA 2WL8A 3W4YA 5BQIA 3A11A 4N6HA 4C7OA 2A0BA 2BL2A 3QMKA 1Z23A 3EHNA 2Y3BA 3VAYA 3KPHA 2MYSA 2A6HF 3QTHA 4JRZA 3G4ZA 4PFOA 1M56C 4U5HA 3KH2A 3TULA 1VB5A 5DQTA 2PNOA 3V5YA 1WWPA 2L6FA 1M2VA 3ZQVA 2DYSC 2LSEA 3ABLC 5JLIA 1OKKD 2ZXOA 2XS8A 3L8IA 3LS1A 3EFOA 2G3VA 1FAPB 3NMJA 4WGZA 1JMWA 1YYXA 2H7BA 3RYLA 3M1CB 3VRCA 2L9JA 1M6TA 3C18A 4KNVA 3AQCA 1M2VB 1RJ9A 4EBJA 2JD3A 4MVOA 1MNEA 4PR9A 4G78A 1O87A 4CIPA 2OJED 4NY3A 3GEIA 3EFOB 4J7TA 2ZXRA 3U9MA 2C04A 2H8AA 5GPGB 3F46A 5KYNA 1RKEB 4OIPF 2VB6A 3US6A 4NQFA 1CPRA 1SMYF 1T5OA 2LK4A 3FXHA 3WAQA 1H7IA 2HV7A 2NPUA 3MLGA 3SXKA 4XQ1A 4XPXA 4DVYP 4ER9A 3LNRA 4B6IA 1RKCA 1JPNA 2MHRA 1MNDA 1K04A 1S7ZA 3RQEA 1H9GA 1Q0FA 4P9TA 4DRIB 3POVA 3EGXB 1LM3B 2HS5A 4J7YA 5COFA 3O55A 2ZXWC 3EH2A 4JVSA 1H9TA 2JX0A 4CJOA 3GM2A 3HKKA 3NYLA 1FR0A 4EWCA 3EZHA 4JC7A 1ZU5A 4LACB 4CBEA 1R5ID 1D0ZA 2AU5A 1QZXA 2OJQA 3W2WA 2Q9AA 4M63A 3CZ6A 1GGQA 2LD6A 2VCBA 4KNWA 1ZW3A 3DMDA 4LDRA 2R9RB 2V26A 1HMOA 2NSGA 4BJTA 2PP4A 5COGA 1OQCA 1FTSA 2KYHA 3C8GD 3EJNA 3KMIA 4JTAB 2EINC 3SEOA 1FNTc 1ZHWA 2FAPB 4LERA 4C3BA 1EQ1A 1Q0MA 4NTFA 4RBNA 3DXJF 3SXZA 1TFKB 1YLMA 3DKAA 1V55C 4PACA 3EHMA 3ZWIA 1D1CA 2EPLX 3ZIBA 2RD9A 1TR2A 3QVYA 2XLDA 5JSLA 3V7OA 5F28E 4X0RA 4CX9A 2J8WA 1NBBA 2ICWG 1LPEA 1ORJA 2LIGA 3AGTA 1IW7F 2KK1A 4CDVA 2CNWA 1OCRC 2J9BA 2KSFA 2R25A 2EIJC 5EK0A 5TJ5E 1RCPA 2YLDA 4BJ1A 4EIYA 4G7HF 4Z9JA 1CGOA 4JCZA 4U5EE 4PFPA 2XSEA 5AC4A 2YRFA 1YA7O 2J7PA 1WOLA 4PJLA 4K1OA 4FWVA 3UGOA 1APCA 2YL0A 2R7UA 3H2VA 2XS1A 3M4BA 4JTCB 5KYXA 4YWQA 5K0IA 1OCCC 2XM4A 3NMIA 4MVQA 4MTFA 4XTKA 3FAJA 5JT4A 4PK4A 2KGOA 4BPMA 3J06A 1SF8A 5FCLA 4P6IC 3X2QC 2J9WA 2XM0A 2XLVA 3NDBB 1V74B 2IM8A 3QVZA 3NKDA 3DJNB 3MYFA 2PBEA 1NSGB 3ABMC 1NU9C 2C03A 1Z5ZA 2YL1A 3JSZA 3KL4A 4BJ6A 4CIHA 3RFYA 4I44A 4IGGA 1BR4A 3CSKA 4XEVA 4C7OB 5B3IA 2HFIA 4BEMJ 1JAFA 3PCVA 3Q7LA 1KU2A 4OD5A 4OD4A 4AL0A 4CS9C 1ST6A 2Z15A 4MS2A 3Q6MA 2YL3A 2P1AA 2PX3A 4IAQA 2R02A 3JYHA 3U8VA 2R7SA 1AUEA 3E70C 1LS1A 2J0WA 5A6AA 1C17M 2EIMC 5HV9A 2EIKC 1C02A 1QQ3A 3K33A 4PJJA 5DS6A 5CIVA 3RVZA 5JS5A 3H65A 4K0DA 4L6RA 3JCUQ 4AE4A 3S28A 3HJCA 3UMHA 3S84A 2Q9CA 3ASNC 3JRTA 1TFOB 4K7BA 