2PNOA

Crystal structure of human leukotriene c4 synthase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
146
structure length
146
Chain Sequence
KDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a human membrane protein involved in cysteinyl leukotriene biosynthesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
total genus 58
structure length 146
sequence length 146
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 2pnoA00
4YL1A 5BQGA 4YK5A 2Q7RA 4NTFA 4JRZA 4AL0A 5BQIA 4BPMA 4NTAA 5K0IA 2PNOA 4YL3A 3HKKA 4JCZA 3PCVA 5HV9A 4J7YA 3LEOA 4NTBA 4WABA 2H8AA 2UUHA 4JC7A 5BQHA 4AL1A 4YL0A 2UUIA 3B29A 3DWWA 4J7TA
chains in the Genus database with same CATH superfamily
3W8IA 2YL1A 2ICWG 3EGDA 4MW8A 1LPEA 4WGZA 5JP7A 5A6AA 5GPGB 5EGYA 3M1CB 1YYJA 2J46A 4MW3A 5DS5A 2XS1A 1VLSA 1TWHA 2G62A 2CW0F 2XM0A 2LCHA 3LNMB 3W2WA 1F1MA 2ZXOA 3C8GA 3AG4C 4JW1A 4KNVA 3JTLO 4MVMA 3TK0A 4ER9A 2J45A 2P0NA 3JRTA 3JSZA 1RXQA 3X2QC 4BJ6C 1OXKA 2A6HF 4DRJB 4O6MA 1M57C 2ASRA 4YL3A 3ZWIA 2WVNA 2XSEA 3O55A 2CGEA 3PDMP 4M63A 4CBEA 5HSWA 4QI2A 2Y3BA 2AP3A 3RH3A 1L3PA 1OCZC 3VF0A 2L9JA 3H2VA 3WHNA 3S0XA 4LERA 1FFTC 3T6JA 4YL0A 3DJNB 1GGQA 1ZW2A 3L1MA 4AK9A 4G7HF 5JUAA 1G5ZA 2A6EF 2I15A 4U5DE 1HMOA 4IAOA 2X0CA 3ZSUA 2R7UA 5AC5A 1WN0A 3I4UA 1UFBA 4NCQA 4U5FE 1Z3IX 4IRUA 2QUPA 2VCCA 4AL0A 5A6KA 2XRHA 3C63A 2AVKA 4BPMA 2YLGA 2B0JA 3AG3C 3ITFA 4N6CA 2P7VA 1DOVA 1GS9A 1D0XA 4K0DA 1K05A 5HV9A 3G50A 4NTBA 3ZDLA 3BEHA 4EUKB 1Z5ZA 2YLDA 3I5PA 3DWWA 1CGNA 1JPNA 3NYLA 1FFHA 3QTHA 3T9OA 5L3VA 4XEVA 1ZZPA 2VCBA 1YYXA 2EILC 3FXHA 2ZXRA 4B6IA 4YT5A 4PACA 2CCYA 1SMYF 2KYHA 3KH2A 3TJ6A 2D4UA 3FOOA 1Y4CA 4N06A 4KNWA 2EIKC 3DM9B 2XLDA 1C03A 1QQ3A 1WGWA 1ZHXA 1NU9C 3NRHA 4P6IC 3QVYA 3HNIA 2LFFA 1CPRA 1OXBA 1MMAA 2VC9A 4G0HA 4CJOA 3JYYA 2VASA 3M15A 4JCZA 2OOCA 4C7OA 1AVOB 2NUTA 4JC7A 4WGYA 3EH2A 1KU2A 4BJ5C 3LEVA 3EZHA 5B1BC 2UUIA 4CS9C 3G4XA 3DI5A 1OCRC 3NYJA 2PFDA 2H7OA 4I1OB 4EHPA 5B3IA 2A69F 4JEBA 1APCA 4PFPA 3I5QA 4XLPF 1NFOA 1TKNA 1Q0GA 2L6HA 3TQOA 3FDQA 2YL0A 1PCXA 1LVKA 4Z9HA 1E83A 2XL8A 2XXAB 1U89A 1VOMA 3MYIA 3O39A 4OINF 2G3VA 2VH3A 2J0XA 5BUOA 1MNDA 2KC3A 2WB7A 3L0IA 2HJMA 2KNHA 2KQ9A 4ONSA 5T3TA 4JIOA 2JX0A 4MTGA 2KGOA 2IOQA 2YHSA 5A6BA 4BJ6A 4PJNA 2OCCC 1E2XA 2YKZA 3KPHA 2OQMA 1V74B 3MX3A 4LACB 4K1OA 3W2VA 4PJLA 5DLJA 1JOGA 3HKKA 3WG7C 3U0CA 2HJ3A 2QTVA 3WODF 1N1CA 3UGPA 3HNJA 2JD3A 2A0BA 5E3AA 1Y6DA 2R7OA 2Y69C 5CI8A 2MWQA 2W4MA 1OR2A 4OIQF 