2QNLA

Crystal structure of a putative dna damage-inducible protein (chu_0679) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
162
structure length
162
Chain Sequence
GMHTQEALFVRLALDAWNTQSSRTDKLIQSLSNEALAVETAPGRNSGTYLLGHLTAVHDAMLPLLELGDTLYPQLAPVFIQNPDKSGLEKPEINDLRLYWSLVQERLANQFNQLQPADWFNKHAAISREDFLKEPHRNKLSVLINRTNHMAYHLGQLAYLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Uncharacterized protein
publication title Crystal structure of uncharacterized protein CHU_0679 (YP_677306.1) from Cytophaga hutchinsonii ATCC 33406 at 1.50 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
total genus 58
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12867 DinB_2 DinB superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2qnlA00
2OQMA 2QNLA 2P1AA 3GORA 5COFA 2NSFA 3CEXA 3DI5A 4N6CA 1RXQA 3DKAA 5CIVA 2OU6A 2F22A 5COGA 2QE9A 2HKVA 5COMA 2RD9A 3QTHA 2YQYA 2NSGA
chains in the Genus database with same CATH superfamily
3GM3A 2XL4A 2A0BA 3QW0A 3LNMB 4MS2A 1EI7A 5BQHA 4XLPF 2IXPA 3C8ZA 3DWWA 1BR4A 1XWJA 2A1DD 4BJ5C 4JJGA 2IOQA 2YL1A 5BQIA 2CW0F 1ZW3A 1M2VB 4AL0A 2OJED 4JVSA 5AC4A 3AJMA 3UMIA 3AG1C 4LDKA 2J7PD 2HJ3A 1PD0A 3TOLA 2J7PA 1MMAA 3DJNB 3QVYA 1ORJA 4D4NA 4AK9A 1GM5A 1D1CA 3ECSA 5T3TA 1VYKA 3ZIBA 5JS5A 5KYUB 1TWAA 3EGXA 4Z9JA 1PV3A 3Q6MA 4JW1A 4PJNA 4YL1A 5L0CA 2KJGA 3SXKA 2NUPA 3H2VA 3MYIA 4DRJB 3FDQA 4CDAA 3NYMA 3EQLF 1L7CA 1V54C 2D4UA 4YL0A 2J9UA 3W4YA 4WABA 2AVKA 1G8XA 3U5SA 2VH3A 3LJBA 5IY5C 1Z7Qc 2R7UA 4IB4A 2VCCA 2YEVA 5COFA 3IQTA 1AEPA 3TULA 3W8IA 3GODA 1FMWA 3HNIA 4MTOA 3RW0A 3B29A 3S0XA 5E33A 1BZ4A 2J9VA 4YT5A 2YL7A 4G0HA 1LIHA 4NTBA 5L0JA 2KGOA 5DS6A 1RCPA 3F46A 1LS4A 2AWYA 3R2PA 3U3BA 1RMVA 2L6FA 2J46A 2YKZA 2QE9A 3LEVA 4K7BA 1EQ1A 2XLVA 2BC5A 4K1OA 4CS8C 1JMWA 4NTFA 1OQCA 4QDLA 5BQGA 3EHMA 3N0TA 4FWVA 2J0XA 4NTAA 1VOMA 3ZTZA 1K05A 1TWGA 2PFDA 3AGTA 3L34A 5AGFA 3ATPA 4MVSA 1HE9A 4R32A 5FZTA 3EH1A 2CDQA 2XXAA 2Q00A 3S29A 5F5HA 4PJMA 3EFOA 4Q4ZF 1O87A 1QKRA 1QSPA 4JE9A 4MVOA 1NU7D 3JYHA 3UNGC 2ZXOA 5DVWA 3V7OA 3DI5A 4A4AA 2XLEA 1ZU4A 3S9OA 4LERA 5A6AA 1RXQA 2OCCC 3FVYA 4XWJA 1LE2A 2MWQA 3OWTA 2BE5F 5CI9A 5D92A 4N06A 5JSLA 4DOZA 1JAFA 2Q3TA 2WL8A 4G7HF 2Q4FA 5EGYA 3Q6NA 256BA 3S28A 2W4BA 3SXZA 1WWPA 2KQ9A 2LSEA 4E17A 4KC9A 1HY5A 3SYNA 3EGDB 5KYXB 4U5DE 2G62A 1NSGB 2OOCA 2Y3DA 3GANA 4PR9A 2NG1A 3HNJA 2EIMC 4C3DA 1K04A 3B71A 2I8BA 2GFHA 5L3VA 1O3UA 3IQ5A 1NZEA 4LDQA 2YL0A 2XRHA 1QLEC 2QLAA 5E2QA 1I5NA 