2PNOA

Crystal structure of human leukotriene c4 synthase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
146
structure length
146
Chain Sequence
KDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Crystal structure of a human membrane protein involved in cysteinyl leukotriene biosynthesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 58
structure length 146
sequence length 146
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 2pnoA00
3LEOA 4WABA 4YK5A 4JCZA 4YL3A 2H8AA 2Q7RA 5BQIA 4J7TA 3HKKA 4YL1A 2UUHA 4NTFA 4BPMA 5HV9A 4JRZA 4AL1A 4NTBA 5BQHA 4J7YA 4AL0A 3B29A 4YL0A 3PCVA 5K0IA 2UUIA 2PNOA 3DWWA 5BQGA 4JC7A 4NTAA
chains in the Genus database with same CATH superfamily
5KYYA 5JT4A 3SP1A 3RVZA 3ASNC 1BR1A 4O79A 1C02A 3IQ5A 2Q9CA 2LD6A 3IQ6A 4O7GA 2H8AA 1YA7O 3C62A 1OW6A 1VYKA 2GAQA 3Q6NA 4DXWA 1U89A 1SF8A 5A6AA 4U5FE 2J46A 3ASOC 4LLEA 3U3BA 4PR9A 4JRZA 4BG0A 1C17M 4EUKB 5KYUB 2L9JA 3FOPA 1A41A 4GEHA 1E86A 2R7WA 1HW2A 2EIMC 3KYIA 1WN0A 3C7JA 1Q0MA 1EQ1A 4M63A 5B1BC 1TWAA 3GEIA 3NKDA 2FGYA 4XWJA 5BQGA 3UMIA 2XLHA 3T6GB 3GWLA 1GM5A 4EBJA 5E33A 3EH1A 4JEAA 3PDMP 3NYLA 4D4XA 1AUEA 3EJNA 3DAFA 4JJGA 2LIGA 2FFHA 1NLXA 5JVEA 2QTVA 2X51A 4J7TA 3GWNA 3FAJA 4AX2A 1A7VA 2PX0A 3RVYA 2KC3A 3M4CA 3BEHA 1WWPA 3Q7GA 1T6UA 3K1HA 1UFBA 4PFOA 4CS7A 2OEXA 1FTSA 1D0YA 3ZIBA 2LCHA 2PBEA 4B6IA 4YL0A 5DLJA 3I5PA 1VYIA 3LNMB 4MTGA 4OIQF 5K0IA 2NPUA 4Z9IA 2EPOA 3L0IA 2P0NA 3M1CB 1U6HA 4GQHA 1TR2A 1ZHYA 4LDRA 5KYWB 1KTMA 4C3DA 3EH2A 3SXMA 5COGA 3JYYA 3ZSUA 2HFIA 1LI5A 4Z9HA 5CI8A 4C3EA 2VCAA 1OCRC 3W2WA 2MWQA 3AQBA 5L0HA 4G7OF 2WL8A 1M57C 2FAPB 3HNIA 2Q4FA 4ULVA 1SYQA 2XS8A 2XS1A 5JLIA 4MS2A 4PJLA 1WATA 3W2VA 1BZ4A 2XM4A 1T01A 4CDYA 3Q7LA 2B0HA 1VMAA 3RIPA 1I5NA 2KW3C 2LK4A 3CSKA 5D91A 1HE9A 1ORSC 2IXMA 3EFOA 3KPHA 2H7BA 5DVWA 5JSLA 1H7IA 1I4ZA 1WTYA 4KNWA 2XM0A 2BL2A 3TJ6A 5BUOA 3GEHA 5B1AC 3RQEA 3KL4A 4E0IA 2MHRA 2R7QA 5EHHA 2R7UA 2J9BA 1Q0FA 3PMRA 3US6A 2ICWG 1OR3A 1ZVZA 2EILC 2R7TA 4U9EA 4ZLCA 3E70C 3TOMA 3ZC4A 3NMIA 4AE4A 3MX3A 4CSAC 5AC5A 1OW8A 1ZHWA 4JTDB 1U0BB 3EHNA 2YZSA 2XXAB 4DRIB 2HSBA 3H65A 3DM5A 3WAQA 4E7SA 5EK0A 3MLGA 2J9UA 1TWGA 3TD7A 3LNRA 2VC9A 2HKVA 3C63A 3DD7A 3C8GD 4EHPA 4MNDA 1MMGA 2J0XA 2XLOA 1CPQA 3EG9A 3LS0A 1AVOB 4YN0B 3AOUA 3DAGA 3VYWA 4CS9A 1FMVA 4MVOA 4PJMA 1CGNA 4DVYP 3EGXB 4FESA 3SXKA 4CBEA 3RYLA 1FNTc 2H7OA 3O39A 3U2LA 4JC7A 2J7PD 3VM6A 1YJGA 1OCZC 1DOVA 1RKEA 1G4WR 2ZXRA 3HNKA 1FFTC 2QY9A 4MW8A 