4LDKA 5CI9A 1I4YA 2CDQA 1OQCA 1Q0MA 4MVSA 2CYDA 3PHF2 1QSPA 1LKXA 2HMZA 2WVQA 3K1HA 1T6UA 3FOPA 5B1AC 5KYNA 3IQ6A 1WASA 4OIRF 1FNTc 2BE5F 2F22A 1SF8A 2C03A 2ETSA 2YEVA 3GORA 5T1DB 5COFA 5JT4A 2R02A 3HNLA 5L0DA 3C8GB 3DAGA 2DYRC 4Q7CA 1U0BB 3KL4A 1TFKB 4P9TA 4CDAA 2L6FA 5IY5C 2HMQA 2JPUA 2YL7A 2EPOA 5L0GA 3NMKA 1AEPA 1J8YF 2HSQA 3AG1C 4CS9A 1AUEA 3K6BA 2EPLX 1VYKA 2P6VA 3U2MA 1NBBA 3T6GB 2KJGA 2YWAA 4G7OF 2KW3C 2LFDA 5KYYB 1ZHYA 2RD9A 3QMKA 2IBFA 1TFOB 3R2PA 4CSAC 5F5FA 3MBGA 2Q3TA 3GWNA 3PMRA 4IARA 4D4NA 3EGXA 3L8JA 3EH1A 3ZQYA 5COMA 4N6HA 4MQ9F 2XM4A 1FAPB 1QKRA 3GODA 2FFHA 1H9TA 1VK5A 2OJQA 3EHMA 4HEAJ 3V5XA 2XL6A 4Q4ZF 4U5GA 3IQCA 2V3CC 3ASOC 2PNOA 3LJBA 2J7PA 1R5ID 3LUTB 3EFOB 1ORSC 3UR3C 3ECSA 2QY9A 4G7ZF 2EIMC 2W45A 4YT4A 4WABA 1FR0A 1GM5A 4XPXA 3O6XA 1D0YA 1C02A 4I3MA 2HZ8A 4BJ5A 2YZSA 4DBRA 3NDBB 1CPQA 3OWTA 5F5HA 1U6HA 2IXNA 3MYFA 2LIGA 2A0UA 3S9OA 3M4BA 1TR2A 2KK1A 4E0HA 4A4AA 4QI0A 3HLZA 1XZPA 5F28E 2R05A 1MQVA 2M64A 3U9MA 3R7CA 1EI7A 2OG2A 1OKKA 2HV6A 1OW6A 3F46A 3HTKC 4DVYP 1I5NA 1MNEA 3RVZA 1YDIA 3NYMA 4U5BE 1H7IA 4MVRA 3B0UX 1BZ4A 2W9YA 3A9CA 5BQIA 1Z63A 4MVUA 3UNGC 4CS8C 1LE2A 1O3UA 1VYIA 2D5RB 2IXPA 3GEIA 3V5YA 2LK4A 1MMDA 1EA8A 3Q7GA 3RQFA 3EGXB 3W4YA 4C7OB 2DB4A 3VYWA 4AE4B 2OEVA 1HE1A 2R7WA 1T5OA 2J9BA 3B29A 3S28A 1RKCA 1JAFA 2WZFA 4NC3A 1JRAA 1ZW3A 3JSEO 5KYYA 1NSGB 4XEKA 1RJ9B 3S90A 3UGOA 3DJUB 3EFOA 4FWVA 4KBLA 3EHNA 4CS8A 2HSBA 2CNWA 1ORJA 2M4EA 1ST6A 3JT1A 3JZ0A 1CGOA 1NU7D 2OJED 2WL8A 4XTKA 1NFNA 4EBKA 1M2OA 4DBQA 3B0VC 3GANA 3ABMC 3RIPA 1K04A 3QZCA 3U3BA 4ZLCA 4NQFA 4CX9A 3SP1A 2KSFA 3JYHA 3AGUA 4JTAB 3SXZA 3QVZA 1HY5A 1JR8A 1KTMA 1EKYA 1S7ZA 4RBNA 4OIPF 1Q0FA 2W4BA 4GEHA 1LI7A 2XL4A 4OD4A 4A2NB 5BQHA 2YL3A 2FAPB 3IHUA 3DE9A 4F4BA 2XLWA 1WWPA 4E0IA 5DS4A 1QPUA 3EG9B 3F47A 4RD9A 4E7ZA 1VB5A 3C7JA 1BDJB 3NMJA 2V26A 3X1OA 3US6A 2ZXWC 1QZXA 4EBBA 3IPMO 3ATPA 3K33A 4P9FA 4EKWA 3LAYA 1RKEB 1A7DA 4IGGA 5DS6A 1QLEC 4BJTA 4BEJA 5A6BD 3IQ5A 3AOUA 3M4CA 3ZVRA 1MMNA 4JURI 2HKVA 2Z15A 4DRHB 3TJ5A 1VLTA 3VM6A 2BL2A 2J9WA 3ZG1A 5JLIA 1GQAA 1RKEA 1T6IA 2C04A 3SNHA 2IXOA 4MVZA 3OEOA 4I1MA 5EHHA 2LQGA 4MNDA 1SR2A 2I8BA 4PJJA 1WOLA 4CIHA 1LI5A 3LLKA 3CZ6A 5JRAA 2R7XA 2GA0A 5DVWA 1RJ9A 3L8IA 1ZHTA 3POVA 3DAFA 3AG2C 4YK5A 2R7VA 2QLAA 5TJ5E 2YQYA 1M56C 2L7AA 3AQCA 3UMIA 3LNRA 4NY3A 5CIVA 2WZLA 1FTSA 1OKKD 3RKOF 3J06A 1V55C 1D1BA 2HS5A 2R25A 3C8GD 3TOMA 3TD7A 2MHRA 4JEAA 1ZYRF 3AJMA 3SXMA 3T6BA 1ZHZA 2Y39A 4Z9IA 