3KH2A 2ZPAA 4J30B 4U5GA 3SXYA 1T6QA 4E0HA 1O5HA 1GGQA 5L3QA 2NSFA 2RSEB 4P9TA 2XLWA 4I3MA 1APCA 3N24A 1H9GA 3JT1A 1VK5A 3WHNA 1A7DA 1S7ZA 3O39A 5CIVA 2OEXA 3OA1A 1SMYF 4W8KA 3ABKC 3C7JA 3FAPB 4U5BE 3F47A 1SYQA 2OU6A 2R7RA 1JR8A 3CZ6A 3PDMP 2WZGA 3EGXB 2LK4A 3SXMA 3RF3A 2R25A 5E3AA 4CDVA 1ST6A 2L7AA 2JPUA 2KSFA 3PMRA 1RKEA 4ANJA 1NU9C 1UG7A 2RD9A 3IPMO 2A69F 2NUPB 3JYYA 2B0HA 1F1MA 3L1MA 3AQCA 2UUHA 5F28E 3RH3A 1JPJA 4BJ5A 4KI2A 3VRCA 2Q9BA 1SR2A 2AWCA 1GS9A 2DYRC 2YLDA 2LP4A 3FHDA 4MVUA 2HV7A 2YWAA 2XS1A 5F5FA 3GORA 1YZAA 1FTSA 4BPMA 5L0IA 2OKUA 4JTAB 4H54A 1D1BA 2J45A 3BRJA 4N4WA 2R7SA 2XLOA 2YLIA 3QVZA 5L0HA 4MW8A 1H9TA 3G4ZA 4E0IA 2KW3C 5JT4A 2XSEA 1HMOA 1MMDA 3DM9B 2EINC 2ZXPA 3K6BA 2FGYA 3NYJA 3RVZA 2PNOA 4LDRA 3NYLA 5DS4A 4W8PA 1V55C 1TFKB 3DE9A 3ZVRA 4JRZA 1A7VA 3K1IC 1J8MF 4MVZA 1UFBA 2IYLD 2OJQA 2PBEA 5KYXA 3FOOA 1CGME 2HMQA 1ZYRF 3DMDA 2HSQA 2H7OA 3HTKC 1SZIA 3L8IA 1D0XA 2XXAB 5FCLA 4PACA 1NFOA 2Y69C 2PX0A 3EFOB 3MYFA 1Z3IX 3RQEA 2PP4A 5JRAA 4IAQA 1QQ3A 2M64A 4IGGA 1VTMP 4NC3A 1Q0DA 2Q7RA 1TWCA 5B1AC 1Z63A 1OW6A 1C17M 2BL2A 3TQOA 4CS8A 2JX0A 1OKKD 3RYLA 2R9RB 4QI2A 3HNLA 1OKKA 1W2WA 2ZXRA 4U5CE 1YA9A 2LD6A 3PHF2 1VYIA 2CNWD 3KYIA 5BUOA 2HMZA 1A7EA 3I4UA 5JP7A 1Z5ZA 2EIKC 2CNWA 4OD5A 4DVZA 3LESA 1YLMA 2FAPB 2LQGA 4PJJA 2A6HF 4CJOA 1TQGA 1NBBA 3HLZA 2XL6A 1ZHXA 1OCCC 1T6IA 2OQMA 3Q7LA 4YT8A 2YZSA 3EH2A 3W2WA 1WTYA 1EA8A 3VAYA 1LI5A 4RD9A 2EILC 1NG1A 3UMHA 3W8HA 4KNVA 4RDAA 1H6GA 3DJUB 2V3CC 1FFTC 2TMVP 2EPLX 4BEJA 1YDIA 4XPYA 3IQ6A 3LLIA 1Y4CA 3B0UX 4YN0B 3KMIA 1M57C 3JCUQ 2IXOA 3ZTMA 2R03A 4B6IA 5KYYA 2R7XA 1TWHA 2ZD9A 2QTVA 4MVQA 4EWCA 4I1MA 1RKEB 2G3KA 2R7OA 3VYWA 1ORSC 2Q9CA 4CIHA 5DLJA 4OD4A 2W9YA 4DBRA 1ZHZA 2FFHA 4JURI 4Z9IA 3JRTA 2YLGA 2NSGA 3B0PA 3ZSUA 2QNLA 4XEFA 1T5OA 1G4WR 3U2LA 2C03A 2M4EA 4EBBA 3POVA 2XLMA 2H8AA 3NRHA 3V5XA 3U2MA 4JIOA 2DGJA 4ZLDA 1FR0A 3E70C 1H7IA 1OW8A 1DOWA 1WASA 3AGUA 3C8GD 4ZLCA 1SF8A 3QW1A 2DI3A 3C8GA 1QPUA 1FFHA 4J7TA 1FAPB 4MQ9F 3LEOA 4U5HA 1C02A 1ZVZA 3A9CA 4LLEA 2Y3GA 1EKYA 2KNHA 4CIPA 5L0DA 3EPVA 4DRIB 4JJFA 3PCVA 3U3FA 1GQAA 3MBGA 4PK4A 2WVNA 1CGOA 4FX5A 3EZIA 4K0DA 4I1OB 4CDYA 4UDVA 3TD7A 3O55A 1U0BB 3QTHA 2A68F 3C63A 1IW7F 4H4KC 4MNDA 3ABLC 1LPEA 4XTKA 2X0CA 4G7ZF 3LNRA 2A0UA 3AOUA 4MVRA 2WVQA 3FAJA 1BR1A 2CCYA 3GWLA 3LAYA 4FESA 1D0ZA 1YZCA 4CSAC 3AG3C 2R7VA 1S05A 4IAOA 2GA0A 1Q0GA 5HSWA 4G7OF 1Z6AA 3TJ6A 2HS5A 5CI8A 4JCHA 2KK1A 3QMKA 4F4BA 1DOVA 3M15A 1T01A 3ZWIA 2XS8A 