2YL7A

Cytochrome c prime from alcaligenes xylosoxidans: as isolated l16g variant at 0.9 a resolution - restraint refinement
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAGTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 53
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yl7A00
1LM3B 2CCYA 3NMJA 3NMKA 4U9EA 3ZWIA 1NBBA 2J9BA 3QVYA 2XLDA 1QQ3A 3M15A 1QPUA 4N6HA 4IB4A 4JEBA 5JLIA 2XLMA 3M4CA 4ULVA 3TOMA 3ZTMA 4CJGA 1YYJA 1YYXA 2YL0A 4D4NA 2J8WA 4CDAA 3TOLA 3NMIA 1MQVA 2XLEA 2YL7A 2YLGA 5B3IA 2YL1A 4U9DA 5JSLA 5JRAA 2QLAA 3QVZA 1E85A 4ER9A 1CGNA 4NC3A 3L1MA 3FOPA 2XM0A 2XLOA 1E86A 4CDYA 3HNJA 4L6RA 4D4XA 3C63A 1CGOA 3ZQYA 3HNIA 3FOOA 2XLWA 3M4BA 3VRCA 4CIPA 1E84A 1E83A 2YL3A 3IQ5A 2XL6A 1JAFA 3QW0A 2BC5A 1A7VA 1BBHA 4EIYA 3ZQVA 5JVEA 1APCA 4N4WA 1EKYA 3IQ6A 2YLIA 1YZCA 256BA 1CPQA 1S05A 4CDVA 3QW1A 1RCPA 2YKZA 1CPRA 4WGYA 3HNKA 3U8PA 3DE9A 2XM4A 5JT4A 4WGZA 2XLHA 3ZTZA 5JS5A 3DE8A 4JEAA 1GQAA 4CX9A 2YLDA 4IAQA 1YZAA 1M6TA 5JUAA 3HNLA 4IARA 4JE9A 3M79A 5AGFA 4JKVA 4CJOA 2XL8A 5JP7A 2XLVA 3C62A
chains in the Genus database with same CATH superfamily
2C03A 4J32B 4E18A 2XS8A 2A0BA 2OKUA 3NMKA 4EKWA 1XZQA 1EA8A 2P7VA 3B0UX 4PFPA 1LPEA 3LEOA 1SF8A 3EGDA 4DBQA 3CSKA 3QVYA 4XPXA 2XLDA 1Z23A 2E87A 3M15A 1L3PA 1OR2A 4N6HA 2RD9A 4J7YA 3CQZA 2GA0A 4ANJA 2FGYA 2F22A 3US6A 3PCVA 1NU9C 3EFOB 1Q0DA 4DRIB 1WOLA 4DVZA 2LQGA 2WB7A 1V4AA 1Z3IX 2HFIA 4AK9A 5JLIA 1T9KA 1L7CA 2L6GA 4U5DE 3TOMA 3W4YA 3ZTMA 4DOZA 2NG1A 5DQZA 3LS0A 1GS9A 2I8BA 3S27A 3JYHA 3T6BA 2KC3A 1IW7F 3WHNA 1VK5A 4DRJB 1LE4A 4E7ZA 4K7BA 3SZRA 1GGQA 4PJJA 3AG2C 3G4ZA 1MQVA 2XLEA 2YLGA 1Q0FA 2IXNA 5BQHA 5JRAA 4A2NB 3EH1A 3NG1A 3NDBB 4XWJA 1DOWA 3ATPA 5A6KA 3H2VA 3LLKA 2R02A 3RFYA 3UGPA 5IY5C 3R7CA 1T01A 4I44A 3AG4C 5KYYB 4LLEA 5BQGA 2Q7RA 5L0FA 1YVIA 4OD4A 5D92A 4BJ5A 2HJMA 1TWAA 1Z7Qc 2CNWA 2PX0A 1E86A 2CDQA 1SMYF 2QNLA 3BRJA 3EZIA 4GEHA 4AL0A 2OCCC 3ABLC 2EPMX 3C63A 2TMVP 1D0YA 2M4EA 1XWJA 3VYWA 3LNRA 1RJ9B 1BZ4A 3C7JA 1N1CA 1ST6A 2OEVA 2R7OA 2XLWA 3MLGA 5BUOA 5CIVA 2OQMA 3B9QA 3GM2A 3I4UA 3TJ6A 1E84A 2C04A 2VC9A 2WZLA 3O6XA 1VLSA 1I4ZA 3Q6MA 2D5RB 3W8HA 5KYXA 2LIGA 4DXWA 4MVMA 4NTBA 2Y3HA 3EG9B 2Y3GA 4UDVA 2WVQA 5DLJA 3UR3C 1LVKA 1ZHZA 2Q00A 4C3EA 4EWCA 2A6EF 5JVEA 1EKYA 3S0XA 2HMZA 4U5FE 3ZIBA 1ZU4A 3CZ6A 1OQCA 3IQ6A 3UGOA 4Q5SF 2QY9A 4KI2A 1OXBA 1C02A 3H2UA 3DM5A 2GFHA 2L81A 1NFOA 1CPQA 4CDVA 1ZHTA 2VB6A 2YZSA 4G78A 1RCPA 4JRZA 4YT8A 4G7OF 3HTKC 1A7DA 1FAPB 3O10A 4QI2A 1TR2A 3JZ0A 2Y39A 4Q7CA 3T9OA 3G50A 5A69A 5KYWA 3TULA 5T3WA 2LFDA 2H7OA 4YN0B 4BJTA 3DE9A 4Z9JA 1JPNA 3DWWA 4MQ9F 4U5EE 2Q9CA 2KQ9A 1BR2A 4ZLCA 2R7SA 4IRUA 1SR2A 4EBBA 3NYLA 3RQEA 3VF0A 1GQAA 5A6BD 3GM1A 4KNVA 4O6MA 2R7TA 4JCHA 3JRTA 3ZG1A 3S90A 1YZAA 3TD7A 1FFHA 3TQOA 3V5XA 4E7SA 3JSEO 3B29A 4CBEA 