2YL7A

Cytochrome c prime from alcaligenes xylosoxidans: as isolated l16g variant at 0.9 a resolution - restraint refinement
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAGTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 53
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yl7A00
5JVEA 4JEAA 4U9DA 1YYXA 3QVZA 3ZTZA 1APCA 4ER9A 1E83A 4JE9A 1JAFA 4WGZA 2BC5A 1M6TA 4D4XA 4EIYA 1E85A 3C62A 2YL7A 2XLWA 2XLVA 5B3IA 1NBBA 4JKVA 3M79A 4JEBA 1YZAA 3ZWIA 1YYJA 3NMJA 1GQAA 5JSLA 2XL6A 3HNKA 2YL0A 5JLIA 2XLOA 4N4WA 5JUAA 4CDYA 3TOMA 5JS5A 3QW0A 1LM3B 3FOOA 3IQ5A 1RCPA 3HNIA 2XM0A 3ZTMA 5JRAA 2XL8A 3QW1A 1QPUA 4N6HA 3DE9A 2J8WA 1CPQA 1E84A 4CJGA 3QVYA 1CPRA 3IQ6A 2YL3A 2XLHA 4L6RA 2XM4A 4CDVA 2QLAA 1MQVA 5AGFA 4IB4A 4CX9A 4CJOA 4ULVA 2CCYA 2YL1A 2XLEA 3HNLA 4WGYA 3M4CA 4D4NA 3DE8A 1QQ3A 4IAQA 3FOPA 2J9BA 1EKYA 3NMKA 3C63A 3TOLA 4IARA 2YLIA 1E86A 3L1MA 3M4BA 2XLDA 3HNJA 3ZQYA 4CIPA 3VRCA 1A7VA 1CGOA 3U8PA 3M15A 2XLMA 4NC3A 5JP7A 2YKZA 5JT4A 1YZCA 1BBHA 2YLDA 1CGNA 3NMIA 4CDAA 1S05A 4U9EA 256BA 3ZQVA 2YLGA
chains in the Genus database with same CATH superfamily
2R7WA 3JZ0A 1VYIA 4BJ5C 2LQGA 3AG2C 3OWTA 4U9DA 2HZ8A 4R32A 4EBJA 3L34A 5L3QA 4CS7A 2R02A 3S28A 3N24A 3QVZA 3VM6A 1A0BA 2H7VC 1VK5A 1JRAA 4OD4A 3BEHA 3ZTZA 5L0HA 3WHNA 4XLPF 4YT8A 2P7VA 1JAFA 2CNWD 1I4ZA 4WGZA 4K1OA 1M6TA 5DS6A 4O79A 3US6A 1E85A 3DKAA 2A0UA 1ZHXA 4NTFA 2DI3A 2YL7A 2XLVA 3T6BA 4K0DA 3EFOB 4LLCA 2YRFA 3JYYA 3K1HA 3JRMO 4BG0A 2A6HF 4JEBA 3KYIA 1XZPA 1QVXA 2R7VA 1OCRC 3RYLA 2L6FA 3IQTA 3MFNA 1GQAA 1TFOB 1H6GA 3JRTA 1TFKB 3V5XA 2Y69C 5JLIA 3C8GA 1R4TA 2KSFA 1K05A 2I8BA 4J32B 2YZSA 3C18A 1FMWA 1LM3B 5D92A 5JUAA 1YARO 2CGEA 2ZXRA 3IQ5A 4OIRF 1HW1A 4Q4ZF 2XM0A 3NKDA 3ITFA 1H9GA 2XL8A 1ST6A 1Y6DA 2W4MA 3QW1A 1JPJA 2JD3A 3NYMA 2HJ3A 3G4XA 1Q0DA 2L6HA 2W4BA 3L8IA 3U9JA 3WODF 4EWCA 2CYDA 3TJ6A 4U5CE 2J0XA 2XRHA 3ABMC 3TQOA 2WL8A 3DZAA 1Y4CA 4PJMA 3K33A 4H54A 3H2VA 3GWNA 2L81A 2Y3GA 1CPRA 4MW3A 2Q9AA 3IQ6A 4YN0B 4F4BA 3X2QC 2J45A 1ZHWA 1ORJA 1HE9A 2ASRA 4YL3A 2L9JA 2QLAA 4DVZA 1UFBA 3AG1C 4IJJA 4LACB 5B1AC 4CS8A 2J46A 1OKKD 1MNEA 1MMDA 2ICWG 4J7YA 2HFIA 1A7EA 2R9RB 1I5NA 2YL1A 4YJWA 4E7ZA 4C7OA 2IOQA 4CSAA 2W9YA 2V3CC 1KNYA 4E0IA 2R7XA 1ZW3A 1DOWA 1RKCA 2L7AA 4U5DE 2EIMC 3AG4C 4E7SA 4BEJA 2Z15A 3FHDA 2FAPB 4P9FA 5T1DB 4YWQA 3DJUB 3DXJF 4D4NA 1BDJB 5A6BD 3VYWA 5FCLA 2R7RA 3DE8A 1QQ3A 2NUPA 4DRIB 4OD5A 4G7HF 1AUEA 3G50A 4A2NB 3W2WA 1MMAA 2DGJA 4DBRA 3EH1A 4JZAA 1LIHA 3MX3A 2B0HA 5IY5C 1ZHZA 5DS5A 2DYSC 4EHPA 1NG1A 2PFDA 1E86A 3NG1A 3LS0A 3B0UX 2EPOA 2IYLD 5COMA 1Z63A 2QUPA 2G3KA 1QZXA 3PMRA 3CZ6A 3AOUA 2YEVA 3TK0A 3B71A 1B68A 1Z7Qc 2ETSA 1NFNA 5EGYA 3V5YA 5EK0A 1SZIA 1OW7A 2HMZA 2QY9A 4JCHA 1JR8A 2C03A 2YVKA 2ZXOA 1ZYRF 2YWAA 1U0BB 2UUIA 2ZXWC 3QMKA 2PBEA 2XXAA 4HEAJ 