1FNTc 2P61A 1OCRC 3IQCA 3K1IA 4JTDB 2XL8A 3WODF 4DBQA 5KYWB 1KNYA 4OIRF 3GEEA 4HFFB 4AE4A 2EPOA 4ULVA 2GWWA 4OINF 5JUAA 1ZHTA 1OR3A 1RJ9A 2XLHA 4XEKA 3RIPA 2HJMA 3O6XA 4N6HA 1VB5A 4YT4A 1E84A 3LUTB 1E86A 2HFIA 2MHRA 1CPQA 3EZHA 3IHUA 1K40A 1QZXA 2D5RB 3M4BA 2HZ8A 2L81A 3KKBA 4U9DA 1JPNA 3G4XA 4OIOF 1E2XA 5T3WA 1YJGA 5A69A 2QY9A 4A2NB 3DAGA 3M4CA 4JTCB 3DD7A 3ASOC 3U8PA 1JOGA 2DYSC 3EG9A 3UR3C 5L0GA 3HKKA 5KYNA 1BDJB 1OR2A 1TFOB 4PJLA 5KYYB 3U9JA 2HUJA 1YYJA 3NDBB 4J32B 4U5FE 1I4YA 1LE4A 2W45A 3MFNA 4MW3A 3T6BA 3NKDA 3O10A 5HV9A 4HEAJ 3HJCA 3C62A 4G78A 2ASRA 4CS7A 3B9QA 4O6NA 2EPNA 3R7CA 2R7WA 2X51A 2B0JA 2NPUA 3T9OA 3UMKA 1MMNA 2P7VA 2YRFA 3L8JA 2L9JA 1ZU5A 2L6HA 3CSKA 4N6CA 5DQTA 3UGOA 4JCZA 4C3EA 3C8GB 2J9WA 2VASA 4CS9C 3VM6A 1MQVA 3I5QA 3LS1A 1U89A 4BJ6C 2LCHA 3K7DA 5DQZA 3T6GB 1OW7A 1TKNA 2V26A 3DM5A 4BJ1A 1Q0KA 3SZRA 1Y6DA 2I15A 3A11A 3M79A 1ZHYA 4JEBA 4M63A 5T1DB 1NLXA 3TK0A 2WVOA 5KYWA 3GEIA 3QZCA 2IXMA 1YA7O 3N2ZB 1OXBA 4KBLA 5DS5A 1V4AA 4XLNF 1Z23A 2OEVA 3GWNA 4DVYP 1L3PA 3JSEO 1CPRA 4IWBA 3SP1A 4P9FA 1M56C 2P1AA 4CX9A 4D4XA 2AP3A 4YK5A 1KTMA 3IEEA 3T4RA 4E7ZA 3AG4C 4BEMJ 3LS0A 4WGYA 2NUTA 4JEAA 2MYSA 2XLDA 4XQ1A 3E9VA 4EBKA 1Q0MA 2VC9A 2Q9AA 1OCOC 4X0RA 4DXWA 1HW2A 3RKOF 4YL3A 3B0VC 5A6BD 4YT2A 1R5ID 4E7SA 2R02A 5A6BA 2WB7A 2Y39A 2G3VA 1XZPA 1XZQA 4LLCA 1T6UA 4AE4B 3GM1A 2IXNA 2LIGA 2CYDA 1E85A 1TR2A 3SEOA 1RJ9B 3J06A 3WG7C 2W4MA 1ORYA 4CSAA 1G5ZA 4OIPF 2QUPA 3UGPA 2Y3HA 4PFOA 3JSZA 4O7GA 3ITFA 1V74B 1YARO 2VCBA 3DXJF 3ZDLA 1N1CA 2YVKA 2IBFA 1E83A 2OG2A 3CEXA 1KU2A 4C7OA 3SNHA 1CGNA 3AQBA 1B68A 1JRAA 3DKAA 4NY3A 3EG9B 3AG2C 1D0YA 4O79A 3W2VA 2ZXWC 4HE8D 1LI7A 4FAPB 3BEHA 2HSBA 2H7VC 2HV6A 3GEHA 3H2UA 2R05A 4J7YA 5COGA 3HNKA 2HKVA 4JC7A 4O6MA 1OCZC 2IM8A 1AVOB 2VB6A 3FOPA 3K1HA 3DE8A 4Q7CA 3ZC4A 1LKXA 4YJWA 3U0CA 2R7TA 3K33A 2WZFA 2EPMX 3X1OA 1T9KA 2Z15A 2YHSA 1J8YF 3C18A 4I44A 3DZAA 5A6JA 1A41A 2L6GA 3LLKA 3L0IA 4P6IC 1LM3B 1QVXA 3JTLO 1VLTA 1Q0FA 4DRHB 4EIYA 1M2VA 1VLSA 2YL3A 3WAQA 3MX3A 5TJ5E 4PFPA 4RBNA 5AC5A 4ULWA 1A0BA 2PF4E 3FXHA 2AU5A 3V5ZA 3ZQVA 4E18A 5A6KA 4XPWA 4JZAA 4ONSA 1G4US 1HE1A 2J9BA 2KC3A 2GDCA 3ASNC 4YWQA 1OXKA 2R7QA 4GQHA 4GYTA 5COMA 5KYUA 4HFKB 3H65A 4BG0A 2E87A 1IZMA 2O9XA 3EHNA 1BBHA 2YQYA 3FMSA 3G50A 3CQZA 1ZW2A 1WOLA 4MTGA 4Q5SF 2DB4A 2KYHA 4IJJA 5E3CA 3JZ0A 5GPGB 1WN0A 3T6JA 3OEOA 2LFDA 3KL4A 4JKVA 3ABMC 4GEHA 3RQGA 1YVIA 2NUTB 3RQFA 3ZQYA 2LFFA 4CS9A 3S84A 2ICWG 4BJ6A 1U6HA 2EIJC 