2YL7A

Cytochrome c prime from alcaligenes xylosoxidans: as isolated l16g variant at 0.9 a resolution - restraint refinement
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSAGTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 53
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yl7A00
1E86A 4IAQA 4CJGA 1YYJA 4JEAA 4U9DA 1E84A 3HNLA 2XL8A 4L6RA 2YL3A 2CCYA 2J9BA 1YYXA 3ZTZA 1APCA 2XLWA 2XM4A 3HNKA 3FOPA 1MQVA 5JVEA 3NMIA 2J8WA 1A7VA 4N4WA 1JAFA 2YLDA 1EKYA 2XLHA 3TOMA 2XM0A 3ZTMA 5JP7A 3ZWIA 3IQ6A 3C62A 1E83A 4WGZA 3ZQVA 2BC5A 4JE9A 2QLAA 4ER9A 4IARA 2XLMA 1NBBA 3M4CA 4D4NA 1QPUA 4N6HA 2YL7A 4IB4A 4D4XA 2YKZA 3M79A 2YL0A 4U9EA 5JS5A 3VRCA 4JKVA 4CX9A 5JRAA 3M4BA 3NMKA 3HNJA 5JT4A 5JSLA 1QQ3A 1RCPA 3FOOA 1YZCA 2XLOA 4CDVA 3DE8A 4WGYA 4NC3A 2YL1A 5JLIA 4EIYA 5JUAA 1LM3B 3DE9A 1BBHA 4ULVA 3NMJA 2YLGA 2XL6A 3QVYA 2YLIA 3HNIA 4JEBA 3TOLA 1YZAA 3QVZA 1M6TA 2XLVA 3U8PA 4CJOA 3M15A 1CGNA 2XLDA 4CIPA 4CDAA 1CPQA 1S05A 5B3IA 3C63A 3QW0A 256BA 1CPRA 2XLEA 1CGOA 1GQAA 4CDYA 3L1MA 3ZQYA 3QW1A 5AGFA 1E85A 3IQ5A
chains in the Genus database with same CATH superfamily
2G3KA 4R32A 5HV9A 1T9KA 2P6VA 1E84A 1YYJA 3AG2C 2YQYA 1Q0DA 2Q3TA 3AG3C 1LVKA 3C18A 5FZTA 3RVZA 2HJMA 3RYLA 5F5HA 2HV7A 1T01A 2CCYA 4AE4B 2JX0A 1YJGA 4RD9A 4JTAB 4DBRA 1NSGB 2CDQA 2LSEA 1VK5A 4NQFA 1KTMA 1NFOA 1SMYF 2XM4A 5T1DB 3FOPA 5JVEA 4K7BA 2CGEA 3AG1C 4P6IC 2QNLA 1AEPA 3DM9B 1JR8A 1MMNA 3GANA 4HE8D 3U3FA 1AUEA 2NSFA 2P7VA 4JJFA 1NFNA 2Y69C 3T6GB 1JAFA 5L0JA 3JTLO 4BEJA 3L0IA 2OEVA 3LLKA 2XM0A 1WN0A 2VCCA 2HMQA 2IYLD 3C8ZA 3IQ6A 3NYJA 2L81A 3X2QC 4WGZA 2A0UA 3LJBA 3JT1A 3V7OA 1FTSA 1D1BA 2HKVA 1N1CA 4ONSA 4ZLCA 1M2VB 2XS8A 4N6HA 2R7TA 2YL7A 2VB6A 2HZ8A 3K1IA 4IB4A 2RSEB 4D4XA 1L3PA 3ZSUA 2DYSC 5KYWA 4U9EA 3W4YA 3AG4C 4WABA 3SXMA 4BJ5A 5JS5A 4QDLA 3R2PA 2J9WA 5L0CA 1NZEA 5AC5A 4PJJA 3VF0A 2Q7RA 5JRAA 4JIOA 4PJMA 1SZIA 4IRUA 4CS8A 2H7OA 2Q9BA 4U5CE 1FFHA 2H8AA 1C17M 1QQ3A 4MVSA 5JSLA 5T3TA 4LDRA 3GEHA 5KYXA 3JSZA 3NDBB 3LUTB 1IW7F 2XLOA 3EGXB 3TD7A 4LDQA 1Z5ZA 3BEHA 1OCZC 1G4US 2FAPB 2A68F 3JRMO 2UUHA 4K1OA 4J32B 1TFKB 4XEVA 3RW0A 1I4ZA 2Y3HA 1ZHZA 2MYSA 3AQCA 3V5YA 3HJCA 3JCUQ 5COFA 3UNGC 4OIPF 1OCCC 3IQTA 3JYHA 1RMVA 4MS2A 4AE4A 2R02A 1KU2A 1LM3B 4Q4ZF 4C7OB 2AP3A 2WVQA 3U0CA 2Z15A 4ULVA 4IWBA 5GPGB 2YVKA 3NMJA 2Q4FA 4KNWA 1D0XA 2HJ3A 2P0NA 3KKBA 3NKDA 1XWJA 5E3CA 3ABLC 2HSBA 3DJUB 4HFFB 1RKEA 1S7ZA 3DJNB 4H4KC 1G8XA 4DBQA 3B0VC 2I15A 2XL6A 2QUPA 4O6NA 3HNIA 2VCBA 1HW2A 1RJ9B 5L0GA 3CSKA 2JD3A 2Q9CA 3JSEO 1TR2A 1Q0FA 1WGWA 2YEVA 3KYJA 3M1CB 3NG1A 4W8KA 3B29A 3U8PA 1Z3IX 3HTKC 4I1OB 3CQZA 1LE2A 3MX3A 1QZXA 3FVYA 1OW7A 2A69F 2ZXRA 4QI2A 3I4UA 3RIPA 3GORA 3PCVA 3RQGA 4CIPA 2OJED 3US6A 1M2VA 1S05A 2WVOA 1UFBA 1HMDA 1YA7O 2NSGA 3LLIA 2PX0A 2YZSA 3C63A 1T6UA 4JVSA 4JURI 