2YL7A

Cytochrome c prime from alcaligenes xylosoxidans: as isolated l16g variant at 0.9 a resolution - restraint refinement
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSAGTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 53
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yl7A00
1EKYA 1CGOA 2XLDA 3NMIA 1YYJA 3HNJA 4U9EA 3QVYA 1APCA 4D4NA 3HNKA 1CPRA 2YL0A 1MQVA 1LM3B 256BA 2XM4A 3M4BA 5JLIA 2YLDA 4EIYA 3VRCA 5JUAA 1JAFA 3ZTZA 5JS5A 5JSLA 1RCPA 4IAQA 3M15A 2YL3A 3M79A 4U9DA 4N6HA 3C62A 4NC3A 3DE9A 3ZTMA 1YZCA 3TOLA 3DE8A 4CDYA 3U8PA 1E86A 2YLIA 5JRAA 2YL1A 5JT4A 3IQ5A 2YL7A 4CJGA 5AGFA 1BBHA 1QPUA 2QLAA 4JEBA 3TOMA 2XL8A 3IQ6A 3FOOA 3NMKA 1QQ3A 4WGYA 5JP7A 4IB4A 3ZWIA 2YLGA 3M4CA 4CDVA 3QW0A 3ZQVA 4ER9A 5JVEA 4CJOA 2XL6A 5B3IA 4JKVA 1M6TA 3QVZA 4JEAA 2J8WA 3C63A 3L1MA 1E85A 2XLMA 4CDAA 4CIPA 3FOPA 1CPQA 4IARA 2J9BA 1E84A 1E83A 2XLVA 3HNLA 2XLWA 1GQAA 2XLOA 4D4XA 3HNIA 1YZAA 1A7VA 3QW1A 4WGZA 2YKZA 1NBBA 2CCYA 1S05A 2XLHA 2BC5A 3NMJA 1CGNA 1YYXA 4N4WA 4JE9A 2XM0A 3ZQYA 4ULVA 2XLEA 4CX9A 4L6RA
chains in the Genus database with same CATH superfamily
1L7CA 2IXOA 4I3MA 1VLSA 1YLMA 1MMGA 4G7HF 1U89A 1K05A 2DYRC 3V7OA 2MHRA 2LD6A 3ABLC 2VCAA 3BRJA 1APCA 2J45A 2R7QA 5L0IA 2X0CA 5KYYA 3EQLF 3HJCA 1M57C 1HW1A 3DAGA 4U5FE 4IGGA 3K1IA 1NU7D 2OCCC 3UMHA 2NUTA 1PD0A 1F1MA 1BDJB 1D0YA 1JR8A 3JT1A 4DBQA 5BUOA 1GGQA 2QY9A 2L7AA 4DRHB 2AP3A 1TWGA 2YLDA 4G0HA 5FCLA 2MWQA 4MW8A 1LIHA 2PBEA 3NYLA 3EH1A 1QZXA 1VTMP 2M4EA 1JPJA 4PFOA 5T1DB 1EI7A 4XLNF 3CAXA 4BEJA 3AJMA 3I5PA 5L3VA 5KYWA 1IW7F 1OCCC 2NUPB 5DVWA 5EHHA 2IXPA 3OWTA 2KC3A 1TWCA 2FGYA 4C7OB 1H9GA 2AU5A 5DQZA 1LS4A 3X1OA 4C3BA 2J9UA 1TKNA 2VCCA 1MNEA 2WVNA 5KYUB 3KPHA 5E2QA 2BE5F 2YL1A 3LEVA 1I5NA 2IXNA 4MNDA 4MTGA 3AGTA 2Q9AA 1K04A 4DXWA 4J7TA 4G7OF 3NG1A 2P7VA 2O9XA 5A6JA 3DI5A 1C17M 1YJGA 2NG1A 1T01A 2OJQA 2Y3GA 3F47A 3MLGA 1OCOC 2LIGA 2OOCA 2NUTB 2XL8A 1YAUO 3SXMA 4WGYA 3B71A 3B0UX 3SEOA 3EJNA 4U5CE 4MVQA 4GEHA 1OW8A 3E9VA 4AE4A 2CDQA 3M4CA 3DJUB 3LNRA 3AG3C 1Z3IX 4HEAJ 4XPXA 2OU6A 2YHSA 1V54C 1A7EA 2IYLD 5KYWB 2HMQA 3ABKC 2HFIA 2LCHA 2LSEA 1QVXA 3SYNA 1Z5ZA 4E7SA 5B3IA 4JKVA 4OIRF 4NQFA 1Z23A 3L1MA 5B3SC 2XLMA 1SR2A 3PMRA 1VYIA 3NKDA 4CIPA 4CBEA 3AG4C 1NFOA 3V5YA 2P6VA 2KJGA 2J9BA 5L0HA 2P0NA 4AL1A 4HFKB 1E83A 2R7VA 2LQGA 2VCBA 3M1CB 5T3WA 4ZLCA 4MQ9F 3U2LA 3O6XA 2ZXWC 1GQAA 3U8VA 1OCRC 1VLTA 3X2QC 1HW2A 2H7VC 4W8PA 3GM3A 4H54A 3T6BA 4WJ0A 4DJ9A 5L0GA 1D0ZA 4Z9JA 4AE4B 5A6KA 3POVA 3C8GA 3H65A 4CSAC 1D1BA 1A7DA 3RQEA 4NCQA 1YA9A 4YT2A 5A6BA 4Q5SF 4R32A 2R7OA 4YT8A 2AVKA 3KYIA 4ULWA 2Y3BA 1G8XA 3ITFA 1TWHA 1NLXA 2CCYA 2J46A 2J9VA 2W45A 3L0IA 3MYFA 4CS9A 4QI0A 1T9KA 1XZQA 5DLJA 2XLHA 1V4AA 3PCVA 2FFHA 3N24A 4JE9A 1VK5A 1TR2A 1AUEA 1ORYA 1UFBA 2Q00A 3T6JA 2KNHA 3ZVRA 3U0CA 