1ZHWA 3CAXA 2ETSA 3EJNA 4EBJA 1AUEA 5D91A 4IRUA 3NKEA 4LACB 4Z9HA 4XEVA 2GAQA 3S27A 1D1AA 4NCQA 1PCXA 3KPHA 3K66A 2F22A 4DJ9A 4U9EA 3NMIA 4EHPA 3ZG1A 1NFNA 5K0IA 3TJ5A 2XM4A 1WATA 4KNWA 4MVMA 2EPKX 4XPXA 3RVYA 1R4TA 3X2QC 4C3BA 1LVKA 1MNDA 5EHHA 2JD3A 1I4ZA 1LS1A 2J0WA 4L6RA 1FMVA 1HW1A 3RFYA 5EK0A 2Y3BA 4AX2A 4NQFA 4BJTA 3KYJA 4QI0A 3TOMA 2A6EF 1YAUO 2C04A 3NG1A 4U5EE 4CBEA 4WJ0A 4EUKB 1RKCA 3JRMO 2WZLA 3VF0A 4C7OB 3V5YA 5B3IA 3NMKA 3US6A 1ZZPA 1MMGA 4AL1A 4ER9A 1M2OA 5JLIA 1PD1A 1YYXA 2J8WA 2UUIA 2H7BA 2P6VA 4EKWA 1MNEA 2XM0A 2VCAA 4O6YA 3NMJA 4WGZA 5JVEA 3S90A 4OIQF 1WGWA 3Q7GA 2CGEA 2P0NA 3EGDA 3MLGA 4IARA 4MTFA 1HMDA 2PX3A 3U9MA 1M6TA 3M1CB 5L0FA 1C03A 3U8VA 1BR2A 3DAFA 5B3SC 3GM2A 4CJGA 5B1BC 3I5PA 1VMAA
chains in the Genus database with same CATH topology
2OQMA 2QNLA 2P1AA 3GORA 5COFA 2NSFA 3CEXA 3DI5A 4N6CA 1RXQA 3DKAA 5CIVA 2OU6A 2F22A 5COGA 2QE9A 2HKVA 5COMA 2RD9A 3QTHA 2YQYA 2NSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQM A;  2QNL A;  2P1A A;  3GOR A;  5COF A;  2NSF A;  3CEX A;  3DI5 A;  4N6C A;  1RXQ A;  3DKA A;  5CIV A;  2OU6 A;  2F22 A;  5COG A;  2QE9 A;  2HKV A;  5COM A;  2RD9 A;  3QTH A;  2YQY A;  2NSG A; 
#chains in the Genus database with same CATH topology
 3GM3 A;  2XL4 A;  2A0B A;  3QW0 A;  3LNM B;  4MS2 A;  1EI7 A;  5BQH A;  4XLP F;  2IXP A;  3C8Z A;  3DWW A;  1BR4 A;  1XWJ A;  2A1D D;  4BJ5 C;  4JJG A;  2IOQ A;  2YL1 A;  5BQI A;  2CW0 F;  1ZW3 A;  1M2V B;  4AL0 A;  2OJE D;  4JVS A;  5AC4 A;  3AJM A;  3UMI A;  3AG1 C;  4LDK A;  2J7P D;  2HJ3 A;  1PD0 A;  3TOL A;  2J7P A;  1MMA A;  3DJN B;  3QVY A;  1ORJ A;  4D4N A;  4AK9 A;  1GM5 A;  1D1C A;  3ECS A;  5T3T A;  1VYK A;  3ZIB A;  5JS5 A;  5KYU B;  1TWA A;  3EGX A;  4Z9J A;  1PV3 A;  3Q6M A;  4JW1 A;  4PJN A;  4YL1 A;  5L0C A;  2KJG A;  3SXK A;  2NUP A;  3H2V A;  3MYI A;  4DRJ B;  3FDQ A;  4CDA A;  3NYM A;  3EQL F;  1L7C A;  1V54 C;  2D4U A;  4YL0 A;  2J9U A;  3W4Y A;  4WAB A;  2AVK A;  1G8X A;  3U5S A;  2VH3 A;  3LJB A;  5IY5 C;  1Z7Q c;  2R7U A;  4IB4 A;  2VCC A;  2YEV A;  5COF A;  3IQT A;  1AEP A;  3TUL A;  3W8I A;  3GOD A;  1FMW A;  3HNI A;  4MTO A;  3RW0 A;  3B29 A;  3S0X A;  5E33 A;  1BZ4 A;  2J9V A;  4YT5 A;  2YL7 A;  4G0H A;  1LIH A;  4NTB A;  5L0J A;  2KGO A;  5DS6 A;  1RCP A;  3F46 A;  1LS4 A;  2AWY A;  3R2P A;  3U3B A;  1RMV A;  2L6F A;  2J46 A;  2YKZ A;  2QE9 A;  3LEV A;  4K7B A;  1EQ1 A;  2XLV A;  2BC5 A;  4K1O A;  4CS8 C;  1JMW