2QNLA

Crystal structure of a putative dna damage-inducible protein (chu_0679) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
162
structure length
162
Chain Sequence
GMHTQEALFVRLALDAWNTQSSRTDKLIQSLSNEALAVETAPGRNSGTYLLGHLTAVHDAMLPLLELGDTLYPQLAPVFIQNPDKSGLEKPEINDLRLYWSLVQERLANQFNQLQPADWFNKHAAISREDFLKEPHRNKLSVLINRTNHMAYHLGQLAYLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of uncharacterized protein CHU_0679 (YP_677306.1) from Cytophaga hutchinsonii ATCC 33406 at 1.50 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
molecule tags Signaling protein
total genus 58
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12867 DinB_2 DinB superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2qnlA00
2QE9A 2HKVA 2RD9A 2NSGA 3CEXA 2NSFA 2YQYA 5COGA 2P1AA 4N6CA 2F22A 3DKAA 1RXQA 2OQMA 5COFA 5CIVA 3DI5A 2OU6A 3GORA 3QTHA 2QNLA 5COMA
chains in the Genus database with same CATH superfamily
2Q4FA 3L8JA 1RKCA 4O7GA 4OIPF 1RKEB 2HV7A 1WTYA 2RD9A 4Q5SF 3AG3C 4M63A 3I5PA 4XWJA 3TOLA 4G7HF 3C7JA 4K7BA 2EPKX 2Q3TA 1LI5A 1BR4A 4PR9A 2A68F 4OD4A 4AE4A 1VLTA 4CIHA 2IXMA 1HW2A 1QVXA 1I5NA 2ICWG 3ZTZA 3ZC4A 2BE5F 2GA0A 3QMKA 4U5HA 1VMAA 4JJGA 4CDVA 2R7SA 3EHMA 4L6RA 4XQ1A 1BBHA 1YAUO 1T9KA 3M4BA 4ZLDA 1LI7A 4F4BA 5KYXB 1VTMP 2WL8A 1BR1A 3AGUA 3ASNC 3S90A 1H6GA 1Y4CA 3PCVA 4WABA 4NC3A 5COMA 4ONSA 4N6HA 2J9BA 1YARO 3W2VA 3OA1A 4Q7CA 3RQFA 3DZAA 5A6JA 4JC7A 1L3PA 3ZIBA 2XS1A 4QDLA 3RYLA 2WZFA 1TWAA 1YZAA 4J7YA 1A0BA 1FFHA 2J9UA 3LUTB 4Z9IA 2EIKC 2G3VA 4JVSA 2BC5A 4JCHA 3AG4C 1TFKB 2WVQA 1J8MF 1QQ3A 3FVYA 3HNKA 5E3AA 4G78A 3VM6A 1E84A 3EG9B 1RKEA 3IQ6A 5F5FA 5DS4A 2LK4A 5A6BA 1FFTC 3G4XA 4LDRA 2OEVA 4RDAA 1A7EA 1MMNA 4WJ0A 5KYWA 1JPNA 1LPEA 1A7DA 4B6IA 2LQGA 2R25A 2QE9A 3A9CA 1OW8A 4OIRF 5DQZA 3JT1A 5JLIA 3CEXA 4O79A 1U6HA 3MYFA 1C02A 3DAFA 4K0DA 3V7OA 1TR2A 3O6XA 5IY5C 1F1MA 1VOMA 1WOLA 4EBKA 3IPMO 2EPOA 2G3KA 4JIOA 2OKUA 3DKAA 3QVZA 4U5FE 1V55C 1OW7A 3RQEA 3AGTA 4E0HA 1Q0FA 1D1CA 1EKYA 4W8KA 1RXQA 2CNWA 1ZZPA 2L6HA 3LESA 3O39A 1Z6AA 3Q6NA 4PACA 1G4US 2AWCA 3VRCA 4P9TA 2GAQA 2Y3HA 1TQGA 3NKDA 5GPGB 3CQZA 1LS4A 4MVUA 2QLAA 3ECSA 4IAQA 2LFDA 2Q7RA 2X0CA 4ANJA 4DBQA 3U2LA 1M2OA 2KK1A 3DE8A 1QSPA 3AG2C 1EI7A 1DOWA 1YA9A 4FX5A 2HJ3A 1SYQA 2OJED 2HKVA 4U9EA 2YEVA 5B3SC 3GODA 1M2VB 5BUOA 2NSGA 4R32A 3NYMA 1KTMA 1T6IA 3JZ0A 3WG7C 4E7ZA 2MYSA 2EIMC 3U8VA 4PFOA 1ST6A 3SXMA 5KYYB 3MFNA 2GFHA 1KU2A 2Z15A 3FOOA 4CSAA 3LLIA 3RVYA 1DOVA 3DXJF 