5A6KA 4JJFA 2VASA 3SNHA 3WHNA 1JRAA 1IZMA 2VC9A 1OW8A 2XL4A 2ZD9A 2KW3C 4U5CE 1OW6A 2EPMX 1DOWA 2WZLA 2OCCC 2QLAA 3DE9A 4IARA 3AQBA 3DM9B 3FOPA 2CW0F 1OR2A 4CS9A 3IQ5A 4N06A 3W8HA 2GAQA 2EPNA 3GWLA 3KYJA 4IRUA 2Y3HA 3W8IA 2Q7RA 4WGYA 5KYYB 2M64A 1OCZC 5DS5A 1PD1A 5D91A 1U89A 4DBQA 2BE5F 4YL0A 4E7ZA 1QLEC 4OIQF 4PJMA 3TOMA 3CAXA 1GS9A 1C03A 1LVKA 3QZCA 3T9OA 4E0IA 4E17A 1K05A 2EPKX 5JP7A 2VCAA 3ATPA 4CJGA 4DJ9A 3CEXA 4CS8C 4DRHB 1MMGA 3FDQA 3S9OA 2R7OA 1A7VA 5JRAA 3K6BA 2GDCA 2ZXPA 4IWBA 3S0XA 1RKEA 3GM3A 1HW2A 3RW0A 5DLJA 3MBGA 1MQVA 3EGDA 5CI9A 2YQYA 2YVKA 2KQ9A 2J9UA 3HTKC 3RF3A 1E86A 2CDQA 4U9DA 3LLIA 2QNLA 3EGXA 2H7VC 2XL6A 3A9CA 1L7CA 3LLKA 1R4TA 2WZGA 3JRMO 3L8JA 5KYUA 3NKEA 2R05A 1AEPA 4ANJA 3EGDB 3UR3C 2HZ8A 1QPUA 3NYJA 1PCXA 2AWYA 1LS4A 5T1DB 1TQGA 3T4RA 3T6JA 3C8ZA 4CS7A 3U2MA 4DRJB 3CQZA 5KYUB 3I4UA 2IXMA 3N0TA 2HMQA 4MW8A 5COMA 3B9QA 4G7OF 1YARO 3ZTMA 4JZAA 1Q0KA 4AL1A 1Z63A 3VYWA 4OIRF 2R7XA 3H2UA 2V3CC 2XL8A 3O10A 4MQ9F 1VLSA 2F22A 2XRHA 3MYIA 4GYTA 3TJ5A 1G4WR 4DVZA 2TMVP 1Q0GA 4Q4ZF 2Q4FA 4FESA 1S05A 3ABKC 5E2QA 4YT4A 3AG3C 2P6VA 4WABA 1PV3A 1MMNA 3UGPA 1MMDA 3B71A 5L0DA 3FOOA 1NG1A 4Z9IA 1M2OA 2L6HA 5BQGA 1A7DA 3UMKA 1TWGA 1MMAA 3N24A 3EZIA 5A6BA 4YT8A 1BR1A 1YA9A 2Y3GA 2G3KA 1VMAA 3SYNA 3GORA 3U8PA 4DXWA 4G7ZF 4LLCA 3K1IC 4KI2A 2DGJA 5E3CA 3IQCA 1CPQA 2AP3A 2AVKA 4MVRA 2XLOA 2OG2A 5B1AC 1NZEA 2VCCA 5A69A 3AG4C 1L3PA 4EUKB 2NG1A 2FFHA 4KC9A 2HSQA 4HFKB 2OOCA 3AJMA 3QW0A 2LFFA 3OA1A 4HFFB 4OINF 3FHDA 1D1BA 3N2ZB 2OU6A 4ZLCA 2J45A 2OQMA 1Q0DA 1ZVZA 2WB7A 3NMKA 4ONSA 4PJNA 3Q7GA 4EBBA 3ZC4A 3B0UX 1I4ZA 3K1IA 5AGFA 3SZRA 2IBFA 1GQAA 5D92A 1U0BB 1Y4CA 2Y69C 3FVYA 1DOVA 4LDKA 1OKKA 1UFBA 3S90A 2R7TA 3DE8A 4MVZA 4IAOA 3B0VC 4H4KC 2VH3A 3HNKA 2A68F 3M15A 2Y39A 3IQTA 1HY5A 1LE2A 2A69F 2GA0A 4IB4A 2P0NA 2IXOA 2ZPAA 3ZDLA 1JOGA 1RXQA 1KNYA 1T6QA 2P61A 1G5ZA 2NSFA 2DI3A 1JPJA 2QE9A 3EPVA 4MVSA 3RVYA 2WVOA 4JTDB 5L0JA 1Z3IX 2HKVA 2R7WA 4O7GA 1ZHZA 4YL1A 5EHHA 3F47A 1E83A 4A2NB 2J9VA 4C3EA 2XXAB 2KNHA 4N6CA 4YT5A 1TWAA 1N1CA 2E87A 1CGNA 3UNGC 2IXNA 3LAYA 2IXPA 4P9FA 2I8BA 4RD9A 3DZAA 5E33A 3FMSA 3EQLF 3JTLO 4GQHA 1BBHA 