1T6IA 1CGOA 3TQOA 1FNTc 1Z63A 2UUIA 1FFTC 1VLTA 1HY5A 1O3UA 3GODA 3S28A 4C3EA 1EKYA 4MTGA 2A6EF 4LERA 4XPXA 2OU6A 3KMIA 1E85A 2VC9A 3SEOA 1TWHA 4CSAC 1D1AA 3S29A 3S90A 1ZHWA 3UMHA 4N06A 4CJGA 4U9DA 1BR2A 2PX3A 3EGXA 3QTHA 4MNDA 5E33A 4YWQA 2XL8A 2V3CC 2OJQA 2R25A 4FX5A 1GS9A 2ICWG 2YL3A 4EKWA 2YRFA 1Q0GA 3NKEA 2OKUA 2OQMA 4KBLA 1A0BA 1NLXA 3EJNA 5DVWA 3ECSA 2X0CA 4AX2A 1APCA 2XLWA 3ZG1A 4DVYP 3UMKA 1BR4A 2J0XA 1JOGA 2M4EA 3NMIA 2J8WA 3EHMA 4C7OA 1XZQA 1Y6DA 2J45A 1VOMA 3U2MA 1JPJA 3B9QA 4JCHA 3L34A 3ABKC 3IPMO 3GM1A 4O6MA 2XLHA 4YT5A 5TJ5E 5A6BD 3S84A 5JP7A 1KNYA 3ZWIA 1GM5A 4OIQF 2ZPAA 5DQZA 4CS9C 4EUKB 1LI5A 1ORSC 1L7CA 3PMRA 3ZQVA 1FR0A 2IOQA 1RJ9A 4JE9A 3SXYA 1PD1A 2R05A 4ER9A 1U89A 3Q7LA 5A69A 4IARA 3M4CA 4XEKA 4BJTA 2J9VA 4PACA 5F28E 3LS1A 3EH1A 2HUJA 1OCRC 5BUOA 1YARO 3O39A 3SXZA 3JRTA 3L8JA 2PFDA 3W2VA 2C03A 3CEXA 2AWYA 2WB7A 1J8MF 3A9CA 4EBJA 3RKOF 4LACB 2V26A 3R7CA 1PV3A 1V74B 2CYDA 2XL4A 3K7DA 4E0IA 3VRCA 1RKEB 3LNMB 4CX9A 4U5BE 2ZD9A 3LEOA 4MQ9F 3MYIA 1G5ZA 4PFOA 3KL4A 1OXKA 3IEEA 3U8VA 4XQ1A 4DXWA 3HLZA 2MHRA 2IXPA 4OD5A 5B3SC 1YZCA 2A0BA 4JC7A 3H65A 4O79A 4CDVA 3OA1A 4E7SA 4AL0A 3FAJA 4F4BA 2GWWA 3VAYA 5T3WA 3MFNA 3V5ZA 4NC3A 5BQHA 3S0XA 3L8IA 1R4TA 1G4WR 2WZFA 3ATPA 4EBKA 1RXQA 3DE9A 3FMSA 3LAYA 1BBHA 2CNWA 2HFIA 4IAOA 2OG2A 2J0WA 2WZLA 2QE9A 3EZIA 2VH3A 4Q7CA 3N0TA 5COGA 2D5RB 3DAGA 1FMWA 2EPNA 3WAQA 1BZ4A 3B0PA 3QVYA 4H54A 1OCOC 2A1DD 2NUTA 4NY3A 3LESA 2R9RB 4ULWA 2R7SA 3C8GB 4XTKA 1ZHXA 5KYYB 4JEBA 2YWAA 2GDCA 3QVZA 3TULA 4K0DA 1M6TA 3DAFA 4CJOA 5CIVA 4U5HA 4DOZA 4MVRA 1PD0A 1BDJB 4I1MA 2HMZA 4MVQA 5KYUB 4MTFA 2GAQA 4A4AA 4HFKB 5EHHA 1TWGA 1C03A 2OEXA 4EHPA 3ZC4A 3QW0A 5L3QA 2DGJA 2EINC 2L9JA 5A6BA 1V54C 4XWJA 2Y3BA 2XLEA 3AJMA 1YVIA 4BJ1A 5A6KA 2Q9AA 1D0YA 1B68A 5L0IA 4NTFA 2LQGA 3L1MA 4U5FE 3ZQYA 3MYFA 4OINF 3U2LA 3H2VA 3CAXA 4NTAA 4KI2A 1ZW3A 1H6GA 2H7BA 4NCQA 1NU7D 1SF8A 3E70C 1E86A 3DM5A 4IAQA 1K04A 2IXOA 3ASNC 4BJ6A 4G7ZF 2M64A 4I44A 3CZ6A 4A2NB 2W9YA 1I4YA 1OQCA 1YAUO 3GEIA 5K0IA 3U9JA 5HSWA 3OWTA 5DS4A 4YT2A 1ORYA 3ZTZA 2HSQA 1HW1A 3HKKA 3HNKA 2R7XA 2L6HA 5F5FA 2NUPA 1UG7A 3FHDA 4P9FA 1V55C 3B0UX 2EIMC 1YLMA 1TWCA 3EHNA 1MNEA 4QI0A 4YN0B 1NG1A 1SR2A 3B71A 1QKRA 2KW3C 1Z6AA 1VB5A 1TKNA 3TOMA 3T9OA 1T5OA 2CNWD 3ZTMA 4BPMA 1OW8A 1D0ZA 2LFDA 1ZU4A 3C62A 3FAPB 3Q6MA 3ZVRA 3K33A 1HE1A 5BQGA 1TFOB 2BC5A 3Q7GA 3U3BA 2QLAA 2HV6A 1WOLA 2KSFA 3C8GA 3O6XA 4M63A 3RF3A 5KYYA 1MMDA 2L6FA 3A11A 2EIKC 4D4NA 2NG1A 1QPUA 1A7DA 3LNRA 3T4RA 3ZDLA 5L3VA 1VYKA 4XPYA 4CSAA 2YKZA 3U9MA 3M79A 1YDIA 2YL0A 3AQBA 5L0HA 3MLGA 3PHF2 1I5NA 2R7VA 1WATA 3GM3A 5KYUA 1U6HA 4XLNF 2LK4A 3G50A 2ZXPA 1W2WA 1ZW2A 1OR2A 4GQHA 4KNVA 4LDKA 4MTOA 4N6CA 4EWCA 1Z23A 4JKVA 2Y39A 1A7EA 4E0HA 3E9VA 2NUTB 1Y4CA 3NMKA 3IHUA 1HE9A 2TMVP 5DQTA 2QY9A 5CI8A 