1VMAA 3TULA 2ZXPA 4J7YA 3FVYA 2UUHA 2AU5A 2NUPA 4R32A 4U9DA 4OIOF 2A68F 5DQZA 3SYNA 3EZIA 3A11A 3S84A 3T4RA 5L0FA 2ZD9A 1JPJA 4W8KA 1Q0KA 1TQGA 4AX2A 1OW8A 2GAQA 3GM2A 4K7BA 4CS7A 4CSAA 3N2ZB 2EIJC 3U5SA 2J0WA 4XPYA 1OCOC 1G4WR 5KYXB 3ABLC 1K40A 1V4AA 2R9RB 1E86A 1ORYA 3ASNC 3N24A 3Q7LA 5JVEA 1MMGA 3GM1A 1YA9A 4MTFA 2DI3A 3EGDB 1ZHWA 3FHDA 1EQ1A 2R7RA 1LS4A 5L0JA 1XZQA 2AWCA 5L0HA 4C3BA 2WZGA 4IAQA 1BR1A 4LLCA 1E85A 3DM5A 1UG7A 1Q0DA 3GEHA 4XPWA 2H8AA 4FESA 5JS5A 2NUTB 4AL1A 4DRIB 2XLVA 4AE4A 4YN0B 5E33A 3DE8A 4J7TA 2J9VA 5D92A 3M79A 1NG1A 1YVIA 2Q9BA 1TWAA 4HE8D 4O7GA 3UMHA 1A7EA 3RYLA 4I44A 5FZTA 1HMDA 4U5CE 3G4ZA 5FCLA 5KYWA 4N4WA 4U9EA 1I4ZA 2YLIA 3DZAA 2P61A 3DMDA 2Y3GA 2XS8A 1LIHA 2Q00A 4XQ1A 3LESA 4IJJA 4IWBA 3O10A 4NTAA 4UDVA 1NLXA 3E9VA 2HFIA 2NSFA 4YJWA 4OD5A 2PF4E 1BR2A 3EPVA 5AC4A 4G78A 3V7OA 4U5EE 4MVOA 2HUJA 2R03A 2NUPB 1M2VA 4FX5A 3CAXA 2RSEB 3S29A 2O9XA 3UMKA 3C18A 4O6YA 5KYUB 2PX3A 3U9JA 1H9GA 3AGTA 3BRJA 3FMSA 4EBJA 2PX0A 1XWJA 3NKDA 3ZC4A 1WTYA 4ULVA 1D1AA 1DOWA 1YJGA 1YAUO 2X51A 2CNWD 4RDAA 3DKAA 3V5ZA 4DXWA 1G8XA 4HFKB 5JSLA 5KYXA 1D1CA 1HE9A 4MS2A 2R7SA 4CIPA 3GEEA 4BJ1A 2E87A 2R7QA 1TWCA 2YVKA 1ZU4A 4H4KC 4W8PA 4ANJA 4EWCA 2J8WA 3GM3A 3HJCA 4JJFA 3RQGA 1FMVA 5E3CA 2LP4A 2NG1A 3LS1A 1TWGA 3PCVA 1H6GA 1IZMA 1V54C 4J30B 2VB6A 2XLMA 3IEEA 3K1IA 1W2WA 2EPNA 2A1DD 2GWWA 1LS1A 1QVXA 2PP4A 3RF3A 1YZCA 4GQHA 4LLEA 1JMWA 4DJ9A 1C17M 4JTDB 4QDLA 3SEOA 3U3FA 1A7VA 2WVOA 3KYJA 3B9QA 4HFFB 4E7SA 4XEFA 1Z6AA 4KI2A 1BR4A 1Z23A 1ZU5A 2VCAA 4XWJA 1WATA 3KYIA 2Q7RA 3Q6NA 3ZQVA 1D0ZA 1HW2A 5D91A 5E2QA 2DYSC 3K66A 4L6RA 5KYWB 2YRFA 3C8ZA 4MVQA 3CSKA 2B0HA 3U2LA 3ABKC 1ZVZA 2EPMX 4C3DA 4IB4A 1YZAA 4JZAA 4PK4A 3S27A 2Y3HA 4JTCB 4JKVA 2XXAA 5AGFA 1PV3A 3DD7A 1HW1A 3TOLA 3B71A 4X0RA 1OR3A 1M2VB 4Z9JA 3U8VA 5DQTA 3KKBA 5T3WA 3EJNA 2L81A 2Q9CA 3QW0A 1E84A 4KC9A 3HNKA 4DVZA 4E17A 4JJGA 4E18A 1FMWA 1O5HA 1VTMP 3MFNA 2AWYA 2TMVP 3L34A 4BG0A 3E70C 2DGJA 4JVSA 1G4US 2J9UA 4PR9A 3ZIBA 4YWQA 2R7TA 2IXMA 2Q4FA 3FAJA 4YL1A 1RMVA 5BQGA 3C62A 3W8HA 3QW1A 3VAYA 4J32B 5B3SC 3NG1A 3NMIA 5COGA 3RQEA 2IM8A 3LS0A 3CEXA 5L0IA 3JCUQ 3SXYA 3WAQA 3JRMO 1A41A 1J8MF 1SZIA 2H7VC 1LE4A 1OW7A 2OEXA 4ZLDA 4FAPB 4YT8A 1A0BA 1PD0A 1YLMA 2Q9AA 3RW0A 3CQZA 3LLIA 5A6JA 5L3QA 1IW7F 5K0IA 3IQTA 1T01A 3KMIA 2MYSA 1Z7Qc 4EIYA 3RVYA 1B68A 1S05A 4BEMJ 2FGYA 2XLHA 4CJGA 2GDCA 2J7PD 2PBEA 3EQLF 1KNYA 1L7CA 3SZRA 3VRCA 2QE9A 4LDRA 4YT2A 4XLNF 5L0CA 1YA7O 4PFOA 