1SR2A 4GEHA 4U5BE 4KBLA 3B29A 3AOUA 3RH3A 2WZFA 2G62A 3IPMO 3EG9A 4U5FE 5L0HA 1EI7A 5CI8A 5KYYA 2XLMA 2MWQA 2PFDA 2JPUA 3I5QA 3S29A 1I4YA 1LI7A 1T01A 1QVXA 1VLTA 1D0YA 1YJGA 1YYJA 2OKUA 1V4AA 3HNIA 1O3UA 1ZHYA 2LP4A 3LUTB 3MX3A 3EG9B 4D4NA 4XLPF 1BDJB 3M4CA 1EA8A 3TQOA 2A6EF 3T6GB 1ZW2A 4YL3A 2W4BA 3C8GA 2WVNA 4MVUA 1J8MF 2L81A 1NFNA 2HJMA 2O9XA 4O79A 1QSPA 1YAUO 2CCYA 5DS4A 1XZPA 1JR8A 1NU7D 4QDLA 4XLNF 4OIOF 4JW1A 1NFOA 4H54A 4EKWA 3C8GB 4NTAA 4BJ5C 2EILC 2QTVA 4EHPA 3IQ6A 4W8PA 1G8XA 4ZLDA 2YEVA 1ORYA 1SYQA 5FZTA 4E0HA 2CNWD 2NUPB 2I15A 1KTMA 4LLEA 2UUHA 2GWWA 2Q00A 2KJGA 2A1DD 3DM5A 4XEKA 3WG7C 5F5FA 3OWTA 3ZG1A 4AK9A 3PDMP 5E3AA 1TWCA 3K7DA 1V54C 2LQGA 3U3FA 2J7PD 3RIPA 4Z9HA 1HE9A 4QI0A 3MFNA 3NRHA 3RQFA 5KYWB 5HSWA 1E84A 5T3TA 4U9EA 3WODF 5DVWA 4YT2A 1BZ4A 3C63A 1ZYRF 2M4EA 3HNLA 3LNMB 4JEAA 3JT1A 3U0CA 4CS8A 3VM6A 5BQHA 2J0XA 1HE1A 3ECSA 1UG7A 4FX5A 4I1MA 4O6NA 2AWCA 4BJ5A 2HMZA 4YJWA 2R7VA 3SP1A 3KYIA 5L0FA 3LEOA 4CSAC 2IYLD 1VYKA 4DBRA 256BA 2L7AA 5EGYA 2Q3TA 4UDVA 2HV6A 2ETSA 4YN0B 1YZCA 1YDIA 3K1HA 3U9JA 3OEOA 4FAPB 4XPYA 4RDAA
chains in the Genus database with same CATH topology
4JCZA 3PCVA 4J7TA 2Q7RA 2H8AA 4AL0A 3DWWA 4YK5A 5BQIA 4WABA 4YL1A 4YL3A 2UUIA 4YL0A 4JRZA 5HV9A 5BQGA 5K0IA 2PNOA 4NTFA 5BQHA 4BPMA 4J7YA 3LEOA 4NTBA 3B29A 4NTAA 3HKKA 4AL1A 4JC7A 2UUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JCZ A;  3PCV A;  4J7T A;  2Q7R A;  2H8A A;  4AL0 A;  3DWW A;  4YK5 A;  5BQI A;  4WAB A;  4YL1 A;  4YL3 A;  2UUI A;  4YL0 A;  4JRZ A;  5HV9 A;  5BQG A;  5K0I A;  2PNO A;  4NTF A;  5BQH A;  4BPM A;  4J7Y A;  3LEO A;  4NTB A;  3B29 A;  4NTA A;  3HKK A;  4AL1 A;  4JC7 A;  2UUH A; 
#chains in the Genus database with same CATH topology
 1Z7Q c;  3C7J A;  3C62 A;  4O6Y A;  3U2L A;  3I5P A;  1CGM E;  3DJU B;  3JZ0 A;  5B3S C;  3ZQY A;  1RJ9 B;  2XLW A;  2KC3 A;  4E7S A;  1FMV A;  2UUI A;  4A4A A;  2W9Y A;  2A0U A;  3LES A;  1J8Y F;  1Z6A A;  1TKN A;  4BG0 A;  5JVE A;  1LKX A;  1W2W A;  5A6J A;  2PX0 A;  1WGW A;  3V5Z A;  2YLI A;  3TOL A;  2YZS A;  3DAG A;  5IY5 C;  4JKV A;  1VYI A;  1H6G A;  4U5G A;  1D1A A;  1WTY