2LSEA 2WZLA 1N1CA 1XZQA 1RJ9B 2CNWD 2EPNA 1AEPA 2HZ8A 4H54A 4JCZA 3C8GA 4P9TA 2WVOA 4JCHA 2Q7RA 4YT2A 2TMVP 3FHDA 1JRAA 4H4KC 5FZTA 3EGDA 2A0BA 2F22A 4YT5A 3RQGA 1QQ3A 4NTFA 3ZWIA 3IPMO 1V55C 2R7RA 3PHF2 3NG1A 1H9GA 1Q0DA 3ATPA 1Y4CA 3ZVRA 1A7EA 1ZW3A 2IXNA 4U5CE 1K05A 1ZU4A 2J7PA 3TOLA 1NBBA 2PF4E 4MW3A 4CS8A 3G4XA 4WGYA 2Q9AA 3B71A 3B0VC 4GYTA 3GM3A 1EKYA 2UUIA 4BEJA 2CNWA 2VH3A 1NZEA 3GODA 3K33A 1BDJB 4JJFA 3ZG1A 3JRTA 4WGZA 2KYHA 4MQ9F 4U9DA 1YA9A 1O87A 5KYWA 2XXAA 4E7ZA 4EWCA 1OR2A 3LEOA 1PCXA 4N4WA 3W4YA 3M79A 3KYJA 5COFA 3IHUA 4PFPA 5DQZA 2Y3HA 4E0HA 1LS1A 1Z7Qc 4G7HF 4IGGA 3QZCA 3M4BA 1XWJA 4NQFA 4N06A 1D1BA 1D0XA 2Q3TA 1H6GA 3OEOA 4ONSA 2W9YA 1L3PA 1HW1A 4JE9A 4N6HA 3RKOF 1C03A 2I8BA 1ZYRF 4J7YA 2J8WA 2HSQA 5KYXB 1A0BA 3FDQA 2RD9A 4JTCB 1ZZPA 4DJ9A 3O10A 5DS6A 2R05A 1CPRA 3R7CA 1FFHA 3UGOA 2AWYA 3S84A 3JSEO 2AU5A 4XTKA 3F47A 3LESA 5L3QA 1FAPB 3H2UA 2YEVA 3DJNB 3V5XA 1M2VB 2JPUA 4FAPB 3AGUA 1Z23A 2L6HA 5E3AA 1G5ZA 5JUAA 2W4MA 4OIRF 1QLEC 4G7ZF 2YL7A 2ZXWC 5B3SC 1W2WA 3V5ZA 1Q0GA 3UMHA 3S29A 3L8IA 1CGOA 1OKKD 4Z9JA 2VCBA 2Y3BA 1OCOC 3KKBA 3GM1A 4RBNA 2MYSA 2NUTB 4JZAA 1NU7D 3AG3C 3K1IC 4Q4ZF 2DB4A 3CEXA 5CI9A 4EIYA 5DS5A 1O3UA 3GANA 1LPEA 2PNOA 2R7OA 1T9KA 4ZLDA 4C7OB 3QTHA 2PP4A 4O6NA 3UNGC 3VAYA 4E18A 4JTAB 2JD3A 4J30B 3S27A 3HJCA 2CDQA 1MMNA 1APCA 2NUPA 3O55A 5T3TA 1OKKA 4FX5A 3RW0A 3S28A 5L0CA 1TWHA 5KYYB 3FXHA 2CW0F 2XLMA 5COMA 3LUTB 1LIHA 1YARO 3NYMA 3JCUQ 1IW7F 3ZTZA 5EGYA 1TFOB 4LDQA 3U8VA 2LQGA 3L1MA 4W8PA 3B29A 5JS5A 2IBFA 4IB4A 4BJ6C 3RH3A 2V3CC 2L81A 2YL1A 3MYIA 1BR4A 2VB6A 3SYNA 1ZHXA 1TKNA 3EZHA 3LJBA 2G3VA 4NCQA 4XPYA 4EBBA 2EPLX 3T4RA 1V4AA 5IY5C 5CIVA 4NTAA 2XRHA 1B68A 1G8XA 3NRHA 3LLIA 4YK5A 1E83A 1HE1A 3HNJA 1JPJA 2EINC 2AP3A 1OQCA 3O6XA 3RFYA 5BQIA 3TULA 2D4UA 1R5ID 4IRUA 1VB5A 1YYXA 4YL1A 3ABLC 5E3CA 2XLVA 5A6BD 4UDVA 2HMQA 1Z5ZA 2HJMA 1TQGA 2XSEA 1A7DA 2YHSA 3OWTA 4NTBA 3X1OA 1LVKA 2OQMA 1ST6A 3DZAA 3U8PA 1WASA 4A2NB 4AL0A 1LKXA 3NYJA 4MVSA 4BJTA 1SZIA 2XLEA 3Q6MA 2BC5A 4XPXA 1FMWA 2I15A 3NDBB 3C18A 3CAXA 3WG7C 4K1OA 4DBRA 3DWWA 5AC4A 4QDLA 5T3WA 2RSEB 1YZCA 4AK9A 5F5FA 1SR2A 2YL0A 5A69A 1VK5A 3KMIA 1J8YF 1NU9C 5A6BA 3QMKA 2ETSA 2QNLA 2PFDA 3ITFA 3S9OA 3V5YA 4ANJA 2VCCA 5L0FA 4QI2A 1MNEA 1RMVA 2PX3A 3LEVA 4FWVA 1MNDA 1WGWA 3U9MA 2EPKX 2XL6A 4ER9A 5A6KA 5JP7A 5KYUA 1UG7A 2DI3A 5L0GA 4NC3A 4QI0A 3EHMA 3K6BA 2J9VA 1H9TA 1OW7A 1K04A 2AVKA 4KNVA 1JMWA 1QKRA 4IARA 4HE8D 3B9QA 3DXJF 2HMZA 3MBGA 