2RD9A 1IZMA 1EI7A 1VLSA 2IXNA 2KNHA 3DKAA 1SYQA 2FGYA 3DE8A 3EPVA 2EPMX 4JCZA 2J46A 1R5ID 2B0JA 2PBEA 2VCAA 2YL1A 4W8PA 4MVMA 2L6GA 2R7UA 2LP4A 1LIHA 1ZHTA 2JPUA 1RKCA 2GFHA 1O87A 2WL8A 3I5PA 1ZZPA 4CS9A 4DRHB 4EIYA 5JUAA 4OIRF 2R7RA 3I5QA 4BJ6C 5B1BC 4LLCA 4DRIB 2XS1A 4EBBA 4G7OF 4G78A 5E2QA 2LFFA 1JPNA 3RFYA 1J8YF 3AOUA 1K40A 1PCXA 2XSEA 3KYIA 5EGYA 3Q6NA 3SYNA 4MVOA 4FWVA 3VM6A 2YLIA 4XPWA 2XRHA 1TQGA 2Y3DA 4YL0A 1LS4A 2B0HA 4YJWA 1TWAA 3LEVA 4GEHA 3K1HA 1D1CA 2LCHA 3DXJF 3G4ZA 3GWLA 3IQCA 1QVXA 1YZAA 2PP4A 3DWWA 4J30B 3SNHA 1ST6A 2E87A 2XLVA 3RQFA 5FCLA 2KK1A 2ASRA 5CI9A 3WODF 3EQLF 2EILC 1H9GA 2WVNA 3EGDB 3TJ5A 1VTMP 1EQ1A 1T6QA 2VASA 3J06A 1ORJA 3EG9B 4YT8A 2R7QA 1CPQA 4YK5A 4G7HF 1Z7Qc 3C8GD 5B3IA 5A6JA 2ETSA 3NRHA 2NUPB 4RBNA 2DI3A 3K6BA 2Y3GA 3UGOA 2DB4A 3UR3C 1ZVZA 3DMDA 2XXAB 1EA8A 4GYTA 3DZAA 1WWPA 3EZHA 1GQAA 3EFOA 1LI7A 1MMGA 2P1AA 4IJJA 3O10A 1WTYA 4U5GA 3GM2A 1MMAA 1OR3A 1DOVA 1Q0KA 3K1IC 3QW1A 3AGUA 3DI5A 4JJGA 5AGFA 1H9TA 2F22A 1ZHYA 1JRAA 1FMVA 2MWQA 3N24A 4DVZA 3F47A 4Z9HA 1M56C 2EIJC 4NTBA 2W4BA 5DS5A 3ITFA 3BRJA 4JEAA 4BJ5C 3RVYA 1ZYRF 4WJ0A 5L0FA 4UDVA 1QSPA 3HNLA 4PFPA 3FDQA 4OIOF 5A6AA 2IBFA 2IM8A 4L6RA 2P61A 4FESA 1O5HA 4PR9A 2J9BA 3W2WA 3QZCA 4CS8C 1YYXA 3KH2A 1YA9A 3UGPA 3QMKA 2G3VA 1MQVA 4RDAA 1VMAA 4Z9JA 3O55A 4G0HA 1M57C 2KC3A 4JTCB 4KC9A 2J7PA 3F46A 3GEEA 3LS0A 5DS6A 3T6JA 1A7VA 4ANJA 4N4WA 4CBEA 4E7ZA 2GA0A 2YLDA 3T6BA 1MNDA 1FAPB 1GGQA 3VYWA 2DYRC 4XEFA 2ZXOA 2HS5A 3WG7C 1OKKA 2KQ9A 3C7JA 1E83A 4Q5SF 4MVZA 3ZIBA 3NYMA 2EPKX 4JRZA 1C02A 3W8IA 5BQIA 2Q00A 2L7AA 2XLMA 1NBBA 4MW8A 3UMIA 3WHNA 2ZXWC 1LKXA 1ZU5A 2R03A 3N2ZB 4JW1A 5IY5C 2PNOA 2BL2A 4DRJB 1Q0MA 1JMWA 2O9XA 3EGDA 5COMA 3S9OA 4CIHA 3POVA 4U5DE 4YL3A 2OCCC 3EG9A 4BG0A 2A6HF 2LIGA 5KYNA 3FXHA 4OD4A 4U5EE 2R7WA 4C3BA 4J7YA 2QTVA 5AC4A 2XXAA 4XLPF 3M4BA 4I3MA 3MBGA 4IGGA 1LS1A 4FAPB 3HNJA 4O6YA 1HMOA 1WASA 4MW3A 3K66A 3GWNA 1RCPA 3ABMC 2C04A 3FOOA 3W8HA 5B1AC 5DLJA 3KPHA 1QLEC 2EPLX 3SXKA 4E18A 2D4UA 1A41A 1LPEA 2IXMA 4X0RA 4WGYA 5L0DA 1U0BB 4B6IA 1K05A 2KJGA 5JLIA 4C3DA 2AVKA 2X51A 4LLEA 5D91A 1BR1A 3RH3A 1E2XA 1OW6A 4J7TA 1XZPA 1LE4A 1AVOB 4O7GA 3EFOB 3S27A 2YLGA 2R7OA 3RQEA 3JZ0A 2W45A 3X1OA 4PJNA 3U5SA 5JT4A 2NPUA 2J7PD 4JTDB 2LD6A 5EK0A 3TOLA 3G4XA 3NYLA 5E3AA 1F1MA 2W4MA 4MVUA 3TK0A 3TJ6A 1DOWA 3EH2A 4PJLA 4AK9A 3V5XA 2AU5A 3AGTA 4AL1A 3ASOC 3M15A 4CS7A 1OKKD 1CGNA 2BE5F 2OOCA 2XLDA 3H2UA 1CGME 2FFHA 1M2OA 4BEMJ 4CDAA 5KYWB 3JYYA 2CW0F 2YHSA 1VYIA 4JZAA 4HEAJ 2I8BA 3PDMP 4DJ9A 3OEOA 3SZRA 256BA 1OXBA 2EPOA 2KGOA 2KYHA 1CPRA 2PF4E 2J9UA 2G62A 1V4AA 4YT4A 3DD7A 3SP1A 4CDYA 1NU9C 5KYXB 4YL1A 5D92A 4P9TA 4Z9IA 4ZLDA 4E17A 2WZGA 1H7IA 2H7VC 2AWCA 3IQ5A 4PK4A
chains in the Genus database with same CATH topology