2XSEA 2KYHA 4RDAA 1ZYRF 2B0HA 2EINC 1SZIA 3M79A 4JCZA 2ASRA 1LS4A 1YLMA 2IOQA 2KJGA 2W45A 4JKVA 4RBNA 3S29A 3V7OA 4CJOA 4XLPF 2KSFA 2WZGA 1CGME 3WAQA 2FAPB 1D1BA 4QDLA 3RYLA 4FAPB 2VCCA 5E33A 2R7VA 5B1BC 1T6IA 1V74B 4NTFA 4XEVA 5DVWA 1K04A 2I15A 2J9BA 2O9XA 3DKAA 4LERA 4E0IA 1QPUA 4CS7A 4IB4A 3PMRA 3JCUQ 3RQGA 5HV9A 2NSFA 3CEXA 1NZEA 1TWHA 2EIJC 3POVA 2B0JA 3F47A 4YJWA 4OINF 4ONSA 2DB4A 2VH3A 3EHNA 1TFKB 3U3FA 2OG2A 1YDIA 2P6VA 3PHF2 2DYRC 5GPGB 4ZLDA 3EGXB 1S7ZA 4MW3A 4CJGA 5DS6A 1YYJA 4W8KA 4BG0A 3MX3A 3DD7A 4OIRF 3JYYA 5HSWA 2LFFA 2OJQA 3L0IA 2Q9BA 3IHUA 4OIOF 1O87A 3AG3C 2KW3C 1MMAA 2LD6A 3U9MA 1EQ1A 1V54C 1JOGA 4EBKA 2YRFA 4YL3A 4LLCA 5JSLA 3SEOA 3W2VA 3T6JA 5K0IA 1M56C 1OW8A 2A0UA 4MVOA 4JJFA 4IAOA 3C8GB 1HY5A 2PF4E 3T4RA 4ER9A 5BQIA 2CYDA 3L1MA 1A41A 3KPHA 2GDCA 2PX3A 1Z63A 1FR0A 2LP4A 2V26A 1M2VB 3EJNA 1QVXA 3U2MA 4CDYA 1LE2A 1VMAA 2GWWA 4ULWA 3UNGC 4LDKA 2ZXWC 2MWQA 2BE5F 2DI3A 4MVRA 5D91A 2HSQA 2XXAB 4YT2A 1CGOA 2Y3DA 3ZQYA 1H9GA 1OCCC 4EHPA 1TWCA 3FOOA 1HE1A 2ZPAA 3KYJA 3M4BA 4A4AA 4XQ1A 2EPKX 3SXMA 3VRCA 3RH3A 1HW2A 3JTLO 4E0HA 3N2ZB 1E83A 4X0RA 2YL3A 3RVZA 3IQ5A 2XL6A 2HUJA 3UMKA 1VYKA 2YEVA 3UMHA 2BC5A 2AU5A 1A7VA 1RKEA 3L34A 2FFHA 2OOCA 3OA1A 1QKRA 2CW0F 1FNTc 5L0HA 2W4BA 2NUPB 4J7TA 3ZQVA 4G7ZF 4N4WA 1FMVA 2NUTB 3LS1A 2G3KA 4RD9A 4C7OA 1Z5ZA 3SXKA 1OKKD 1KU2A 2L6FA 1BR1A 4MW8A 4P9FA 2J45A 4PK4A 1C03A 4AL1A 2HV7A 3V5YA 4FX5A 1D0XA 2WVOA 3EGDB 5DQTA 4AE4A 3X2QC 4O6YA 4BJ1A 3AGUA 4G7HF 3GEEA 3RVYA 4BPMA 4C3DA 3X1OA 2R05A 3WG7C 3SNHA 1FMWA 3GODA 3HNKA 4YT4A 2EILC 2WVNA 4YK5A 2LK4A 3U8PA 3RIPA 2HSBA 3KMIA 3ECSA 5KYNA 4H4KC 2A6HF 3AJMA 2PP4A 1RMVA 3K1HA 4XEKA 3JSZA 2D4UA 3U8VA 4E17A 2QTVA 1R4TA 2RSEB 2VASA 1WTYA 3ITFA 5EK0A 3W8IA 5JT4A 2XLHA 4O7GA 2R03A 1M2OA 5JS5A 2DYSC 2J7PD 3M1CB 3GORA 1FTSA 3Q7GA 4QI0A 2R7XA 3FAPB 5DS5A 2YLDA 1MNDA 3ABKC 2PFDA 1M6TA 4OD5A 5JUAA 4IARA 4CS9C 1AUEA 2H7BA 1HMOA 1WATA 3BEHA 4P6IC 2XL8A 4DJ9A 2JX0A 1F1MA 3KYIA 3V5ZA 2XLVA 3C62A 2HMQA 5L0IA 5E3CA 1LM3B 1QZXA 3I5QA 4U9EA 1R5ID 2XL4A 4Q4ZF 4GYTA 1YAUO 2OJED 3DZAA 1TWGA 1QQ3A 4YL1A 3DXJF 3GEHA 5A6JA 4CS9A 2L9JA 4HFKB 5COFA 3B71A 4FESA 4JEBA 3I5PA 1H9TA 2HV6A 3Q6NA 3JT1A 4PJLA 1BR4A 1OW6A 2AP3A 4CS8C 4XPYA 3RW0A 4ULVA 2WL8A 3GWNA 2A69F 4K0DA 3EH2A 3DM9B 3UMIA 2AVKA 1YYXA 2P61A 2ZD9A 2YL0A 3NRHA 3QZCA 1RKCA 4D4NA 5E2QA 4CDAA 4LDRA 4EUKB 1VTMP 2JD3A 4I3MA 4W8PA 2H8AA 5KYUA 3O39A 2ETSA 1ZW2A 1B68A 1Z6AA 2AWYA 5FCLA 4O79A 1YA7O 2YL7A 2HZ8A 1FFTC 5B3IA 1D1AA 2YL1A 4CS8A 4U9DA 1D0ZA 3KKBA 3OWTA 4U5CE 2L7AA 4BJ6C 4JTDB 2IYLD 4LDQA 1CGNA 3ZSUA 3G4XA 2R7QA 4NC3A 5L0JA 3SYNA 3FOPA 3MFNA 3S84A 1VB5A 5L3QA 2WZFA 4NCQA 4JC7A 3LESA 4NQFA 5L3VA 2V3CC 3DMDA 4FWVA 4JTCB 4N6CA 2LSEA 5KYWB 1AVOB 5COMA 4L6RA 1Q0GA 2JPUA 3EFOA 1ZHXA 3IEEA 4D4XA 1PCXA 5F28E 1KTMA 