1O5HA 4ULWA 1LVKA 4RD9A 1YVIA 3L8JA 4Z9JA 2NPUA 4KBLA 2WVOA 3SZRA 2WB7A 3I5PA 2LCHA 3AG3C 4H4KC 3A11A 4DXWA 1VLSA 4JEAA 3VAYA 3U3FA 2NG1A 1PD0A 2M4EA 4I44A 2FFHA 4CS9A 3JCUQ 1RMVA 1APCA 1RKEA 2EPNA 4E18A 5E3AA 2YHSA 4U5BE 3BRJA 5KYNA 3JT1A 3LJBA 2X0CA 3EHMA 3Q7LA 4AL1A 2I15A 4D4XA 1V54C 4ZLCA 3C62A 5KYYA 3ZSUA 2IXPA 1AEPA 4DRHB 2NUTA 2A69F 4I3MA 4LERA 2J0WA 1NBBA 5E3CA 3M1CB 1YAUO 3PCVA 4C7OB 3M79A 1ZU4A 2BE5F 3G4ZA 3ZIBA 1MNDA 1HMOA 3EG9A 4LDQA 3ECSA 2OEXA 2VCCA 3O55A 4MNDA 2XL6A 2HKVA 1RJ9A 3DAFA 3HNKA 3JTLO 3SP1A 4YT4A 5A6JA 3TULA 3NDBB 2HMQA 2R7OA 4N4WA 1XZQA 1T9KA 2ZXPA 5JS5A 1D1CA 3QW0A 1H7IA 2D4UA 2NUPB 2DYRC 3RVZA 3NKEA 3RW0A 1FFTC 5KYUA 3MBGA 3EQLF 4AE4A 2R03A 1LE2A 2W45A 3ZTMA 1D0YA 3IQCA 3DJNB 2QE9A 4JCZA 1T6QA 2P1AA 4O6NA 5AC5A 3DM9B 3TD7A 4N6HA 1GS9A 2LFFA 2KNHA 3DE9A 4NY3A 1ZHTA 4EKWA 1CGME 4MVSA 3K6BA 2EIKC 4Z9HA 2DB4A 3E9VA 5HSWA 5L0IA 2Y3HA 5HV9A 1NU9C 1HW2A 2CW0F 5TJ5E 2HSQA 2VH3A 4NTBA 4JJFA 3UR3C 4AX2A 4BEMJ 3EGDA 1IW7F 1V55C 1TWAA 3V7OA 1OXKA 3GODA 5A6AA 1LKXA 3HLZA 3TJ5A 4N06A 1N1CA 2XM4A 3ZG1A 4HE8D 1BZ4A 2O9XA 1C17M 1MQVA 1RXQA 5AGFA 4CX9A 3GEIA 2XXAB 1V74B 3DD7A 4W8KA 3IEEA 4JURI 1I4YA 4BJ1A 4DOZA 4U5GA 4EUKB 1EA8A 2J9VA 5F28E 5DS4A 4PJNA 1M2VA 4CS8C 3AJMA 2OQMA 1FMVA 3KKBA 3LNMB 5KYXB 3U2LA 3EHNA 4CSAC 1U89A 1LPEA 3KL4A 2ZPAA 5CI8A 2Y39A 4BJ5A 3SXZA 4C3DA 3HTKC 3R7CA 2Q3TA 2B0JA 5L0JA 4A4AA 2J7PD 4MVOA 2D5RB 3E70C 3NMKA 3O10A 3W2VA 1FNTc 3C63A 3SXMA 1VLTA 4BPMA 4E17A 3ASOC 2OJQA 2YQYA 3B9QA 3RH3A 5KYYB 2GAQA 2BL2A 3JSZA 5EHHA 3LESA 2YLIA 4JIOA 5D91A 1PD1A 3FMSA 3M4BA 3EZHA 3RF3A 5F5HA 1OR3A 1C03A 3B29A 3OEOA 3QTHA 3ZQYA 1EQ1A 2QTVA 4PJLA 4U5FE 2E87A 2OJED 4FAPB 1JPNA 1W2WA 3B0PA 3Q6NA 1YA9A 3UGPA 3EG9B 4NC3A 5AC4A 3UNGC 5E2QA 4JTAB 5JP7A 2NSFA 5L0GA 2YKZA 1M2OA 4OIQF 3HKKA 1BBHA 1RJ9B 1PV3A 1TWCA 2Y3DA 3JYHA 1Z6AA 2UUHA 2WZFA 2C04A 4PACA 3SEOA 1WASA 2XS1A 2EIJC 2MHRA 3HJCA 4HFKB 3U5SA 3AGUA 2JPUA 2J9UA 5L3VA 3RVYA 5KYUB 4AE4B 2RSEB 3EPVA 4ULVA 3ZQVA 3GEHA 2YLGA 4XTKA 3SXYA 2F22A 2HSBA 1T6UA 5CIVA 2JX0A 2HS5A 3I4UA 1YYXA 4MVRA 2Y3BA 3LLKA 2R25A 3N2ZB 2VCBA 1E2XA 4J7TA 4PFPA 2A6EF 3MLGA 1ORYA 1FFHA 4U5HA 1TR2A 1E83A 3H2UA 4YL0A 2KYHA 3C7JA 4QI2A 4BJ6A 1L7CA 3EGDB 4CS9C 1QLEC 1WATA 1QSPA 4QDLA 4XWJA 3EGXA 1VMAA 1G4WR 4UDVA 5B3IA 2LD6A 4XEKA 3C8GB 2Q9BA 3N0TA 1OKKA 4YT2A 4JKVA 2WZLA 2OOCA 3DWWA 3S27A 3QZCA 1U6HA 1Z5ZA 2AWYA 3EH2A 4FX5A 4JW1A 4NTAA 1IZMA 1WN0A 3ABKC 1S7ZA 1NU7D 4JVSA 1K04A 1T6IA 2AU5A 2CDQA 3EFOA 3LNRA 4XPXA 4BJTA 2XLOA 2HUJA 2MWQA 4G7OF 5A6BA 4CDYA 4GEHA 3U0CA 1O87A 4IAOA 1D0ZA 1FTSA 1OQCA 3WG7C 3HNIA 2R7UA 1D1BA 5GPGB 2FGYA 5JRAA 4JTCB 1L3PA 2Q00A 1YA7O 2P61A 3KH2A 4MVMA 2G3VA 2MYSA 4WJ0A 1QPUA 1LI5A 1OCCC 4MVQA 2XSEA 1WOLA 3U2MA 3LUTB 1YJGA 1VTMP 1BR4A 4DRJB 1AVOB 4CBEA 4NCQA 5BUOA 2KJGA 