1E86A 4IAQA 4CJGA 1YYJA 4JEAA 4U9DA 1E84A 3HNLA 2XL8A 4L6RA 2YL3A 2CCYA 2J9BA 1YYXA 3ZTZA 1APCA 2XLWA 2XM4A 3HNKA 3FOPA 1MQVA 5JVEA 3NMIA 2J8WA 1A7VA 4N4WA 1JAFA 2YLDA 1EKYA 2XLHA 3TOMA 2XM0A 3ZTMA 5JP7A 3ZWIA 3IQ6A 3C62A 1E83A 4WGZA 3ZQVA 2BC5A 4JE9A 2QLAA 4ER9A 4IARA 2XLMA 1NBBA 3M4CA 4D4NA 1QPUA 4N6HA 2YL7A 4IB4A 4D4XA 2YKZA 3M79A 2YL0A 4U9EA 5JS5A 3VRCA 4JKVA 4CX9A 5JRAA 3M4BA 3NMKA 3HNJA 5JT4A 5JSLA 1QQ3A 1RCPA 3FOOA 1YZCA 2XLOA 4CDVA 3DE8A 4WGYA 4NC3A 2YL1A 5JLIA 4EIYA 5JUAA 1LM3B 3DE9A 1BBHA 4ULVA 3NMJA 2YLGA 2XL6A 3QVYA 2YLIA 3HNIA 4JEBA 3TOLA 1YZAA 3QVZA 1M6TA 2XLVA 3U8PA 4CJOA 3M15A 1CGNA 2XLDA 4CIPA 4CDAA 1CPQA 1S05A 5B3IA 3C63A 3QW0A 256BA 1CPRA 2XLEA 1CGOA 1GQAA 4CDYA 3L1MA 3ZQYA 3QW1A 5AGFA 1E85A 3IQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E86 A;  4IAQ A;  4CJG A;  1YYJ A;  4JEA A;  4U9D A;  1E84 A;  3HNL A;  2XL8 A;  4L6R A;  2YL3 A;  2CCY A;  2J9B A;  1YYX A;  3ZTZ A;  1APC A;  2XLW A;  2XM4 A;  3HNK A;  3FOP A;  1MQV A;  5JVE A;  3NMI A;  2J8W A;  1A7V A;  4N4W A;  1JAF A;  2YLD A;  1EKY A;  2XLH A;  3TOM A;  2XM0 A;  3ZTM A;  5JP7 A;  3ZWI A;  3IQ6 A;  3C62 A;  1E83 A;  4WGZ A;  3ZQV A;  2BC5 A;  4JE9 A;  2QLA A;  4ER9 A;  4IAR A;  2XLM A;  1NBB A;  3M4C A;  4D4N A;  1QPU A;  4N6H A;  2YL7 A;  4IB4 A;  4D4X A;  2YKZ A;  3M79 A;  2YL0 A;  4U9E A;  5JS5 A;  3VRC A;  4JKV A;  4CX9 A;  5JRA A;  3M4B A;  3NMK A;  3HNJ A;  5JT4 A;  5JSL A;  1QQ3 A;  1RCP A;  3FOO A;  1YZC A;  2XLO A;  4CDV A;  3DE8 A;  4WGY A;  4NC3 A;  2YL1 A;  5JLI A;  4EIY A;  5JUA A;  1LM3 B;  3DE9 A;  1BBH A;  4ULV A;  3NMJ A;  2YLG A;  2XL6 A;  3QVY A;  2YLI A;  3HNI A;  4JEB A;  3TOL A;  1YZA A;  3QVZ A;  1M6T A;  2XLV A;  3U8P A;  4CJO A;  3M15 A;  1CGN A;  2XLD A;  4CIP A;  4CDA A;  1CPQ A;  1S05 A;  5B3I A;  3C63 A;  3QW0 A;  256B A;  1CPR A;  2XLE A;  1CGO A;  1GQA A;  4CDY A;  3L1M A;  3ZQY A;  3QW1 A;  5AGF A;  1E85 A;  3IQ5 A; 
#chains in the Genus database with same CATH topology
 2G3K A;  4R32 A;  5HV9 A;  1T9K A;  2P6V A;  1E84 A;  1YYJ A;  3AG2 C;  2YQY A;  1Q0D A;  2Q3T A;  3AG3 C;  1LVK A;  3C18 A;  5FZT A;  3RVZ A;  2HJM A;  3RYL A;  5F5H A;  2HV7 A;  1T01 A;  2CCY A;  4AE4 B;  2JX0 A;  1YJG A;  4RD9 A;  4JTA B;  4DBR A;  1NSG B;  2CDQ A;  2LSE A;  1VK5 A;  4NQF A;  1KTM A;  1NFO A;  1SMY F;  2XM4 A;  5T1D B;  3FOP A;  5JVE A;  4K7B A;  2CGE A;  3AG1 C;  4P6I C;  2QNL A;  1AEP A;  3DM9 B;  1JR8 A;  1MMN A;  3GAN A;  4HE8 D;  3U3F A;  1AUE A;  2NSF A;  2P7V A;  4JJF A;  1NFN A;  2Y69 C;  3T6G B;  1JAF A;  5L0J A;  3JTL O;  4BEJ A;  3L0I A;  2OEV A;  3LLK A;  2XM0 A;  1WN0 A;  2VCC A;  2HMQ A;  2IYL D;  3C8Z A;  3IQ6 A;  3NYJ A;  2L81 A;  3X2Q C;  4WGZ A;  2A0U A;  3LJB A;  3JT1 A;  3V7O A;  1FTS A;  1D1B A;  2HKV A;  1N1C A;  4ONS A;  4ZLC A;  1M2V