4HFFB 4BJ6A 3HNIA 2A1DD 2R7RA 3AGTA 1VYIA 2CGEA 3LUTB 3QMKA 5AC4A 2R9RB 2OEXA 1ZVZA 2OU6A 3EPVA 2DGJA 2EIMC 1VLTA 3ABMC 2W9YA 1J8YF 2NPUA 4BEJA 3DAGA 4MS2A 1JAFA 4YWQA 5A6AA 3ZDLA 2IXOA 4J30B 1ZHWA 3B0VC 2H7VC 1TFOB 1WGWA 3FDQA 1OCZC 4G0HA 5T3TA 4NTAA 5CI9A 3IQCA 1MMDA 1APCA 1V55C 2LCHA 4C3BA 3C8GD 1ORSC 3ZC4A 3EQLF 3NYMA 5T1DB 2R7UA 4PFOA 3J06A 1JRAA 2YLIA 3K1IC 4Z9HA 5KYYA 3DI5A 1PD1A 2J9WA 3DJUB 1S05A 2GAQA 4K1OA 1I4YA 3LLIA 4DRHB 3LEVA 3QW1A 3K33A 1J8MF 1Q0MA 4DBRA 3HKKA 2UUHA 3MYIA 4WGYA 2P1AA 3EHMA 1Y4CA 1K05A 4MNDA 4N06A 2EIKC 3L8JA 2R25A 3WODF 1LI7A 2XM4A 1LS1A 1RJ9A 3HJCA 1O5HA 2MYSA 3K1IA 1MMGA 2PNOA 4GQHA 4XTKA 3VM6A 4I1MA 2A68F 1HW1A 3LJBA 3DE8A 4JEAA 4R32A 3MYFA 1M57C 2Y69C 2J7PA 2W4MA 1PV3A 5AC5A 3FVYA 4YL0A 3HNLA 4JE9A 5EGYA 3EG9A 3C18A 3N24A 2EPNA 3KL4A 4MVSA 4NY3A 3S28A 1H7IA 4BJ5C 4CIHA 2NSGA 1T6QA 2HJ3A 1C17M 3AOUA 4IJJA 2HKVA 3NMJA 2CCYA 1UFBA 3GWLA 5L0DA 1RXQA 3ZWIA 3IQTA 4XPWA 3FHDA 2XRHA 1NBBA 4MTGA 3U3BA 1LIHA 1TQGA 1I5NA 3CAXA 4MVZA 1XZPA 1OXKA 2KGOA 2KK1A 1EI7A 1O3UA 3B0PA 1T6UA 1PD0A 4U5HA 4I1OB 3A9CA 2VCAA 5E3AA 1HMDA 1ZU5A 3FAJA 2XLMA 3AQBA 1ZW3A 3E70C 3M4CA 2IXPA 5EHHA 5L0CA 2Y3BA 3QTHA 1Q0KA 1OW7A 3FXHA 2PBEA 5A6BA 2X0CA 1DOVA 2Q3TA 4JW1A 3AG1C 3SXZA 4Z9IA 1H6GA 2J8WA 3K6BA 1OCRC 4MTOA 1QLEC 4XEFA 1T5OA 1RKEB 1TKNA 1WWPA 2QE9A 1MMNA 4M63A 1OR3A 2J9VA 1A7EA 3TOLA 4OIQF 3NMIA 3LNMB 1ZZPA 1ORYA 4B6IA 3EZHA 4C7OB 2IXMA 1LKXA 2QLAA 3QVZA 2P0NA 1E85A 1Y6DA 3KH2A 1E2XA 3W2WA 2EPLX 2Z15A 2CNWD 4F4BA 4PR9A 3O55A 2UUIA 4AE4B 1A0BA 1WN0A 3IPMO 1D1CA 3F46A 2XM0A 5L0GA 3K7DA 4MVQA 2XLOA 2VCBA 1U0BB 1G8XA 3DJNB 2MHRA 3HLZA 4KBLA 4PJMA 1ZHYA 1YARO 2IM8A 1AEPA 3HNJA 1ORJA 2J9UA 2Q9AA 3E9VA 3NYJA 2YVKA 2BL2A 3TJ5A 1OCOC 1JPJA 4MTFA 3K66A 5FZTA 1W2WA 1JR8A 4CSAC 4XLNF 1HE9A 4CIPA 2QUPA 3EGXA 1NFNA 3RKOF 5F5HA 2AWCA 4JTAB 1G4WR 1NG1A 3JRMO 1UG7A 3Q7LA 2X51A 5CI8A 3QW0A 2L6HA 1G5ZA 4O6NA 4LACB 5F5FA 4JZAA 1BBHA 1BDJB 4EIYA 1WASA 3LAYA 3NKDA 4HEAJ 3U9JA 2XS1A 3GANA 3L8IA 4PJNA 3U0CA 2ZXRA 1JMWA 4IWBA 4JJGA 1YJGA 3S9OA 3VAYA 4YT5A 1VOMA 3OEOA 4CSAA 1LI5A 3GEIA 3DAFA 2ZXPA 3U2LA 3C8GA 5B3SC 1QSPA 4WABA 1YA9A 2Q4FA 1YZCA 256BA 3GM3A 1KNYA 3N0TA 2ZXOA 3FMSA 4H54A 4WJ0A 5TJ5E 2KNHA 2ICWG 1GM5A 1M2VA 2J0WA 3A11A 2R7WA 3U5SA 2YKZA 1CPRA 1NLXA 3MBGA 3R2PA 1NU7D 2YHSA 2G3VA 1K40A 3H65A 3ZVRA 4OIPF 1U6HA 4JIOA 2XXAA 4HE8D 5B1AC 3TK0A 2IBFA 2EPOA 3ASNC 2HS5A 3RQFA 2YQYA 4IGGA 2YWAA 1IZMA 1U89A 2J46A 4WGZA 3ZTZA 4AX2A 3ASOC 2M64A 2J0XA 1MNEA 3NKEA 4JURI 4PACA 4EBJA 5KYXB 4DVYP 2G62A 1NSGB 5COGA 3RF3A 3T6GB 4CX9A 4JVSA 5KYUB 4IAQA 3SP1A 4U5GA 4MVUA 4KC9A 4P9TA 4KNWA 3PDMP 1G4US 1OKKA 2NUPA 4U5BE 5AGFA 4BEMJ 1SYQA 2NUTA 3SXYA 3AQCA 5JP7A 3C8ZA 5DS4A
chains in the Genus database with same CATH topology