1CGME 2EINC 1YARO 2BC5A 4O6NA 4JCHA 1O87A 1SYQA 2LD6A 3K7DA 4H54A 2H7BA 2IYLD 2ZPAA 3RFYA 2LSEA 3ZTMA 3Q6MA 2OKUA 3B0PA 4D4XA 1T6QA 4WJ0A 4O79A 4U5HA 5A69A 4NTFA 3H65A 1R4TA 4JRZA 2QNLA 2EPKX 3MLGA 1NZEA 3U8PA 2XLEA 1M6TA 1LM3B 1RCPA 5EK0A 3SXKA 4CDVA 2GFHA 2Y3DA 3FAPB 2NPUA 3GWLA 256BA 3H2UA 1PD1A 2P1AA 3NKEA 2G3KA 3N0TA 4MTOA 2L6GA 4GYTA 1BBHA 2HV7A 2NSGA 3LEOA 3AQBA 4JE9A 2OU6A 4LDQA 4C3EA 1OCCC 4Q5SF 3ZTZA 2XLOA 5KYUA 4ULWA 3OA1A 4DOZA 3K1IC 4PJMA 3EG9A 3DXJF 1T9KA 4CDYA
chains in the Genus database with same CATH topology
4YL1A 5BQGA 4YK5A 2Q7RA 4NTFA 4JRZA 4AL0A 5BQIA 4BPMA 4NTAA 5K0IA 2PNOA 4YL3A 3HKKA 4JCZA 3PCVA 5HV9A 4J7YA 3LEOA 4NTBA 4WABA 2H8AA 2UUHA 4JC7A 5BQHA 4AL1A 4YL0A 2UUIA 3B29A 3DWWA 4J7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL1 A;  5BQG A;  4YK5 A;  2Q7R A;  4NTF A;  4JRZ A;  4AL0 A;  5BQI A;  4BPM A;  4NTA A;  5K0I A;  2PNO A;  4YL3 A;  3HKK A;  4JCZ A;  3PCV A;  5HV9 A;  4J7Y A;  3LEO A;  4NTB A;  4WAB A;  2H8A A;  2UUH A;  4JC7 A;  5BQH A;  4AL1 A;  4YL0 A;  2UUI A;  3B29 A;  3DWW A;  4J7T A; 
#chains in the Genus database with same CATH topology
 3W8I A;  2YL1 A;  2ICW G;  3EGD A;  4MW8 A;  1LPE A;  4WGZ A;  5JP7 A;  5A6A A;  5GPG B;  5EGY A;  3M1C B;  1YYJ A;  2J46 A;  4MW3 A;  5DS5 A;  2XS1 A;  1VLS A;  1TWH A;  2G62 A;  2CW0 F;  2XM0 A;  2LCH A;  3LNM B;  3W2W A;  1F1M A;  2ZXO A;  3C8G A;  3AG4 C;  4JW1 A;  4KNV A;  3JTL O;  4MVM A;  3TK0 A;  4ER9 A;  2J45 A;  2P0N A;  3JRT A;  3JSZ A;  1RXQ A;  3X2Q C;  4BJ6 C;  1OXK A;  2A6H F;  4DRJ B;  4O6M A;  1M57 C;  2ASR A;  4YL3 A;  3ZWI A;  2WVN A;  2XSE A;  3O55 A;  2CGE A;  3PDM P;  4M63 A;  4CBE A;  5HSW A;  4QI2 A;  2Y3B A;  2AP3 A;  3RH3 A;  1L3P A;  1OCZ C;  3VF0 A;  2L9J A;  3H2V A;  3WHN A;  3S0X A;  4LER A;  1FFT C;  3T6J A;  4YL0 A;  3DJN B;  1GGQ A;  1ZW2 A;  3L1M A;  4AK9 A;  4G7H F;  5JUA A;  1G5Z A;  2A6E F;  2I15 A;  4U5D E;  1HMO A;  4IAO A;  2X0C A;  3ZSU A;  2R7U A;  5AC5 A;  1WN0 A;  3I4U A;  1UFB A;  4NCQ A;  4U5F E;  1Z3I X;  4IRU A;  2QUP A;  2VCC A;  4AL0 A;  5A6K A;  2XRH A;  3C63 A;  2AVK A;  4BPM A;  2YLG A;  2B0J A;  3AG3 C;  3ITF A;  4N6C A;  2P7V A;  1DOV A;  1GS9 A;  1D0X A;  4K0D A;  1K05 A;  5HV9 A;  3G50 A;  4NTB A;  3ZDL A;  3BEH A;  4EUK B;  1Z5Z A;  2YLD A;  3I5P A;  3DWW A;  1CGN A;  1JPN A;  3NYL A;  1FFH A;  3QTH A;  3T9O A;  5L3V A;  4XEV A;  1ZZP A;  2VCB A;  1YYX A;  2EIL C;  3FXH A;  