A;  5BUO A;  4JEB A;  5L3Q A;  4XEF A;  1F1M A;  1OXK A;  4CSA A;  2YWA A;  3RKO F;  2QY9 A;  4WJ0 A;  2EPO A;  1T9K A;  1LI5 A;  3LEV A;  1T6I A;  3GEH A;  5T3W A;  4IJJ A;  3U3B A;  2OEV A;  1E85 A;  1OCO C;  4XPW A;  5L3V A;  4YK5 A;  2LFD A;  3VF0 A;  4HEA J;  2X0C A;  3W2V A;  3JSE O;  1OW7 A;  2LCH A;  3NYM A;  3PMR A;  2ASR A;  3ZTZ A;  1FFT C;  3E9V A;  3RQG A;  1XWJ A;  2IOQ A;  2OEX A;  2X51 A;  3BEH A;  3G4X A;  3IHU A;  3JYY A;  4CDA A;  2DYR C;  2H7O A;  3Q6N A;  1ZU4 A;  1T6U A;  1WAT A;  3L0I A;  4ULW A;  1ZHX A;  2P7V A;  2YL7 A;  3LJB A;  3K66 A;  4LDQ A;  4JE9 A;  1A7E A;  1B68 A;  2L6G A;  2YKZ A;  4NTB A;  3TD7 A;  4D4X A;  2W45 A;  3DAF A;  2CGE A;  3B0P A;  3GM1 A;  2BC5 A;  4MND A;  4DOZ A;  3U5S A;  1I5N A;  1FMW A;  1O5H A;  2WVQ A;  3KKB A;  4Q7C A;  5L0C A;  1VTM P;  3LS0 A;  1RMV A;  1VOM A;  4EBK A;  4N4W A;  4HE8 D;  2CYD A;  2XXA A;  3GEE A;  3HNJ A;  1BR2 A;  3SXY A;  4BJ6 C;  1QKR A;  3AG2 C;  3DD7 A;  1WN0 A;  2XLE A;  2HUJ A;  1NLX A;  2HSB A;  3HLZ A;  4JCH A;  4O6M A;  1D0X A;  2B0J A;  5L0I A;  1PD0 A;  1ZZP A;  3BRJ A;  1HW1 A;  2YLG A;  2QUP A;  3O39 A;  4JIO A;  3X1O A;  3G50 A;  5B1B C;  4AX2 A;  2Y3D A;  4CDY A;  1Y6D A;  1ORS C;  1WAS A;  2GFH A;  4I3M A;  2D4U A;  4MVM A;  3TK0 A;  4NCQ A;  4F4B A;  1U6H A;  2PF4 E;  2NUT A;  3R2P A;  2YHS A;  2R7R A;  1OXB A;  2Q9B A;  5KYX B;  1HMD A;  1YVI A;  3T6B A;  4Q5S F;  4C3D A;  3V5X A;  4JUR I;  3ITF A;  3GWN A;  5F5H A;  5AC5 A;  3AG1 C;  3GOD A;  3L1M A;  2R7Q A;  1A0B A;  3IEE A;  4JJG A;  2RSE B;  4W8K A;  2NUT B;  5L0G A;  5JUA A;  1LE4 A;  1ZHT A;  3O6X A;  4ULV A;  1TWH A;  3DWW A;  4XWJ A;  3SXM A;  2R03 A;  3QW1 A;  3DI5 A;  4MW3 A;  3S27 A;  3R7C A;  3ASO C;  1K40 A;  4NC3 A;  2D5R B;  5A6B D;  2W4M A;  3EH1 A;  4G0H A;  1G4U S;  1OR3 A;  1FFH A;  1YZA A;  3ZSU A;  3L34 A;  1VK5 A;  1XZQ A;  1E2X A;  2NUP A;  4QI2 A;  1EKY A;  1A41 A;  4BEJ A;  1SZI A;  2XLH A;  2J46 A;  4J30 B;  4R32 A;  3FAP B;  3NG1 A;  3TJ6 A;  2HJ3 A;  1AVO B;  3UMI A;  4AE4 B;  3ZVR A;  1LIH A;  1GM5 A;  4U5D E;  5DQZ A;  2FGY A;  3PHF 2;  5KYW A;  3AGU