2VASA 1UG7A 5F5HA 2ICWG 4CIHA 1EKYA 2L9JA 3EGXB 4PR9A 3CSKA 1JOGA 2DB4A 3VAYA 4IWBA 2J0WA 2J7PA 3HNJA 2I8BA 2VB6A 1L3PA 2L6GA 3LAYA 5CIVA 3QVYA 4WABA 3NRHA 4E0HA 2QTVA 4FESA 4BG0A 1MMDA 2B0HA 3N0TA 3FMSA 3E70C 1OXBA 4KBLA 4C3EA 1HMOA 3TULA 2JD3A 4IJJA 1EQ1A 3HKKA 3M4BA 4NTBA 5JLIA 4OIPF 4BJ5A 2H7OA 1ZVZA 1OR2A 4JTAB 4KNVA 4EIYA 2NSFA 4QDLA 1WASA 3VRCA 5DS6A 3FHDA 1JAFA 2MYSA 2HS5A 2NUPA 2RSEB 3ZTZA 3TJ5A 2R7WA 3A9CA 4N06A 2WZLA 3UMIA 4C7OA 2J0XA 3ZC4A 1RCPA 2QUPA 3MYIA 3W8HA 4Z9HA 4MVSA 2YL3A 3K1IC 4O79A 3DE9A 5KYUA 1YARO 4CS7A 3NYJA 4UDVA 1Z63A 3W4YA 4YN0B 3QTHA 3ZSUA 3GEHA 3VYWA 4JJGA 1Q0KA 2FAPB 2HUJA 3U8PA 2ZPAA 3DWWA 4E7ZA 1V55C 2YLIA 2V3CC 1BR4A 3FAPB 2L6HA 2A68F 4G78A 4JIOA 1FMWA 3KYJA 2D5RB 4XEVA 2LK4A 4MVUA 3RKOF 2V26A 4E17A 1WWPA 1C03A 1O87A 2EPMX 2EPNA 3DM9B 4GQHA 4JEBA 3IQTA 1WGWA 2PX0A 4YWQA 3IQ6A 5JP7A 1ORJA 4IB4A 5CI9A 5A6AA 4MW3A 1FR0A 3H2VA 1GS9A 4MVZA 3DXJF 4CS8A 4K0DA 3GEEA 4X0RA 4ONSA 3QW0A 2GWWA 1VOMA 4RDAA 3S90A 2YWAA 4ZLDA 3ZQVA 3EG9B 3LLIA 4FX5A 3ASOC 2GAQA 1ORSC 2OEVA 4JCZA 5F5FA 3DD7A 1ZW3A 1LS1A 4JVSA 3U2MA 5JVEA 3JYYA 3GANA 2XL6A 3GEIA 3O39A 5FZTA 3SXZA 1I4ZA 1M6TA 2QE9A 3QZCA 3C8ZA 4JEAA 2WZGA 1T6IA 3FDQA 3B0VC 2CYDA 4YT5A 3TQOA 1A41A 1KNYA 1GM5A 3F46A 3I5QA 2A1DD 2Y69C 4O7GA 2R03A 1QSPA 2OKUA 4IARA 4BJ1A 4DOZA 5L0JA 4XQ1A 1Z7Qc 4FAPB 4A4AA 1T6UA 2M64A 4YT4A 1E84A 2YEVA 3EFOB 2Y3DA 4U5HA 2HSBA 1R4TA 3KMIA 1ST6A 2RD9A 4C3DA 4PJNA 3FXHA 5B1BC 4B6IA 3UNGC 4JJFA 5KYXB 1BR2A 3K33A 4D4XA 3U3FA 4RBNA 2R05A 1R5ID 2PNOA 4U5EE 4EHPA 2C03A 2HKVA 2YVKA 4JURI 2A0BA 2IBFA 3B0PA 2TMVP 3FVYA 4N6CA 3RVZA 3PDMP 2X51A 4JZAA 3QMKA 1ZYRF 5HV9A 2H8AA 4PFPA 3RVYA 3LUTB 3JTLO 5D91A 2R25A 3TK0A 4PACA 3OA1A 2XS8A 3C8GD 4DVZA 2R7XA 2VH3A 5AC5A 1CGNA 4N4WA 3TD7A 3DMDA 1FNTc 5HSWA 4HFFB 4RD9A 2OEXA 3EGXA 1RKEA 3K6BA 2Y3HA 1HE9A 2XLEA 3RYLA 1C02A 4JCHA 4NY3A 4U5BE 3UMKA 4L6RA 2PF4E 1CGOA 3LNMB 4XPWA 3EZHA 3NMIA 1VMAA 1ZU4A 4BEMJ 4OINF 4U9EA 3RW0A 3J06A 3K1HA 3LLKA 4CS9C 4D4NA 3HNKA 2HZ8A 3VF0A 1U0BB 4LLCA 2EIJC 1ZZPA 256BA 1TWAA 3GM2A 3UGPA 1OKKA 2Q9BA 2AWYA 4DRJB 2DI3A 1V74B 1VYKA 4OIQF 1S7ZA 1NFNA 2LFFA 1AVOB 3RH3A 3V5ZA 5DQTA 5JS5A 4PJJA 4XEKA 4IAOA 2KGOA 3JSZA 3AOUA 4GYTA 5L0DA 1G5ZA 2LP4A 2QNLA 3GORA 4O6YA 2GA0A 1BR1A 5JSLA 4IAQA 1Q0MA 3M15A 1RKEB 2Q3TA 3W8IA 2R7UA 1FMVA 3C62A 3EGDB 3R7CA 4KNWA 4NC3A 5A69A 1JMWA 2NPUA 4K7BA 4BJ5C 1YZCA 1ZHZA 4Q4ZF 2H7BA 2OQMA 4KC9A 2EINC 3DE8A 1SYQA 3EZIA 2WVQA 4CDYA 1MNDA 4EBBA 4EKWA 1LI5A 1U6HA 2F22A 4PJLA 1E86A 3A11A 3IQ5A 1Q0FA 2C04A 4CJGA 2HSQA 4E18A 4XTKA 4G7ZF 2ZD9A 5AGFA 3N2ZB 2Q7RA 2W9YA 4MS2A 1IZMA 1OW7A 2WB7A 4JRZA 1G4WR 3B29A 3NMKA 1QQ3A 2R9RB 3SZRA 3EHNA 1NG1A 3KKBA 4MTOA 2Q4FA 2EPKX 4I1OB 2EPOA 3GWNA 3EG9A 3L8IA 5CI8A 1OCZC 1RMVA 3CEXA 3B9QA 1ZHWA 2BL2A 2VC9A 4CDVA 2YZSA 4BJTA 