3GM3A 2IBFA 3ATPA 4U9DA 3C8ZA 4KC9A 2B0JA 2E87A 2OOCA 1EQ1A 3R2PA 4NTFA 3L0IA 1MMAA 3NMJA 3B29A 4I1MA 3NMIA 4G7OF 2OU6A 3X2QC 3LEVA 1OQCA 5KYUB 4BG0A 3H2VA 1MQVA 1YA7O 5FCLA 3LAYA 1LE2A 1M56C 3QTHA 4EBBA 2O9XA 4IAOA 3R7CA 3UMHA 3UR3C 2XXAA 4KBLA 3W8HA 2HJMA 2VCAA 3CSKA 1AUEA 4CX9A 4DXWA 2IXPA 2GWWA 5A6AA 3CAXA 2R7VA 3GM2A 3QW1A 1K40A 2YQYA 1E85A 2XS8A 4XLPF 3RW0A 2B0HA 4N6CA 1ZHYA 1V54C 3EPVA 2J0WA 2YRFA 3BRJA 1Z63A 3JYYA 4I3MA 4EKWA 1OR3A 3T6JA 3B0VC 3L8IA 5CI8A 5E3CA 2EINC 3W8IA 4AL1A 4BJ5A 4CDYA 4KNWA 5JSLA 3HNLA 5DS6A 3POVA 1M2VA 2YL7A 3RQGA 1V4AA 3S28A 5FZTA 3K1IA 2YL0A 3T9OA 1NFNA 4J32B 1OR2A 3PHF2 1JMWA 3T4RA 1FMWA 4DRIB 3EJNA 1YDIA 2HMZA 2A0BA 1TWGA 3EZIA 4CDAA 4XEFA 3SXZA 2G62A 2BL2A 4MW3A 3IEEA 5TJ5E 1QZXA 3S27A 3W4YA 4MS2A 1M57C 2ZXWC 3TK0A 4C3EA 2EPMX 4IB4A 5L0DA 1Q0MA 1VLSA 3HJCA 3GANA 3OWTA 2KC3A 5KYUA 4UDVA 3TJ5A 3UNGC 2OG2A 2IOQA 2WVOA 3KYIA 4N4WA 4ULWA 2IM8A 3RFYA 4E18A 2J7PD 2YVKA 2EPLX 2V3CC 2UUIA 3DWWA 4DRHB 1K04A 4CS8C 2Q00A 1LM3B 2R05A 1XWJA 3Q7GA 2UUHA 5L0IA 3V5XA 5DQTA 1ZHWA 2HMQA 2L81A 3LNMB 3U9JA 2H8AA 1OCZC 2XM4A 3TQOA 4PJJA 1I4YA 3AQCA 4I44A 3E9VA 3WAQA 4HEAJ 1Z23A 1G5ZA 1ZU5A 1S7ZA 1VYIA 2P1AA 2HSBA 4CS9A 3WHNA 5EK0A 5BQHA 1IW7F 3B71A 2LP4A 2OEXA 4EBJA 2YLIA 3KYJA 4CSAC 3JCUQ 2FAPB 2L6FA 4MTFA 3LNRA 1I4ZA 256BA 4O6NA 4JE9A 1PCXA 1HE1A 2D4UA 2YLGA 4P6IC 4Q4ZF 1G4WR 5BQGA 4YT8A 3K6BA 3ITFA 1OCCC 1T5OA 2YL3A 1SZIA 3GORA 3ZG1A 1XZPA 2H7OA 3DE9A 1D1AA 4BJ6A 3S0XA 1OKKD 1WGWA 2DYSC 3GM1A 3K66A 1WATA 2HV6A 3C8GD 3Q6MA 3EQLF 4C3BA 5L0GA 3QW0A 1D0YA 3M4CA 1WN0A 2VB6A 4XEVA 1M6TA 4E17A 4Z9JA 1MMGA 4NTBA 3DJUB 2CW0F 3K7DA 1HY5A 2RSEB 2DI3A 5A6KA 3B0UX 3JSEO 4FWVA 2H7VC 2FFHA 2YHSA 3K33A 3NYJA 3A11A 2CGEA 1IZMA 2PNOA 1ZHZA 5L0CA 2XXAB 5K0IA 2L7AA 2P0NA 3G50A 2TMVP 4BJ5C 5D92A 1YZCA 5COFA 4AL0A 1CGME 2W9YA 4MVQA 4O6MA 1JAFA 2AVKA 4PFPA 4BEJA 4BPMA 1E83A 3NRHA 5JRAA 3K1IC 2MWQA 1PV3A 1Z3IX 2DGJA 3LEOA 1Q0DA 3U5SA 5EHHA 5L3VA 3EGXA 3KL4A 1ORYA 5T3TA 2XLWA 3HTKC 5JT4A 2A69F 4FESA 2VCCA 4C3DA 3C62A 4BJTA 2Q9CA 2CDQA 3F46A 3LJBA 2A6HF 4J30B 2IYLD 3JTLO 3MLGA 5T1DB 5A69A 4O6YA 1VK5A 3I5QA 1MMDA 2PFDA 4YL0A 1S05A 1QLEC 2W4BA 1AVOB 4U5EE 4FAPB 2EIJC 2D5RB 3TOMA 3RIPA 1A41A 4LACB 2QTVA 4NCQA 2R7OA 2Y69C 2OQMA 1LIHA 3FAJA 3VF0A 4IWBA 3FXHA 2L9JA 4EUKB 4E0IA 4GYTA 1ZU4A 3FMSA 2L6GA 2XSEA 2R7TA 1LE4A 3JRMO 5KYWB 1ZVZA 1RCPA 2YL1A 2HUJA 3PMRA 2QNLA 1GS9A 2J8WA 5DVWA 4G7ZF 2JD3A 2XLHA 5JUAA 1FNTc 4QI0A 2ZPAA 