1LM3B 2CCYA 3NMJA 3NMKA 4U9EA 3ZWIA 1NBBA 2J9BA 3QVYA 2XLDA 1QQ3A 3M15A 1QPUA 4N6HA 4IB4A 4JEBA 5JLIA 2XLMA 3M4CA 4ULVA 3TOMA 3ZTMA 4CJGA 1YYJA 1YYXA 2YL0A 4D4NA 2J8WA 4CDAA 3TOLA 3NMIA 1MQVA 2XLEA 2YL7A 2YLGA 5B3IA 2YL1A 4U9DA 5JSLA 5JRAA 2QLAA 3QVZA 1E85A 4ER9A 1CGNA 4NC3A 3L1MA 3FOPA 2XM0A 2XLOA 1E86A 4CDYA 3HNJA 4L6RA 4D4XA 3C63A 1CGOA 3ZQYA 3HNIA 3FOOA 2XLWA 3M4BA 3VRCA 4CIPA 1E84A 1E83A 2YL3A 3IQ5A 2XL6A 1JAFA 3QW0A 2BC5A 1A7VA 1BBHA 4EIYA 3ZQVA 5JVEA 1APCA 4N4WA 1EKYA 3IQ6A 2YLIA 1YZCA 256BA 1CPQA 1S05A 4CDVA 3QW1A 1RCPA 2YKZA 1CPRA 4WGYA 3HNKA 3U8PA 3DE9A 2XM4A 5JT4A 4WGZA 2XLHA 3ZTZA 5JS5A 3DE8A 4JEAA 1GQAA 4CX9A 2YLDA 4IAQA 1YZAA 1M6TA 5JUAA 3HNLA 4IARA 4JE9A 3M79A 5AGFA 4JKVA 4CJOA 2XL8A 5JP7A 2XLVA 3C62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LM3 B;  2CCY A;  3NMJ A;  3NMK A;  4U9E A;  3ZWI A;  1NBB A;  2J9B A;  3QVY A;  2XLD A;  1QQ3 A;  3M15 A;  1QPU A;  4N6H A;  4IB4 A;  4JEB A;  5JLI A;  2XLM A;  3M4C A;  4ULV A;  3TOM A;  3ZTM A;  4CJG A;  1YYJ A;  1YYX A;  2YL0 A;  4D4N A;  2J8W A;  4CDA A;  3TOL A;  3NMI A;  1MQV A;  2XLE A;  2YL7 A;  2YLG A;  5B3I A;  2YL1 A;  4U9D A;  5JSL A;  5JRA A;  2QLA A;  3QVZ A;  1E85 A;  4ER9 A;  1CGN A;  4NC3 A;  3L1M A;  3FOP A;  2XM0 A;  2XLO A;  1E86 A;  4CDY A;  3HNJ A;  4L6R A;  4D4X A;  3C63 A;  1CGO A;  3ZQY A;  3HNI A;  3FOO A;  2XLW A;  3M4B A;  3VRC A;  4CIP A;  1E84 A;  1E83 A;  2YL3 A;  3IQ5 A;  2XL6 A;  1JAF A;  3QW0 A;  2BC5 A;  1A7V A;  1BBH A;  4EIY A;  3ZQV A;  5JVE A;  1APC A;  4N4W A;  1EKY A;  3IQ6 A;  2YLI A;  1YZC A;  256B A;  1CPQ A;  1S05 A;  4CDV A;  3QW1 A;  1RCP A;  2YKZ A;  1CPR A;  4WGY A;  3HNK A;  3U8P A;  3DE9 A;  2XM4 A;  5JT4 A;  4WGZ A;  2XLH A;  3ZTZ A;  5JS5 A;  3DE8 A;  4JEA A;  1GQA A;  4CX9 A;  2YLD A;  4IAQ A;  1YZA A;  1M6T A;  5JUA A;  3HNL A;  4IAR A;  4JE9 A;  3M79 A;  5AGF A;  4JKV A;  4CJO A;  2XL8 A;  5JP7 A;  2XLV A;  3C62 A; 
#chains in the Genus database with same CATH topology
 2C03 A;  4J32 B;  4E18 A;  2XS8 A;  2A0B A;  2OKU A;  3NMK A;  4EKW A;  1XZQ A;  1EA8 A;  2P7V A;  3B0U X;  4PFP A;  1LPE A;  3LEO A;  1SF8 A;  3EGD A;  4DBQ A;  3CSK A;  3QVY A;  4XPX A;  2XLD A;  1Z23 A;  2E87 A;  3M15 A;  1L3P A;  1OR2 A;  4N6H A;  2RD9 A;  4J7Y A;  3CQZ A;  2GA0 A;  4ANJ A;  2FGY A;  2F22 A;  3US6 A;  3PCV A;  1NU9 C;  3EFO B;  1Q0D A;  4DRI B;  1WOL A;  4DVZ A;  2LQG A;  2WB7 A;  1V4A A;  1Z3I X;  2HFI A;  4AK9 A;  5JLI A;  1T9K A;  1L7C A;  2L6G A;  4U5D E;  3TOM A;  3W4Y A;  3ZTM A;  4DOZ A;  2NG1 A;  5DQZ A;  3LS0 A;  1GS9 A;  2I8B A;  3S27 A;  3JYH A;  3T6B A;  2KC3 A;  1IW7 F;  3WHN A;  1VK5 A;  4DRJ B;  1LE4 A;  4E7Z A;  4K7B A;  3SZR A;  1GGQ A;  4PJJ A;  3AG2 C;  3G4Z A;  1MQV A;  2XLE A;  2YLG A;  1Q0F A;  2IXN A;  5BQH A;  5JRA A;  4A2N B;  3EH1 