3JSEO 2J8WA 1NFOA 3CAXA 2R7TA 3AQBA 4Z9IA 3PDMP 3KYJA 5DVWA 2HJMA 1FAPB 3QVYA 2IXOA 4OINF 3L0IA 2YL3A 2EPKX 1F1MA 1NZEA 1BR1A 4W8PA 1NLXA 3GM2A 1SR2A 1JMWA 4MTOA 2KW3C 3IPMO 4IB4A 2XS8A 1MMGA 2AWCA 3SNHA 3F46A 1WTYA 5COFA 3W8HA 1C02A 3A9CA 3RQFA 1M56C 3O6XA 1TWGA 4MW8A 2VCAA 1ZZPA 2OCCC 4G0HA 2OG2A 4J30B 5L0CA 4MTGA 1QKRA 3H65A 3C8GD 2ZD9A 3R2PA 4MQ9F 5COGA 3ZDLA 2OU6A 5BQIA 5L0DA 4X0RA 3B0VC 4IAQA 3FOPA 2J9BA 3T9OA 2A0BA 3GM1A 3K1IA 4NQFA 4LDKA 3UMIA 5B1BC 1SYQA 2AVKA 4IARA 1SMYF 3T6GB 3EGXB 4HFFB 2KK1A 2HV7A 3L1MA 2LIGA 3HNJA 3LAYA 1YDIA 3S0XA 1R5ID 4PFOA 2GDCA 2H8AA 4M63A 3I5QA 4RBNA 4G78A 1NSGB 3X1OA 3OA1A 4C3EA 2PF4E 4G7ZF 4B6IA 2XLMA 1SF8A 2IM8A 4MVUA 4N6CA 3W8IA 4Q5SF 5JT4A 1Z23A 1CGNA 1T01A 3LLIA 4PR9A 1JOGA 1KTMA 3S29A 2H7BA 3IHUA 4CDAA 1S05A 2WZGA 1WGWA 4U9EA 2Q9CA 256BA 1ZVZA 1RKEB 3DMDA 3FXHA 4ANJA 4DJ9A 3S90A 5JVEA 1HY5A 4JTDB 2CNWA 4YL1A 1LS1A 1GM5A 2EPLX 3GORA 2M64A 2R7QA 2GWWA 4OIPF 1EI7A 4AL0A 3RFYA 2EILC 4JJGA 2NUTB 3CQZA 2WVQA 2RD9A 4ER9A 4ONSA 4XEFA 3T6JA 4EBBA 4JE9A 2QNLA 3PHF2 4XPWA 1H9TA 3UMHA 2BC5A 1LI7A 4PJJA 2EINC 3RIPA 1D0XA 4JRZA 4EIYA 1VYKA 2XLWA 5KYWA 1T5OA 3O39A 5DQZA 4WABA 4PK4A 4YT5A 4BJ6C 5DQTA 3S9OA 2PX3A 5BQGA 1YZAA 1BR2A 3ZWIA 1YYJA 1Z3IX 2PNOA 5F5FA 1TKNA 2GA0A 2R7SA 3LEVA 3NMJA 1OCZC 2LFDA 4O7GA 5JSLA 1TWHA 3J06A 3GM3A 5CI9A 3DM5A 3NYJA 4DVYP 2YL0A 4GQHA 1TQGA 4MTFA 2VASA 4IRUA 1FR0A 5K0IA 3TOMA 3FOOA 4MVZA 3AQCA 2LP4A 2J7PA 3ASNC 4XPYA 2Q7RA 1KU2A 4OIOF 3RKOF 1RCPA 4LLEA 4FWVA 5A6KA 3K7DA 2VB6A 5FZTA 3T4RA 1VB5A 4YK5A 4KNWA 2GFHA 2IXMA 3FAPB 3RQGA 1V4AA 4JC7A 2A68F 2KQ9A 1OW6A 1K40A 3GWLA 4E0HA 2Q4FA 4I1OB 4GYTA 1A41A 1CPQA 2PP4A 2H7OA 5T3TA 1Q0KA 1E84A 4CJGA 4ZLDA 1HE1A 3EZIA 3NYLA 4K7BA 5T3WA 2WVNA 2IXNA 1M2VB 1ZHYA 4QI0A 4L6RA 2XLHA 3SYNA 5DLJA 3FAJA 2IBFA 4I1MA 4AK9A 4CDVA 4KNVA 3WAQA 3VF0A 5BQHA 2LSEA 3DAGA 1DOVA 1O3UA 2TMVP 3POVA 4O6YA 4CJOA 3GANA 1D1AA 2CCYA 4XEVA 4Q7CA 2XLEA 3UGOA 1LS4A 3MYFA 2NSGA 1UG7A 3C8ZA 1J8MF 2OKUA 2L6GA 2P0NA 2VC9A 3F47A 3HNLA 3K66A 3KPHA 3MYIA 3Q7GA 4WGYA 1HMDA 1Q0GA 4KI2A 1YLMA 3UMKA 4XLNF 3M4CA 3KMIA 4IGGA 3EJNA 3ABLC 3U9MA 1MMNA 1ZW2A 1ORSC 1Q0FA 2A1DD 2G62A 3AGTA 4U5EE 3V5ZA 3ZVRA 5E33A 4EBKA 1GGQA 1EKYA 2V26A 3FVYA 4CIHA 2XL4A 3TOLA 1VOMA 3ATPA 2P6VA 3CSKA 4IWBA 1OXBA 5KYXA 3W4YA 5KYWB 1OCOC 4FESA 5L0FA 1G5ZA 2XLDA 1G8XA 4CIPA 1OW8A 3K1IC 3RQEA 4RDAA 3VRCA 1OR2A 3DI5A 1A7VA 4MS2A 3U3BA 2R05A 5B3SC 2EPMX 1CGOA 3ZC4A 2PX0A 2X51A 3U8PA 3NRHA 4KC9A 3M15A 3U8VA 3LEOA 1J8YF 2J9WA 1A7DA 1WWPA 3LS1A 2AP3A 3Q6MA 4LDRA 4C3BA 2KGOA 1PCXA 1YZCA 1M57C 2YLDA 1XWJA 4P9TA 2KC3A 3NMIA 5A69A 4O6MA 2LK4A 2HV6A 4P6IC 1ZU5A 3GEEA 4DBQA 3S84A 1LE4A 3FDQA 3SXKA 3CEXA 4XQ1A 2OEVA 1G4US 1Q0MA
chains in the Genus database with same CATH topology
5JVEA 4JEAA 4U9DA 1YYXA 3QVZA 3ZTZA 1APCA 4ER9A 1E83A 4JE9A 1JAFA 4WGZA 2BC5A 1M6TA 4D4XA 4EIYA 1E85A 3C62A 2YL7A 2XLWA 2XLVA 5B3IA 1NBBA 4JKVA 3M79A 4JEBA 1YZAA 3ZWIA 1YYJA 3NMJA 1GQAA 5JSLA 2XL6A 3HNKA 2YL0A 5JLIA 2XLOA 4N4WA 5JUAA 4CDYA 3TOMA 5JS5A 3QW0A 1LM3B 3FOOA 3IQ5A 1RCPA 3HNIA 2XM0A 3ZTMA 5JRAA 2XL8A 3QW1A 1QPUA 4N6HA 3DE9A 2J8WA 1CPQA 1E84A 4CJGA 3QVYA 1CPRA 3IQ6A 2YL3A 2XLHA 4L6RA 2XM4A 4CDVA 2QLAA 1MQVA 5AGFA 4IB4A 4CX9A 4CJOA 4ULVA 2CCYA 2YL1A 2XLEA 3HNLA 4WGYA 3M4CA 4D4NA 3DE8A 1QQ3A 4IAQA 3FOPA 2J9BA 1EKYA 3NMKA 3C63A 3TOLA 4IARA 2YLIA 1E86A 3L1MA 3M4BA 2XLDA 3HNJA 3ZQYA 4CIPA 3VRCA 1A7VA 1CGOA 3U8PA 3M15A 2XLMA 4NC3A 5JP7A 2YKZA 5JT4A 1YZCA 1BBHA 2YLDA 1CGNA 3NMIA 4CDAA 1S05A 4U9EA 256BA 3ZQVA 2YLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JVE A;  4JEA A;  4U9D A;  1YYX A;  3QVZ A;  3ZTZ A;  1APC A;  4ER9 A;  1E83 A;  4JE9 A;  1JAF A;  4WGZ A;  2BC5 A;  1M6T A;  4D4X A;  4EIY A;  1E85 A;  3C62 A;  2YL7 A;  2XLW A;  2XLV A;  5B3I A;  1NBB A;  4JKV A;  3M79 A;  4JEB A;  1YZA A;  3ZWI A;  1YYJ A;  3NMJ A;  1GQA A;  5JSL A;  2XL6 A;  3HNK A;  2YL0 A;  5JLI A;  2XLO A;  4N4W A;  5JUA A;  4CDY A;  3TOM A;  5JS5 A;  3QW0 A;  1LM3 B;  3FOO A;  3IQ5 A;  1RCP A;  3HNI A;  2XM0 A;  3ZTM A;  5JRA A;  2XL8 A;  3QW1 A;  1QPU A;  4N6H A;  3DE9 A;  2J8W A;  1CPQ A;  1E84 A;  4CJG A;  3QVY A;  1CPR A;  3IQ6 A;  2YL3 A;  2XLH A;  4L6R A;  2XM4 A;  4CDV A;  2QLA A;  1MQV A;  5AGF A;  4IB4 A;  4CX9 A;  4CJO A;  4ULV A;  2CCY A;  2YL1 A;  2XLE A;  3HNL A;  4WGY A;  3M4C A;  4D4N A;  3DE8 A;  1QQ3 A;  4IAQ A;  3FOP A;  2J9B A;  1EKY A;  3NMK A;  3C63 A;  3TOL A;  4IAR A;  2YLI A;  1E86 A;  3L1M A;  3M4B A;  2XLD A;  3HNJ A;  3ZQY A;  4CIP A;  3VRC A;  1A7V A;  1CGO A;  3U8P A;  3M15 A;  2XLM A;  4NC3 A;  5JP7 A;  2YKZ A;  5JT4 A;  1YZC A;  1BBH A;  2YLD A;  1CGN A;  3NMI A;  4CDA A;  1S05 A;  4U9E A;  256B A;  3ZQV A;  2YLG A; 
#chains in the Genus database with same CATH topology
 2R7W A;  3JZ0 A;  1VYI A;  4BJ5 C;  2LQG A;  3AG2 C;  3OWT A;  4U9D A;  2HZ8 A;  4R32 A;  4EBJ A;  3L34 A;  5L3Q A;  4CS7 A;  2R02 A;  3S28 A;  3N24 A;  3QVZ A;  3VM6 A;  1A0B A;  2H7V C;  1VK5 A;  1JRA A;  4OD4 A;  3BEH A;  3ZTZ A;  5L0H A;  3WHN A;  4XLP F;  4YT8 A;  2P7V A;  1JAF A;  2CNW D;  1I4Z A;  4WGZ A;  4K1O A;  1M6T A;  5DS6 A;  4O79 A;  3US6 A;  1E85 A;  3DKA A;  2A0U A;  1ZHX A;  4NTF A;  2DI3 A;  2YL7 A;  2XLV A;  3T6B A;  4K0D A;  3EFO B;  4LLC A;  2YRF A;  3JYY A;  3K1H A;  3JRM O;  4BG0 A;  2A6H F;  4JEB A;  3KYI A;  1XZP A;  1QVX A;  2R7V A;  1OCR C;  3RYL A;  2L6F A;  3IQT A;  3MFN A;  1GQA A;  1TFO B;  1H6G A;  3JRT A;  1TFK B;  3V5X A;  2Y69 C;  5JLI A;  3C8G A;  1R4T A;  2KSF A;  1K05 A;  2I8B A;  4J32 B;  2YZS A;  3C18 A;  1FMW A;  1LM3 B;  5D92 A;  5JUA