A;  4NTF A;  1OQC A;  4QDL A;  5BQG A;  3EHM A;  3N0T A;  4FWV A;  2J0X A;  4NTA A;  1VOM A;  3ZTZ A;  1K05 A;  1TWG A;  2PFD A;  3AGT A;  3L34 A;  5AGF A;  3ATP A;  4MVS A;  1HE9 A;  4R32 A;  5FZT A;  3EH1 A;  2CDQ A;  2XXA A;  2Q00 A;  3S29 A;  5F5H A;  4PJM A;  3EFO A;  4Q4Z F;  1O87 A;  1QKR A;  1QSP A;  4JE9 A;  4MVO A;  1NU7 D;  3JYH A;  3UNG C;  2ZXO A;  5DVW A;  3V7O A;  3DI5 A;  4A4A A;  2XLE A;  1ZU4 A;  3S9O A;  4LER A;  5A6A A;  1RXQ A;  2OCC C;  3FVY A;  4XWJ A;  1LE2 A;  2MWQ A;  3OWT A;  2BE5 F;  5CI9 A;  5D92 A;  4N06 A;  5JSL A;  4DOZ A;  1JAF A;  2Q3T A;  2WL8 A;  4G7H F;  2Q4F A;  5EGY A;  3Q6N A;  256B A;  3S28 A;  2W4B A;  3SXZ A;  1WWP A;  2KQ9 A;  2LSE A;  4E17 A;  4KC9 A;  1HY5 A;  3SYN A;  3EGD B;  5KYX B;  4U5D E;  2G62 A;  1NSG B;  2OOC A;  2Y3D A;  3GAN A;  4PR9 A;  2NG1 A;  3HNJ A;  2EIM C;  4C3D A;  1K04 A;  3B71 A;  2I8B A;  2GFH A;  5L3V A;  1O3U A;  3IQ5 A;  1NZE A;  4LDQ A;  2YL0 A;  2XRH A;  1QLE C;  2QLA A;  5E2Q A;  1I5N A;  3KH2 A;  2ZPA A;  4J30 B;  4U5G A;  3SXY A;  1T6Q A;  4E0H A;  1O5H A;  1GGQ A;  5L3Q A;  2NSF A;  2RSE B;  4P9T A;  2XLW A;  4I3M A;  1APC A;  3N24 A;  1H9G A;  3JT1 A;  1VK5 A;  3WHN A;  1A7D A;  1S7Z A;  3O39 A;  5CIV A;  2OEX A;  3OA1 A;  1SMY F;  4W8K A;  3ABK C;  3C7J A;  3FAP B;  4U5B E;  3F47 A;  1SYQ A;  2OU6 A;  2R7R A;  1JR8 A;  3CZ6 A;  3PDM P;  2WZG A;  3EGX B;  2LK4 A;  3SXM A;  3RF3 A;  2R25 A;  5E3A A;  4CDV A;  1ST6 A;  2L7A A;  2JPU A;  2KSF A;  3PMR A;  1RKE A;  4ANJ A;  1NU9 C;  1UG7 A;  2RD9 A;  3IPM O;  2A69 F;  2NUP B;  3JYY A;  2B0H A;  1F1M A;  3L1M A;  3AQC A;  2UUH A;  5F28 E;  3RH3 A;  1JPJ A;  4BJ5 A;  4KI2 A;  3VRC A;  2Q9B A;  1SR2 A;  2AWC A;  1GS9 A;  2DYR C;  2YLD A;  2LP4 A;  3FHD A;  4MVU A;  2HV7 A;  2YWA A;  2XS1 A;  5F5F A;  3GOR A;  1YZA A;  1FTS A;  4BPM A;  5L0I A;  2OKU A;  4JTA B;  4H54 A;  1D1B A;  2J45 A;  3BRJ A;  4N4W A;  2R7S A;  2XLO A;  2YLI A;  3QVZ A;  5L0H A;  4MW8 A;  1H9T A;  3G4Z A;  4E0I A;  2KW3 C;  5JT4 A;  2XSE A;  1HMO A;  1MMD A;  3DM9 B;  2EIN C;  2ZXP A;  3K6B A;  2FGY A;  3NYJ A;  3RVZ A;  2PNO A;  4LDR A;  3NYL A;  5DS4 A;  4W8P A;  1V55 C;  1TFK B;  3DE9 A;  3ZVR A;  4JRZ A;  1A7V A;  3K1I C;  1J8M F;  4MVZ A;  1UFB A;  2IYL D;  2OJQ A;  2PBE A;  5KYX A;  3FOO A;  1CGM E;  2HMQ A;  1ZYR F;  3DMD A;  2HSQ A;  2H7O A;  3HTK C;  1SZI A;  3L8I A;  1D0X A;  2XXA B;  5FCL A;  4PAC A;  1NFO A;  2Y69 C;  