2R7SA 4P9TA 3MX3A 3I4UA 1LPEA 4W8KA 2W4MA 3DM5A 3Q7GA 3JCUQ 5BQGA 3IEEA 3SXKA 2CNWA 4YK5A 3AQBA 4J30B 1D1CA 1JPNA 1O5HA 1VB5A 4CJOA 5E33A 1TQGA 1WOLA 5DS4A 4BJ6A 2HJMA 4XLPF 3SP1A 1E85A 3MFNA 2HJ3A 4O6NA 1ZHXA 2B0JA 2XXAB 3FOPA 5EK0A 3BEHA 4YJWA 2PFDA 3EFOA 3JSEO 3LS0A 2DGJA 4AK9A 1H9TA 3JZ0A 4NTAA 3G4ZA 1HE1A 1OQCA 4CS8C 4JTCB 4IRUA 5KYXA 3T9OA 4XPYA 3L8JA 1O3UA 2L81A 3WHNA 2YQYA 2XLWA 1A0BA 3HNLA 1HY5A 3LEOA 3TJ6A 1BZ4A 2XLOA 3K7DA 4PJMA 1EA8A 4EWCA 3O55A 5EGYA 3G4XA 3HNIA 4YL0A 1YZAA 2G3VA 4LDRA 1QKRA 1WN0A 2I15A 1D1AA 2IXMA 2YRFA 1LI7A 3AGUA 3QW1A 1NSGB 3G50A 4WGZA 3S27A 3AG1C 4JC7A 1WTYA 1PCXA 2ETSA 2HV6A 3ATPA 4J32B 4DVYP 4QI2A 2WZFA 2JX0A 2R02A 2ZXOA 4LDQA 5B1AC 1Q0GA 4MTFA 3RFYA 3U3BA 3EH2A 1WATA 2NSGA 3Q7LA 1J8MF 2BC5A 3Q6NA 4JTDB 2WVOA 4U5GA 1NU9C 3IPMO 2KSFA 4H4KC 1JRAA 4MVMA 3ZQYA 1TFOB 1M2OA 2DYSC 1RJ9A 2G3KA 4ULVA 3ZG1A 1PD1A 4FWVA 4OD5A 4CX9A 1OW6A 1FAPB 2IOQA 2W4BA 3MBGA 1SF8A 2XLDA 1YYJA 3SXYA 5AC4A 2KQ9A 2GFHA 1FFTC 1MMNA 1M2VA 4EBJA 5KYNA 3DJNB 5T3TA 3WAQA 3S84A 2R7TA 1CPRA 4M63A 2YL0A 2ZXRA 1YVIA 3DKAA 1MQVA 2A0UA 1LM3B 2E87A 2Y39A 4BPMA 1Q0DA 1KU2A 1Y4CA 2LFDA 2XM4A 3ASNC 3IQCA 3OEOA 4J7YA 3VM6A 4AL0A 3DZAA 5KYYB 3K66A 1N1CA 3DAFA 3V5XA 1RKCA 5COGA 1YA7O 1B68A 3RIPA 1M56C 3H2UA 4YL3A 4A2NB 5A6BD 5JUAA 1W2WA 2PP4A 1OXKA 1OKKD 2KW3C 3JRTA 1T6QA 3EGDA 2CGEA 5BQHA 1LVKA 1RJ9B 2GDCA 3M79A 4YL1A 4U9DA 4N6HA 3NKEA 5K0IA 4ANJA 2WL8A 2JPUA 4DRIB 2KK1A 3ZTMA 1ZU5A 1T5OA 2CW0F 3TOLA 2D4UA 2XSEA 5L3QA 3JRMO 2A6EF 4XWJA 1CGME 4Q7CA 2HMZA 2EIKC 1AEPA 2L6FA 5JRAA 5JT4A 2YL7A 1FFHA 1M2VB 4HE8D 3AG2C 4O6MA 3RF3A 3GODA 5L0FA 4I44A 2UUIA 2J7PD 1D0XA 2G62A 1BBHA 1YDIA 4LACB 1QPUA 3S29A 4DBRA 3GWLA 2QLAA 1QLEC 4NTFA 3TOMA 2AWCA 3AQCA 3FAJA 3U9MA 1XZPA 3FOOA 2R7RA 2EILC 3CZ6A 4LLEA 2ZXPA 3ZWIA 1J8YF 3ABMC 2YLGA 3LESA 4JW1A 1LE2A 4EBKA 3C18A 3ECSA 1Y6DA 2P61A 3KH2A 5E3CA 1K40A 1LKXA 3WODF 1OR3A 3PHF2 4OIOF 5TJ5E 1HMDA 1ZHYA 2P1AA 3LJBA 4ER9A 2XS1A 2IM8A 3IHUA 3NYMA 5GPGB 2XXAA 3NDBB 2UUHA 3QVZA 4LDKA 2J8WA 3C63A 3ZIBA 1I4YA 1LE4A 3R2PA 4CDAA 2A6HF 4U5DE 2XRHA 3W2VA 4CSAA 2CNWD 1CPQA 3KL4A 3S9OA 3HTKC 3RQGA 4P6IC 5L0CA 1SMYF 1DOWA 3EPVA 5IY5C 2XLVA 2Z15A 5COMA 1PV3A 3GM1A 1MMAA 3O10A 1G4US 4OD4A 1SZIA 4E0IA 3US6A 4AX2A 4EUKB 1FTSA 4MVRA 5DS5A 3U9JA 1DOVA 2J9WA 2Q9CA 1H6GA 3CQZA 2EPLX 4BJ6C 4XEFA 4KI2A 3EHMA 2OG2A 4P9FA 4PK4A 4LERA 1TFKB 1A7VA 4K1OA 5COFA 2ASRA 3T4RA 3LS1A 2A69F 1ZHTA 3UGOA 3UR3C 2YKZA 1E2XA 3C8GB 2PX3A 3JYHA 4Z9IA 5F28E 3S0XA 1XWJA 1NBBA 3Q6MA 5E3AA 2HV7A 1NZEA 2EIMC 2KYHA 1S05A 2XL4A 4MVOA 3U5SA 5BQIA 1KTMA 3NMJA 5D92A 1YYXA 1RXQA 2XM0A 3WG7C 3HLZA 3S28A 4I1MA 3ZDLA 2OJED 3C7JA 1H7IA 3W2WA 3RQFA 3T6GB 3SNHA 4F4BA 1ZW2A 1Z6AA 3L34A
chains in the Genus database with same CATH topology
