3K33A

Crystal structure of the phd-doc complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
124
structure length
124
Chain Sequence
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSALLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death on curing protein
publication title Allostery and intrinsic disorder mediate transcription regulation by conditional cooperativity.
pubmed doi rcsb
source organism Enterobacteria phage p1
molecule tags Toxin/antitoxin
total genus 47
structure length 124
sequence length 124
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1870 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3k33A00
3KH2A 3K33A 3DD7A
chains in the Genus database with same CATH superfamily
4YWQA 3EZIA 4IARA 2AWYA 4E0HA 1MNEA 2A0UA 2C04A 2XLDA 2P7VA 3AGTA 3S28A 4ANJA 1ZVZA 4F4BA 1B68A 5COFA 4OIOF 5T3WA 2R7UA 1RKEA 5GPGB 3NRHA 1Q0GA 1S7ZA 4N4WA 1EQ1A 1ZHXA 1XZQA 3SXYA 2EPMX 4EWCA 2BE5F 4C7OB 1WWPA 5JS5A 4X0RA 4UDVA 3WG7C 3LEVA 5EGYA 1VLTA 5E3AA 2YQYA 3Q6NA 2ZXRA 3RYLA 3ASOC 1NU7D 3B0PA 1JAFA 3C8ZA 4M63A 4YT5A 2OQMA 3TJ5A 3C18A 3UMIA 2X51A 1VB5A 4AL1A 3LLIA 2J9VA 2LP4A 4NTBA 3WHNA 2ZD9A 1I4YA 1WGWA 1T6UA 2XM0A 2YEVA 3LS0A 4B6IA 2KJGA 1BZ4A 1D0YA 5A69A 2H8AA 3NMIA 2WVNA 4U5EE 4N6HA 1ZU5A 2Y3GA 2NUPB 5D92A 3KPHA 4PJJA 1LS1A 5JSLA 4KI2A 3NMJA 2B0HA 1AVOB 4NTFA 2C03A 3ZQYA 3AG1C 3U2LA 1D0XA 2IXOA 4XLPF 3Q7GA 4K0DA 1S05A 2YRFA 4XPYA 2AU5A 1F1MA 3E9VA 1H9TA 3ZTMA 5KYWB 3NMKA 1U6HA 2GDCA 4JC7A 4ULVA 4XPXA 4AL0A 2XRHA 2R02A 3K1IA 2A1DD 5L0CA 2LQGA 4PJNA 1GS9A 3FAPB 2Y39A 4GYTA 4MVQA 4XEFA 3ABLC 3QZCA 1YYXA 3PHF2 2L81A 1GQAA 2G3VA 4OD4A 3DM9B 2OJQA 4C7OA 1M6TA 5L0IA 1T5OA 2HMQA 4YT2A 3EGXB 4PR9A 3SP1A 2R7WA 2R7RA 4RBNA 5FCLA 5EK0A 3PCVA 1OKKD 1L7CA 3TOMA 1Z23A 3HJCA 1QVXA 3WODF 3ZVRA 4EBBA 5EHHA 3HNIA 2DB4A 4YJWA 4KBLA 3I5PA 4AX2A 4MNDA 