A;  3NG1 A;  3NDB B;  4XWJ A;  1DOW A;  3ATP A;  5A6K A;  3H2V A;  3LLK A;  2R02 A;  3RFY A;  3UGP A;  5IY5 C;  3R7C A;  1T01 A;  4I44 A;  3AG4 C;  5KYY B;  4LLE A;  5BQG A;  2Q7R A;  5L0F A;  1YVI A;  4OD4 A;  5D92 A;  4BJ5 A;  2HJM A;  1TWA A;  1Z7Q c;  2CNW A;  2PX0 A;  1E86 A;  2CDQ A;  1SMY F;  2QNL A;  3BRJ A;  3EZI A;  4GEH A;  4AL0 A;  2OCC C;  3ABL C;  2EPM X;  3C63 A;  2TMV P;  1D0Y A;  2M4E A;  1XWJ A;  3VYW A;  3LNR A;  1RJ9 B;  1BZ4 A;  3C7J A;  1N1C A;  1ST6 A;  2OEV A;  2R7O A;  2XLW A;  3MLG A;  5BUO A;  5CIV A;  2OQM A;  3B9Q A;  3GM2 A;  3I4U A;  3TJ6 A;  1E84 A;  2C04 A;  2VC9 A;  2WZL A;  3O6X A;  1VLS A;  1I4Z A;  3Q6M A;  2D5R B;  3W8H A;  5KYX A;  2LIG A;  4DXW A;  4MVM A;  4NTB A;  2Y3H A;  3EG9 B;  2Y3G A;  4UDV A;  2WVQ A;  5DLJ A;  3UR3 C;  1LVK A;  1ZHZ A;  2Q00 A;  4C3E A;  4EWC A;  2A6E F;  5JVE A;  1EKY A;  3S0X A;  2HMZ A;  4U5F E;  3ZIB A;  1ZU4 A;  3CZ6 A;  1OQC A;  3IQ6 A;  3UGO A;  4Q5S F;  2QY9 A;  4KI2 A;  1OXB A;  1C02 A;  3H2U A;  3DM5 A;  2GFH A;  2L81 A;  1NFO A;  1CPQ A;  4CDV A;  1ZHT A;  2VB6 A;  2YZS A;  4G78 A;  1RCP A;  4JRZ A;  4YT8 A;  4G7O F;  3HTK C;  1A7D A;  1FAP B;  3O10 A;  4QI2 A;  1TR2 A;  3JZ0 A;  2Y39 A;  4Q7C A;  3T9O A;  3G50 A;  5A69 A;  5KYW A;  3TUL A;  5T3W A;  2LFD A;  2H7O A;  4YN0 B;  4BJT A;  3DE9 A;  4Z9J A;  1JPN A;  3DWW A;  4MQ9 F;  4U5E E;  2Q9C A;  2KQ9 A;  1BR2 A;  4ZLC A;  2R7S A;  4IRU A;  1SR2 A;  4EBB A;  3NYL A;  3RQE A;  3VF0 A;  1GQA A;  5A6B D;  3GM1 A;  4KNV A;  4O6M A;  2R7T A;  4JCH A;  3JRT A;  3ZG1 A;  3S90 A;  1YZA A;  3TD7 A;  1FFH A;  3TQO A;  3V5X A;  4E7S A;  3JSE O;  3B29 A;  4CBE A;  2XSE A;  2KYH A;  4RDA A;  1ZYR F;  2B0H A;  2EIN C;  1SZI A;  3M79 A;  4JCZ A;  2ASR A;  1LS4 A;  1YLM A;  2IOQ A;  2KJG A;  2W45 A;  4JKV A;  4RBN A;  3S29 A;  3V7O A;  4CJO A;  4XLP F;  2KSF A;  2WZG A;  1CGM E;  3WAQ A;  2FAP B;  1D1B A;  4QDL A;  3RYL A;  4FAP B;  2VCC A;  5E33 A;  2R7V A;  5B1B C;  1T6I A;  1V74 B;  4NTF A;  4XEV A;  5DVW A;  1K04 A;  2I15 A;  2J9B A;  2O9X A;  3DKA A;  4LER A;  4E0I A;  1QPU A;  4CS7 A;  4IB4 A;  3PMR A;  3JCU Q;  3RQG A;  5HV9 A;  2NSF A;  3CEX A;  1NZE A;  1TWH A;  2EIJ C;  3POV A;  2B0J A;  3F47 A;  4YJW A;  4OIN F;  4ONS A;  2DB4 A;  2VH3 A;  3EHN A;  1TFK B;  3U3F A;  2OG2 A;  1YDI A;  2P6V A;  3PHF 2;  2DYR C;  5GPG B;  4ZLD A;  3EGX B;  1S7Z A;  4MW3 A;  4CJG A;  5DS6 A;  1YYJ A;  4W8K A;  4BG0 A;  3MX3 A;  3DD7 A;  4OIR F;  3JYY A;  5HSW A;  2LFF A;  2OJQ A;  3L0I A;  2Q9B A;  3IHU A;  4OIO F;  1O87 A;  3AG3 C;  2KW3 C;  1MMA A;  2LD6 A;  3U9M A;  1EQ1 A;  1V54 C;  1JOG A;  4EBK A;  2YRF A;  4YL3 A;  4LLC A;  5JSL A;  3SEO A;  3W2V A;  3T6J A;  5K0I A;  1M56 C;  1OW8 A;  2A0U A;  4MVO A;  4JJF A;  4IAO