2PX0 A;  3EFO B;  3MYF A;  1Z3I X;  3RQE A;  2PP4 A;  5JRA A;  4IAQ A;  1QQ3 A;  2M64 A;  4IGG A;  1VTM P;  4NC3 A;  1Q0D A;  2Q7R A;  1TWC A;  5B1A C;  1Z63 A;  1OW6 A;  1C17 M;  2BL2 A;  3TQO A;  4CS8 A;  2JX0 A;  1OKK D;  3RYL A;  2R9R B;  4QI2 A;  3HNL A;  1OKK A;  1W2W A;  2ZXR A;  4U5C E;  1YA9 A;  2LD6 A;  3PHF 2;  1VYI A;  2CNW D;  3KYI A;  5BUO A;  2HMZ A;  1A7E A;  3I4U A;  5JP7 A;  1Z5Z A;  2EIK C;  2CNW A;  4OD5 A;  4DVZ A;  3LES A;  1YLM A;  2FAP B;  2LQG A;  4PJJ A;  2A6H F;  4CJO A;  1TQG A;  1NBB A;  3HLZ A;  2XL6 A;  1ZHX A;  1OCC C;  1T6I A;  2OQM A;  3Q7L A;  4YT8 A;  2YZS A;  3EH2 A;  3W2W A;  1WTY A;  1EA8 A;  3VAY A;  1LI5 A;  4RD9 A;  2EIL C;  1NG1 A;  3UMH A;  3W8H A;  4KNV A;  4RDA A;  1H6G A;  3DJU B;  2V3C C;  1FFT C;  2TMV P;  2EPL X;  4BEJ A;  1YDI A;  4XPY A;  3IQ6 A;  3LLI A;  1Y4C A;  3B0U X;  4YN0 B;  3KMI A;  1M57 C;  3JCU Q;  2IXO A;  3ZTM A;  2R03 A;  4B6I A;  5KYY A;  2R7X A;  1TWH A;  2ZD9 A;  2QTV A;  4MVQ A;  4EWC A;  4I1M A;  1RKE B;  2G3K A;  2R7O A;  3VYW A;  1ORS C;  2Q9C A;  4CIH A;  5DLJ A;  4OD4 A;  2W9Y A;  4DBR A;  1ZHZ A;  2FFH A;  4JUR I;  4Z9I A;  3JRT A;  2YLG A;  2NSG A;  3B0P A;  3ZSU A;  2QNL A;  4XEF A;  1T5O A;  1G4W R;  3U2L A;  2C03 A;  2M4E A;  4EBB A;  3POV A;  2XLM A;  2H8A A;  3NRH A;  3V5X A;  3U2M A;  4JIO A;  2DGJ A;  4ZLD A;  1FR0 A;  3E70 C;  1H7I A;  1OW8 A;  1DOW A;  1WAS A;  3AGU A;  3C8G D;  4ZLC A;  1SF8 A;  3QW1 A;  2DI3 A;  3C8G A;  1QPU A;  1FFH A;  4J7T A;  1FAP B;  4MQ9 F;  3LEO A;  4U5H A;  1C02 A;  1ZVZ A;  3A9C A;  4LLE A;  2Y3G A;  1EKY A;  2KNH A;  4CIP A;  5L0D A;  3EPV A;  4DRI B;  4JJF A;  3PCV A;  3U3F A;  1GQA A;  3MBG A;  4PK4 A;  2WVN A;  1CGO A;  4FX5 A;  3EZI A;  4K0D A;  4I1O B;  4CDY A;  4UDV A;  3TD7 A;  3O55 A;  1U0B B;  3QTH A;  2A68 F;  3C63 A;  1IW7 F;  4H4K C;  4MND A;  3ABL C;  1LPE A;  4XTK A;  2X0C A;  4G7Z F;  3LNR A;  2A0U A;  3AOU A;  4MVR A;  2WVQ A;  3FAJ A;  1BR1 A;  2CCY A;  3GWL A;  3LAY A;  4FES A;  1D0Z A;  1YZC A;  4CSA C;  3AG3 C;  2R7V A;  1S05 A;  4IAO A;  2GA0 A;  1Q0G A;  5HSW A;  4G7O F;  1Z6A A;  3TJ6 A;  2HS5 A;  5CI8 A;  4JCH A;  2KK1 A;  3QMK A;  4F4B A;  1DOV A;  3M15 A;  1T01 A;  3ZWI A;  2XS8 A;  1FNT c;  2P61 A;  1OCR C;  3IQC A;  3K1I A;  4JTD B;  2XL8 A;  3WOD F;  4DBQ A;  5KYW B;  1KNY A;  4OIR F;  3GEE A;  4HFF B;  4AE4 A;  2EPO A;  4ULV A;  2GWW A;  4OIN F;  5JUA A;  1ZHT A;  1OR3 A;  