3PCVA 4JW1A 3EFOB 1M6TA 2AWCA 3U9JA 3ZQVA 2Q9BA 4KC9A 4U5EE 4CJOA 3POVA 2XLDA 4OINF 1HMOA 3K1IA 5DS4A 5L3VA 3W8HA 4Q5SF 1ORJA 2A68F 2ZPAA 4R32A 1SMYF 4PJNA 3X2QC 5DQTA 5B3IA 1V54C 4YL3A 3T9OA 2E87A 1MQVA 1NFOA 2J0WA 5A6JA 5L0JA 4AE4B 3VRCA 4OIOF 3DMDA 1LE4A 1NG1A 1XZPA 3LS1A 2XL8A 4IAOA 1YVIA 1S7ZA 4XQ1A 4OD4A 2WB7A 4I44A 2NSGA 2WZFA 2IXPA 2P61A 2G3KA 1Z6AA 3JRMO 4N6CA 4XLNF 4I1MA 2V26A 4XEKA 4BJ6A 2LFDA 3ZTMA 3TJ5A 1QPUA 2NG1A 2Q00A 3EG9B 3JSZA 2IYLD 3H2VA 4JURI 2OJQA 4BEMJ 2OEVA 3RF3A 1JOGA 4K7BA 2P1AA 3M15A 3U3FA 2J45A 4HFKB 4MVQA 1RKEB 1ZW2A 1CGME 4CIPA 2BE5F 5T1DB 2C04A 1YYJA 1TFKB 2R7VA 2R7SA 3N24A 4G78A 1HY5A 2QUPA 4CSAA 3FAPB 3IEEA 2HV7A 1F1MA 1K40A 2L7AA 3C8GB 1ZHTA 4BJ5C 4PACA 4CS9C 5HV9A 4G0HA 4JEBA 4L6RA 3AG1C 3EGDB 1TWCA 3HLZA 4XEVA 2YWAA 3B0PA 4DBQA 4MTOA 1GQAA 3JT1A 3KH2A 1EI7A 2C03A 1NFNA 2A6HF 3TQOA 2NSFA 4W8KA 2CGEA 256BA 3HTKC 2XL4A 1E2XA 4HFFB 4IJJA 4DOZA 1T6IA 3EQLF 4LLCA 3DE8A 2LFFA 2OCCC 4CDAA 4EBKA 2D5RB 3SXYA 4ULWA 2Y39A 2YLDA 3DM9B 2YVKA 4MVMA 4JKVA 2HJ3A 4U5BE 4U5HA 4JIOA 1Q0KA 3A11A 4U5DE 1EA8A 1VOMA 2VASA 2A1DD 3FOOA 1VLTA 4A4AA 2DGJA 4HEAJ 4DVZA 3QW1A 1YAUO 2ASRA 2UUHA 1Y6DA 2WZGA 3IQTA 1JAFA 1NSGB 4CS8C 3U0CA 3CZ6A 3E9VA 5L0IA 1LE2A 1M2OA 2A6EF 4EKWA 2YQYA 5E2QA 1M56C 3T6JA 3EGXA 4KBLA 3J06A 1PD0A 3HNLA 2OG2A 1MMDA 1RXQA 4MTFA 3AQCA 3NKEA 4X0RA 1LI7A 4O6YA 3U5SA 3JYHA 4XPWA 2Y3GA 3UMKA 3T6BA 4PJJA 3WHNA 2W4BA 2GDCA 2KK1A 1RKCA 4DRHB 2QLAA 4MVZA 5JRAA 1OXKA 1RCPA 1RJ9A 1WOLA 2DYRC 2LP4A 2YKZA 3QVZA 4I3MA 4J32B 4O6MA 4CIHA 3AJMA 3ZQYA 4Q7CA 4CJGA 3ABKC 4MVRA 2IM8A 2GWWA 2EIJC 2QE9A 4PK4A 3ECSA 3HKKA 3V7OA 2M4EA 3AG2C 4IWBA 4YT8A 1PD1A 1T6QA 1E84A 3SZRA 3DKAA 4CDVA 2WVNA 1V74B 2R9RB 3SEOA 1BBHA 1L7CA 3FMSA 2G62A 3RQFA 4P6IC 4AL1A 3F46A 2X0CA 3SXZA 3TK0A 1JPNA 2YRFA 3ZDLA 1Z63A 1OCCC 3LLKA 2HUJA 3I5QA 1E85A 2ZD9A 2R7XA 4MVUA 3DI5A 4OIPF 1S05A 3GORA 2KQ9A 1QSPA 1KNYA 2GFHA 3MFNA 4U5GA 1I4YA 4DRJB 1LS4A 3AGTA 4F4BA 3QW0A 2R02A 1T5OA 1HMDA 2YLGA 4YT4A 2R03A 3MYFA 4XEFA 5L0DA 1YZAA 4WABA 2H7VC 2W45A 3UGPA 1QVXA 2ZXPA 3LAYA 1VTMP 2IOQA 2CYDA 2IXOA 2KNHA 3GM2A 2XLWA 3IQCA 3B0UX 2OU6A 2R25A 1VLSA 4K0DA 1D1AA 1Z3IX 3NMJA 2M64A 3NMKA 2KSFA 5TJ5E 3BRJA 1FR0A 2NUPB 3U2MA 4BPMA 2P7VA 5KYXA 3W8IA 3N0TA 3I4UA 2YL3A 3N2ZB 3R2PA 2OOCA 1ZU5A 1MMAA 2WVQA 3K7DA 5F28E 3SNHA 2DYSC 4CX9A 5BQHA 4IAQA 4NY3A 4BJ5A 4E17A 1OXBA 2ZXOA 4OD5A 5AGFA 2A69F 2EIKC 3UR3C 2B0JA 2Z15A 4YJWA 1KU2A 1YDIA 5KYNA 1ZHZA 3JZ0A 3DE9A 