A;  3C8G B;  1HY5 A;  2PF4 E;  3T4R A;  4ER9 A;  5BQI A;  2CYD A;  3L1M A;  1A41 A;  3KPH A;  2GDC A;  2PX3 A;  1Z63 A;  1FR0 A;  2LP4 A;  2V26 A;  1M2V B;  3EJN A;  1QVX A;  3U2M A;  4CDY A;  1LE2 A;  1VMA A;  2GWW A;  4ULW A;  3UNG C;  4LDK A;  2ZXW C;  2MWQ A;  2BE5 F;  2DI3 A;  4MVR A;  5D91 A;  2HSQ A;  2XXA B;  4YT2 A;  1CGO A;  2Y3D A;  3ZQY A;  1H9G A;  1OCC C;  4EHP A;  1TWC A;  3FOO A;  1HE1 A;  2ZPA A;  3KYJ A;  3M4B A;  4A4A A;  4XQ1 A;  2EPK X;  3SXM A;  3VRC A;  3RH3 A;  1HW2 A;  3JTL O;  4E0H A;  3N2Z B;  1E83 A;  4X0R A;  2YL3 A;  3RVZ A;  3IQ5 A;  2XL6 A;  2HUJ A;  3UMK A;  1VYK A;  2YEV A;  3UMH A;  2BC5 A;  2AU5 A;  1A7V A;  1RKE A;  3L34 A;  2FFH A;  2OOC A;  3OA1 A;  1QKR A;  2CW0 F;  1FNT c;  5L0H A;  2W4B A;  2NUP B;  4J7T A;  3ZQV A;  4G7Z F;  4N4W A;  1FMV A;  2NUT B;  3LS1 A;  2G3K A;  4RD9 A;  4C7O A;  1Z5Z A;  3SXK A;  1OKK D;  1KU2 A;  2L6F A;  1BR1 A;  4MW8 A;  4P9F A;  2J45 A;  4PK4 A;  1C03 A;  4AL1 A;  2HV7 A;  3V5Y A;  4FX5 A;  1D0X A;  2WVO A;  3EGD B;  5DQT A;  4AE4 A;  3X2Q C;  4O6Y A;  4BJ1 A;  3AGU A;  4G7H F;  3GEE A;  3RVY A;  4BPM A;  4C3D A;  3X1O A;  2R05 A;  3WG7 C;  3SNH A;  1FMW A;  3GOD A;  3HNK A;  4YT4 A;  2EIL C;  2WVN A;  4YK5 A;  2LK4 A;  3U8P A;  3RIP A;  2HSB A;  3KMI A;  3ECS A;  5KYN A;  4H4K C;  2A6H F;  3AJM A;  2PP4 A;  1RMV A;  3K1H A;  4XEK A;  3JSZ A;  2D4U A;  3U8V A;  4E17 A;  2QTV A;  1R4T A;  2RSE B;  2VAS A;  1WTY A;  3ITF A;  5EK0 A;  3W8I A;  5JT4 A;  2XLH A;  4O7G A;  2R03 A;  1M2O A;  5JS5 A;  2DYS C;  2J7P D;  3M1C B;  3GOR A;  1FTS A;  3Q7G A;  4QI0 A;  2R7X A;  3FAP B;  5DS5 A;  2YLD A;  1MND A;  3ABK C;  2PFD A;  1M6T A;  4OD5 A;  5JUA A;  4IAR A;  4CS9 C;  1AUE A;  2H7B A;  1HMO A;  1WAT A;  3BEH A;  4P6I C;  2XL8 A;  4DJ9 A;  2JX0 A;  1F1M A;  3KYI A;  3V5Z A;  2XLV A;  3C62 A;  2HMQ A;  5L0I A;  5E3C A;  1LM3 B;  1QZX A;  3I5Q A;  4U9E A;  1R5I D;  2XL4 A;  4Q4Z F;  4GYT A;  1YAU O;  2OJE D;  3DZA A;  1TWG A;  1QQ3 A;  4YL1 A;  3DXJ F;  3GEH A;  5A6J A;  4CS9 A;  2L9J A;  4HFK B;  5COF A;  3B71 A;  4FES A;  4JEB A;  3I5P A;  1H9T A;  2HV6 A;  3Q6N A;  3JT1 A;  4PJL A;  1BR4 A;  1OW6 A;  2AP3 A;  4CS8 C;  4XPY A;  3RW0 A;  4ULV A;  2WL8 A;  3GWN A;  2A69 F;  4K0D A;  3EH2 A;  3DM9 B;  3UMI A;  2AVK A;  1YYX A;  2P61 A;  2ZD9 A;  2YL0 A;  3NRH A;  3QZC A;  1RKC A;  4D4N A;  5E2Q A;  4CDA A;  4LDR A;  4EUK B;  1VTM P;  2JD3 A;  4I3M A;  4W8P A;  2H8A A;  5KYU A;  3O39 A;  2ETS A;  1ZW2 A;  1B68 A;  1Z6A A;  2AWY A;  5FCL A;  4O79 A;  1YA7 O;  2YL7 A;  2HZ8 A;  1FFT C;  5B3I A;  1D1A A;  2YL1 A;  4CS8 A;  4U9D A;  1D0Z A;  3KKB A;  3OWT A;  4U5C E;  2L7A A;  4BJ6 C;  4JTD B;  2IYL D;  4LDQ A;  1CGN A;  3ZSU A;  3G4X A;  2R7Q A;  4NC3 A;  5L0J A;  3SYN A;  