3AOUA 2PX3A 3X1OA 4LLCA 3NYLA 3QZCA 4MVZA 3RF3A 1MNDA 4CS9C 3SNHA 4XEKA 3UGOA 1NLXA 4CS7A 1RJ9A 4OD5A 3AJMA 4E7SA 4H54A 2KSFA 1C17M 2ASRA 1T6QA 1TFOB 2JPUA 4JCZA 3VAYA 2J9WA 3S29A 3ZTMA 1ORSC 5CIVA 5D91A 5L0JA 5L0HA 2PF4E 4J7TA 3I4UA 3HLZA 4LDQA 3JYHA 3UMIA 3EH2A 1K05A 2QUPA 3IHUA 1R4TA 2C04A 4BJ6C 1ZW3A 1Q0KA 2X51A 2W4MA 3DJNB 4MQ9F 5DS5A 4HFKB 4NY3A 3GWNA 2XRHA 1HMOA 2LSEA 3V5YA 1V74B 1OCOC 2Q9AA 1ZYRF 5L0FA 3E70C 1Y6DA 5T3WA 4DBRA 4CBEA 3S84A 4AK9A 3SYNA 3ZQVA 2Q9BA 5E33A 3GWLA 3RH3A 1YJGA 4K1OA 2LFFA 3SZRA 1LVKA 3SXKA 2P61A 1NU7D 3B0PA 1O3UA 2EILC 1FAPB 4G0HA 4GEHA 3JSZA 3QVYA 2XLMA 3MBGA 4RD9A 3T6GB 3US6A 4ZLCA 4YT4A 1Q0GA 1MNEA 2R03A 3EH1A 4LERA 2A1DD 2Y39A 3C18A 3ABKC 1L7CA 4HE8D 3KPHA 2AP3A 2V26A 3HKKA 3L34A 4JTCB 3G4ZA 2ZXRA 5E2QA 4JURI 4JTDB 2WZGA 5B3IA 1PD1A 4YN0B 1R5ID 1E2XA 2WVNA 3TJ6A 1GQAA 2NUPB 4U5DE 2J45A 1YLMA 3KKBA 4YL1A 3SEOA 1O87A 4BJ1A 4DJ9A 3HNIA 4DVZA 1OXKA 4YWQA 1QPUA 2YWAA 3T6BA 2R7XA 2Y3GA 4YL3A 2Y3BA 3ZDLA 4JRZA 1W2WA 4DRJB 4ER9A 4Z9HA 3J06A 1WWPA 2F22A 4U5GA 1WASA 2AWYA 4U5BE 4EHPA 4OINF 4NQFA 3U2MA 1FMVA 2KYHA 1NBBA 3EGXB 3C8GB 4A4AA 1NG1A 5F28E 4JZAA 2J7PA 1D1BA 1LKXA 1QKRA 2NUTB 2NG1A 5EGYA 1VB5A 2NPUA 5AGFA 3ABLC 4YT5A 5HV9A 4C7OA 2IXOA 2J46A 2KW3C 4IGGA 5A6BD 2YZSA 2QY9A 2LD6A 3ABMC 4IJJA 2OCCC 2CCYA 4PJLA 4EWCA 4EIYA 1OW6A 1JR8A 3RVZA 1SR2A 1NFOA 2I8BA 3EFOA 2CYDA 3ZQYA 4PK4A 2XLVA 4BEMJ 1BDJB 4YK5A 1NU9C 3S9OA 1Z7Qc 3NG1A 2LIGA 1HMDA 1AEPA 1ORJA 2HFIA 3U9MA 1G8XA 1YVIA 3IQTA 3UMKA 2P7VA 2A0UA 3GEHA 1TWCA 2R7QA 1VYKA 4PJNA 4XPXA 2C03A 2KQ9A 3EGDA 2CNWD 2XLDA 3U3FA 4XPYA 3RKOF 1J8YF 3M1CB 4KI2A 1C03A 1T6UA 2NUPA 2LCHA 2HZ8A 1CPQA 2HS5A 3CZ6A 3U0CA 5B1AC 3LS0A 2DB4A 2AU5A 2R7WA 1T01A 2WZLA 2XL4A 4MNDA 5KYNA 5DLJA 1RJ9B 2ZXOA 1HW1A 1APCA 4AX2A 1NSGB 2R9RB 3NKEA 4JEBA 3ASOC 3VYWA 5AC4A 1OKKA 3LLKA 3IQ5A 3C8GA 3AG1C 2R02A 1ZW2A 5CI9A 4MTGA 2XM0A 5JP7A 4RBNA 3N24A 2NUTA 2DYRC 2R7RA 2NSFA 3EHNA 5COGA 2OJQA 1JRAA 4CJGA 3U8PA 3PDMP 2KNHA 4MVRA 2H7BA 5KYXA 4MW8A 2VASA 2GDCA 1BR2A 1LS1A 2XL6A 2MHRA 2YLDA 3EZHA 4P9FA 3FDQA 4ULVA 1UFBA 2PX0A 2ZD9A 5BQIA 3NDBB 4CS8A 2ZXPA 2EPNA 4DOZA 2P6VA 2PBEA 1YYXA 2FGYA 2XLEA 4MVSA 3NMKA 4LDKA 1H7IA 1NZEA 4MTOA 1UG7A 4XTKA 4JJFA 4YJWA 1KNYA 1OCRC 1FTSA 4OIQF 4X0RA 1PD0A 2VC9A 4QI2A 1A7VA 3B9QA 3ZVRA 1U0BB 5L3QA 2A6EF 3EG9A 2R7UA 4PJMA 4D4XA 4GQHA 1SMYF 2VH3A 4N06A 1SF8A 4JTAB 3SP1A 1JPJA 3DD7A 4MVMA 3ZWIA 1CGNA 4U5CE 3OEOA 3WODF 4JKVA 4JW1A 1O5HA 1TWHA 5F5HA 