1RJ9 A;  2XLH A;  4XEK A;  3RIP A;  2HJM A;  3O6X A;  4N6H A;  1VB5 A;  4YT4 A;  1E84 A;  3LUT B;  1E86 A;  2HFI A;  2MHR A;  1CPQ A;  3EZH A;  3IHU A;  1K40 A;  1QZX A;  2D5R B;  3M4B A;  2HZ8 A;  2L81 A;  3KKB A;  4U9D A;  1JPN A;  3G4X A;  4OIO F;  1E2X A;  5T3W A;  1YJG A;  5A69 A;  2QY9 A;  4A2N B;  3DAG A;  3M4C A;  4JTC B;  3DD7 A;  3ASO C;  3U8P A;  1JOG A;  2DYS C;  3EG9 A;  3UR3 C;  5L0G A;  3HKK A;  5KYN A;  1BDJ B;  1OR2 A;  1TFO B;  4PJL A;  5KYY B;  3U9J A;  2HUJ A;  1YYJ A;  3NDB B;  4J32 B;  4U5F E;  1I4Y A;  1LE4 A;  2W45 A;  3MFN A;  4MW3 A;  3T6B A;  3NKD A;  3O10 A;  5HV9 A;  4HEA J;  3HJC A;  3C62 A;  4G78 A;  2ASR A;  4CS7 A;  3B9Q A;  4O6N A;  2EPN A;  3R7C A;  2R7W A;  2X51 A;  2B0J A;  2NPU A;  3T9O A;  3UMK A;  1MMN A;  2P7V A;  2YRF A;  3L8J A;  2L9J A;  1ZU5 A;  2L6H A;  3CSK A;  4N6C A;  5DQT A;  3UGO A;  4JCZ A;  4C3E A;  3C8G B;  2J9W A;  2VAS A;  4CS9 C;  3VM6 A;  1MQV A;  3I5Q A;  3LS1 A;  1U89 A;  4BJ6 C;  2LCH A;  3K7D A;  5DQZ A;  3T6G B;  1OW7 A;  1TKN A;  2V26 A;  3DM5 A;  4BJ1 A;  1Q0K A;  3SZR A;  1Y6D A;  2I15 A;  3A11 A;  3M79 A;  1ZHY A;  4JEB A;  4M63 A;  5T1D B;  1NLX A;  3TK0 A;  2WVO A;  5KYW A;  3GEI A;  3QZC A;  2IXM A;  1YA7 O;  3N2Z B;  1OXB A;  4KBL A;  5DS5 A;  1V4A A;  4XLN F;  1Z23 A;  2OEV A;  3GWN A;  4DVY P;  1L3P A;  3JSE O;  1CPR A;  4IWB A;  3SP1 A;  4P9F A;  1M56 C;  2P1A A;  4CX9 A;  4D4X A;  2AP3 A;  4YK5 A;  1KTM A;  3IEE A;  3T4R A;  4E7Z A;  3AG4 C;  4BEM J;  3LS0 A;  4WGY A;  2NUT A;  4JEA A;  2MYS A;  2XLD A;  4XQ1 A;  3E9V A;  4EBK A;  1Q0M A;  2VC9 A;  2Q9A A;  1OCO C;  4X0R A;  4DXW A;  1HW2 A;  3RKO F;  4YL3 A;  3B0V C;  5A6B D;  4YT2 A;  1R5I D;  4E7S A;  2R02 A;  5A6B A;  2WB7 A;  2Y39 A;  2G3V A;  1XZP A;  1XZQ A;  4LLC A;  1T6U A;  4AE4 B;  3GM1 A;  2IXN A;  2LIG A;  2CYD A;  1E85 A;  1TR2 A;  3SEO A;  1RJ9 B;  3J06 A;  3WG7 C;  2W4M A;  1ORY A;  4CSA A;  1G5Z A;  4OIP F;  2QUP A;  3UGP A;  2Y3H A;  4PFO A;  3JSZ A;  4O7G A;  3ITF A;  1V74 B;  1YAR O;  2VCB A;  3DXJ F;  3ZDL A;  1N1C A;  2YVK A;  2IBF A;  1E83 A;  2OG2 A;  3CEX A;  1KU2 A;  4C7O A;  3SNH A;  1CGN A;  3AQB A;  1B68 A;  1JRA A;  3DKA A;  4NY3 A;  3EG9 B;  3AG2 C;  1D0Y A;  4O79 A;  3W2V A;  2ZXW C;  4HE8 D;  1LI7 A;  4FAP B;  3BEH A;  2HSB A;  2H7V C;  2HV6 A;  3GEH A;  3H2U A;  2R05 A;  4J7Y A;  5COG A;  3HNK A;  2HKV A;  4JC7 A;  4O6M A;  1OCZ C;  2IM8 A;  1AVO B;  2VB6 A;  3FOP