B;  2XS8 A;  4N6H A;  2R7T A;  2YL7 A;  2VB6 A;  2HZ8 A;  3K1I A;  4IB4 A;  2RSE B;  4D4X A;  1L3P A;  3ZSU A;  2DYS C;  5KYW A;  4U9E A;  3W4Y A;  3AG4 C;  4WAB A;  3SXM A;  4BJ5 A;  5JS5 A;  4QDL A;  3R2P A;  2J9W A;  5L0C A;  1NZE A;  5AC5 A;  4PJJ A;  3VF0 A;  2Q7R A;  5JRA A;  4JIO A;  4PJM A;  1SZI A;  4IRU A;  4CS8 A;  2H7O A;  2Q9B A;  4U5C E;  1FFH A;  2H8A A;  1C17 M;  1QQ3 A;  4MVS A;  5JSL A;  5T3T A;  4LDR A;  3GEH A;  5KYX A;  3JSZ A;  3NDB B;  3LUT B;  1IW7 F;  2XLO A;  3EGX B;  3TD7 A;  4LDQ A;  1Z5Z A;  3BEH A;  1OCZ C;  1G4U S;  2FAP B;  2A68 F;  3JRM O;  2UUH A;  4K1O A;  4J32 B;  1TFK B;  4XEV A;  3RW0 A;  1I4Z A;  2Y3H A;  1ZHZ A;  2MYS A;  3AQC A;  3V5Y A;  3HJC A;  3JCU Q;  5COF A;  3UNG C;  4OIP F;  1OCC C;  3IQT A;  3JYH A;  1RMV A;  4MS2 A;  4AE4 A;  2R02 A;  1KU2 A;  1LM3 B;  4Q4Z F;  4C7O B;  2AP3 A;  2WVQ A;  3U0C A;  2Z15 A;  4ULV A;  4IWB A;  5GPG B;  2YVK A;  3NMJ A;  2Q4F A;  4KNW A;  1D0X A;  2HJ3 A;  2P0N A;  3KKB A;  3NKD A;  1XWJ A;  5E3C A;  3ABL C;  2HSB A;  3DJU B;  4HFF B;  1RKE A;  1S7Z A;  3DJN B;  4H4K C;  1G8X A;  4DBQ A;  3B0V C;  2I15 A;  2XL6 A;  2QUP A;  4O6N A;  3HNI A;  2VCB A;  1HW2 A;  1RJ9 B;  5L0G A;  3CSK A;  2JD3 A;  2Q9C A;  3JSE O;  1TR2 A;  1Q0F A;  1WGW A;  2YEV A;  3KYJ A;  3M1C B;  3NG1 A;  4W8K A;  3B29 A;  3U8P A;  1Z3I X;  3HTK C;  4I1O B;  3CQZ A;  1LE2 A;  3MX3 A;  1QZX A;  3FVY A;  1OW7 A;  2A69 F;  2ZXR A;  4QI2 A;  3I4U A;  3RIP A;  3GOR A;  3PCV A;  3RQG A;  4CIP A;  2OJE D;  3US6 A;  1M2V A;  1S05 A;  2WVO A;  1UFB A;  1HMD A;  1YA7 O;  2NSG A;  3LLI A;  2PX0 A;  2YZS A;  3C63 A;  1T6U A;  4JVS A;  4JUR I;  1T6I A;  1CGO A;  3TQO A;  1FNT c;  1Z63 A;  2UUI A;  1FFT C;  1VLT A;  1HY5 A;  1O3U A;  3GOD A;  3S28 A;  4C3E A;  1EKY A;  4MTG A;  2A6E F;  4LER A;  4XPX A;  2OU6 A;  3KMI A;  1E85 A;  2VC9 A;  3SEO A;  1TWH A;  4CSA C;  1D1A A;  3S29 A;  3S90 A;  1ZHW A;  3UMH A;  4N06 A;  4CJG A;  4U9D A;  1BR2 A;  2PX3 A;  3EGX A;  3QTH A;  4MND A;  5E33 A;  4YWQ A;  2XL8 A;  2V3C C;  2OJQ A;  2R25 A;  4FX5 A;  1GS9 A;  2ICW G;  2YL3 A;  4EKW A;  2YRF A;  1Q0G A;  3NKE A;  2OKU A;  2OQM A;  4KBL A;  1A0B A;  1NLX A;  3EJN A;  5DVW A;  3ECS A;  2X0C A;  4AX2 A;  1APC A;  2XLW A;  3ZG1 A;  4DVY P;  3UMK A;  1BR4 A;  2J0X A;  1JOG A;  2M4E A;  3NMI A;  2J8W A;  3EHM A;  4C7O A;  1XZQ A;  1Y6D A;  2J45 A;  1VOM A;  3U2M A;  1JPJ A;  3B9Q A;  4JCH A;  3L34 A;  3ABK C;  3IPM O;  3GM1 A;  4O6M A;  2XLH A;  4YT5 A;  5TJ5 E;  5A6B D;  3S84 A;  5JP7 A;  1KNY A;  3ZWI A;  1GM5 A;  4OIQ F;  2ZPA A;  5DQZ A;  4CS9 C;  4EUK B;  1LI5 A;  1ORS C;  1L7C A;  3PMR A;  3ZQV A;  1FR0 A;  2IOQ A;  1RJ9 A;  4JE9 A;  3SXY A;  1PD1 A;  2R05 A;  4ER9 A;  1U89 A;  3Q7L A;  5A69 A;  4IAR