2XLOA 2M64A 5JVEA 3FAPB 3DAGA 4OIOF 4YT2A 5AC5A 3SXYA 4CIPA 1OXBA 3M79A 3FOPA 3M15A 4I1OB 3BEHA 4XPWA 5JS5A 1BZ4A 4HFFB 4CJOA 2JX0A 1H9TA 1GM5A 3W2WA 2W45A 3DMDA 3N2ZB 1ZHXA 4NTAA 4WGZA 3KMIA 2VCBA 3L1MA 4AE4B 2YKZA 1GGQA 3F47A 4IRUA 3HNJA 3LS1A 1XZQA 2KGOA 3MX3A 2I15A 3ZSUA 4DVYP 1CGOA 1CPRA 3KH2A 5B1BC 3GEIA 3IQCA 4XLNF 2J9VA 3V5ZA 5HSWA 1HE9A 1ZHTA 3Q7LA 3TD7A 1D0ZA 2ETSA 3AQBA 3DM9B 1B68A 3H2UA 4C7OB 3FHDA 2Y3DA 2PP4A 3DM5A 3K1HA 4MVOA 4D4NA 1E86A 1Z5ZA 3JRTA 3O10A 3U3BA 3MYIA 2M4EA 2KJGA 1YYJA 4LLEA 3UGPA 2IXNA 3EFOB 4WGYA 4JEAA 3TULA 1FR0A 1H9GA 3DI5A 4A2NB 1RMVA 3C63A 1TKNA 1JOGA 1U89A 4H4KC 2HSQA 4KNVA 1N1CA 1EA8A 3H65A 2XL8A 3N0TA 5KYYA 2WB7A 3GEEA 2J0XA 3O55A 1D0XA 4IARA 4W8PA 3EGDB
chains in the Genus database with same CATH topology
2QE9A 2HKVA 2RD9A 2NSGA 3CEXA 2NSFA 2YQYA 5COGA 2P1AA 4N6CA 2F22A 3DKAA 1RXQA 2OQMA 5COFA 5CIVA 3DI5A 2OU6A 3GORA 3QTHA 2QNLA 5COMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QE9 A;  2HKV A;  2RD9 A;  2NSG A;  3CEX A;  2NSF A;  2YQY A;  5COG A;  2P1A A;  4N6C A;  2F22 A;  3DKA A;  1RXQ A;  2OQM A;  5COF A;  5CIV A;  3DI5 A;  2OU6 A;  3GOR A;  3QTH A;  2QNL A;  5COM A; 
#chains in the Genus database with same CATH topology
 2Q4F A;  3L8J A;  1RKC A;  4O7G A;  4OIP F;  1RKE B;  2HV7 A;  1WTY A;  2RD9 A;  4Q5S F;  3AG3 C;  4M63 A;  3I5P A;  4XWJ A;  3TOL A;  4G7H F;  3C7J A;  4K7B A;  2EPK X;  2Q3T A;  1LI5 A;  1BR4 A;  4PR9 A;  2A68 F;  4OD4 A;  4AE4 A;  1VLT A;  4CIH A;  2IXM A;  1HW2 A;  1QVX A;  1I5N A;  2ICW G;  3ZTZ A;  3ZC4 A;  2BE5 F;  2GA0 A;  3QMK A;  4U5H A;  1VMA A;  4JJG A;  4CDV A;  2R7S A;  3EHM A;  4L6R A;  4XQ1 A;  1BBH A;  1YAU O;  1T9K A;  3M4B A;  4ZLD A;  1LI7 A;  4F4B A;  5KYX B;  1VTM P;  2WL8 A;  1BR1 A;  3AGU A;  3ASN C;  3S90 A;  1H6G A;  1Y4C A;  3PCV A;  4WAB A;  4NC3 A;  5COM A;  4ONS A;  4N6H A;  2J9B A;  1YAR O;  3W2V A;  3OA1 A;  4Q7C A;  3RQF A;  3DZA A;  5A6J A;  4JC7 A;  1L3P A;  3ZIB A;  2XS1 A;  4QDL A;  3RYL A;  2WZF A;  1TWA A;  1YZA A;  4J7Y A;  1A0B A;  1FFH A;  2J9U A;  3LUT B;  4Z9I A;  2EIK C;  2G3V A;  4JVS A;  2BC5 A;  4JCH A;  3AG4 C;  1TFK B;  2WVQ A;  1J8M F;  1QQ3 A;  3FVY A;  3HNK A;  5E3A A;  4G78 A;  3VM6 A;  1E84 A;  3EG9 B;  1RKE A;  3IQ6 A;  5F5F A;  5DS4 A;  2LK4 A;  5A6B A;  1FFT C;  3G4X A;  4LDR A;  2OEV A;  4RDA A;  1A7E A;  1MMN A;  4WJ0 A;  5KYW A;  1JPN A;  1LPE A;  1A7D A;  4B6I A;  2LQG A;  2R25 A;  2QE9 A;  