4QDLA 4OD5A 1K40A 2V3CC 2NUPA 3UGPA 2RSEB 1OCOC 2EIJC 2HS5A 4RD9A 4CBEA 4EKWA 4CDYA 2YL7A 3DJUB 1YLMA 4O79A 1PD0A 4FWVA 2VB6A 2OEVA 3LJBA 1G4WR 4JEBA 1VTMP 4HFFB 1BR1A 2J0WA 4PFPA 2XS8A 3U8PA 2CGEA 3DZAA 4E7SA 3ZC4A 2M64A 1APCA 5L0GA 2WZLA 3KMIA 3PDMP 4DVYP 5COGA 2LIGA 5DVWA 4YN0B 2J9BA 4YL3A 3VAYA 2HJ3A 5CI9A 5KYWA 4GQHA 4G7OF 3DAFA 2A68F 3I5QA 1LI5A 1LVKA 1W2WA 2Y3DA 3T6JA 5DS5A 5DQZA 1KTMA 3H65A 5A6BA 1OW8A 4IWBA 2A6EF 3DKAA 3EGXA 1AUEA 2OOCA 3K1IC 4MVUA 3FDQA 2GA0A 5A6JA 4E17A 1OQCA 3C8GD 3FVYA 5JRAA 1E86A 3EJNA 3W2VA 3LNMB 4G7HF 2FAPB 1JPJA 1XZPA 2XL8A 3C7JA 4Q5SF 1TWAA 2XLVA 1D0ZA 2WZFA 4WABA 2W9YA 1VYKA 4FESA 2P6VA 3ABKC 4JTDB 4KC9A 4LLEA 4DRHB 2VH3A 1OCZC 3DD7A 1GGQA 3IQCA 3EHNA 1YARO 3AQCA 4IB4A 1M2VB 4H4KC 1LM3B 1WTYA 1ZW2A 3U2MA 3UNGC 3I4UA 4CS8A 3CAXA 2J7PD 3NYMA 3WAQA 3OWTA 3UGOA 1RKCA 2MHRA 1TWCA 1IZMA 3CZ6A 2FGYA 3H2VA 1RCPA 3SYNA 1Z6AA 4XLNF 1OR3A 2CW0F 1FMWA 1V4AA 3AQBA 4MTFA 2OKUA 1OXBA 2WVQA 4D4NA 2ZPAA 1DOWA 4MVSA 4U5GA 5F5HA 3QW0A 1O3UA 1XWJA 2NSFA 3N0TA 1TFKB 3AG3C 3Q7LA 3JYHA 3MFNA 4EBKA 3SEOA 3S84A 1NG1A 2CCYA 3G4ZA 3SXMA 2G62A 4O7GA 4IAOA 3V5XA 3N24A 4U9EA 3CQZA 3PMRA 1MNDA 2YWAA 3TQOA 4BEMJ 1Y6DA 3KKBA 4YK5A 1Q0DA 4QI0A 1V54C 2QTVA 4PJLA 4BG0A 2DGJA 1EI7A 4OIRF 2R7SA 2W4BA 5L0HA 2NPUA 1KNYA 2NSGA 1H7IA 4QI2A 2B0JA 2YL0A 1FTSA 4LLCA 3U5SA 2X0CA 3G50A 1M57C 1MQVA 4CJGA 4CIPA 3VF0A 4C3BA 3JCUQ 1BR4A 3SXZA 3B9QA 3TK0A 3IQ5A 1TFOB 1Q0MA 5DLJA 2J45A 2TMVP 4O6NA 1M2VA 2M4EA 3W2WA 5JVEA 1M56C 4LDKA 3SZRA 3BEHA 2ZXWC 1CGME 3B0UX 1HE9A 3DI5A 2R7XA 2R7OA 4JKVA 2HMZA 2BC5A 1AEPA 1E83A 1J8YF 2W4MA 2LFDA 3JSEO 4K7BA 4AK9A 4CS8C 2QY9A 4ZLCA 1VOMA 3FAJA 3B29A 5E33A 1OCRC 2OG2A 1PV3A 5L3QA 3MYFA 3R7CA 1NZEA 5L0JA 2VASA 2Q9CA 3CEXA 3U0CA 3UMKA 3MBGA 5B3SC 4CIHA 1UFBA 2R7TA 3AJMA 2PFDA 3F47A 3L34A 2I15A 1E84A 2HSBA 2Q3TA 3DXJF 1I5NA 