2ZXR A;  4B6I A;  4YT5 A;  4PAC A;  2CCY A;  1SMY F;  2KYH A;  3KH2 A;  3TJ6 A;  2D4U A;  3FOO A;  1Y4C A;  4N06 A;  4KNW A;  2EIK C;  3DM9 B;  2XLD A;  1C03 A;  1QQ3 A;  1WGW A;  1ZHX A;  1NU9 C;  3NRH A;  4P6I C;  3QVY A;  3HNI A;  2LFF A;  1CPR A;  1OXB A;  1MMA A;  2VC9 A;  4G0H A;  4CJO A;  3JYY A;  2VAS A;  3M15 A;  4JCZ A;  2OOC A;  4C7O A;  1AVO B;  2NUT A;  4JC7 A;  4WGY A;  3EH2 A;  1KU2 A;  4BJ5 C;  3LEV A;  3EZH A;  5B1B C;  2UUI A;  4CS9 C;  3G4X A;  3DI5 A;  1OCR C;  3NYJ A;  2PFD A;  2H7O A;  4I1O B;  4EHP A;  5B3I A;  2A69 F;  4JEB A;  1APC A;  4PFP A;  3I5Q A;  4XLP F;  1NFO A;  1TKN A;  1Q0G A;  2L6H A;  3TQO A;  3FDQ A;  2YL0 A;  1PCX A;  1LVK A;  4Z9H A;  1E83 A;  2XL8 A;  2XXA B;  1U89 A;  1VOM A;  3MYI A;  3O39 A;  4OIN F;  2G3V A;  2VH3 A;  2J0X A;  5BUO A;  1MND A;  2KC3 A;  2WB7 A;  3L0I A;  2HJM A;  2KNH A;  2KQ9 A;  4ONS A;  5T3T A;  4JIO A;  2JX0 A;  4MTG A;  2KGO A;  2IOQ A;  2YHS A;  5A6B A;  4BJ6 A;  4PJN A;  2OCC C;  1E2X A;  2YKZ A;  3KPH A;  2OQM A;  1V74 B;  3MX3 A;  4LAC B;  4K1O A;  3W2V A;  4PJL A;  5DLJ A;  1JOG A;  3HKK A;  3WG7 C;  3U0C A;  2HJ3 A;  2QTV A;  3WOD F;  1N1C A;  3UGP A;  3HNJ A;  2JD3 A;  2A0B A;  5E3A A;  1Y6D A;  2R7O A;  2Y69 C;  5CI8 A;  2MWQ A;  2W4M A;  1OR2 A;  4OIQ F;  4LDK A;  5CI9 A;  1I4Y A;  2CDQ A;  1OQC A;  1Q0M A;  4MVS A;  2CYD A;  3PHF 2;  1QSP A;  1LKX A;  2HMZ A;  2WVQ A;  3K1H A;  1T6U A;  3FOP A;  5B1A C;  5KYN A;  3IQ6 A;  1WAS A;  4OIR F;  1FNT c;  2BE5 F;  2F22 A;  1SF8 A;  2C03 A;  2ETS A;  2YEV A;  3GOR A;  5T1D B;  5COF A;  5JT4 A;  2R02 A;  3HNL A;  5L0D A;  3C8G B;  3DAG A;  2DYR C;  4Q7C A;  1U0B B;  3KL4 A;  1TFK B;  4P9T A;  4CDA A;  2L6F A;  5IY5 C;  2HMQ A;  2JPU A;  2YL7 A;  2EPO A;  5L0G A;  3NMK A;  1AEP A;  1J8Y F;  2HSQ A;  3AG1 C;  4CS9 A;  1AUE A;  3K6B A;  2EPL X;  1VYK A;  2P6V A;  3U2M A;  1NBB A;  3T6G B;  2KJG A;  2YWA A;  4G7O F;  2KW3 C;  2LFD A;  5KYY B;  1ZHY A;  2RD9 A;  3QMK A;  2IBF A;  1TFO B;  3R2P A;  4CSA C;  5F5F A;  3MBG A;  2Q3T A;  3GWN A;  3PMR A;  4IAR A;  4D4N A;  3EGX A;  3L8J A;  3EH1 A;  3ZQY A;  5COM A;  4N6H A;  4MQ9 F;  2XM4 A;  1FAP B;  1QKR A;  3GOD A;  2FFH A;  1H9T A;  1VK5 A;  2OJQ A;  3EHM A;  4HEA J;  3V5X A;  2XL6 A;  4Q4Z F;  4U5G A;  3IQC A;  2V3C C;  3ASO C;  2PNO A;  3LJB A;  2J7P A;  1R5I D;  3LUT B;  3EFO B;  1ORS C;  3UR3 C;  3ECS A;  2QY9 A;  4G7Z F;  2EIM C;  2W45 A;  4YT4 A;  