3A9C A;  1OW8 A;  4OIR F;  5DQZ A;  3JT1 A;  5JLI A;  3CEX A;  4O79 A;  1U6H A;  3MYF A;  1C02 A;  3DAF A;  4K0D A;  3V7O A;  1TR2 A;  3O6X A;  5IY5 C;  1F1M A;  1VOM A;  1WOL A;  4EBK A;  3IPM O;  2EPO A;  2G3K A;  4JIO A;  2OKU A;  3DKA A;  3QVZ A;  4U5F E;  1V55 C;  1OW7 A;  3RQE A;  3AGT A;  4E0H A;  1Q0F A;  1D1C A;  1EKY A;  4W8K A;  1RXQ A;  2CNW A;  1ZZP A;  2L6H A;  3LES A;  3O39 A;  1Z6A A;  3Q6N A;  4PAC A;  1G4U S;  2AWC A;  3VRC A;  4P9T A;  2GAQ A;  2Y3H A;  1TQG A;  3NKD A;  5GPG B;  3CQZ A;  1LS4 A;  4MVU A;  2QLA A;  3ECS A;  4IAQ A;  2LFD A;  2Q7R A;  2X0C A;  4ANJ A;  4DBQ A;  3U2L A;  1M2O A;  2KK1 A;  3DE8 A;  1QSP A;  3AG2 C;  1EI7 A;  1DOW A;  1YA9 A;  4FX5 A;  2HJ3 A;  1SYQ A;  2OJE D;  2HKV A;  4U9E A;  2YEV A;  5B3S C;  3GOD A;  1M2V B;  5BUO A;  2NSG A;  4R32 A;  3NYM A;  1KTM A;  1T6I A;  3JZ0 A;  3WG7 C;  4E7Z A;  2MYS A;  2EIM C;  3U8V A;  4PFO A;  1ST6 A;  3SXM A;  5KYY B;  3MFN A;  2GFH A;  1KU2 A;  2Z15 A;  3FOO A;  4CSA A;  3LLI A;  3RVY A;  1DOV A;  3DXJ F;  3GM3 A;  2IBF A;  3ATP A;  4U9D A;  3C8Z A;  4KC9 A;  2B0J A;  2E87 A;  2OOC A;  1EQ1 A;  3R2P A;  4NTF A;  3L0I A;  1MMA A;  3NMJ A;  3B29 A;  4I1M A;  3NMI A;  4G7O F;  2OU6 A;  3X2Q C;  3LEV A;  1OQC A;  5KYU B;  4BG0 A;  3H2V A;  1MQV A;  1YA7 O;  5FCL A;  3LAY A;  1LE2 A;  1M56 C;  3QTH A;  4EBB A;  2O9X A;  4IAO A;  3R7C A;  3UMH A;  3UR3 C;  2XXA A;  4KBL A;  3W8H A;  2HJM A;  2VCA A;  3CSK A;  1AUE A;  4CX9 A;  4DXW A;  2IXP A;  2GWW A;  5A6A A;  3CAX A;  2R7V A;  3GM2 A;  3QW1 A;  1K40 A;  2YQY A;  1E85 A;  2XS8 A;  4XLP F;  3RW0 A;  2B0H A;  4N6C A;  1ZHY A;  1V54 C;  3EPV A;  2J0W A;  2YRF A;  3BRJ A;  1Z63 A;  3JYY A;  4I3M A;  4EKW A;  1OR3 A;  3T6J A;  3B0V C;  3L8I A;  5CI8 A;  5E3C A;  2EIN C;  3W8I A;  4AL1 A;  4BJ5 A;  4CDY A;  4KNW A;  5JSL A;  3HNL A;  5DS6 A;  3POV A;  1M2V A;  2YL7 A;  3RQG A;  1V4A A;  3S28 A;  5FZT A;  3K1I A;  2YL0 A;  3T9O A;  1NFN A;  4J32 B;  1OR2 A;  3PHF 2;  1JMW A;  3T4R A;  1FMW A;  4DRI B;  3EJN A;  1YDI A;  2HMZ A;  2A0B A;  1TWG A;  3EZI A;  4CDA A;  4XEF A;  3SXZ A;  2G62 A;  2BL2 A;  4MW3 A;  3IEE A;  5TJ5 E;  1QZX A;  3S27 A;  3W4Y A;  4MS2 A;  1M57 C;  2ZXW C;  3TK0 A;  4C3E A;  2EPM X;  4IB4 A;  5L0D A;  1Q0M A;  1VLS A;  3HJC A;  3GAN A;  3OWT A;  2KC3 A;  5KYU A;  4UDV A;  3TJ5 A;  3UNG C;  2OG2 A;  2IOQ A;  2WVO A;  3KYI A;  4N4W A;  4ULW A;  2IM8 A;  3RFY A;  4E18 A;  