4H54A 4KNVA 1HW2A 1Y4CA 1JPNA 1G8XA 4JE9A 3M1CB 4DRJB 3DE9A 4BJTA 1D1AA 1ZYRF 2AWCA 2J9UA 1NBBA 2BL2A 4P9TA 3U3BA 3TOLA 4DRIB 4U9DA 5HSWA 1C02A 1Z7Qc 3M15A 2PX0A 5D91A 3GEEA 2H7VC 1J8MF 4MTOA 1UG7A 1BR2A 2F22A 1ST6A 3ITFA 4JJGA 4CDVA 1YDIA 3QVZA 4XEVA 1RJ9B 4Q7CA 2A69F 3GM1A 1MMDA 4U5HA 4C3DA 2V26A 3AOUA 1ORYA 2IOQA 2KW3C 2I8BA 3DAGA 1V74B 1H6GA 5E3CA 4ONSA 4D4XA 3JZ0A 1FMVA 1O5HA 2PP4A 2YL1A 4OIQF 5FZTA 3QTHA 2YLGA 3OA1A 1YAUO 4HEAJ 4G78A 2XLHA 2A0BA 3NKDA 3QW1A 3JT1A 4W8PA 3ZG1A 2IYLD 1OCCC 2PF4E 1VK5A 3O10A 1GM5A 1OW6A 4XEKA 4CS9A 2P61A 4JVSA 2KSFA 2YZSA 2E87A 1LKXA 1JOGA 1T01A 3LNRA 2ASRA 2OCCC 4NCQA 2O9XA 1SMYF 3DMDA 3QMKA 5F28E 1WOLA 1CPQA 4MVOA 4MVMA 3VM6A 3RQGA 1JRAA 1TWHA 4YT8A 3FXHA 1ZZPA 4JCHA 2R7VA 2DYSC 2NUTB 3AG4C 5IY5C 4JCZA 2XL6A 3RF3A 3M4BA 2WB7A 256BA 3K66A 4NTAA 2HV7A 3ASNC 3IQ6A 1QLEC 5HV9A 3LEOA 1LE2A 2CYDA 4LDQA 3V5ZA 1RJ9A 1RXQA 2QUPA 4O6YA 2J8WA 4AE4B 3NDBB 3EHMA 5K0IA 2L6GA 3RKOF 2HFIA 4NQFA 5L0DA 3IHUA 2VCAA 3A9CA 3HTKC 1FFTC 4I3MA 4A4AA 1FFHA 5BQIA 4FX5A 4K1OA 4JEAA 2QNLA 4MTGA 2A6HF 1K04A 4JIOA 2R7QA 2HKVA 4ER9A 3E70C 1KU2A 1SZIA 3GM2A 3KH2A 1IW7F 2CNWD 3CSKA 4JTAB 2J0XA 2KC3A 5CI8A 3L1MA 1FAPB 3C63A 3U3FA 1TR2A 4G7ZF 3JRTA 4MW8A 1FNTc 2R03A 5L3VA 5BQHA 1CGNA 2IBFA 1QZXA 1YJGA 1E2XA 1TKNA 3ZDLA 4CS9C 1Z5ZA 2JD3A 2QE9A 5AC5A 3T9OA 5AGFA 5AC4A 1A0BA 4XQ1A 3TJ6A 4LACB 2P1AA 2NUTA 1BBHA 2WL8A 3G4XA 3K1HA 3RVYA 4C3EA 3AG2C 4U5BE 2HV6A 3ECSA 4GEHA 1MMGA 3RVZA 1ZHWA 2PNOA 4XPWA 4DVZA 5JLIA 4P9FA 2XLMA 3V5YA 4J30B 3U8VA 3DM5A 1NSGB 3KYJA 2R25A 4AE4A 1A7VA 3A11A 4YL1A 2GAQA 2PBEA 2PX3A 3FMSA 3VYWA 5A6KA 1T6QA 3EFOB 3LLKA 1FR0A 1OW7A 4EHPA 2R9RB 5JP7A 4BPMA 1ZHZA 2UUIA 2EILC 1BDJB 2FFHA 4CX9A 4Z9JA 2EPKX 4DXWA 2HSQA 1PCXA 3M79A 3X2QC 2DYRC 3O39A 3GM3A 3EH1A 3S29A 1T6IA 2H7OA 3EGDB 2EPOA 4I44A 4PACA 4BEJA 3BRJA 3W4YA 2IXNA 2UUHA 