2Y69C 3JTLO 4LDKA 1G4US 1M2VA 3C8ZA 2P6VA 1PV3A 3K66A 3S0XA 2J9WA 5D92A 4YWQA 2OKUA 1DOWA 1D1CA 1GS9A 3EPVA 3L8JA 4I1OB 4LACB 1J8MF 2HS5A 4RDAA 2EPMX 1D0ZA 4RD9A 1BR2A 2GA0A 3OA1A 2KGOA 2O9XA 4KI2A 1LM3B 3DJUB 2L6FA 5GPGB 1ORYA 3ABMC 4JVSA 4BJ1A 3QVYA 1JR8A 5HSWA 2NUTA 3CQZA 3G4ZA 3A9CA 3AG4C 2CCYA 4WJ0A 2KJGA 2Y3DA 1O5HA 4LERA 4C3BA 2HV6A 2JX0A 1R4TA 2A0UA 2L6GA 1GGQA 3EZIA 4P9FA 4XLPF 4C7OA 3WODF 5FCLA 3FVYA 3GEEA 3L34A 5F5HA 1QZXA 1YLMA 2OJED 3VF0A 3G50A 3S90A 1IZMA 4D4NA 2YLIA
chains in the Genus database with same CATH topology
3LEOA 4WABA 4YK5A 4JCZA 4YL3A 2H8AA 2Q7RA 5BQIA 4J7TA 3HKKA 4YL1A 2UUHA 4NTFA 4BPMA 5HV9A 4JRZA 4AL1A 4NTBA 5BQHA 4J7YA 4AL0A 3B29A 4YL0A 3PCVA 5K0IA 2UUIA 2PNOA 3DWWA 5BQGA 4JC7A 4NTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEO A;  4WAB A;  4YK5 A;  4JCZ A;  4YL3 A;  2H8A A;  2Q7R A;  5BQI A;  4J7T A;  3HKK A;  4YL1 A;  2UUH A;  4NTF A;  4BPM A;  5HV9 A;  4JRZ A;  4AL1 A;  4NTB A;  5BQH A;  4J7Y A;  4AL0 A;  3B29 A;  4YL0 A;  3PCV A;  5K0I A;  2UUI A;  2PNO A;  3DWW A;  5BQG A;  4JC7 A;  4NTA A; 
#chains in the Genus database with same CATH topology
 5KYY A;  5JT4 A;  3SP1 A;  3RVZ A;  3ASN C;  1BR1 A;  4O79 A;  1C02 A;  3IQ5 A;  2Q9C A;  2LD6 A;  3IQ6 A;  4O7G A;  2H8A A;  1YA7 O;  3C62 A;  1OW6 A;  1VYK A;  2GAQ A;  3Q6N A;  4DXW A;  1U89 A;  1SF8 A;  5A6A A;  4U5F E;  2J46 A;  3ASO C;  4LLE A;  3U3B A;  4PR9 A;  4JRZ A;  4BG0 A;  1C17 M;  4EUK B;  5KYU B;  2L9J A;  3FOP A;  1A41 A;  4GEH A;  1E86 A;  2R7W A;  1HW2 A;  2EIM C;  3KYI A;  1WN0 A;  3C7J A;  1Q0M A;  1EQ1 A;  4M63 A;  5B1B C;  1TWA A;  3GEI A;  3NKD A;  2FGY A;  4XWJ A;  5BQG A;  3UMI A;  2XLH A;  3T6G B;  3GWL A;  1GM5 A;  4EBJ A;  5E33 A;  3EH1 A;  4JEA A;  3PDM P;  3NYL A;  4D4X A;  1AUE A;  3EJN A;  3DAF A;  4JJG A;  2LIG A;  2FFH A;  1NLX A;  5JVE A;  2QTV A;  2X51 A;  4J7T A;  3GWN A;  3FAJ A;  4AX2 A;  1A7V A;  2PX0 A;  3RVY A;  2KC3 A;  3M4C A;  3BEH A;  1WWP A;  3Q7G A;  1T6U A;  3K1H A;  1UFB A;  4PFO A;  4CS7 A;  2OEX A;  1FTS A;  1D0Y A;  3ZIB A;  2LCH A;  2PBE A;  4B6I A;  4YL0 A;  5DLJ A;  3I5P A;  1VYI A;  3LNM B;  4MTG A;  4OIQ F;  5K0I A;  2NPU A;  4Z9I A;  2EPO A;  3L0I A;  2P0N A;  3M1C B;  1U6H A;  4GQH A;  1TR2 A;  1ZHY A;  4LDR A;  5KYW B;  1KTM A;  4C3D A;  3EH2 A;  3SXM A;  5COG A;  3JYY A;  3ZSU A;  2HFI A;  1LI5 A;  4Z9H A;  5CI8 A;  4C3E A;  2VCA A;  1OCR C;  3W2W A;  2MWQ A;  3AQB