A;  3GAN A;  4I1O B;  4J32 B;  2DB4 A;  2B0H A;  4MTO A;  4E18 A;  3M79 A;  1M57 C;  4MTG A;  2WL8 A;  3W4Y A;  5BQI A;  3A11 A;  4N6H A;  4C7O A;  2A0B A;  2BL2 A;  3QMK A;  1Z23 A;  3EHN A;  2Y3B A;  3VAY A;  3KPH A;  2MYS A;  2A6H F;  3QTH A;  4JRZ A;  3G4Z A;  4PFO A;  1M56 C;  4U5H A;  3KH2 A;  3TUL A;  1VB5 A;  5DQT A;  2PNO A;  3V5Y A;  1WWP A;  2L6F A;  1M2V A;  3ZQV A;  2DYS C;  2LSE A;  3ABL C;  5JLI A;  1OKK D;  2ZXO A;  2XS8 A;  3L8I A;  3LS1 A;  3EFO A;  2G3V A;  1FAP B;  3NMJ A;  4WGZ A;  1JMW A;  1YYX A;  2H7B A;  3RYL A;  3M1C B;  3VRC A;  2L9J A;  1M6T A;  3C18 A;  4KNV A;  3AQC A;  1M2V B;  1RJ9 A;  4EBJ A;  2JD3 A;  4MVO A;  1MNE A;  4PR9 A;  4G78 A;  1O87 A;  4CIP A;  2OJE D;  4NY3 A;  3GEI A;  3EFO B;  4J7T A;  2ZXR A;  3U9M A;  2C04 A;  2H8A A;  5GPG B;  3F46 A;  5KYN A;  1RKE B;  4OIP F;  2VB6 A;  3US6 A;  4NQF A;  1CPR A;  1SMY F;  1T5O A;  2LK4 A;  3FXH A;  3WAQ A;  1H7I A;  2HV7 A;  2NPU A;  3MLG A;  3SXK A;  4XQ1 A;  4XPX A;  4DVY P;  4ER9 A;  3LNR A;  4B6I A;  1RKC A;  1JPN A;  2MHR A;  1MND A;  1K04 A;  1S7Z A;  3RQE A;  1H9G A;  1Q0F A;  4P9T A;  4DRI B;  3POV A;  3EGX B;  1LM3 B;  2HS5 A;  4J7Y A;  5COF A;  3O55 A;  2ZXW C;  3EH2 A;  4JVS A;  1H9T A;  2JX0 A;  4CJO A;  3GM2 A;  3HKK A;  3NYL A;  1FR0 A;  4EWC A;  3EZH A;  4JC7 A;  1ZU5 A;  4LAC B;  4CBE A;  1R5I D;  1D0Z A;  2AU5 A;  1QZX A;  2OJQ A;  3W2W A;  2Q9A A;  4M63 A;  3CZ6 A;  1GGQ A;  2LD6 A;  2VCB A;  4KNW A;  1ZW3 A;  3DMD A;  4LDR A;  2R9R B;  2V26 A;  1HMO A;  2NSG A;  4BJT A;  2PP4 A;  5COG A;  1OQC A;  1FTS A;  2KYH A;  3C8G D;  3EJN A;  3KMI A;  4JTA B;  2EIN C;  3SEO A;  1FNT c;  1ZHW A;  2FAP B;  4LER A;  4C3B A;  1EQ1 A;  1Q0M A;  4NTF A;  4RBN A;  3DXJ F;  3SXZ A;  1TFK B;  1YLM A;  3DKA A;  1V55 C;  4PAC A;  3EHM A;  3ZWI A;  1D1C A;  2EPL X;  3ZIB A;  2RD9 A;  1TR2 A;  3QVY A;  2XLD A;  5JSL A;  3V7O A;  5F28 E;  4X0R A;  4CX9 A;  2J8W A;  1NBB A;  2ICW G;  1LPE A;  1ORJ A;  2LIG A;  3AGT A;  1IW7 F;  2KK1 A;  4CDV A;  2CNW A;  1OCR C;  2J9B A;  2KSF A;  2R25 A;  2EIJ C;  5EK0 A;  5TJ5 E;  1RCP A;  2YLD A;  4BJ1 A;  