A;  1YAR O;  2CGE A;  2ZXR A;  3IQ5 A;  4OIR F;  1HW1 A;  4Q4Z F;  2XM0 A;  3NKD A;  3ITF A;  1H9G A;  2XL8 A;  1ST6 A;  1Y6D A;  2W4M A;  3QW1 A;  1JPJ A;  2JD3 A;  3NYM A;  2HJ3 A;  3G4X A;  1Q0D A;  2L6H A;  2W4B A;  3L8I A;  3U9J A;  3WOD F;  4EWC A;  2CYD A;  3TJ6 A;  4U5C E;  2J0X A;  2XRH A;  3ABM C;  3TQO A;  2WL8 A;  3DZA A;  1Y4C A;  4PJM A;  3K33 A;  4H54 A;  3H2V A;  3GWN A;  2L81 A;  2Y3G A;  1CPR A;  4MW3 A;  2Q9A A;  3IQ6 A;  4YN0 B;  4F4B A;  3X2Q C;  2J45 A;  1ZHW A;  1ORJ A;  1HE9 A;  2ASR A;  4YL3 A;  2L9J A;  2QLA A;  4DVZ A;  1UFB A;  3AG1 C;  4IJJ A;  4LAC B;  5B1A C;  4CS8 A;  2J46 A;  1OKK D;  1MNE A;  1MMD A;  2ICW G;  4J7Y A;  2HFI A;  1A7E A;  2R9R B;  1I5N A;  2YL1 A;  4YJW A;  4E7Z A;  4C7O A;  2IOQ A;  4CSA A;  2W9Y A;  2V3C C;  1KNY A;  4E0I A;  2R7X A;  1ZW3 A;  1DOW A;  1RKC A;  2L7A A;  4U5D E;  2EIM C;  3AG4 C;  4E7S A;  4BEJ A;  2Z15 A;  3FHD A;  2FAP B;  4P9F A;  5T1D B;  4YWQ A;  3DJU B;  3DXJ F;  4D4N A;  1BDJ B;  5A6B D;  3VYW A;  5FCL A;  2R7R A;  3DE8 A;  1QQ3 A;  2NUP A;  4DRI B;  4OD5 A;  4G7H F;  1AUE A;  3G50 A;  4A2N B;  3W2W A;  1MMA A;  2DGJ A;  4DBR A;  3EH1 A;  4JZA A;  1LIH A;  3MX3 A;  2B0H A;  5IY5 C;  1ZHZ A;  5DS5 A;  2DYS C;  4EHP A;  1NG1 A;  2PFD A;  1E86 A;  3NG1 A;  3LS0 A;  3B0U X;  2EPO A;  2IYL D;  5COM A;  1Z63 A;  2QUP A;  2G3K A;  1QZX A;  3PMR A;  3CZ6 A;  3AOU A;  2YEV A;  3TK0 A;  3B71 A;  1B68 A;  1Z7Q c;  2ETS A;  1NFN A;  5EGY A;  3V5Y A;  5EK0 A;  1SZI A;  1OW7 A;  2HMZ A;  2QY9 A;  4JCH A;  1JR8 A;  2C03 A;  2YVK A;  2ZXO A;  1ZYR F;  2YWA A;  1U0B B;  2UUI A;  2ZXW C;  3QMK A;  2PBE A;  2XXA A;  4HEA J;  1O5H A;  4ULW A;  1LVK A;  4RD9 A;  1YVI A;  3L8J A;  4Z9J A;  2NPU A;  4KBL A;  2WVO A;  3SZR A;  2WB7 A;  3I5P A;  2LCH A;  3AG3 C;  4H4K C;  3A11 A;  4DXW A;  1VLS A;  4JEA A;  3VAY A;  3U3F A;  2NG1 A;  1PD0 A;  2M4E A;  4I44 A;  2FFH A;  4CS9 A;  3JCU Q;  1RMV A;  1APC A;  1RKE A;  2EPN A;  4E18 A;  5E3A A;  2YHS A;  4U5B E;  3BRJ A;  5KYN A;  3JT1 A;  3LJB A;  2X0C A;  3EHM A;  3Q7L A;  4AL1 A;  2I15 A;  4D4X A;  1V54 C;  4ZLC A;  3C62 A;  5KYY A;  3ZSU A;  2IXP A;  1AEP A;  4DRH B;  2NUT A;  2A69 F;  4I3M A;  4LER A;  2J0W A;  1NBB A;  5E3C A;  3M1C B;  1YAU O;  3PCV A;  4C7O B;  3M79 A;  1ZU4 A;  2BE5 F;  3G4Z A;  3ZIB A;  1MND A;  1HMO A;  3EG9 A;  4LDQ A;  3ECS A;  2OEX A;  2VCC A;  3O55 A;  4MND A;  2XL6 A;  2HKV A;  1RJ9 A;  3DAF A;  3HNK A;  3JTL O;  3SP1 A;  4YT4 A;  5A6J A;  3TUL A;  3NDB B;  2HMQ A;  2R7O A;  4N4W A;  1XZQ A;  1T9K A;  2ZXP A;  5JS5 A;  1D1C A;  3QW0 A;  1H7I A;  2D4U A;  2NUP B;  2DYR C;  3RVZ A;  3NKE A;  3RW0 A;  1FFT C;  5KYU A;  3MBG A;  3EQL F;  4AE4 A;  2R03 A;  1LE2 A;  2W45 A;  3ZTM A;  1D0Y A;  3IQC A;  3DJN