A;  3M4C A;  4XEK A;  4BJT A;  2J9V A;  4PAC A;  5F28 E;  3LS1 A;  3EH1 A;  2HUJ A;  1OCR C;  5BUO A;  1YAR O;  3O39 A;  3SXZ A;  3JRT A;  3L8J A;  2PFD A;  3W2V A;  2C03 A;  3CEX A;  2AWY A;  2WB7 A;  1J8M F;  3A9C A;  4EBJ A;  3RKO F;  4LAC B;  2V26 A;  3R7C A;  1PV3 A;  1V74 B;  2CYD A;  2XL4 A;  3K7D A;  4E0I A;  3VRC A;  1RKE B;  3LNM B;  4CX9 A;  4U5B E;  2ZD9 A;  3LEO A;  4MQ9 F;  3MYI A;  1G5Z A;  4PFO A;  3KL4 A;  1OXK A;  3IEE A;  3U8V A;  4XQ1 A;  4DXW A;  3HLZ A;  2MHR A;  2IXP A;  4OD5 A;  5B3S C;  1YZC A;  2A0B A;  4JC7 A;  3H65 A;  4O79 A;  4CDV A;  3OA1 A;  4E7S A;  4AL0 A;  3FAJ A;  4F4B A;  2GWW A;  3VAY A;  5T3W A;  3MFN A;  3V5Z A;  4NC3 A;  5BQH A;  3S0X A;  3L8I A;  1R4T A;  1G4W R;  2WZF A;  3ATP A;  4EBK A;  1RXQ A;  3DE9 A;  3FMS A;  3LAY A;  1BBH A;  2CNW A;  2HFI A;  4IAO A;  2OG2 A;  2J0W A;  2WZL A;  2QE9 A;  3EZI A;  2VH3 A;  4Q7C A;  3N0T A;  5COG A;  2D5R B;  3DAG A;  1FMW A;  2EPN A;  3WAQ A;  1BZ4 A;  3B0P A;  3QVY A;  4H54 A;  1OCO C;  2A1D D;  2NUT A;  4NY3 A;  3LES A;  2R9R B;  4ULW A;  2R7S A;  3C8G B;  4XTK A;  1ZHX A;  5KYY B;  4JEB A;  2YWA A;  2GDC A;  3QVZ A;  3TUL A;  4K0D A;  1M6T A;  3DAF A;  4CJO A;  5CIV A;  4U5H A;  4DOZ A;  4MVR A;  1PD0 A;  1BDJ B;  4I1M A;  2HMZ A;  4MVQ A;  5KYU B;  4MTF A;  2GAQ A;  4A4A A;  4HFK B;  5EHH A;  1TWG A;  1C03 A;  2OEX A;  4EHP A;  3ZC4 A;  3QW0 A;  5L3Q A;  2DGJ A;  2EIN C;  2L9J A;  5A6B A;  1V54 C;  4XWJ A;  2Y3B A;  2XLE A;  3AJM A;  1YVI A;  4BJ1 A;  5A6K A;  2Q9A A;  1D0Y A;  1B68 A;  5L0I A;  4NTF A;  2LQG A;  3L1M A;  4U5F E;  3ZQY A;  3MYF A;  4OIN F;  3U2L A;  3H2V A;  3CAX A;  4NTA A;  4KI2 A;  1ZW3 A;  1H6G A;  2H7B A;  4NCQ A;  1NU7 D;  1SF8 A;  3E70 C;  1E86 A;  3DM5 A;  4IAQ A;  1K04 A;  2IXO A;  3ASN C;  4BJ6 A;  4G7Z F;  2M64 A;  4I44 A;  3CZ6 A;  4A2N B;  2W9Y A;  1I4Y A;  1OQC A;  1YAU O;  3GEI A;  5K0I A;  3U9J A;  5HSW A;  3OWT A;  5DS4 A;  4YT2 A;  1ORY A;  3ZTZ A;  2HSQ A;  1HW1 A;  3HKK A;  3HNK A;  2R7X A;  2L6H A;  5F5F A;  2NUP A;  1UG7 A;  3FHD A;  4P9F A;  1V55 C;  3B0U X;  2EIM C;  1YLM A;  1TWC A;  3EHN A;  1MNE A;  4QI0 A;  4YN0 B;  1NG1 A;  1SR2 A;  3B71 A;  1QKR A;  2KW3 C;  1Z6A A;  1VB5 A;  1TKN A;  3TOM A;  3T9O A;  1T5O A;  2CNW D;  3ZTM A;  4BPM A;  1OW8 A;  1D0Z A;  2LFD A;  1ZU4 A;  3C62 A;  3FAP B;  3Q6M A;  3ZVR A;  3K33 A;  1HE1 A;  5BQG A;  1TFO B;  2BC5 A;  3Q7G A;  3U3B A;  2QLA A;  2HV6 A;  1WOL A;  2KSF A;  3C8G A;  3O6X A;  4M63 A;  3RF3 A;  5KYY A;  1MMD A;  2L6F A;  3A11 A;  2EIK C;  4D4N A;  2NG1 A;  1QPU A;  1A7D A;  3LNR A;  3T4R A;  3ZDL A;  5L3V A;  1VYK A;  4XPY A;  4CSA A;  2YKZ A;  3U9M A;  3M79 A;  1YDI A;  2YL0 A;  3AQB A;  5L0H A;  3MLG A;  3PHF 2;  1I5N A;  2R7V A;  1WAT A;  3GM3 A;  