1EKYA 1CGOA 2XLDA 3NMIA 1YYJA 3HNJA 4U9EA 3QVYA 1APCA 4D4NA 3HNKA 1CPRA 2YL0A 1MQVA 1LM3B 256BA 2XM4A 3M4BA 5JLIA 2YLDA 4EIYA 3VRCA 5JUAA 1JAFA 3ZTZA 5JS5A 5JSLA 1RCPA 4IAQA 3M15A 2YL3A 3M79A 4U9DA 4N6HA 3C62A 4NC3A 3DE9A 3ZTMA 1YZCA 3TOLA 3DE8A 4CDYA 3U8PA 1E86A 2YLIA 5JRAA 2YL1A 5JT4A 3IQ5A 2YL7A 4CJGA 5AGFA 1BBHA 1QPUA 2QLAA 4JEBA 3TOMA 2XL8A 3IQ6A 3FOOA 3NMKA 1QQ3A 4WGYA 5JP7A 4IB4A 3ZWIA 2YLGA 3M4CA 4CDVA 3QW0A 3ZQVA 4ER9A 5JVEA 4CJOA 2XL6A 5B3IA 4JKVA 1M6TA 3QVZA 4JEAA 2J8WA 3C63A 3L1MA 1E85A 2XLMA 4CDAA 4CIPA 3FOPA 1CPQA 4IARA 2J9BA 1E84A 1E83A 2XLVA 3HNLA 2XLWA 1GQAA 2XLOA 4D4XA 3HNIA 1YZAA 1A7VA 3QW1A 4WGZA 2YKZA 1NBBA 2CCYA 1S05A 2XLHA 2BC5A 3NMJA 1CGNA 1YYXA 4N4WA 4JE9A 2XM0A 3ZQYA 4ULVA 2XLEA 4CX9A 4L6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EKY A;  1CGO A;  2XLD A;  3NMI A;  1YYJ A;  3HNJ A;  4U9E A;  3QVY A;  1APC A;  4D4N A;  3HNK A;  1CPR A;  2YL0 A;  1MQV A;  1LM3 B;  256B A;  2XM4 A;  3M4B A;  5JLI A;  2YLD A;  4EIY A;  3VRC A;  5JUA A;  1JAF A;  3ZTZ A;  5JS5 A;  5JSL A;  1RCP A;  4IAQ A;  3M15 A;  2YL3 A;  3M79 A;  4U9D A;  4N6H A;  3C62 A;  4NC3 A;  3DE9 A;  3ZTM A;  1YZC A;  3TOL A;  3DE8 A;  4CDY A;  3U8P A;  1E86 A;  2YLI A;  5JRA A;  2YL1 A;  5JT4 A;  3IQ5 A;  2YL7 A;  4CJG A;  5AGF A;  1BBH A;  1QPU A;  2QLA A;  4JEB A;  3TOM A;  2XL8 A;  3IQ6 A;  3FOO A;  3NMK A;  1QQ3 A;  4WGY A;  5JP7 A;  4IB4 A;  3ZWI A;  2YLG A;  3M4C A;  4CDV A;  3QW0 A;  3ZQV A;  4ER9 A;  5JVE A;  4CJO A;  2XL6 A;  5B3I A;  4JKV A;  1M6T A;  3QVZ A;  4JEA A;  2J8W A;  3C63 A;  3L1M A;  1E85 A;  2XLM A;  4CDA A;  4CIP A;  3FOP A;  1CPQ A;  4IAR A;  2J9B A;  1E84 A;  1E83 A;  2XLV A;  3HNL A;  2XLW A;  1GQA A;  2XLO A;  4D4X A;  3HNI A;  1YZA A;  1A7V A;  3QW1 A;  4WGZ A;  2YKZ A;  1NBB A;  2CCY A;  1S05 A;  2XLH A;  2BC5 A;  3NMJ A;  1CGN A;  1YYX A;  4N4W A;  4JE9 A;  2XM0 A;  3ZQY A;  4ULV A;  2XLE A;  4CX9 A;  4L6R A; 
#chains in the Genus database with same CATH topology
 1L7C A;  2IXO A;  4I3M A;  1VLS A;  1YLM A;  1MMG A;  4G7H F;  1U89 A;  1K05 A;  2DYR C;  3V7O A;  2MHR A;  2LD6 A;  3ABL C;  2VCA A;  3BRJ A;  1APC A;  2J45 A;  2R7Q A;  5L0I A;  2X0C A;  5KYY A;  3EQL F;  3HJC A;  1M57 C;  1HW1 A;  3DAG A;  4U5F E;  4IGG A;  3K1I A;  1NU7 D;  2OCC C;  3UMH A;  2NUT A;  1PD0 A;  1F1M A;  1BDJ B;  1D0Y A;  1JR8 A;  3JT1 A;  4DBQ A;  5BUO A;  1GGQ A;  2QY9 A;  2L7A A;  4DRH B;  2AP3 A;  1TWG A;  2YLD A;  4G0H A;  5FCL A;  2MWQ A;  4MW8 A;  1LIH A;  2PBE A;  3NYL A;  3EH1 A;  1QZX A;  1VTM P;  2M4E A;  1JPJ A;  4PFO A;  5T1D B;  1EI7 A;  4XLN F;  3CAX A;  4BEJ A;  3AJM A;  3I5P A;  5L3V A;  5KYW A;  1IW7 F;  1OCC C;  2NUP B;  5DVW A;  5EHH A;  2IXP A;  3OWT A;  2KC3 A;  1TWC A;  2FGY A;  4C7O B;  1H9G A;  2AU5 A;  5DQZ A;  1LS4 A;  3X1O A;  4C3B