B;  2QE9 A;  4JCZ A;  1T6Q A;  2P1A A;  4O6N A;  5AC5 A;  3DM9 B;  3TD7 A;  4N6H A;  1GS9 A;  2LFF A;  2KNH A;  3DE9 A;  4NY3 A;  1ZHT A;  4EKW A;  1CGM E;  4MVS A;  3K6B A;  2EIK C;  4Z9H A;  2DB4 A;  3E9V A;  5HSW A;  5L0I A;  2Y3H A;  5HV9 A;  1NU9 C;  1HW2 A;  2CW0 F;  5TJ5 E;  2HSQ A;  2VH3 A;  4NTB A;  4JJF A;  3UR3 C;  4AX2 A;  4BEM J;  3EGD A;  1IW7 F;  1V55 C;  1TWA A;  3V7O A;  1OXK A;  3GOD A;  5A6A A;  1LKX A;  3HLZ A;  3TJ5 A;  4N06 A;  1N1C A;  2XM4 A;  3ZG1 A;  4HE8 D;  1BZ4 A;  2O9X A;  1C17 M;  1MQV A;  1RXQ A;  5AGF A;  4CX9 A;  3GEI A;  2XXA B;  1V74 B;  3DD7 A;  4W8K A;  3IEE A;  4JUR I;  1I4Y A;  4BJ1 A;  4DOZ A;  4U5G A;  4EUK B;  1EA8 A;  2J9V A;  5F28 E;  5DS4 A;  4PJN A;  1M2V A;  4CS8 C;  3AJM A;  2OQM A;  1FMV A;  3KKB A;  3LNM B;  5KYX B;  3U2L A;  3EHN A;  4CSA C;  1U89 A;  1LPE A;  3KL4 A;  2ZPA A;  5CI8 A;  2Y39 A;  4BJ5 A;  3SXZ A;  4C3D A;  3HTK C;  3R7C A;  2Q3T A;  2B0J A;  5L0J A;  4A4A A;  2J7P D;  4MVO A;  2D5R B;  3E70 C;  3NMK A;  3O10 A;  3W2V A;  1FNT c;  3C63 A;  3SXM A;  1VLT A;  4BPM A;  4E17 A;  3ASO C;  2OJQ A;  2YQY A;  3B9Q A;  3RH3 A;  5KYY B;  2GAQ A;  2BL2 A;  3JSZ A;  5EHH A;  3LES A;  2YLI A;  4JIO A;  5D91 A;  1PD1 A;  3FMS A;  3M4B A;  3EZH A;  3RF3 A;  5F5H A;  1OR3 A;  1C03 A;  3B29 A;  3OEO A;  3QTH A;  3ZQY A;  1EQ1 A;  2QTV A;  4PJL A;  4U5F E;  2E87 A;  2OJE D;  4FAP B;  1JPN A;  1W2W A;  3B0P A;  3Q6N A;  1YA9 A;  3UGP A;  3EG9 B;  4NC3 A;  5AC4 A;  3UNG C;  5E2Q A;  4JTA B;  5JP7 A;  2NSF A;  5L0G A;  2YKZ A;  1M2O A;  4OIQ F;  3HKK A;  1BBH A;  1RJ9 B;  1PV3 A;  1TWC A;  2Y3D A;  3JYH A;  1Z6A A;  2UUH A;  2WZF A;  2C04 A;  4PAC A;  3SEO A;  1WAS A;  2XS1 A;  2EIJ C;  2MHR A;  3HJC A;  4HFK B;  3U5S A;  3AGU A;  2JPU A;  2J9U A;  5L3V A;  3RVY A;  5KYU B;  4AE4 B;  2RSE B;  3EPV A;  4ULV A;  3ZQV A;  3GEH A;  2YLG A;  4XTK A;  3SXY A;  2F22 A;  2HSB A;  1T6U A;  5CIV A;  2JX0 A;  2HS5 A;  3I4U A;  1YYX A;  4MVR A;  2Y3B A;  3LLK A;  2R25 A;  3N2Z B;  2VCB A;  1E2X A;  4J7T A;  4PFP A;  2A6E F;  3MLG A;  1ORY A;  1FFH A;  4U5H A;  1TR2 A;  1E83 A;  3H2U A;  4YL0 A;  2KYH A;  3C7J A;  4QI2 A;  4BJ6 A;  1L7C A;  3EGD B;  4CS9 C;  1QLE C;  1WAT A;  1QSP A;  4QDL A;  4XWJ A;  3EGX A;  1VMA A;  1G4W R;  4UDV A;  5B3I A;  2LD6 A;  4XEK A;  3C8G B;  2Q9B A;  3N0T A;  1OKK A;  4YT2 A;  4JKV A;  2WZL A;  2OOC A;  3DWW A;  3S27 A;  3QZC A;  1U6H A;  1Z5Z A;  2AWY A;  3EH2 A;  4FX5 A;  4JW1 A;  4NTA A;  1IZM A;  1WN0 A;  3ABK C;  1S7Z A;  1NU7 D;  4JVS A;  1K04 A;  1T6I A;  2AU5 A;  2CDQ A;  3EFO A;  3LNR A;  4XPX A;  4BJT A;  2XLO A;  2HUJ A;  2MWQ A;  4G7O F;  5A6B A;  4CDY A;  4GEH A;  3U0C A;  1O87 A;  4IAO A;  1D0Z A;  1FTS A;  1OQC A;  3WG7 C;  3HNI A;  2R7U A;  1D1B A;  5GPG B;  2FGY A;  5JRA A;  4JTC B;  1L3P A;  2Q00 A;  1YA7 O;  2P61 A;  3KH2 A;  4MVM A;  2G3V A;  2MYS A;  4WJ0 A;  1QPU A;  1LI5 A;  1OCC C;  4MVQ A;  2XSE A;  1WOL A;  3U2M A;  3LUT B;  1YJG A;  1VTM P;  1BR4 A;  4DRJ B;  1AVO B;  4CBE A;  4NCQ A;  5BUO A;  2KJG A;  3JSE O;  2J8W A;  1NFO A;  3CAX A;  2R7T A;  3AQB A;  4Z9I A;  3PDM P;  3KYJ A;  5DVW A;  2HJM A;  1FAP B;  3QVY A;  2IXO A;  4OIN F;  3L0I A;  2YL3 A;  2EPK X;  1F1M A;  1NZE A;  1BR1 A;  4W8P A;  1NLX A;  3GM2 A;  1SR2 A;  1JMW A;  4MTO A;  2KW3 C;  3IPM O;  4IB4 A;  2XS8 A;  1MMG A;  2AWC A;  3SNH A;  3F46 A;  1WTY A;  5COF A;  3W8H A;  1C02 A;  3A9C A;  3RQF A;  1M56 C;  3O6X A;  1TWG A;  4MW8 A;  2VCA A;  1ZZP A;  2OCC C;  4G0H A;  2OG2 A;  4J30 B;  5L0C A;  4MTG A;  1QKR A;  3H65 A;  3C8G D;  2ZD9 A;  3R2P A;  4MQ9 F;  5COG A;  3ZDL A;  2OU6 A;  5BQI A;  5L0D A;  4X0R A;  3B0V C;  4IAQ A;  3FOP A;  2J9B A;  3T9O A;  2A0B A;  3GM1 A;  3K1I A;  4NQF A;  4LDK A;  3UMI A;  5B1B C;  1SYQ A;  2AVK A;  4IAR A;  1SMY F;  3T6G B;  3EGX B;  4HFF B;  2KK1 A;  2HV7 A;  3L1M A;  2LIG A;  3HNJ A;  3LAY A;  1YDI A;  3S0X A;  1R5I D;  4PFO A;  2GDC A;  2H8A A;  4M63 A;  3I5Q A;  4RBN A;  4G78 A;  1NSG B;  3X1O A;  3OA1 A;  4C3E A;  2PF4 E;  4G7Z F;  4B6I A;  2XLM A;  1SF8 A;  2IM8 A;  4MVU A;  4N6C A;  3W8I A;  4Q5S F;  5JT4 A;  1Z23 A;  1CGN A;  1T01 A;  3LLI A;  4PR9 A;  1JOG A;  1KTM A;  3S29 A;  2H7B A;  3IHU A;  4CDA A;  1S05 A;  2WZG A;  1WGW A;  4U9E A;  2Q9C A;  256B A;  1ZVZ A;  1RKE B;  3DMD A;  3FXH A;  4ANJ A;  4DJ9 A;  3S90 A;  5JVE A;  1HY5 A;  4JTD B;  2CNW A;  4YL1 A;  1LS1 A;  1GM5 A;  2EPL X;  3GOR A;  2M64 A;  2R7Q A;  2GWW A;  4OIP F;  1EI7 A;  4AL0 A;  3RFY A;  2EIL C;  4JJG A;  2NUT B;  3CQZ A;  2WVQ A;  2RD9 A;  4ER9 A;  4ONS A;  4XEF A;  3T6J A;  4EBB A;  4JE9 A;  2QNL A;  3PHF 2;  4XPW A;  1H9T A;  3UMH A;  2BC5 A;  1LI7 A;  4PJJ A;  2EIN C;  3RIP A;  1D0X A;  4JRZ A;  4EIY A;  1VYK A;  2XLW A;  5KYW A;  1T5O A;  3O39 A;  5DQZ A;  4WAB A;  4PK4 A;  4YT5 A;  4BJ6 C;  5DQT A;  3S9O A;  2PX3 A;  5BQG A;  1YZA A;  1BR2 A;  3ZWI A;  1YYJ A;  1Z3I X;  2PNO A;  5F5F A;  1TKN A;  2GA0 A;  2R7S A;  3LEV A;  3NMJ A;  1OCZ C;  2LFD A;  4O7G A;  5JSL A;  1TWH A;  3J06 A;  3GM3 A;  5CI9 A;  3DM5 A;  3NYJ A;  4DVY P;  2YL0 A;  4GQH A;  1TQG A;  4MTF A;  2VAS A;  4IRU A;  1FR0 A;  5K0I A;  3TOM A;  3FOO A;  4MVZ A;  3AQC A;  2LP4 A;  2J7P A;  3ASN C;  4XPY A;  2Q7R A;  1KU2 A;  4OIO F;  3RKO F;  1RCP A;  4LLE A;  4FWV A;  5A6K A;  3K7D A;  2VB6 A;  5FZT A;  3T4R A;  1VB5 A;  4YK5 A;  4KNW A;  2GFH A;  2IXM A;  3FAP B;  3RQG A;  1V4A A;  4JC7 A;  2A68 F;  2KQ9 A;  1OW6 A;  1K40 A;  3GWL A;  4E0H A;  2Q4F A;  4I1O B;  4GYT A;  1A41 A;  1CPQ A;  2PP4 A;  2H7O A;  5T3T