3FOP A;  3MFN A;  3S84 A;  1VB5 A;  5L3Q A;  2WZF A;  4NCQ A;  4JC7 A;  3LES A;  4NQF A;  5L3V A;  2V3C C;  3DMD A;  4FWV A;  4JTC B;  4N6C A;  2LSE A;  5KYW B;  1AVO B;  5COM A;  4L6R A;  1Q0G A;  2JPU A;  3EFO A;  1ZHX A;  3IEE A;  4D4X A;  1PCX A;  5F28 E;  1KTM A;  4HFF B;  4BJ6 A;  3HNI A;  2A1D D;  2R7R A;  3AGT A;  1VYI A;  2CGE A;  3LUT B;  3QMK A;  5AC4 A;  2R9R B;  2OEX A;  1ZVZ A;  2OU6 A;  3EPV A;  2DGJ A;  2EIM C;  1VLT A;  3ABM C;  2W9Y A;  1J8Y F;  2NPU A;  4BEJ A;  3DAG A;  4MS2 A;  1JAF A;  4YWQ A;  5A6A A;  3ZDL A;  2IXO A;  4J30 B;  1ZHW A;  3B0V C;  2H7V C;  1TFO B;  1WGW A;  3FDQ A;  1OCZ C;  4G0H A;  5T3T A;  4NTA A;  5CI9 A;  3IQC A;  1MMD A;  1APC A;  1V55 C;  2LCH A;  4C3B A;  3C8G D;  1ORS C;  3ZC4 A;  3EQL F;  3NYM A;  5T1D B;  2R7U A;  4PFO A;  3J06 A;  1JRA A;  2YLI A;  3K1I C;  4Z9H A;  5KYY A;  3DI5 A;  1PD1 A;  2J9W A;  3DJU B;  1S05 A;  2GAQ A;  4K1O A;  1I4Y A;  3LLI A;  4DRH B;  3LEV A;  3QW1 A;  3K33 A;  1J8M F;  1Q0M A;  4DBR A;  3HKK A;  2UUH A;  3MYI A;  4WGY A;  2P1A A;  3EHM A;  1Y4C A;  1K05 A;  4MND A;  4N06 A;  2EIK C;  3L8J A;  2R25 A;  3WOD F;  1LI7 A;  2XM4 A;  1LS1 A;  1RJ9 A;  3HJC A;  1O5H A;  2MYS A;  3K1I A;  1MMG A;  2PNO A;  4GQH A;  4XTK A;  3VM6 A;  4I1M A;  2A68 F;  1HW1 A;  3LJB A;  3DE8 A;  4JEA A;  4R32 A;  3MYF A;  1M57 C;  2Y69 C;  2J7P A;  2W4M A;  1PV3 A;  5AC5 A;  3FVY A;  4YL0 A;  3HNL A;  4JE9 A;  5EGY A;  3EG9 A;  3C18 A;  3N24 A;  2EPN A;  3KL4 A;  4MVS A;  4NY3 A;  3S28 A;  1H7I A;  4BJ5 C;  4CIH A;  2NSG A;  1T6Q A;  2HJ3 A;  1C17 M;  3AOU A;  4IJJ A;  2HKV A;  3NMJ A;  2CCY A;  1UFB A;  3GWL A;  5L0D A;  1RXQ A;  3ZWI A;  3IQT A;  4XPW A;  3FHD A;  2XRH A;  1NBB A;  4MTG A;  3U3B A;  1LIH A;  1TQG A;  1I5N A;  3CAX A;  4MVZ A;  1XZP A;  1OXK A;  2KGO A;  2KK1 A;  1EI7 A;  1O3U A;  3B0P A;  1T6U A;  1PD0 A;  4U5H A;  4I1O B;  3A9C A;  2VCA A;  5E3A A;  1HMD A;  1ZU5 A;  3FAJ A;  2XLM A;  3AQB A;  1ZW3 A;  3E70 C;  3M4C A;  2IXP A;  5EHH A;  5L0C A;  2Y3B A;  3QTH A;  1Q0K A;  1OW7 A;  3FXH A;  2PBE A;  5A6B A;  2X0C A;  1DOV A;  2Q3T A;  4JW1 A;  3AG1 C;  3SXZ A;  4Z9I A;  1H6G A;  2J8W A;  3K6B A;  1OCR C;  4MTO A;  1QLE C;  4XEF A;  1T5O A;  1RKE B;  1TKN A;  1WWP A;  2QE9 A;  1MMN A;  4M63 A;  1OR3 A;  2J9V A;  1A7E A;  3TOL A;  4OIQ F;  3NMI A;  3LNM B;  1ZZP A;  1ORY A;  4B6I A;  3EZH A;  4C7O B;  2IXM A;  1LKX A;  2QLA A;  3QVZ A;  2P0N A;  1E85 A;  1Y6D A;  3KH2 A;  1E2X A;  3W2W A;  2EPL X;  2Z15 A;  2CNW D;  4F4B A;  4PR9 A;  3O55 A;  2UUI A;  4AE4 B;  1A0B A;  1WN0 A;  3IPM O;  1D1C A;  3F46 A;  2XM0 A;  5L0G A;  3K7D A;  4MVQ A;  2XLO A;  2VCB A;  1U0B B;  1G8X A;  3DJN B;  2MHR A;  3HLZ A;  4KBL A;  4PJM A;  1ZHY A;  1YAR O;  2IM8 A;  1AEP A;  3HNJ A;  1ORJ A;  2J9U A;  2Q9A A;  3E9V A;  3NYJ A;  2YVK A;  2BL2 A;  3TJ5 A;  1OCO C;  1JPJ A;  4MTF A;  3K66 A;  5FZT A;  1W2W A;  1JR8 A;  4CSA C;  4XLN F;  1HE9 A;  4CIP A;  2QUP A;  3EGX A;  1NFN A;  3RKO F;  5F5H A;  2AWC A;  4JTA B;  1G4W R;  1NG1 A;  3JRM O;  1UG7 A;  3Q7L A;  2X51 A;  5CI8 A;  3QW0 A;  2L6H A;  1G5Z A;  4O6N A;  4LAC B;  5F5F A;  4JZA A;  1BBH A;  1BDJ B;  4EIY A;  1WAS A;  3LAY A;  3NKD A;  4HEA J;  3U9J A;  2XS1 A;  3GAN A;  3L8I A;  4PJN A;  3U0C A;  2ZXR A;  1JMW A;  4IWB A;  4JJG A;  1YJG A;  3S9O A;  3VAY A;  4YT5 A;  1VOM A;  3OEO A;  4CSA A;  1LI5 A;  3GEI A;  3DAF A;  2ZXP A;  3U2L A;  3C8G A;  5B3S C;  1QSP A;  4WAB A;  1YA9 A;  2Q4F A;  1YZC A;  256B A;  3GM3 A;  1KNY A;  3N0T A;  2ZXO A;  3FMS A;  4H54 A;  4WJ0 A;  5TJ5 E;  2KNH A;  2ICW G;  1GM5 A;  1M2V A;  2J0W A;  3A11 A;  2R7W A;  3U5S A;  2YKZ A;  1CPR A;  1NLX A;  3MBG A;  3R2P A;  1NU7 D;  2YHS A;  2G3V A;  1K40 A;  3H65 A;  3ZVR A;  4OIP F;  1U6H A;  4JIO A;  2XXA A;  4HE8 D;  5B1A C;  3TK0 A;  2IBF A;  2EPO A;  3ASN C;  2HS5 A;  3RQF A;  2YQY A;  4IGG A;  2YWA A;  1IZM A;  1U89 A;  2J46 A;  4WGZ A;  3ZTZ A;  4AX2 A;  3ASO C;  2M64 A;  2J0X A;  1MNE A;  3NKE A;  4JUR I;  4PAC A;  4EBJ A;  5KYX B;  4DVY P;  2G62 A;  1NSG B;  5COG A;  3RF3 A;  3T6G B;  4CX9 A;  4JVS A;  5KYU B;  4IAQ A;  3SP1 A;  4U5G A;  4MVU A;  4KC9 A;  4P9T A;  4KNW A;  3PDM P;  1G4U S;  1OKK A;  2NUP A;  4U5B E;  5AGF A;  4BEM J;  1SYQ A;  2NUT A;  3SXY A;  3AQC A;  5JP7 A;  3C8Z A;  5DS4 A; 
#chains in the Genus database with same CATH homology
 1LM3 B;  2CCY A;  3NMJ A;  3NMK A;  4U9E A;  3ZWI A;  1NBB A;  2J9B A;  3QVY A;  2XLD A;  1QQ3 A;  3M15 A;  1QPU A;  4N6H A;  4IB4 A;  4JEB A;  5JLI A;  2XLM A;  3M4C A;  4ULV A;  3TOM A;  3ZTM A;  4CJG A;  1YYJ A;  1YYX A;  2YL0 A;  4D4N A;  2J8W A;  4CDA A;  3TOL A;  3NMI A;  1MQV A;  2XLE A;  2YL7 A;  2YLG A;  5B3I A;  2YL1 A;  4U9D A;  5JSL A;  5JRA A;  2QLA A;  3QVZ A;  1E85 A;  4ER9 A;  1CGN A;  4NC3 A;  3L1M A;  3FOP A;  2XM0 A;  2XLO A;  1E86 A;  4CDY A;  3HNJ A;  4L6R A;  4D4X A;  3C63 A;  1CGO A;  3ZQY A;  3HNI A;  3FOO A;  2XLW A;  3M4B A;  3VRC A;  4CIP A;  1E84 A;  1E83 A;  2YL3 A;  3IQ5 A;  2XL6 A;  1JAF A;  3QW0 A;  2BC5 A;  1A7V A;  1BBH A;  4EIY A;  3ZQV A;  5JVE A;  1APC A;  4N4W A;  1EKY A;  3IQ6 A;  2YLI A;  1YZC A;  256B A;  1CPQ A;  1S05 A;  4CDV A;  3QW1 A;  1RCP A;  2YKZ A;  1CPR A;  4WGY A;  3HNK A;  3U8P A;  3DE9 A;  2XM4 A;  5JT4 A;  4WGZ A;  2XLH A;  3ZTZ A;  5JS5 A;  3DE8 A;  4JEA A;  1GQA A;  4CX9 A;  2YLD A;  4IAQ A;  1YZA A;  1M6T A;  5JUA A;  3HNL A;  4IAR A;  4JE9 A;  3M79 A;  5AGF A;  4JKV A;  4CJO A;  2XL8 A;  5JP7 A;  2XLV A;  3C62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...