4WAB A;  1FR0 A;  1GM5 A;  4XPX A;  3O6X A;  1D0Y A;  1C02 A;  4I3M A;  2HZ8 A;  4BJ5 A;  2YZS A;  4DBR A;  3NDB B;  1CPQ A;  3OWT A;  5F5H A;  1U6H A;  2IXN A;  3MYF A;  2LIG A;  2A0U A;  3S9O A;  3M4B A;  1TR2 A;  2KK1 A;  4E0H A;  4A4A A;  4QI0 A;  3HLZ A;  1XZP A;  5F28 E;  2R05 A;  1MQV A;  2M64 A;  3U9M A;  3R7C A;  1EI7 A;  2OG2 A;  1OKK A;  2HV6 A;  1OW6 A;  3F46 A;  3HTK C;  4DVY P;  1I5N A;  1MNE A;  3RVZ A;  1YDI A;  3NYM A;  4U5B E;  1H7I A;  4MVR A;  3B0U X;  1BZ4 A;  2W9Y A;  3A9C A;  5BQI A;  1Z63 A;  4MVU A;  3UNG C;  4CS8 C;  1LE2 A;  1O3U A;  1VYI A;  2D5R B;  2IXP A;  3GEI A;  3V5Y A;  2LK4 A;  1MMD A;  1EA8 A;  3Q7G A;  3RQF A;  3EGX B;  3W4Y A;  4C7O B;  2DB4 A;  3VYW A;  4AE4 B;  2OEV A;  1HE1 A;  2R7W A;  1T5O A;  2J9B A;  3B29 A;  3S28 A;  1RKC A;  1JAF A;  2WZF A;  4NC3 A;  1JRA A;  1ZW3 A;  3JSE O;  5KYY A;  1NSG B;  4XEK A;  1RJ9 B;  3S90 A;  3UGO A;  3DJU B;  3EFO A;  4FWV A;  4KBL A;  3EHN A;  4CS8 A;  2HSB A;  2CNW A;  1ORJ A;  2M4E A;  1ST6 A;  3JT1 A;  3JZ0 A;  1CGO A;  1NU7 D;  2OJE D;  2WL8 A;  4XTK A;  1NFN A;  4EBK A;  1M2O A;  4DBQ A;  3B0V C;  3GAN A;  3ABM C;  3RIP A;  1K04 A;  3QZC A;  3U3B A;  4ZLC A;  4NQF A;  4CX9 A;  3SP1 A;  2KSF A;  3JYH A;  3AGU A;  4JTA B;  3SXZ A;  3QVZ A;  1HY5 A;  1JR8 A;  1KTM A;  1EKY A;  1S7Z A;  4RBN A;  4OIP F;  1Q0F A;  2W4B A;  4GEH A;  1LI7 A;  2XL4 A;  4OD4 A;  4A2N B;  5BQH A;  2YL3 A;  2FAP B;  3IHU A;  3DE9 A;  4F4B A;  2XLW A;  1WWP A;  4E0I A;  5DS4 A;  1QPU A;  3EG9 B;  3F47 A;  4RD9 A;  4E7Z A;  1VB5 A;  3C7J A;  1BDJ B;  3NMJ A;  2V26 A;  3X1O A;  3US6 A;  2ZXW C;  1QZX A;  4EBB A;  3IPM O;  3ATP A;  3K33 A;  4P9F A;  4EKW A;  3LAY A;  1RKE B;  1A7D A;  4IGG A;  5DS6 A;  1QLE C;  4BJT A;  4BEJ A;  5A6B D;  3IQ5 A;  3AOU A;  3M4C A;  3ZVR A;  1MMN A;  4JUR I;  2HKV A;  2Z15 A;  4DRH B;  3TJ5 A;  1VLT A;  3VM6 A;  2BL2 A;  2J9W A;  3ZG1 A;  5JLI A;  1GQA A;  1RKE A;  1T6I A;  2C04 A;  3SNH A;  2IXO A;  4MVZ A;  3OEO A;  4I1M A;  5EHH A;  2LQG A;  4MND A;  1SR2 A;  2I8B A;  4PJJ A;  1WOL A;  4CIH A;  1LI5 A;  3LLK A;  3CZ6 A;  5JRA A;  2R7X A;  2GA0 A;  5DVW A;  1RJ9 A;  3L8I A;  1ZHT A;  3POV A;  3DAF A;  3AG2 C;  4YK5 A;  2R7V A;  2QLA A;  5TJ5 E;  2YQY A;  1M56 C;  2L7A A;  3AQC A;  3UMI A;  3LNR A;  4NY3 A;  5CIV A;  2WZL A;  1FTS A;  1OKK D;  3RKO F;  3J06 A;  1V55 C;  1D1B A;  2HS5 A;  2R25 A;  3C8G D;  3TOM A;  3TD7 A;  2MHR A;  