4EIY A;  4G7H F;  4Z9J A;  1CGO A;  4JCZ A;  4U5E E;  4PFP A;  2XSE A;  5AC4 A;  2YRF A;  1YA7 O;  2J7P A;  1WOL A;  4PJL A;  4K1O A;  4FWV A;  3UGO A;  1APC A;  2YL0 A;  2R7U A;  3H2V A;  2XS1 A;  3M4B A;  4JTC B;  5KYX A;  4YWQ A;  5K0I A;  1OCC C;  2XM4 A;  3NMI A;  4MVQ A;  4MTF A;  4XTK A;  3FAJ A;  5JT4 A;  4PK4 A;  2KGO A;  4BPM A;  3J06 A;  1SF8 A;  5FCL A;  4P6I C;  3X2Q C;  2J9W A;  2XM0 A;  2XLV A;  3NDB B;  1V74 B;  2IM8 A;  3QVZ A;  3NKD A;  3DJN B;  3MYF A;  2PBE A;  1NSG B;  3ABM C;  1NU9 C;  2C03 A;  1Z5Z A;  2YL1 A;  3JSZ A;  3KL4 A;  4BJ6 A;  4CIH A;  3RFY A;  4I44 A;  4IGG A;  1BR4 A;  3CSK A;  4XEV A;  4C7O B;  5B3I A;  2HFI A;  4BEM J;  1JAF A;  3PCV A;  3Q7L A;  1KU2 A;  4OD5 A;  4OD4 A;  4AL0 A;  4CS9 C;  1ST6 A;  2Z15 A;  4MS2 A;  3Q6M A;  2YL3 A;  2P1A A;  2PX3 A;  4IAQ A;  2R02 A;  3JYH A;  3U8V A;  2R7S A;  1AUE A;  3E70 C;  1LS1 A;  2J0W A;  5A6A A;  1C17 M;  2EIM C;  5HV9 A;  2EIK C;  1C02 A;  1QQ3 A;  3K33 A;  4PJJ A;  5DS6 A;  5CIV A;  3RVZ A;  5JS5 A;  3H65 A;  4K0D A;  4L6R A;  3JCU Q;  4AE4 A;  3S28 A;  3HJC A;  3UMH A;  3S84 A;  2Q9C A;  3ASN C;  3JRT A;  1TFO B;  4K7B A;  5A6K A;  4JJF A;  2VAS A;  3SNH A;  3WHN A;  1JRA A;  1IZM A;  2VC9 A;  1OW8 A;  2XL4 A;  2ZD9 A;  2KW3 C;  4U5C E;  1OW6 A;  2EPM X;  1DOW A;  2WZL A;  2OCC C;  2QLA A;  3DE9 A;  4IAR A;  3AQB A;  3DM9 B;  3FOP A;  2CW0 F;  1OR2 A;  4CS9 A;  3IQ5 A;  4N06 A;  3W8H A;  2GAQ A;  2EPN A;  3GWL A;  3KYJ A;  4IRU A;  2Y3H A;  3W8I A;  2Q7R A;  4WGY A;  5KYY B;  2M64 A;  1OCZ C;  5DS5 A;  1PD1 A;  5D91 A;  1U89 A;  4DBQ A;  2BE5 F;  4YL0 A;  4E7Z A;  1QLE C;  4OIQ F;  4PJM A;  3TOM A;  3CAX A;  1GS9 A;  1C03 A;  1LVK A;  3QZC A;  3T9O A;  4E0I A;  4E17 A;  1K05 A;  2EPK X;  5JP7 A;  2VCA A;  3ATP A;  4CJG A;  4DJ9 A;  3CEX A;  4CS8 C;  4DRH B;  1MMG A;  3FDQ A;  3S9O A;  2R7O A;  1A7V A;  5JRA A;  3K6B A;  2GDC A;  2ZXP A;  4IWB A;  3S0X A;  1RKE A;  3GM3 A;  1HW2 A;  3RW0 A;  5DLJ A;  3MBG A;  1MQV A;  3EGD A;  5CI9 A;  2YQY A;  2YVK A;  2KQ9 A;  2J9U A;  3HTK C;  3RF3 A;  1E86 A;  2CDQ A;  4U9D A;  3LLI A;  2QNL A;  3EGX A;  