A;  3K1H A;  3DE8 A;  4Q7C A;  3ZC4 A;  1LKX A;  4YJW A;  3U0C A;  2R7T A;  3K33 A;  2WZF A;  2EPM X;  3X1O A;  1T9K A;  2Z15 A;  2YHS A;  1J8Y F;  3C18 A;  4I44 A;  3DZA A;  5A6J A;  1A41 A;  2L6G A;  3LLK A;  3L0I A;  4P6I C;  1LM3 B;  1QVX A;  3JTL O;  1VLT A;  1Q0F A;  4DRH B;  4EIY A;  1M2V A;  1VLS A;  2YL3 A;  3WAQ A;  3MX3 A;  5TJ5 E;  4PFP A;  4RBN A;  5AC5 A;  4ULW A;  1A0B A;  2PF4 E;  3FXH A;  2AU5 A;  3V5Z A;  3ZQV A;  4E18 A;  5A6K A;  4XPW A;  4JZA A;  4ONS A;  1G4U S;  1HE1 A;  2J9B A;  2KC3 A;  2GDC A;  3ASN C;  4YWQ A;  1OXK A;  2R7Q A;  4GQH A;  4GYT A;  5COM A;  5KYU A;  4HFK B;  3H65 A;  4BG0 A;  2E87 A;  1IZM A;  2O9X A;  3EHN A;  1BBH A;  2YQY A;  3FMS A;  3G50 A;  3CQZ A;  1ZW2 A;  1WOL A;  4MTG A;  4Q5S F;  2DB4 A;  2KYH A;  4IJJ A;  5E3C A;  3JZ0 A;  5GPG B;  1WN0 A;  3T6J A;  3OEO A;  2LFD A;  3KL4 A;  4JKV A;  3ABM C;  4GEH A;  3RQG A;  1YVI A;  2NUT B;  3RQF A;  3ZQY A;  2LFF A;  4CS9 A;  3S84 A;  2ICW G;  4BJ6 A;  1U6H A;  2EIJ C;  1ZHW A;  3CAX A;  2ETS A;  3EJN A;  4EBJ A;  1AUE A;  5D91 A;  4IRU A;  3NKE A;  4LAC B;  4Z9H A;  4XEV A;  2GAQ A;  3S27 A;  1D1A A;  4NCQ A;  1PCX A;  3KPH A;  3K66 A;  2F22 A;  4DJ9 A;  4U9E A;  3NMI A;  4EHP A;  3ZG1 A;  1NFN A;  5K0I A;  3TJ5 A;  2XM4 A;  1WAT A;  4KNW A;  4MVM A;  2EPK X;  4XPX A;  3RVY A;  1R4T A;  3X2Q C;  4C3B A;  1LVK A;  1MND A;  5EHH A;  2JD3 A;  1I4Z A;  1LS1 A;  2J0W A;  4L6R A;  1FMV A;  1HW1 A;  3RFY A;  5EK0 A;  2Y3B A;  4AX2 A;  4NQF A;  4BJT A;  3KYJ A;  4QI0 A;  3TOM A;  2A6E F;  1YAU O;  2C04 A;  3NG1 A;  4U5E E;  4CBE A;  4WJ0 A;  4EUK B;  1RKC A;  3JRM O;  2WZL A;  3VF0 A;  4C7O B;  3V5Y A;  5B3I A;  3NMK A;  3US6 A;  1ZZP A;  1MMG A;  4AL1 A;  4ER9 A;  1M2O A;  5JLI A;  1PD1 A;  1YYX A;  2J8W A;  2UUI A;  2H7B A;  2P6V A;  4EKW A;  1MNE A;  2XM0 A;  2VCA A;  4O6Y A;  3NMJ A;  4WGZ A;  5JVE A;  3S90 A;  4OIQ F;  1WGW A;  3Q7G A;  2CGE A;  2P0N A;  3EGD A;  3MLG A;  4IAR A;  4MTF A;  1HMD A;  2PX3 A;  3U9M A;  1M6T A;  3M1C B;  5L0F A;  1C03 A;  3U8V A;  1BR2 A;  3DAF A;  5B3S C;  3GM2 A;  4CJG A;  5B1B C;  3I5P A;  1VMA A; 
#chains in the Genus database with same CATH homology
 2OQM A;  2QNL A;  2P1A A;  3GOR A;  5COF A;  2NSF A;  3CEX A;  3DI5 A;  4N6C A;  1RXQ A;  3DKA A;  5CIV A;  2OU6 A;  2F22 A;  5COG A;  2QE9 A;  2HKV A;  5COM A;  2RD9 A;  3QTH A;  2YQY A;  2NSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...