4JEA A;  1ZYR F;  3AJM A;  3SXM A;  3T6B A;  1ZHZ A;  2Y39 A;  4Z9I A;  1VMA A;  3TUL A;  2ZXP A;  4J7Y A;  3FVY A;  2UUH A;  2AU5 A;  2NUP A;  4R32 A;  4U9D A;  4OIO F;  2A68 F;  5DQZ A;  3SYN A;  3EZI A;  3A11 A;  3S84 A;  3T4R A;  5L0F A;  2ZD9 A;  1JPJ A;  4W8K A;  1Q0K A;  1TQG A;  4AX2 A;  1OW8 A;  2GAQ A;  3GM2 A;  4K7B A;  4CS7 A;  4CSA A;  3N2Z B;  2EIJ C;  3U5S A;  2J0W A;  4XPY A;  1OCO C;  1G4W R;  5KYX B;  3ABL C;  1K40 A;  1V4A A;  2R9R B;  1E86 A;  1ORY A;  3ASN C;  3N24 A;  3Q7L A;  5JVE A;  1MMG A;  3GM1 A;  1YA9 A;  4MTF A;  2DI3 A;  3EGD B;  1ZHW A;  3FHD A;  1EQ1 A;  2R7R A;  1LS4 A;  5L0J A;  1XZQ A;  2AWC A;  5L0H A;  4C3B A;  2WZG A;  4IAQ A;  1BR1 A;  4LLC A;  1E85 A;  3DM5 A;  1UG7 A;  1Q0D A;  3GEH A;  4XPW A;  2H8A A;  4FES A;  5JS5 A;  2NUT B;  4AL1 A;  4DRI B;  2XLV A;  4AE4 A;  4YN0 B;  5E33 A;  3DE8 A;  4J7T A;  2J9V A;  5D92 A;  3M79 A;  1NG1 A;  1YVI A;  2Q9B A;  1TWA A;  4HE8 D;  4O7G A;  3UMH A;  1A7E A;  3RYL A;  4I44 A;  5FZT A;  1HMD A;  4U5C E;  3G4Z A;  5FCL A;  5KYW A;  4N4W A;  4U9E A;  1I4Z A;  2YLI A;  3DZA A;  2P61 A;  3DMD A;  2Y3G A;  2XS8 A;  1LIH A;  2Q00 A;  4XQ1 A;  3LES A;  4IJJ A;  4IWB A;  3O10 A;  4NTA A;  4UDV A;  1NLX A;  3E9V A;  2HFI A;  2NSF A;  4YJW A;  4OD5 A;  2PF4 E;  1BR2 A;  3EPV A;  5AC4 A;  4G78 A;  3V7O A;  4U5E E;  4MVO A;  2HUJ A;  2R03 A;  2NUP B;  1M2V A;  4FX5 A;  3CAX A;  2RSE B;  3S29 A;  2O9X A;  3UMK A;  3C18 A;  4O6Y A;  5KYU B;  2PX3 A;  3U9J A;  1H9G A;  3AGT A;  3BRJ A;  3FMS A;  4EBJ A;  2PX0 A;  1XWJ A;  3NKD A;  3ZC4 A;  1WTY A;  4ULV A;  1D1A A;  1DOW A;  1YJG A;  1YAU O;  2X51 A;  2CNW D;  4RDA A;  3DKA A;  3V5Z A;  4DXW A;  1G8X A;  4HFK B;  5JSL A;  5KYX A;  1D1C A;  1HE9 A;  4MS2 A;  2R7S A;  4CIP A;  3GEE A;  4BJ1 A;  2E87 A;  2R7Q A;  1TWC A;  2YVK A;  1ZU4 A;  4H4K C;  4W8P A;  4ANJ A;  4EWC A;  2J8W A;  3GM3 A;  3HJC A;  4JJF A;  3RQG A;  1FMV A;  5E3C A;  2LP4 A;  2NG1 A;  3LS1 A;  1TWG A;  3PCV A;  1H6G A;  1IZM A;  1V54 C;  4J30 B;  2VB6 A;  2XLM A;  3IEE A;  3K1I A;  1W2W A;  2EPN A;  2A1D D;  2GWW A;  1LS1 A;  1QVX A;  2PP4 A;  3RF3 A;  1YZC A;  4GQH A;  4LLE A;  1JMW A;  4DJ9 A;  1C17 M;  4JTD B;  4QDL A;  3SEO A;  3U3F A;  1A7V A;  2WVO A;  3KYJ A;  3B9Q A;  4HFF B;  4E7S A;  4XEF A;  1Z6A A;  4KI2 A;  1BR4 A;  1Z23 A;  1ZU5 A;  2VCA A;  4XWJ A;  1WAT A;  3KYI A;  2Q7R A;  3Q6N A;  3ZQV A;  1D0Z A;  1HW2 A;  5D91 A;  