A;  5L0H A;  4G7O F;  2WL8 A;  1M57 C;  2FAP B;  3HNI A;  2Q4F A;  4ULV A;  1SYQ A;  2XS8 A;  2XS1 A;  5JLI A;  4MS2 A;  4PJL A;  1WAT A;  3W2V A;  1BZ4 A;  2XM4 A;  1T01 A;  4CDY A;  3Q7L A;  2B0H A;  1VMA A;  3RIP A;  1I5N A;  2KW3 C;  2LK4 A;  3CSK A;  5D91 A;  1HE9 A;  1ORS C;  2IXM A;  3EFO A;  3KPH A;  2H7B A;  5DVW A;  5JSL A;  1H7I A;  1I4Z A;  1WTY A;  4KNW A;  2XM0 A;  2BL2 A;  3TJ6 A;  5BUO A;  3GEH A;  5B1A C;  3RQE A;  3KL4 A;  4E0I A;  2MHR A;  2R7Q A;  5EHH A;  2R7U A;  2J9B A;  1Q0F A;  3PMR A;  3US6 A;  2ICW G;  1OR3 A;  1ZVZ A;  2EIL C;  2R7T A;  4U9E A;  4ZLC A;  3E70 C;  3TOM A;  3ZC4 A;  3NMI A;  4AE4 A;  3MX3 A;  4CSA C;  5AC5 A;  1OW8 A;  1ZHW A;  4JTD B;  1U0B B;  3EHN A;  2YZS A;  2XXA B;  4DRI B;  2HSB A;  3H65 A;  3DM5 A;  3WAQ A;  4E7S A;  5EK0 A;  3MLG A;  2J9U A;  1TWG A;  3TD7 A;  3LNR A;  2VC9 A;  2HKV A;  3C63 A;  3DD7 A;  3C8G D;  4EHP A;  4MND A;  1MMG A;  2J0X A;  2XLO A;  1CPQ A;  3EG9 A;  3LS0 A;  1AVO B;  4YN0 B;  3AOU A;  3DAG A;  3VYW A;  4CS9 A;  1FMV A;  4MVO A;  4PJM A;  1CGN A;  4DVY P;  3EGX B;  4FES A;  3SXK A;  4CBE A;  3RYL A;  1FNT c;  2H7O A;  3O39 A;  3U2L A;  4JC7 A;  2J7P D;  3VM6 A;  1YJG A;  1OCZ C;  1DOV A;  1RKE A;  1G4W R;  2ZXR A;  3HNK A;  1FFT C;  2QY9 A;  4MW8 A;  2LSE A;  2WZL A;  1N1C A;  1XZQ A;  1RJ9 B;  2CNW D;  2EPN A;  1AEP A;  2HZ8 A;  4H54 A;  4JCZ A;  3C8G A;  4P9T A;  2WVO A;  4JCH A;  2Q7R A;  4YT2 A;  2TMV P;  3FHD A;  1JRA A;  4H4K C;  5FZT A;  3EGD A;  2A0B A;  2F22 A;  4YT5 A;  3RQG A;  1QQ3 A;  4NTF A;  3ZWI A;  3IPM O;  1V55 C;  2R7R A;  3PHF 2;  3NG1 A;  1H9G A;  1Q0D A;  3ATP A;  1Y4C A;  3ZVR A;  1A7E A;  1ZW3 A;  2IXN A;  4U5C E;  1K05 A;  1ZU4 A;  2J7P A;  3TOL A;  1NBB A;  2PF4 E;  4MW3 A;  4CS8 A;  3G4X A;  4WGY A;  2Q9A A;  3B71 A;  3B0V C;  4GYT A;  3GM3 A;  1EKY A;  2UUI A;  4BEJ A;  2CNW A;  2VH3 A;  1NZE A;  3GOD A;  3K33 A;  1BDJ B;  4JJF A;  3ZG1 A;  3JRT A;  4WGZ A;  2KYH A;  4MQ9 F;  4U9D A;  1YA9 A;  1O87 A;  5KYW A;  2XXA A;  4E7Z A;  4EWC A;  1OR2 A;  3LEO A;  1PCX A;  4N4W A;  3W4Y A;  3M79 A;  3KYJ A;  5COF A;  3IHU A;  4PFP A;  5DQZ A;  2Y3H A;  4E0H A;  1LS1 A;  1Z7Q c;  4G7H F;  4IGG A;  3QZC A;  3M4B A;  1XWJ A;  4NQF A;  4N06 A;  1D1B A;  1D0X A;  2Q3T A;  1H6G A;  3OEO A;  4ONS A;  2W9Y A;  1L3P A;  1HW1 A;  4JE9 A;  4N6H A;  3RKO F;  1C03 A;  2I8B A;  1ZYR F;  4J7Y A;  2J8W A;  2HSQ A;  5KYX B;  1A0B A;  3FDQ A;  2RD9 A;  4JTC B;  1ZZP A;  4DJ9 A;  3O10 A;  5DS6 A;  2R05 A;  1CPR A;  3R7C A;  1FFH A;  3UGO A;  2AWY A;  3S84 A;  3JSE O;  2AU5 A;  4XTK A;  3F47 A;  3LES A;  5L3Q A;  1FAP B;  3H2U A;  2YEV A;  3DJN B;  3V5X A;  1M2V B;  2JPU A;  4FAP B;  3AGU A;  1Z23 A;  2L6H A;  5E3A A;  1G5Z A;  5JUA A;  2W4M A;  4OIR F;  1QLE C;  4G7Z F;  2YL7 A;  2ZXW C;  5B3S C;  1W2W A;  3V5Z A;  1Q0G A;  3UMH A;  3S29 A;  3L8I A;  1CGO A;  1OKK D;  4Z9J A;  2VCB A;  2Y3B A;  1OCO C;  3KKB A;  3GM1 A;  4RBN A;  2MYS A;  2NUT B;  4JZA A;  1NU7 D;  3AG3 C;  3K1I C;  4Q4Z F;  2DB4 A;  3CEX A;  5CI9 A;  4EIY A;  5DS5 A;  1O3U A;  3GAN A;  1LPE A;  2PNO A;  2R7O A;  1T9K A;  4ZLD A;  4C7O B;  3QTH A;  2PP4 A;  4O6N A;  3UNG C;  3VAY A;  4E18 A;  4JTA B;  2JD3 A;  4J30 B;  3S27 A;  3HJC A;  2CDQ A;  1MMN A;  1APC A;  2NUP A;  3O55 A;  5T3T A;  1OKK A;  4FX5 A;  3RW0 A;  3S28 A;  5L0C A;  1TWH A;  5KYY B;  3FXH A;  2CW0 F;  2XLM A;  5COM A;  3LUT B;  1LIH A;  1YAR O;  3NYM A;  3JCU Q;  1IW7 F;  3ZTZ A;  5EGY A;  1TFO B;  4LDQ A;  3U8V A;  2LQG A;  3L1M A;  4W8P A;  3B29 A;  5JS5 A;  2IBF A;  4IB4 A;  4BJ6 C;  3RH3 A;  2V3C C;  2L81 A;  2YL1 A;  3MYI A;  1BR4 A;  2VB6 A;  3SYN A;  1ZHX A;  1TKN A;  3EZH A;  3LJB A;  2G3V A;  4NCQ A;  4XPY A;  4EBB A;  2EPL X;  3T4R A;  1V4A A;  5IY5 C;  5CIV A;  4NTA A;  2XRH A;  1B68 A;  1G8X A;  3NRH A;  3LLI A;  4YK5 A;  1E83 A;  1HE1 A;  3HNJ A;  1JPJ A;  2EIN C;  2AP3 A;  1OQC A;  3O6X A;  3RFY A;  5BQI A;  3TUL A;  2D4U A;  1R5I D;  4IRU A;  1VB5 A;  1YYX A;  4YL1 A;  3ABL C;  5E3C A;  2XLV A;  5A6B D;  4UDV A;  2HMQ A;  1Z5Z A;  2HJM A;  1TQG A;  2XSE A;  1A7D A;  2YHS A;  3OWT A;  4NTB A;  3X1O A;  1LVK A;  2OQM A;  1ST6 A;  3DZA A;  3U8P A;  1WAS A;  4A2N B;  4AL0 A;  1LKX A;  3NYJ A;  4MVS A;  4BJT A;  1SZI A;  2XLE A;  3Q6M A;  2BC5 A;  4XPX A;  1FMW A;  2I15 A;  3NDB B;  3C18 A;  3CAX A;  3WG7 C;  4K1O A;  4DBR A;  3DWW A;  5AC4 A;  4QDL A;  5T3W A;  2RSE B;  1YZC A;  4AK9 A;  5F5F A;  1SR2 A;  2YL0 A;  5A69 A;  1VK5 A;  3KMI A;  1J8Y F;  1NU9 C;  5A6B A;  3QMK A;  2ETS A;  2QNL A;  2PFD A;  3ITF A;  3S9O A;  3V5Y A;  4ANJ A;  2VCC A;  5L0F A;  4QI2 A;  1MNE A;  1RMV A;  2PX3 A;  3LEV A;  4FWV A;  1MND A;  1WGW A;  3U9M A;  2EPK X;  2XL6 A;  4ER9 A;  5A6K A;  5JP7 A;  5KYU A;  1UG7 A;  2DI3 A;  5L0G A;  4NC3 A;  4QI0 A;  3EHM A;  3K6B A;  2J9V A;  1H9T A;  1OW7 A;  1K04 A;  2AVK A;  4KNV A;  1JMW