A;  2J9U A;  1TKN A;  2VCC A;  1MNE A;  2WVN A;  5KYU B;  3KPH A;  5E2Q A;  2BE5 F;  2YL1 A;  3LEV A;  1I5N A;  2IXN A;  4MND A;  4MTG A;  3AGT A;  2Q9A A;  1K04 A;  4DXW A;  4J7T A;  4G7O F;  3NG1 A;  2P7V A;  2O9X A;  5A6J A;  3DI5 A;  1C17 M;  1YJG A;  2NG1 A;  1T01 A;  2OJQ A;  2Y3G A;  3F47 A;  3MLG A;  1OCO C;  2LIG A;  2OOC A;  2NUT B;  2XL8 A;  1YAU O;  3SXM A;  4WGY A;  3B71 A;  3B0U X;  3SEO A;  3EJN A;  4U5C E;  4MVQ A;  4GEH A;  1OW8 A;  3E9V A;  4AE4 A;  2CDQ A;  3M4C A;  3DJU B;  3LNR A;  3AG3 C;  1Z3I X;  4HEA J;  4XPX A;  2OU6 A;  2YHS A;  1V54 C;  1A7E A;  2IYL D;  5KYW B;  2HMQ A;  3ABK C;  2HFI A;  2LCH A;  2LSE A;  1QVX A;  3SYN A;  1Z5Z A;  4E7S A;  5B3I A;  4JKV A;  4OIR F;  4NQF A;  1Z23 A;  3L1M A;  5B3S C;  2XLM A;  1SR2 A;  3PMR A;  1VYI A;  3NKD A;  4CIP A;  4CBE A;  3AG4 C;  1NFO A;  3V5Y A;  2P6V A;  2KJG A;  2J9B A;  5L0H A;  2P0N A;  4AL1 A;  4HFK B;  1E83 A;  2R7V A;  2LQG A;  2VCB A;  3M1C B;  5T3W A;  4ZLC A;  4MQ9 F;  3U2L A;  3O6X A;  2ZXW C;  1GQA A;  3U8V A;  1OCR C;  1VLT A;  3X2Q C;  1HW2 A;  2H7V C;  4W8P A;  3GM3 A;  4H54 A;  3T6B A;  4WJ0 A;  4DJ9 A;  5L0G A;  1D0Z A;  4Z9J A;  4AE4 B;  5A6K A;  3POV A;  3C8G A;  3H65 A;  4CSA C;  1D1B A;  1A7D A;  3RQE A;  4NCQ A;  1YA9 A;  4YT2 A;  5A6B A;  4Q5S F;  4R32 A;  2R7O A;  4YT8 A;  2AVK A;  3KYI A;  4ULW A;  2Y3B A;  1G8X A;  3ITF A;  1TWH A;  1NLX A;  2CCY A;  2J46 A;  2J9V A;  2W45 A;  3L0I A;  3MYF A;  4CS9 A;  4QI0 A;  1T9K A;  1XZQ A;  5DLJ A;  2XLH A;  1V4A A;  3PCV A;  2FFH A;  3N24 A;  4JE9 A;  1VK5 A;  1TR2 A;  1AUE A;  1ORY A;  1UFB A;  2Q00 A;  3T6J A;  2KNH A;  3ZVR A;  3U0C A;  2VAS A;  1UG7 A;  5F5H A;  2ICW G;  4CIH A;  1EKY A;  2L9J A;  3EGX B;  4PR9 A;  3CSK A;  1JOG A;  2DB4 A;  3VAY A;  4IWB A;  2J0W A;  2J7P A;  3HNJ A;  2I8B A;  2VB6 A;  1L3P A;  2L6G A;  3LAY A;  5CIV A;  3QVY A;  4WAB A;  3NRH A;  4E0H A;  2QTV A;  4FES A;  4BG0 A;  1MMD A;  2B0H A;  3N0T A;  3FMS A;  3E70 C;  1OXB A;  4KBL A;  4C3E A;  1HMO A;  3TUL A;  2JD3 A;  4IJJ A;  1EQ1 A;  3HKK A;  3M4B A;  4NTB A;  5JLI A;  4OIP F;  4BJ5 A;  2H7O A;  1ZVZ A;  1OR2 A;  4JTA B;  4KNV A;  4EIY A;  2NSF A;  4QDL A;  1WAS A;  3VRC A;  5DS6 A;  3FHD A;  1JAF A;  2MYS A;  2HS5 A;  2NUP A;  2RSE B;  3ZTZ A;  3TJ5 A;  2R7W A;  3A9C A;  4N06 A;  2WZL A;  3UMI A;  4C7O A;  2J0X A;  3ZC4 A;  1RCP A;  2QUP A;  3MYI A;  3W8H A;  4Z9H A;  4MVS A;  2YL3 A;  3K1I C;  4O79 A;  3DE9 A;  5KYU A;  1YAR O;  4CS7 A;  3NYJ A;  4UDV A;  1Z63 A;  3W4Y A;  4YN0 B;  3QTH A;  3ZSU A;  3GEH A;  3VYW A;  4JJG A;  1Q0K A;  2FAP B;  2HUJ A;  3U8P A;  2ZPA A;  3DWW A;  4E7Z A;  1V55 C;  2YLI A;  2V3C C;  1BR4 A;  3FAP B;  2L6H A;  2A68 F;  4G78 A;  4JIO A;  1FMW A;  3KYJ A;  2D5R B;  4XEV