A;  1Q0K A;  1E84 A;  4CJG A;  4ZLD A;  1HE1 A;  3EZI A;  3NYL A;  4K7B A;  5T3W A;  2WVN A;  2IXN A;  1M2V B;  1ZHY A;  4QI0 A;  4L6R A;  2XLH A;  3SYN A;  5DLJ A;  3FAJ A;  2IBF A;  4I1M A;  4AK9 A;  4CDV A;  4KNV A;  3WAQ A;  3VF0 A;  5BQH A;  2LSE A;  3DAG A;  1DOV A;  1O3U A;  2TMV P;  3POV A;  4O6Y A;  4CJO A;  3GAN A;  1D1A A;  2CCY A;  4XEV A;  4Q7C A;  2XLE A;  3UGO A;  1LS4 A;  3MYF A;  2NSG A;  1UG7 A;  3C8Z A;  1J8M F;  2OKU A;  2L6G A;  2P0N A;  2VC9 A;  3F47 A;  3HNL A;  3K66 A;  3KPH A;  3MYI A;  3Q7G A;  4WGY A;  1HMD A;  1Q0G A;  4KI2 A;  1YLM A;  3UMK A;  4XLN F;  3M4C A;  3KMI A;  4IGG A;  3EJN A;  3ABL C;  3U9M A;  1MMN A;  1ZW2 A;  1ORS C;  1Q0F A;  2A1D D;  2G62 A;  3AGT A;  4U5E E;  3V5Z A;  3ZVR A;  5E33 A;  4EBK A;  1GGQ A;  1EKY A;  2V26 A;  3FVY A;  4CIH A;  2XL4 A;  3TOL A;  1VOM A;  3ATP A;  2P6V A;  3CSK A;  4IWB A;  1OXB A;  5KYX A;  3W4Y A;  5KYW B;  1OCO C;  4FES A;  5L0F A;  1G5Z A;  2XLD A;  1G8X A;  4CIP A;  1OW8 A;  3K1I C;  3RQE A;  4RDA A;  3VRC A;  1OR2 A;  3DI5 A;  1A7V A;  4MS2 A;  3U3B A;  2R05 A;  5B3S C;  2EPM X;  1CGO A;  3ZC4 A;  2PX0 A;  2X51 A;  3U8P A;  3NRH A;  4KC9 A;  3M15 A;  3U8V A;  3LEO A;  1J8Y F;  2J9W A;  1A7D A;  1WWP A;  3LS1 A;  2AP3 A;  3Q6M A;  4LDR A;  4C3B A;  2KGO A;  1PCX A;  1YZC A;  1M57 C;  2YLD A;  1XWJ A;  4P9T A;  2KC3 A;  3NMI A;  5A69 A;  4O6M A;  2LK4 A;  2HV6 A;  4P6I C;  1ZU5 A;  3GEE A;  4DBQ A;  3S84 A;  1LE4 A;  3FDQ A;  3SXK A;  3CEX A;  4XQ1 A;  2OEV A;  1G4U S;  1Q0M A; 
#chains in the Genus database with same CATH homology
 5JVE A;  4JEA A;  4U9D A;  1YYX A;  3QVZ A;  3ZTZ A;  1APC A;  4ER9 A;  1E83 A;  4JE9 A;  1JAF A;  4WGZ A;  2BC5 A;  1M6T A;  4D4X A;  4EIY A;  1E85 A;  3C62 A;  2YL7 A;  2XLW A;  2XLV A;  5B3I A;  1NBB A;  4JKV A;  3M79 A;  4JEB A;  1YZA A;  3ZWI A;  1YYJ A;  3NMJ A;  1GQA A;  5JSL A;  2XL6 A;  3HNK A;  2YL0 A;  5JLI A;  2XLO A;  4N4W A;  5JUA A;  4CDY A;  3TOM A;  5JS5 A;  3QW0 A;  1LM3 B;  3FOO A;  3IQ5 A;  1RCP A;  3HNI A;  2XM0 A;  3ZTM A;  5JRA A;  2XL8 A;  3QW1 A;  1QPU A;  4N6H A;  3DE9 A;  2J8W A;  1CPQ A;  1E84 A;  4CJG A;  3QVY A;  1CPR A;  3IQ6 A;  2YL3 A;  2XLH A;  4L6R A;  2XM4 A;  4CDV A;  2QLA A;  1MQV A;  5AGF A;  4IB4 A;  4CX9 A;  4CJO A;  4ULV A;  2CCY A;  2YL1 A;  2XLE A;  3HNL A;  4WGY A;  3M4C A;  4D4N A;  3DE8 A;  1QQ3 A;  4IAQ A;  3FOP A;  2J9B A;  1EKY A;  3NMK A;  3C63 A;  3TOL A;  4IAR A;  2YLI A;  1E86 A;  3L1M A;  3M4B A;  2XLD A;  3HNJ A;  3ZQY A;  4CIP A;  3VRC A;  1A7V A;  1CGO A;  3U8P A;  3M15 A;  2XLM A;  4NC3 A;  5JP7 A;  2YKZ A;  5JT4 A;  1YZC A;  1BBH A;  2YLD A;  1CGN A;  3NMI A;  4CDA A;  1S05 A;  4U9E A;  256B A;  3ZQV A;  2YLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...