2J7P D;  2YVK A;  2EPL X;  2V3C C;  2UUI A;  3DWW A;  4DRH B;  1K04 A;  4CS8 C;  2Q00 A;  1LM3 B;  2R05 A;  1XWJ A;  3Q7G A;  2UUH A;  5L0I A;  3V5X A;  5DQT A;  1ZHW A;  2HMQ A;  2L81 A;  3LNM B;  3U9J A;  2H8A A;  1OCZ C;  2XM4 A;  3TQO A;  4PJJ A;  1I4Y A;  3AQC A;  4I44 A;  3E9V A;  3WAQ A;  4HEA J;  1Z23 A;  1G5Z A;  1ZU5 A;  1S7Z A;  1VYI A;  2P1A A;  2HSB A;  4CS9 A;  3WHN A;  5EK0 A;  5BQH A;  1IW7 F;  3B71 A;  2LP4 A;  2OEX A;  4EBJ A;  2YLI A;  3KYJ A;  4CSA C;  3JCU Q;  2FAP B;  2L6F A;  4MTF A;  3LNR A;  1I4Z A;  256B A;  4O6N A;  4JE9 A;  1PCX A;  1HE1 A;  2D4U A;  2YLG A;  4P6I C;  4Q4Z F;  1G4W R;  5BQG A;  4YT8 A;  3K6B A;  3ITF A;  1OCC C;  1T5O A;  2YL3 A;  1SZI A;  3GOR A;  3ZG1 A;  1XZP A;  2H7O A;  3DE9 A;  1D1A A;  4BJ6 A;  3S0X A;  1OKK D;  1WGW A;  2DYS C;  3GM1 A;  3K66 A;  1WAT A;  2HV6 A;  3C8G D;  3Q6M A;  3EQL F;  4C3B A;  5L0G A;  3QW0 A;  1D0Y A;  3M4C A;  1WN0 A;  2VB6 A;  4XEV A;  1M6T A;  4E17 A;  4Z9J A;  1MMG A;  4NTB A;  3DJU B;  2CW0 F;  3K7D A;  1HY5 A;  2RSE B;  2DI3 A;  5A6K A;  3B0U X;  3JSE O;  4FWV A;  2H7V C;  2FFH A;  2YHS A;  3K33 A;  3NYJ A;  3A11 A;  2CGE A;  1IZM A;  2PNO A;  1ZHZ A;  5L0C A;  2XXA B;  5K0I A;  2L7A A;  2P0N A;  3G50 A;  2TMV P;  4BJ5 C;  5D92 A;  1YZC A;  5COF A;  4AL0 A;  1CGM E;  2W9Y A;  4MVQ A;  4O6M A;  1JAF A;  2AVK A;  4PFP A;  4BEJ A;  4BPM A;  1E83 A;  3NRH A;  5JRA A;  3K1I C;  2MWQ A;  1PV3 A;  1Z3I X;  2DGJ A;  3LEO A;  1Q0D A;  3U5S A;  5EHH A;  5L3V A;  3EGX A;  3KL4 A;  1ORY A;  5T3T A;  2XLW A;  3HTK C;  5JT4 A;  2A69 F;  4FES A;  2VCC A;  4C3D A;  3C62 A;  4BJT A;  2Q9C A;  2CDQ A;  3F46 A;  3LJB A;  2A6H F;  4J30 B;  2IYL D;  3JTL O;  3MLG A;  5T1D B;  5A69 A;  4O6Y A;  1VK5 A;  3I5Q A;  1MMD A;  2PFD A;  4YL0 A;  1S05 A;  1QLE C;  2W4B A;  1AVO B;  4U5E E;  4FAP B;  2EIJ C;  2D5R B;  3TOM A;  3RIP A;  1A41 A;  4LAC B;  2QTV A;  4NCQ A;  2R7O A;  2Y69 C;  2OQM A;  1LIH A;  3FAJ A;  3VF0 A;  4IWB A;  3FXH A;  2L9J A;  4EUK B;  4E0I A;  4GYT A;  1ZU4 A;  3FMS A;  2L6G A;  2XSE A;  2R7T A;  1LE4 A;  3JRM O;  5KYW B;  1ZVZ A;  1RCP A;  2YL1 A;  2HUJ A;  3PMR A;  2QNL A;  1GS9 A;  2J8W A;  5DVW A;  4G7Z F;  2JD3 A;  2XLH A;  5JUA A;  1FNT c;  4QI0 A;  2ZPA A;  3AOU A;  2PX3 A;  3X1O A;  4LLC A;  3NYL A;  3QZC A;  4MVZ A;  3RF3 A;  1MND A;  4CS9 C;  3SNH A;  4XEK A;  3UGO A;  1NLX A;  4CS7 A;  1RJ9 A;  4OD5 A;  3AJM A;  4E7S A;  4H54 A;  