A;  2LK4 A;  4MVU A;  3RKO F;  2V26 A;  4E17 A;  1WWP A;  1C03 A;  1O87 A;  2EPM X;  2EPN A;  3DM9 B;  4GQH A;  4JEB A;  3IQT A;  1WGW A;  2PX0 A;  4YWQ A;  3IQ6 A;  5JP7 A;  1ORJ A;  4IB4 A;  5CI9 A;  5A6A A;  4MW3 A;  1FR0 A;  3H2V A;  1GS9 A;  4MVZ A;  3DXJ F;  4CS8 A;  4K0D A;  3GEE A;  4X0R A;  4ONS A;  3QW0 A;  2GWW A;  1VOM A;  4RDA A;  3S90 A;  2YWA A;  4ZLD A;  3ZQV A;  3EG9 B;  3LLI A;  4FX5 A;  3ASO C;  2GAQ A;  1ORS C;  2OEV A;  4JCZ A;  5F5F A;  3DD7 A;  1ZW3 A;  1LS1 A;  4JVS A;  3U2M A;  5JVE A;  3JYY A;  3GAN A;  2XL6 A;  3GEI A;  3O39 A;  5FZT A;  3SXZ A;  1I4Z A;  1M6T A;  2QE9 A;  3QZC A;  3C8Z A;  4JEA A;  2WZG A;  1T6I A;  3FDQ A;  3B0V C;  2CYD A;  4YT5 A;  3TQO A;  1A41 A;  1KNY A;  1GM5 A;  3F46 A;  3I5Q A;  2A1D D;  2Y69 C;  4O7G A;  2R03 A;  1QSP A;  2OKU A;  4IAR A;  4BJ1 A;  4DOZ A;  5L0J A;  4XQ1 A;  1Z7Q c;  4FAP B;  4A4A A;  1T6U A;  2M64 A;  4YT4 A;  1E84 A;  2YEV A;  3EFO B;  2Y3D A;  4U5H A;  2HSB A;  1R4T A;  3KMI A;  1ST6 A;  2RD9 A;  4C3D A;  4PJN A;  3FXH A;  5B1B C;  4B6I A;  3UNG C;  4JJF A;  5KYX B;  1BR2 A;  3K33 A;  4D4X A;  3U3F A;  4RBN A;  2R05 A;  1R5I D;  2PNO A;  4U5E E;  4EHP A;  2C03 A;  2HKV A;  2YVK A;  4JUR I;  2A0B A;  2IBF A;  3B0P A;  2TMV P;  3FVY A;  4N6C A;  3RVZ A;  3PDM P;  2X51 A;  4JZA A;  3QMK A;  1ZYR F;  5HV9 A;  2H8A A;  4PFP A;  3RVY A;  3LUT B;  3JTL O;  5D91 A;  2R25 A;  3TK0 A;  4PAC A;  3OA1 A;  2XS8 A;  3C8G D;  4DVZ A;  2R7X A;  2VH3 A;  5AC5 A;  1CGN A;  4N4W A;  3TD7 A;  3DMD A;  1FNT c;  5HSW A;  4HFF B;  4RD9 A;  2OEX A;  3EGX A;  1RKE A;  3K6B A;  2Y3H A;  1HE9 A;  2XLE A;  3RYL A;  1C02 A;  4JCH A;  4NY3 A;  4U5B E;  3UMK A;  4L6R A;  2PF4 E;  1CGO A;  3LNM B;  4XPW A;  3EZH A;  3NMI A;  1VMA A;  1ZU4 A;  4BEM J;  4OIN F;  4U9E A;  3RW0 A;  3J06 A;  3K1H A;  3LLK A;  4CS9 C;  4D4N A;  3HNK A;  2HZ8 A;  3VF0 A;  1U0B B;  4LLC A;  2EIJ C;  1ZZP A;  256B A;  1TWA A;  3GM2 A;  3UGP A;  1OKK A;  2Q9B A;  2AWY A;  4DRJ B;  2DI3 A;  1V74 B;  1VYK A;  4OIQ F;  1S7Z A;  1NFN A;  2LFF A;  1AVO B;  3RH3 A;  3V5Z A;  5DQT A;  5JS5 A;  4PJJ A;  4XEK A;  4IAO A;  2KGO A;  3JSZ A;  3AOU A;  4GYT A;  5L0D A;  1G5Z A;  2LP4 A;  2QNL A;  3GOR A;  4O6Y A;  2GA0 A;  1BR1 A;  5JSL A;  4IAQ A;  1Q0M A;  3M15 A;  1RKE B;  2Q3T A;  3W8I A;  2R7U A;  1FMV A;  3C62 A;  3EGD B;  3R7C A;  4KNW A;  4NC3 A;  5A69 A;  1JMW A;  2NPU A;  4K7B A;  4BJ5 C;  1YZC A;  1ZHZ A;  4Q4Z F;  2H7B A;  2OQM A;  4KC9 A;  2EIN C;  3DE8 A;  1SYQ A;  3EZI A;  2WVQ A;  4CDY A;  1MND A;  4EBB A;  4EKW A;  1LI5 A;  1U6H A;  2F22 A;  4PJL A;  1E86 A;  3A11 A;  3IQ5 A;  1Q0F A;  2C04 A;  4CJG A;  2HSQ A;  4E18 A;  4XTK A;  4G7Z F;  2ZD9 A;  5AGF A;  3N2Z B;  2Q7R A;  2W9Y A;  4MS2 A;  1IZM A;  1OW7 A;  