A;  1QKR A;  4IAR A;  4HE8 D;  3B9Q A;  3DXJ F;  2HMZ A;  3MBG A;  3PCV A;  4JW1 A;  3EFO B;  1M6T A;  2AWC A;  3U9J A;  3ZQV A;  2Q9B A;  4KC9 A;  4U5E E;  4CJO A;  3POV A;  2XLD A;  4OIN F;  1HMO A;  3K1I A;  5DS4 A;  5L3V A;  3W8H A;  4Q5S F;  1ORJ A;  2A68 F;  2ZPA A;  4R32 A;  1SMY F;  4PJN A;  3X2Q C;  5DQT A;  5B3I A;  1V54 C;  4YL3 A;  3T9O A;  2E87 A;  1MQV A;  1NFO A;  2J0W A;  5A6J A;  5L0J A;  4AE4 B;  3VRC A;  4OIO F;  3DMD A;  1LE4 A;  1NG1 A;  1XZP A;  3LS1 A;  2XL8 A;  4IAO A;  1YVI A;  1S7Z A;  4XQ1 A;  4OD4 A;  2WB7 A;  4I44 A;  2NSG A;  2WZF A;  2IXP A;  2P61 A;  2G3K A;  1Z6A A;  3JRM O;  4N6C A;  4XLN F;  4I1M A;  2V26 A;  4XEK A;  4BJ6 A;  2LFD A;  3ZTM A;  3TJ5 A;  1QPU A;  2NG1 A;  2Q00 A;  3EG9 B;  3JSZ A;  2IYL D;  3H2V A;  4JUR I;  2OJQ A;  4BEM J;  2OEV A;  3RF3 A;  1JOG A;  4K7B A;  2P1A A;  3M15 A;  3U3F A;  2J45 A;  4HFK B;  4MVQ A;  1RKE B;  1ZW2 A;  1CGM E;  4CIP A;  2BE5 F;  5T1D B;  2C04 A;  1YYJ A;  1TFK B;  2R7V A;  2R7S A;  3N24 A;  4G78 A;  1HY5 A;  2QUP A;  4CSA A;  3FAP B;  3IEE A;  2HV7 A;  1F1M A;  1K40 A;  2L7A A;  3C8G B;  1ZHT A;  4BJ5 C;  4PAC A;  4CS9 C;  5HV9 A;  4G0H A;  4JEB A;  4L6R A;  3AG1 C;  3EGD B;  1TWC A;  3HLZ A;  4XEV A;  2YWA A;  3B0P A;  4DBQ A;  4MTO A;  1GQA A;  3JT1 A;  3KH2 A;  1EI7 A;  2C03 A;  1NFN A;  2A6H F;  3TQO A;  2NSF A;  4W8K A;  2CGE A;  256B A;  3HTK C;  2XL4 A;  1E2X A;  4HFF B;  4IJJ A;  4DOZ A;  1T6I A;  3EQL F;  4LLC A;  3DE8 A;  2LFF A;  2OCC C;  4CDA A;  4EBK A;  2D5R B;  3SXY A;  4ULW A;  2Y39 A;  2YLD A;  3DM9 B;  2YVK A;  4MVM A;  4JKV A;  2HJ3 A;  4U5B E;  4U5H A;  4JIO A;  1Q0K A;  3A11 A;  4U5D E;  1EA8 A;  1VOM A;  2VAS A;  2A1D D;  3FOO A;  1VLT A;  4A4A A;  2DGJ A;  4HEA J;  4DVZ A;  3QW1 A;  1YAU O;  2ASR A;  2UUH A;  1Y6D A;  2WZG A;  3IQT A;  1JAF A;  1NSG B;  4CS8 C;  3U0C A;  3CZ6 A;  3E9V A;  5L0I A;  1LE2 A;  1M2O A;  2A6E F;  4EKW A;  2YQY A;  5E2Q A;  1M56 C;  3T6J A;  3EGX A;  4KBL A;  3J06 A;  1PD0 A;  3HNL A;  2OG2 A;  1MMD A;  1RXQ A;  4MTF A;  3AQC A;  3NKE A;  4X0R A;  1LI7 A;  4O6Y A;  3U5S A;  3JYH A;  4XPW A;  2Y3G A;  3UMK A;  3T6B A;  4PJJ A;  3WHN A;  2W4B A;  2GDC A;  2KK1 A;  1RKC A;  4DRH B;  2QLA A;  4MVZ A;  5JRA A;  1OXK A;  1RCP A;  1RJ9 A;  1WOL A;  2DYR C;  2LP4 A;  2YKZ A;  3QVZ A;  4I3M A;  4J32 B;  4O6M A;  4CIH A;  3AJM A;  3ZQY A;  4Q7C A;  4CJG A;  3ABK C;  4MVR A;  2IM8 A;  2GWW A;  2EIJ C;  2QE9 A;  4PK4 A;  3ECS A;  3HKK A;  3V7O A;  2M4E A;  3AG2 C;  4IWB A;  4YT8 A;  1PD1 A;  1T6Q A;  1E84 A;  3SZR A;  3DKA A;  4CDV A;  2WVN A;  1V74 B;  2R9R B;  3SEO A;  1BBH A;  1L7C A;  3FMS A;  2G62 A;  3RQF A;  4P6I C;  4AL1 A;  3F46 A;  2X0C A;  3SXZ A;  3TK0 A;  1JPN A;  2YRF A;  3ZDL A;  1Z63 A;  1OCC C;  3LLK A;  2HUJ A;  3I5Q A;  1E85 A;  2ZD9 A;  2R7X A;  4MVU A;  3DI5 A;  4OIP F;  1S05 A;  3GOR A;  2KQ9 A;  1QSP A;  1KNY A;  2GFH A;  3MFN A;  4U5G A;  1I4Y A;  4DRJ B;  1LS4 A;  3AGT A;  4F4B A;  3QW0 A;  2R02 A;  1T5O A;  1HMD A;  2YLG A;  4YT4 A;  2R03 A;  3MYF A;  4XEF A;  5L0D A;  1YZA A;  4WAB A;  2H7V C;  2W45 A;  3UGP A;  1QVX A;  2ZXP A;  3LAY A;  1VTM P;  2IOQ A;  2CYD A;  2IXO A;  2KNH A;  3GM2 A;  2XLW A;  3IQC A;  3B0U X;  2OU6 A;  2R25 A;  1VLS A;  4K0D A;  1D1A A;  1Z3I X;  3NMJ A;  2M64 A;  3NMK A;  2KSF A;  5TJ5 E;  3BRJ A;  1FR0 A;  2NUP B;  3U2M A;  4BPM A;  2P7V A;  5KYX A;  3W8I A;  3N0T A;  3I4U A;  2YL3 A;  3N2Z B;  3R2P A;  2OOC A;  1ZU5 A;  1MMA A;  2WVQ A;  3K7D A;  5F28 E;  3SNH A;  2DYS C;  4CX9 A;  5BQH A;  4IAQ A;  4NY3 A;  4BJ5 A;  4E17 A;  1OXB A;  2ZXO A;  4OD5 A;  5AGF A;  2A69 F;  2EIK C;  3UR3 C;  2B0J A;  2Z15 A;  4YJW A;  1KU2 A;  1YDI A;  5KYN A;  1ZHZ A;  3JZ0 A;  3DE9 A;  2Y69 C;  3JTL O;  4LDK A;  1G4U S;  1M2V A;  3C8Z A;  2P6V A;  1PV3 A;  3K66 A;  3S0X A;  2J9W A;  5D92 A;  4YWQ A;  2OKU A;  1DOW A;  1D1C A;  1GS9 A;  3EPV A;  3L8J A;  4I1O B;  4LAC B;  1J8M F;  2HS5 A;  4RDA A;  2EPM X;  1D0Z A;  4RD9 A;  1BR2 A;  2GA0 A;  3OA1 A;  2KGO A;  2O9X A;  4KI2 A;  1LM3 B;  3DJU B;  2L6F A;  5GPG B;  1ORY A;  3ABM C;  4JVS A;  4BJ1 A;  3QVY A;  1JR8 A;  5HSW A;  2NUT A;  3CQZ A;  3G4Z A;  3A9C A;  3AG4 C;  2CCY A;  4WJ0 A;  2KJG A;  2Y3D A;  1O5H A;  4LER A;  4C3B A;  2HV6 A;  2JX0 A;  1R4T A;  2A0U A;  2L6G A;  1GGQ A;  3EZI A;  4P9F A;  4XLP F;  4C7O A;  3WOD F;  5FCL A;  3FVY A;  3GEE A;  3L34 A;  5F5H A;  1QZX A;  1YLM A;  2OJE D;  3VF0 A;  3G50 A;  3S90 A;  1IZM A;  4D4N A;  2YLI A; 
#chains in the Genus database with same CATH homology
 3LEO A;  4WAB A;  4YK5 A;  4JCZ A;  4YL3 A;  2H8A A;  2Q7R A;  5BQI A;  4J7T A;  3HKK A;  4YL1 A;  2UUH A;  4NTF A;  4BPM A;  5HV9 A;  4JRZ A;  4AL1 A;  4NTB A;  5BQH A;  4J7Y A;  4AL0 A;  3B29 A;  4YL0 A;  3PCV A;  5K0I A;  2UUI A;  2PNO A;  3DWW A;  5BQG A;  4JC7 A;  4NTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...