2KSF A;  1C17 M;  2ASR A;  1T6Q A;  1TFO B;  2JPU A;  4JCZ A;  3VAY A;  2J9W A;  3S29 A;  3ZTM A;  1ORS C;  5CIV A;  5D91 A;  5L0J A;  5L0H A;  2PF4 E;  4J7T A;  3I4U A;  3HLZ A;  4LDQ A;  3JYH A;  3UMI A;  3EH2 A;  1K05 A;  2QUP A;  3IHU A;  1R4T A;  2C04 A;  4BJ6 C;  1ZW3 A;  1Q0K A;  2X51 A;  2W4M A;  3DJN B;  4MQ9 F;  5DS5 A;  4HFK B;  4NY3 A;  3GWN A;  2XRH A;  1HMO A;  2LSE A;  3V5Y A;  1V74 B;  1OCO C;  2Q9A A;  1ZYR F;  5L0F A;  3E70 C;  1Y6D A;  5T3W A;  4DBR A;  4CBE A;  3S84 A;  4AK9 A;  3SYN A;  3ZQV A;  2Q9B A;  5E33 A;  3GWL A;  3RH3 A;  1YJG A;  4K1O A;  2LFF A;  3SZR A;  1LVK A;  3SXK A;  2P61 A;  1NU7 D;  3B0P A;  1O3U A;  2EIL C;  1FAP B;  4G0H A;  4GEH A;  3JSZ A;  3QVY A;  2XLM A;  3MBG A;  4RD9 A;  3T6G B;  3US6 A;  4ZLC A;  4YT4 A;  1Q0G A;  1MNE A;  2R03 A;  3EH1 A;  4LER A;  2A1D D;  2Y39 A;  3C18 A;  3ABK C;  1L7C A;  4HE8 D;  3KPH A;  2AP3 A;  2V26 A;  3HKK A;  3L34 A;  4JTC B;  3G4Z A;  2ZXR A;  5E2Q A;  4JUR I;  4JTD B;  2WZG A;  5B3I A;  1PD1 A;  4YN0 B;  1R5I D;  1E2X A;  2WVN A;  3TJ6 A;  1GQA A;  2NUP B;  4U5D E;  2J45 A;  1YLM A;  3KKB A;  4YL1 A;  3SEO A;  1O87 A;  4BJ1 A;  4DJ9 A;  3HNI A;  4DVZ A;  1OXK A;  4YWQ A;  1QPU A;  2YWA A;  3T6B A;  2R7X A;  2Y3G A;  4YL3 A;  2Y3B A;  3ZDL A;  4JRZ A;  1W2W A;  4DRJ B;  4ER9 A;  4Z9H A;  3J06 A;  1WWP A;  2F22 A;  4U5G A;  1WAS A;  2AWY A;  4U5B E;  4EHP A;  4OIN F;  4NQF A;  3U2M A;  1FMV A;  2KYH A;  1NBB A;  3EGX B;  3C8G B;  4A4A A;  1NG1 A;  5F28 E;  4JZA A;  2J7P A;  1D1B A;  1LKX A;  1QKR A;  2NUT B;  2NG1 A;  5EGY A;  1VB5 A;  2NPU A;  5AGF A;  3ABL C;  4YT5 A;  5HV9 A;  4C7O A;  2IXO A;  2J46 A;  2KW3 C;  4IGG A;  5A6B D;  2YZS A;  2QY9 A;  2LD6 A;  3ABM C;  4IJJ A;  2OCC C;  2CCY A;  4PJL A;  4EWC A;  4EIY A;  1OW6 A;  1JR8 A;  3RVZ A;  1SR2 A;  1NFO A;  2I8B A;  3EFO A;  2CYD A;  3ZQY A;  4PK4 A;  2XLV A;  4BEM J;  1BDJ B;  4YK5 A;  1NU9 C;  3S9O A;  1Z7Q c;  3NG1 A;  2LIG A;  1HMD A;  1AEP A;  1ORJ A;  2HFI A;  3U9M A;  1G8X A;  1YVI A;  3IQT A;  3UMK A;  2P7V A;  2A0U A;  3GEH A;  1TWC A;  2R7Q A;  1VYK A;  4PJN A;  4XPX A;  2C03 A;  2KQ9 A;  3EGD A;  2CNW D;  2XLD A;  3U3F A;  4XPY A;  3RKO F;  1J8Y F;  3M1C B;  4KI2 A;  1C03 A;  1T6U A;  2NUP A;  2LCH A;  2HZ8 A;  1CPQ A;  2HS5 A;  3CZ6 A;  3U0C A;  5B1A C;  3LS0 A;  2DB4 A;  2AU5 A;  2R7W A;  1T01 A;  2WZL A;  2XL4 A;  4MND A;  5KYN A;  5DLJ A;  1RJ9 B;  2ZXO A;  1HW1 A;  