2WB7 A;  4JRZ A;  1G4W R;  3B29 A;  3NMK A;  1QQ3 A;  2R9R B;  3SZR A;  3EHN A;  1NG1 A;  3KKB A;  4MTO A;  2Q4F A;  2EPK X;  4I1O B;  2EPO A;  3GWN A;  3EG9 A;  3L8I A;  5CI8 A;  1OCZ C;  1RMV A;  3CEX A;  3B9Q A;  1ZHW A;  2BL2 A;  2VC9 A;  4CDV A;  2YZS A;  4BJT A;  2R7S A;  4P9T A;  3MX3 A;  3I4U A;  1LPE A;  4W8K A;  2W4M A;  3DM5 A;  3Q7G A;  3JCU Q;  5BQG A;  3IEE A;  3SXK A;  2CNW A;  4YK5 A;  3AQB A;  4J30 B;  1D1C A;  1JPN A;  1O5H A;  1VB5 A;  4CJO A;  5E33 A;  1TQG A;  1WOL A;  5DS4 A;  4BJ6 A;  2HJM A;  4XLP F;  3SP1 A;  1E85 A;  3MFN A;  2HJ3 A;  4O6N A;  1ZHX A;  2B0J A;  2XXA B;  3FOP A;  5EK0 A;  3BEH A;  4YJW A;  2PFD A;  3EFO A;  3JSE O;  3LS0 A;  2DGJ A;  4AK9 A;  1H9T A;  3JZ0 A;  4NTA A;  3G4Z A;  1HE1 A;  1OQC A;  4CS8 C;  4JTC B;  4IRU A;  5KYX A;  3T9O A;  4XPY A;  3L8J A;  1O3U A;  2L81 A;  3WHN A;  2YQY A;  2XLW A;  1A0B A;  3HNL A;  1HY5 A;  3LEO A;  3TJ6 A;  1BZ4 A;  2XLO A;  3K7D A;  4PJM A;  1EA8 A;  4EWC A;  3O55 A;  5EGY A;  3G4X A;  3HNI A;  4YL0 A;  1YZA A;  2G3V A;  4LDR A;  1QKR A;  1WN0 A;  2I15 A;  1D1A A;  2IXM A;  2YRF A;  1LI7 A;  3AGU A;  3QW1 A;  1NSG B;  3G50 A;  4WGZ A;  3S27 A;  3AG1 C;  4JC7 A;  1WTY A;  1PCX A;  2ETS A;  2HV6 A;  3ATP A;  4J32 B;  4DVY P;  4QI2 A;  2WZF A;  2JX0 A;  2R02 A;  2ZXO A;  4LDQ A;  5B1A C;  1Q0G A;  4MTF A;  3RFY A;  3U3B A;  3EH2 A;  1WAT A;  2NSG A;  3Q7L A;  1J8M F;  2BC5 A;  3Q6N A;  4JTD B;  2WVO A;  4U5G A;  1NU9 C;  3IPM O;  2KSF A;  4H4K C;  1JRA A;  4MVM A;  3ZQY A;  1TFO B;  1M2O A;  2DYS C;  1RJ9 A;  2G3K A;  4ULV A;  3ZG1 A;  1PD1 A;  4FWV A;  4OD5 A;  4CX9 A;  1OW6 A;  1FAP B;  2IOQ A;  2W4B A;  3MBG A;  1SF8 A;  2XLD A;  1YYJ A;  3SXY A;  5AC4 A;  2KQ9 A;  2GFH A;  1FFT C;  1MMN A;  1M2V A;  4EBJ A;  5KYN A;  3DJN B;  5T3T A;  3WAQ A;  3S84 A;  2R7T A;  1CPR A;  4M63 A;  2YL0 A;  2ZXR A;  1YVI A;  3DKA A;  1MQV A;  2A0U A;  1LM3 B;  2E87 A;  2Y39 A;  4BPM A;  1Q0D A;  1KU2 A;  1Y4C A;  2LFD A;  2XM4 A;  3ASN C;  3IQC A;  3OEO A;  4J7Y A;  3VM6 A;  4AL0 A;  3DZA A;  5KYY B;  3K66 A;  1N1C A;  3DAF A;  3V5X A;  1RKC A;  5COG A;  1YA7 O;  1B68 A;  3RIP A;  1M56 C;  3H2U A;  4YL3 A;  4A2N B;  5A6B D;  5JUA A;  1W2W A;  2PP4 A;  1OXK A;  1OKK D;  2KW3 C;  3JRT A;  1T6Q A;  3EGD A;  2CGE A;  5BQH A;  1LVK A;  1RJ9 B;  2GDC A;  3M79 A;  4YL1 A;  4U9D A;  4N6H A;  3NKE A;  5K0I A;  4ANJ A;  2WL8 A;  2JPU A;  4DRI B;  2KK1 A;  3ZTM A;  1ZU5 A;  1T5O A;  2CW0 F;  3TOL A;  2D4U A;  2XSE A;  5L3Q A;  3JRM O;  2A6E F;  4XWJ A;  1CGM E;  4Q7C A;  2HMZ A;  2EIK C;  1AEP A;  2L6F A;  5JRA A;  5JT4 A;  2YL7 A;  1FFH A;  1M2V B;  4HE8 D;  3AG2 C;  4O6M A;  3RF3 A;  3GOD A;  5L0F A;  4I44 A;  2UUI A;  2J7P D;  1D0X A;  2G62 A;  1BBH A;  1YDI A;  4LAC B;  1QPU