2H7V C;  2XL6 A;  3A9C A;  1L7C A;  3LLK A;  1R4T A;  2WZG A;  3JRM O;  3L8J A;  5KYU A;  3NKE A;  2R05 A;  1AEP A;  4ANJ A;  3EGD B;  3UR3 C;  2HZ8 A;  1QPU A;  3NYJ A;  1PCX A;  2AWY A;  1LS4 A;  5T1D B;  1TQG A;  3T4R A;  3T6J A;  3C8Z A;  4CS7 A;  3U2M A;  4DRJ B;  3CQZ A;  5KYU B;  3I4U A;  2IXM A;  3N0T A;  2HMQ A;  4MW8 A;  5COM A;  3B9Q A;  4G7O F;  1YAR O;  3ZTM A;  4JZA A;  1Q0K A;  4AL1 A;  1Z63 A;  3VYW A;  4OIR F;  2R7X A;  3H2U A;  2V3C C;  2XL8 A;  3O10 A;  4MQ9 F;  1VLS A;  2F22 A;  2XRH A;  3MYI A;  4GYT A;  3TJ5 A;  1G4W R;  4DVZ A;  2TMV P;  1Q0G A;  4Q4Z F;  2Q4F A;  4FES A;  1S05 A;  3ABK C;  5E2Q A;  4YT4 A;  3AG3 C;  2P6V A;  4WAB A;  1PV3 A;  1MMN A;  3UGP A;  1MMD A;  3B71 A;  5L0D A;  3FOO A;  1NG1 A;  4Z9I A;  1M2O A;  2L6H A;  5BQG A;  1A7D A;  3UMK A;  1TWG A;  1MMA A;  3N24 A;  3EZI A;  5A6B A;  4YT8 A;  1BR1 A;  1YA9 A;  2Y3G A;  2G3K A;  1VMA A;  3SYN A;  3GOR A;  3U8P A;  4DXW A;  4G7Z F;  4LLC A;  3K1I C;  4KI2 A;  2DGJ A;  5E3C A;  3IQC A;  1CPQ A;  2AP3 A;  2AVK A;  4MVR A;  2XLO A;  2OG2 A;  5B1A C;  1NZE A;  2VCC A;  5A69 A;  3AG4 C;  1L3P A;  4EUK B;  2NG1 A;  2FFH A;  4KC9 A;  2HSQ A;  4HFK B;  2OOC A;  3AJM A;  3QW0 A;  2LFF A;  3OA1 A;  4HFF B;  4OIN F;  3FHD A;  1D1B A;  3N2Z B;  2OU6 A;  4ZLC A;  2J45 A;  2OQM A;  1Q0D A;  1ZVZ A;  2WB7 A;  3NMK A;  4ONS A;  4PJN A;  3Q7G A;  4EBB A;  3ZC4 A;  3B0U X;  1I4Z A;  3K1I A;  5AGF A;  3SZR A;  2IBF A;  1GQA A;  5D92 A;  1U0B B;  1Y4C A;  2Y69 C;  3FVY A;  1DOV A;  4LDK A;  1OKK A;  1UFB A;  3S90 A;  2R7T A;  3DE8 A;  4MVZ A;  4IAO A;  3B0V C;  4H4K C;  2VH3 A;  3HNK A;  2A68 F;  3M15 A;  2Y39 A;  3IQT A;  1HY5 A;  1LE2 A;  2A69 F;  2GA0 A;  4IB4 A;  2P0N A;  2IXO A;  2ZPA A;  3ZDL A;  1JOG A;  1RXQ A;  1KNY A;  1T6Q A;  2P61 A;  1G5Z A;  2NSF A;  2DI3 A;  1JPJ A;  2QE9 A;  3EPV A;  4MVS A;  3RVY A;  2WVO A;  4JTD B;  5L0J A;  1Z3I X;  2HKV A;  2R7W A;  4O7G A;  1ZHZ A;  4YL1 A;  5EHH A;  3F47 A;  1E83 A;  4A2N B;  2J9V A;  4C3E A;  2XXA B;  2KNH A;  4N6C A;  4YT5 A;  1TWA A;  1N1C A;  2E87 A;  1CGN A;  3UNG C;  2IXN A;  3LAY A;  2IXP A;  