1APC A;  4AX2 A;  1NSG B;  2R9R B;  3NKE A;  4JEB A;  3ASO C;  3VYW A;  5AC4 A;  1OKK A;  3LLK A;  3IQ5 A;  3C8G A;  3AG1 C;  2R02 A;  1ZW2 A;  5CI9 A;  4MTG A;  2XM0 A;  5JP7 A;  4RBN A;  3N24 A;  2NUT A;  2DYR C;  2R7R A;  2NSF A;  3EHN A;  5COG A;  2OJQ A;  1JRA A;  4CJG A;  3U8P A;  3PDM P;  2KNH A;  4MVR A;  2H7B A;  5KYX A;  4MW8 A;  2VAS A;  2GDC A;  1BR2 A;  1LS1 A;  2XL6 A;  2MHR A;  2YLD A;  3EZH A;  4P9F A;  3FDQ A;  4ULV A;  1UFB A;  2PX0 A;  2ZD9 A;  5BQI A;  3NDB B;  4CS8 A;  2ZXP A;  2EPN A;  4DOZ A;  2P6V A;  2PBE A;  1YYX A;  2FGY A;  2XLE A;  4MVS A;  3NMK A;  4LDK A;  1H7I A;  1NZE A;  4MTO A;  1UG7 A;  4XTK A;  4JJF A;  4YJW A;  1KNY A;  1OCR C;  1FTS A;  4OIQ F;  4X0R A;  1PD0 A;  2VC9 A;  4QI2 A;  1A7V A;  3B9Q A;  3ZVR A;  1U0B B;  5L3Q A;  2A6E F;  3EG9 A;  2R7U A;  4PJM A;  4D4X A;  4GQH A;  1SMY F;  2VH3 A;  4N06 A;  1SF8 A;  4JTA B;  3SP1 A;  1JPJ A;  3DD7 A;  4MVM A;  3ZWI A;  1CGN A;  4U5C E;  3OEO A;  3WOD F;  4JKV A;  4JW1 A;  1O5H A;  1TWH A;  5F5H A;  2XLO A;  2M64 A;  5JVE A;  3FAP B;  3DAG A;  4OIO F;  4YT2 A;  5AC5 A;  3SXY A;  4CIP A;  1OXB A;  3M79 A;  3FOP A;  3M15 A;  4I1O B;  3BEH A;  4XPW A;  5JS5 A;  1BZ4 A;  4HFF B;  4CJO A;  2JX0 A;  1H9T A;  1GM5 A;  3W2W A;  2W45 A;  3DMD A;  3N2Z B;  1ZHX A;  4NTA A;  4WGZ A;  3KMI A;  2VCB A;  3L1M A;  4AE4 B;  2YKZ A;  1GGQ A;  3F47 A;  4IRU A;  3HNJ A;  3LS1 A;  1XZQ A;  2KGO A;  3MX3 A;  2I15 A;  3ZSU A;  4DVY P;  1CGO A;  1CPR A;  3KH2 A;  5B1B C;  3GEI A;  3IQC A;  4XLN F;  2J9V A;  3V5Z A;  5HSW A;  1HE9 A;  1ZHT A;  3Q7L A;  3TD7 A;  1D0Z A;  2ETS A;  3AQB A;  3DM9 B;  1B68 A;  3H2U A;  4C7O B;  3FHD A;  2Y3D A;  2PP4 A;  3DM5 A;  3K1H A;  4MVO A;  4D4N A;  1E86 A;  1Z5Z A;  3JRT A;  3O10 A;  3U3B A;  3MYI A;  2M4E A;  2KJG A;  1YYJ A;  4LLE A;  3UGP A;  2IXN A;  3EFO B;  4WGY A;  4JEA A;  3TUL A;  1FR0 A;  1H9G A;  3DI5 A;  4A2N B;  1RMV A;  3C63 A;  1TKN A;  1JOG A;  1U89 A;  4H4K C;  2HSQ A;  4KNV A;  1N1C A;  1EA8 A;  3H65 A;  2XL8 A;  3N0T A;  5KYY A;  2WB7 A;  3GEE A;  2J0X A;  3O55 A;  1D0X A;  4IAR A;  4W8P A;  3EGD B; 
#chains in the Genus database with same CATH homology
 2QE9 A;  2HKV A;  2RD9 A;  2NSG A;  3CEX A;  2NSF A;  2YQY A;  5COG A;  2P1A A;  4N6C A;  2F22 A;  3DKA A;  1RXQ A;  2OQM A;  5COF A;  5CIV A;  3DI5 A;  2OU6 A;  3GOR A;  3QTH A;  2QNL A;  5COM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...