A;  3S29 A;  4DBR A;  3GWL A;  2QLA A;  1QLE C;  4NTF A;  3TOM A;  2AWC A;  3AQC A;  3FAJ A;  3U9M A;  1XZP A;  3FOO A;  2R7R A;  2EIL C;  3CZ6 A;  4LLE A;  2ZXP A;  3ZWI A;  1J8Y F;  3ABM C;  2YLG A;  3LES A;  4JW1 A;  1LE2 A;  4EBK A;  3C18 A;  3ECS A;  1Y6D A;  2P61 A;  3KH2 A;  5E3C A;  1K40 A;  1LKX A;  3WOD F;  1OR3 A;  3PHF 2;  4OIO F;  5TJ5 E;  1HMD A;  1ZHY A;  2P1A A;  3LJB A;  4ER9 A;  2XS1 A;  2IM8 A;  3IHU A;  3NYM A;  5GPG B;  2XXA A;  3NDB B;  2UUH A;  3QVZ A;  4LDK A;  2J8W A;  3C63 A;  3ZIB A;  1I4Y A;  1LE4 A;  3R2P A;  4CDA A;  2A6H F;  4U5D E;  2XRH A;  3W2V A;  4CSA A;  2CNW D;  1CPQ A;  3KL4 A;  3S9O A;  3HTK C;  3RQG A;  4P6I C;  5L0C A;  1SMY F;  1DOW A;  3EPV A;  5IY5 C;  2XLV A;  2Z15 A;  5COM A;  1PV3 A;  3GM1 A;  1MMA A;  3O10 A;  1G4U S;  4OD4 A;  1SZI A;  4E0I A;  3US6 A;  4AX2 A;  4EUK B;  1FTS A;  4MVR A;  5DS5 A;  3U9J A;  1DOV A;  2J9W A;  2Q9C A;  1H6G A;  3CQZ A;  2EPL X;  4BJ6 C;  4XEF A;  4KI2 A;  3EHM A;  2OG2 A;  4P9F A;  4PK4 A;  4LER A;  1TFK B;  1A7V A;  4K1O A;  5COF A;  2ASR A;  3T4R A;  3LS1 A;  2A69 F;  1ZHT A;  3UGO A;  3UR3 C;  2YKZ A;  1E2X A;  3C8G B;  2PX3 A;  3JYH A;  4Z9I A;  5F28 E;  3S0X A;  1XWJ A;  1NBB A;  3Q6M A;  5E3A A;  2HV7 A;  1NZE A;  2EIM C;  2KYH A;  1S05 A;  2XL4 A;  4MVO A;  3U5S A;  5BQI A;  1KTM A;  3NMJ A;  5D92 A;  1YYX A;  1RXQ A;  2XM0 A;  3WG7 C;  3HLZ A;  3S28 A;  4I1M A;  3ZDL A;  2OJE D;  3C7J A;  1H7I A;  3W2W A;  3RQF A;  3T6G B;  3SNH A;  4F4B A;  1ZW2 A;  1Z6A A;  3L34 A; 
#chains in the Genus database with same CATH homology
 1EKY A;  1CGO A;  2XLD A;  3NMI A;  1YYJ A;  3HNJ A;  4U9E A;  3QVY A;  1APC A;  4D4N A;  3HNK A;  1CPR A;  2YL0 A;  1MQV A;  1LM3 B;  256B A;  2XM4 A;  3M4B A;  5JLI A;  2YLD A;  4EIY A;  3VRC A;  5JUA A;  1JAF A;  3ZTZ A;  5JS5 A;  5JSL A;  1RCP A;  4IAQ A;  3M15 A;  2YL3 A;  3M79 A;  4U9D A;  4N6H A;  3C62 A;  4NC3 A;  3DE9 A;  3ZTM A;  1YZC A;  3TOL A;  3DE8 A;  4CDY A;  3U8P A;  1E86 A;  2YLI A;  5JRA A;  2YL1 A;  5JT4 A;  3IQ5 A;  2YL7 A;  4CJG A;  5AGF A;  1BBH A;  1QPU A;  2QLA A;  4JEB A;  3TOM A;  2XL8 A;  3IQ6 A;  3FOO A;  3NMK A;  1QQ3 A;  4WGY A;  5JP7 A;  4IB4 A;  3ZWI A;  2YLG A;  3M4C A;  4CDV A;  3QW0 A;  3ZQV A;  4ER9 A;  5JVE A;  4CJO A;  2XL6 A;  5B3I A;  4JKV A;  1M6T A;  3QVZ A;  4JEA A;  2J8W A;  3C63 A;  3L1M A;  1E85 A;  2XLM A;  4CDA A;  4CIP A;  3FOP A;  1CPQ A;  4IAR A;  2J9B A;  1E84 A;  1E83 A;  2XLV A;  3HNL A;  2XLW A;  1GQA A;  2XLO A;  4D4X A;  3HNI A;  1YZA A;  1A7V A;  3QW1 A;  4WGZ A;  2YKZ A;  1NBB A;  2CCY A;  1S05 A;  2XLH A;  2BC5 A;  3NMJ A;  1CGN A;  1YYX A;  4N4W A;  4JE9 A;  2XM0 A;  3ZQY A;  4ULV A;  2XLE A;  4CX9 A;  4L6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...