4P9F A;  2I8B A;  4RD9 A;  3DZA A;  5E33 A;  3FMS A;  3EQL F;  3JTL O;  4GQH A;  1BBH A;  1SR2 A;  4GEH A;  4U5B E;  4KBL A;  3B29 A;  3AOU A;  3RH3 A;  2WZF A;  2G62 A;  3IPM O;  3EG9 A;  4U5F E;  5L0H A;  1EI7 A;  5CI8 A;  5KYY A;  2XLM A;  2MWQ A;  2PFD A;  2JPU A;  3I5Q A;  3S29 A;  1I4Y A;  1LI7 A;  1T01 A;  1QVX A;  1VLT A;  1D0Y A;  1YJG A;  1YYJ A;  2OKU A;  1V4A A;  3HNI A;  1O3U A;  1ZHY A;  2LP4 A;  3LUT B;  3MX3 A;  3EG9 B;  4D4N A;  4XLP F;  1BDJ B;  3M4C A;  1EA8 A;  3TQO A;  2A6E F;  3T6G B;  1ZW2 A;  4YL3 A;  2W4B A;  3C8G A;  2WVN A;  4MVU A;  1J8M F;  2L81 A;  1NFN A;  2HJM A;  2O9X A;  4O79 A;  1QSP A;  1YAU O;  2CCY A;  5DS4 A;  1XZP A;  1JR8 A;  1NU7 D;  4QDL A;  4XLN F;  4OIO F;  4JW1 A;  1NFO A;  4H54 A;  4EKW A;  3C8G B;  4NTA A;  4BJ5 C;  2EIL C;  2QTV A;  4EHP A;  3IQ6 A;  4W8P A;  1G8X A;  4ZLD A;  2YEV A;  1ORY A;  1SYQ A;  5FZT A;  4E0H A;  2CNW D;  2NUP B;  2I15 A;  1KTM A;  4LLE A;  2UUH A;  2GWW A;  2Q00 A;  2KJG A;  2A1D D;  3DM5 A;  4XEK A;  3WG7 C;  5F5F A;  3OWT A;  3ZG1 A;  4AK9 A;  3PDM P;  5E3A A;  1TWC A;  3K7D A;  1V54 C;  2LQG A;  3U3F A;  2J7P D;  3RIP A;  4Z9H A;  1HE9 A;  4QI0 A;  3MFN A;  3NRH A;  3RQF A;  5KYW B;  5HSW A;  1E84 A;  5T3T A;  4U9E A;  3WOD F;  5DVW A;  4YT2 A;  1BZ4 A;  3C63 A;  1ZYR F;  2M4E A;  3HNL A;  3LNM B;  4JEA A;  3JT1 A;  3U0C A;  4CS8 A;  3VM6 A;  5BQH A;  2J0X A;  1HE1 A;  3ECS A;  1UG7 A;  4FX5 A;  4I1M A;  4O6N A;  2AWC A;  4BJ5 A;  2HMZ A;  4YJW A;  2R7V A;  3SP1 A;  3KYI A;  5L0F A;  3LEO A;  4CSA C;  2IYL D;  1VYK A;  4DBR A;  256B A;  2L7A A;  5EGY A;  2Q3T A;  4UDV A;  2HV6 A;  2ETS A;  4YN0 B;  1YZC A;  1YDI A;  3K1H A;  3U9J A;  3OEO A;  4FAP B;  4XPY A;  4RDA A; 
#chains in the Genus database with same CATH homology
 4JCZ A;  3PCV A;  4J7T A;  2Q7R A;  2H8A A;  4AL0 A;  3DWW A;  4YK5 A;  5BQI A;  4WAB A;  4YL1 A;  4YL3 A;  2UUI A;  4YL0 A;  4JRZ A;  5HV9 A;  5BQG A;  5K0I A;  2PNO A;  4NTF A;  5BQH A;  4BPM A;  4J7Y A;  3LEO A;  4NTB A;  3B29 A;  4NTA A;  3HKK A;  4AL1 A;  4JC7 A;  2UUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...