5E2Q A;  2DYS C;  3K66 A;  4L6R A;  5KYW B;  2YRF A;  3C8Z A;  4MVQ A;  3CSK A;  2B0H A;  3U2L A;  3ABK C;  1ZVZ A;  2EPM X;  4C3D A;  4IB4 A;  1YZA A;  4JZA A;  4PK4 A;  3S27 A;  2Y3H A;  4JTC B;  4JKV A;  2XXA A;  5AGF A;  1PV3 A;  3DD7 A;  1HW1 A;  3TOL A;  3B71 A;  4X0R A;  1OR3 A;  1M2V B;  4Z9J A;  3U8V A;  5DQT A;  3KKB A;  5T3W A;  3EJN A;  2L81 A;  2Q9C A;  3QW0 A;  1E84 A;  4KC9 A;  3HNK A;  4DVZ A;  4E17 A;  4JJG A;  4E18 A;  1FMW A;  1O5H A;  1VTM P;  3MFN A;  2AWY A;  2TMV P;  3L34 A;  4BG0 A;  3E70 C;  2DGJ A;  4JVS A;  1G4U S;  2J9U A;  4PR9 A;  3ZIB A;  4YWQ A;  2R7T A;  2IXM A;  2Q4F A;  3FAJ A;  4YL1 A;  1RMV A;  5BQG A;  3C62 A;  3W8H A;  3QW1 A;  3VAY A;  4J32 B;  5B3S C;  3NG1 A;  3NMI A;  5COG A;  3RQE A;  2IM8 A;  3LS0 A;  3CEX A;  5L0I A;  3JCU Q;  3SXY A;  3WAQ A;  3JRM O;  1A41 A;  1J8M F;  1SZI A;  2H7V C;  1LE4 A;  1OW7 A;  2OEX A;  4ZLD A;  4FAP B;  4YT8 A;  1A0B A;  1PD0 A;  1YLM A;  2Q9A A;  3RW0 A;  3CQZ A;  3LLI A;  5A6J A;  5L3Q A;  1IW7 F;  5K0I A;  3IQT A;  1T01 A;  3KMI A;  2MYS A;  1Z7Q c;  4EIY A;  3RVY A;  1B68 A;  1S05 A;  4BEM J;  2FGY A;  2XLH A;  4CJG A;  2GDC A;  2J7P D;  2PBE A;  3EQL F;  1KNY A;  1L7C A;  3SZR A;  3VRC A;  2QE9 A;  4LDR A;  4YT2 A;  4XLN F;  5L0C A;  1YA7 O;  4PFO A;  1CGM E;  2EIN C;  1YAR O;  2BC5 A;  4O6N A;  4JCH A;  1O87 A;  1SYQ A;  2LD6 A;  3K7D A;  4H54 A;  2H7B A;  2IYL D;  2ZPA A;  3RFY A;  2LSE A;  3ZTM A;  3Q6M A;  2OKU A;  3B0P A;  4D4X A;  1T6Q A;  4WJ0 A;  4O79 A;  4U5H A;  5A69 A;  4NTF A;  3H65 A;  1R4T A;  4JRZ A;  2QNL A;  2EPK X;  3MLG A;  1NZE A;  3U8P A;  2XLE A;  1M6T A;  1LM3 B;  1RCP A;  5EK0 A;  3SXK A;  4CDV A;  2GFH A;  2Y3D A;  3FAP B;  2NPU A;  3GWL A;  256B A;  3H2U A;  1PD1 A;  2P1A A;  3NKE A;  2G3K A;  3N0T A;  4MTO A;  2L6G A;  4GYT A;  1BBH A;  2HV7 A;  2NSG A;  3LEO A;  3AQB A;  4JE9 A;  2OU6 A;  4LDQ A;  4C3E A;  1OCC C;  4Q5S F;  3ZTZ A;  2XLO A;  5KYU A;  4ULW A;  3OA1 A;  4DOZ A;  3K1I C;  4PJM A;  3EG9 A;  3DXJ F;  1T9K A;  4CDY A; 
#chains in the Genus database with same CATH homology
 4YL1 A;  5BQG A;  4YK5 A;  2Q7R A;  4NTF A;  4JRZ A;  4AL0 A;  5BQI A;  4BPM A;  4NTA A;  5K0I A;  2PNO A;  4YL3 A;  3HKK A;  4JCZ A;  3PCV A;  5HV9 A;  4J7Y A;  3LEO A;  4NTB A;  4WAB A;  2H8A A;  2UUH A;  4JC7 A;  5BQH A;  4AL1 A;  4YL0 A;  2UUI A;  3B29 A;  3DWW A;  4J7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...