5KYU A;  1U6H A;  4XLN F;  2LK4 A;  3G50 A;  2ZXP A;  1W2W A;  1ZW2 A;  1OR2 A;  4GQH A;  4KNV A;  4LDK A;  4MTO A;  4N6C A;  4EWC A;  1Z23 A;  4JKV A;  2Y39 A;  1A7E A;  4E0H A;  3E9V A;  2NUT B;  1Y4C A;  3NMK A;  3IHU A;  1HE9 A;  2TMV P;  5DQT A;  2QY9 A;  5CI8 A;  2RD9 A;  1IZM A;  1EI7 A;  1VLS A;  2IXN A;  2KNH A;  3DKA A;  1SYQ A;  2FGY A;  3DE8 A;  3EPV A;  2EPM X;  4JCZ A;  2J46 A;  1R5I D;  2B0J A;  2PBE A;  2VCA A;  2YL1 A;  4W8P A;  4MVM A;  2L6G A;  2R7U A;  2LP4 A;  1LIH A;  1ZHT A;  2JPU A;  1RKC A;  2GFH A;  1O87 A;  2WL8 A;  3I5P A;  1ZZP A;  4CS9 A;  4DRH B;  4EIY A;  5JUA A;  4OIR F;  2R7R A;  3I5Q A;  4BJ6 C;  5B1B C;  4LLC A;  4DRI B;  2XS1 A;  4EBB A;  4G7O F;  4G78 A;  5E2Q A;  2LFF A;  1JPN A;  3RFY A;  1J8Y F;  3AOU A;  1K40 A;  1PCX A;  2XSE A;  3KYI A;  5EGY A;  3Q6N A;  3SYN A;  4MVO A;  4FWV A;  3VM6 A;  2YLI A;  4XPW A;  2XRH A;  1TQG A;  2Y3D A;  4YL0 A;  1LS4 A;  2B0H A;  4YJW A;  1TWA A;  3LEV A;  4GEH A;  3K1H A;  1D1C A;  2LCH A;  3DXJ F;  3G4Z A;  3GWL A;  3IQC A;  1QVX A;  1YZA A;  2PP4 A;  3DWW A;  4J30 B;  3SNH A;  1ST6 A;  2E87 A;  2XLV A;  3RQF A;  5FCL A;  2KK1 A;  2ASR A;  5CI9 A;  3WOD F;  3EQL F;  2EIL C;  1H9G A;  2WVN A;  3EGD B;  3TJ5 A;  1VTM P;  1EQ1 A;  1T6Q A;  2VAS A;  3J06 A;  1ORJ A;  3EG9 B;  4YT8 A;  2R7Q A;  1CPQ A;  4YK5 A;  4G7H F;  1Z7Q c;  3C8G D;  5B3I A;  5A6J A;  2ETS A;  3NRH A;  2NUP B;  4RBN A;  2DI3 A;  3K6B A;  2Y3G A;  3UGO A;  2DB4 A;  3UR3 C;  1ZVZ A;  3DMD A;  2XXA B;  1EA8 A;  4GYT A;  3DZA A;  1WWP A;  3EZH A;  1GQA A;  3EFO A;  1LI7 A;  1MMG A;  2P1A A;  4IJJ A;  3O10 A;  1WTY A;  4U5G A;  3GM2 A;  1MMA A;  1OR3 A;  1DOV A;  1Q0K A;  3K1I C;  3QW1 A;  3AGU A;  3DI5 A;  4JJG A;  5AGF A;  1H9T A;  2F22 A;  1ZHY A;  1JRA A;  1FMV A;  2MWQ A;  3N24 A;  4DVZ A;  3F47 A;  4Z9H A;  1M56 C;  2EIJ C;  4NTB A;  2W4B A;  5DS5 A;  3ITF A;  3BRJ A;  4JEA A;  4BJ5 C;  3RVY A;  1ZYR F;  4WJ0 A;  5L0F A;  4UDV A;  1QSP A;  3HNL A;  4PFP A;  3FDQ A;  4OIO F;  5A6A A;  2IBF A;  2IM8 A;  4L6R A;  2P61 A;  4FES A;  1O5H A;  4PR9 A;  2J9B A;  3W2W A;  3QZC A;  4CS8 C;  1YYX A;  3KH2 A;  1YA9 A;  3UGP A;  3QMK A;  2G3V A;  1MQV A;  4RDA A;  1VMA A;  4Z9J A;  3O55 A;  4G0H A;  1M57 C;  2KC3 A;  4JTC B;  4KC9 A;  2J7P A;  3F46 A;  3GEE A;  3LS0 A;  5DS6 A;  3T6J A;  1A7V A;  4ANJ A;  4N4W A;  4CBE A;  4E7Z A;  2GA0 A;  2YLD A;  3T6B A;  1MND A;  1FAP B;  1GGQ A;  3VYW A;  2DYR C;  4XEF A;  2ZXO A;  2HS5 A;  3WG7 C;  1OKK A;  2KQ9 A;  3C7J A;  1E83 A;  4Q5S F;  4MVZ A;  3ZIB A;  3NYM A;  2EPK X;  4JRZ A;  1C02 A;  3W8I A;  5BQI A;  2Q00 A;  2L7A A;  2XLM A;  1NBB A;  4MW8 A;  3UMI A;  3WHN A;  2ZXW C;  1LKX A;  1ZU5 A;  2R03 A;  3N2Z B;  4JW1 A;  5IY5 C;  2PNO A;  2BL2 A;  4DRJ B;  1Q0M A;  1JMW A;  2O9X A;  3EGD A;  5COM A;  3S9O A;  4CIH A;  3POV A;  4U5D E;  4YL3 A;  2OCC C;  3EG9 A;  4BG0 A;  2A6H F;  2LIG A;  5KYN A;  3FXH A;  4OD4 A;  4U5E E;  2R7W A;  4C3B A;  4J7Y A;  2QTV A;  5AC4 A;  2XXA A;  4XLP F;  3M4B A;  4I3M A;  3MBG A;  4IGG A;  1LS1 A;  4FAP B;  3HNJ A;  4O6Y A;  1HMO A;  1WAS A;  4MW3 A;  3K66 A;  3GWN A;  1RCP A;  3ABM C;  2C04 A;  3FOO A;  3W8H A;  5B1A C;  5DLJ A;  3KPH A;  1QLE C;  2EPL X;  3SXK A;  4E18 A;  2D4U A;  1A41 A;  1LPE A;  2IXM A;  4X0R A;  4WGY A;  5L0D A;  1U0B B;  4B6I A;  1K05 A;  2KJG A;  5JLI A;  4C3D A;  2AVK A;  2X51 A;  4LLE A;  5D91 A;  1BR1 A;  3RH3 A;  1E2X A;  1OW6 A;  4J7T A;  1XZP A;  1LE4 A;  1AVO B;  4O7G A;  3EFO B;  3S27 A;  2YLG A;  2R7O A;  3RQE A;  3JZ0 A;  2W45 A;  3X1O A;  4PJN A;  3U5S A;  5JT4 A;  2NPU A;  2J7P D;  4JTD B;  2LD6 A;  5EK0 A;  3TOL A;  3G4X A;  3NYL A;  5E3A A;  1F1M A;  2W4M A;  4MVU A;  3TK0 A;  3TJ6 A;  1DOW A;  3EH2 A;  4PJL A;  4AK9 A;  3V5X A;  2AU5 A;  3AGT A;  4AL1 A;  3ASO C;  3M15 A;  4CS7 A;  1OKK D;  1CGN A;  2BE5 F;  2OOC A;  2XLD A;  3H2U A;  1CGM E;  2FFH A;  1M2O A;  4BEM J;  4CDA A;  5KYW B;  3JYY A;  2CW0 F;  2YHS A;  1VYI A;  4JZA A;  4HEA J;  2I8B A;  3PDM P;  4DJ9 A;  3OEO A;  3SZR A;  256B A;  1OXB A;  2EPO A;  2KGO A;  2KYH A;  1CPR A;  2PF4 E;  2J9U A;  2G62 A;  1V4A A;  4YT4 A;  3DD7 A;  3SP1 A;  4CDY A;  1NU9 C;  5KYX B;  4YL1 A;  5D92 A;  4P9T A;  4Z9I A;  4ZLD A;  4E17 A;  2WZG A;  1H7I A;  2H7V C;  2AWC A;  3IQ5 A;  4PK4 A; 
#chains in the Genus database with same CATH homology
 1E86 A;  4IAQ A;  4CJG A;  1YYJ A;  4JEA A;  4U9D A;  1E84 A;  3HNL A;  2XL8 A;  4L6R A;  2YL3 A;  2CCY A;  2J9B A;  1YYX A;  3ZTZ A;  1APC A;  2XLW A;  2XM4 A;  3HNK A;  3FOP A;  1MQV A;  5JVE A;  3NMI A;  2J8W A;  1A7V A;  4N4W A;  1JAF A;  2YLD A;  1EKY A;  2XLH A;  3TOM A;  2XM0 A;  3ZTM A;  5JP7 A;  3ZWI A;  3IQ6 A;  3C62 A;  1E83 A;  4WGZ A;  3ZQV A;  2BC5 A;  4JE9 A;  2QLA A;  4ER9 A;  4IAR A;  2XLM A;  1NBB A;  3M4C A;  4D4N A;  1QPU A;  4N6H A;  2YL7 A;  4IB4 A;  4D4X A;  2YKZ A;  3M79 A;  2YL0 A;  4U9E A;  5JS5 A;  3VRC A;  4JKV A;  4CX9 A;  5JRA A;  3M4B A;  3NMK A;  3HNJ A;  5JT4 A;  5JSL A;  1QQ3 A;  1RCP A;  3FOO A;  1YZC A;  2XLO A;  4CDV A;  3DE8 A;  4WGY A;  4NC3 A;  2YL1 A;  5JLI A;  4EIY A;  5JUA A;  1LM3 B;  3DE9 A;  1BBH A;  4ULV A;  3NMJ A;  2YLG A;  2XL6 A;  3QVY A;  2YLI A;  3HNI A;  4JEB A;  3TOL A;  1YZA A;  3QVZ A;  1M6T A;  2XLV A;  3U8P A;  4CJO A;  3M15 A;  1CGN A;  2XLD A;  4CIP A;  4CDA A;  1CPQ A;  1S05 A;  5B3I A;  3C63 A;  3QW0 A;  256B A;  1CPR A;  2XLE A;  1CGO A;  1GQA A;  4CDY A;  3L1M A;  3ZQY A;  3QW1 A;  5AGF A;  1E85 A;  3IQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...