4Z9IA 4WGYA 4O6MA 1C17M 1ZHYA 3JTLO 4OIPF 1ORJA 1ZU4A 4BJ5A 2XSEA 4KNWA 2EPLX 3LS1A 4L6RA 1ZW3A 1A7DA 1QQ3A 3T4RA 3W8IA 4Z9HA 5JT4A 5A6AA 3SNHA 4PFOA 3US6A 3HKKA 4ULWA 5COMA 3ATPA 3ZQVA 4IGGA 3EG9B 1NLXA 2NG1A 2VCBA 4MS2A 3GANA 1YVIA 3S27A 2GWWA 5KYNA 1SR2A 3TULA 2KNHA 2IXPA 2H7BA 3EH2A 4CJOA 2LCHA 1LS4A 5T1DB 3M4CA 3B0VC 1O87A 3KL4A 1V55C 4WGZA 2XLOA 2Q4FA 3RFYA 1LIHA 2LK4A 2D4UA 3POVA 3C62A 1JR8A 1WASA 2Y69C 3HLZA 4JJFA 3U9MA 3VRCA 1QSPA 3EQLF 1YYJA 3W8HA 3ZTZA 3EFOA 4NC3A 4JURI 4DBRA 1CGOA 3JYYA 4JTCB 2R05A 2Y3HA 3S0XA 4ZLDA 1PD1A 3K33A 2MYSA 3K7DA 4HFKB 4MQ9F 3C8GB 2ETSA 3S90A 1WN0A 1OKKA 3RIPA 1G4US 1SYQA 4J32B 1HMOA 4RDAA 2J9WA 3EGDA 3HNJA 5F5FA 2Q7RA 4R32A 4YT4A 5DS6A 4CSAC 4IJJA 2DI3A 3O6XA 1K05A 4LERA 1A41A 1YZCA 4IAQA 3F46A 4MVRA 1U0BB 3FOOA 2W45A 1OR2A 2Z15A 2YLDA 2HZ8A 3QVYA 3RW0A 1HE1A 3B71A 3EG9A 2EPNA 5B1BC 4BJ5C 3EPVA 1EKYA 2YL3A 1EA8A 5E2QA 2L9JA 2L6FA 3IPMO 3LESA 5KYXB 4JW1A 1TWGA 3RQFA 2KGOA 2OEXA 3O55A 4J7YA 4P6IC 2EIKC 2KQ9A 4PK4A 2ZXPA 5KYUB 2XXAB 3FHDA 4FAPB 4I1MA 3DJNB 4NY3A 3HNKA 4W8KA 2WZGA 2YLIA 1YA9A 4N06A 3IEEA 4BJ1A 4E18A 2Q9BA 2D5RB 3MX3A 2XLWA 4DJ9A 2IXMA 4E7ZA 4LDRA 1ZHTA 2P0NA 3IQTA 5T3TA 4WJ0A 2AVKA 3RQEA 3GWNA 1G5ZA 4BJ6A 3UMHA 3C8GA 3T6BA 2QLAA 1HY5A 1H9GA 2YHSA 3ZWIA 3RH3A 2HUJA 1U89A 1RMVA 1YZAA 4IRUA 4E0IA 4MW3A 3GORA 4YL0A 3R2PA 4CS7A 2Q00A 3TD7A 5TJ5E 4JZAA 4EUKB 2XM4A 1I4ZA 2CNWA 1M2OA 4PJMA 3ZIBA 4JRZA 1QKRA 1HW1A 5DQTA 3NYJA 4A2NB 3GEHA 2XL4A 3UR3C 5KYYB 5BQGA 2J7PA 2OU6A 1VLSA 3OEOA 4Q4ZF 3HNLA 1D1BA 3MYIA 3SXKA 3DE8A 3L0IA 2L7AA 4XWJA 4EBJA 5KYXA 3K6BA 2RD9A 2ICWG 1C03A 2J46A 2YKZA 3JSZA 5KYUA 5JUAA 2XXAA 1JMWA 1R4TA 2ZXOA 4OINF 2XS1A 3LAYA 4DBQA 4N6CA 1Z63A 2HJMA 1LPEA 1RKEB 2LFFA 2VC9A 4U5CE 5DS4A 5BUOA 5A6BD 1Q0FA 3GWLA 4J7TA 2EIMC 2WVOA 3V7OA 3FOPA 3ZSUA 2Y3BA 5B1AC 3DWWA 1NFOA 3JRMO 3J06A 1VYIA 1MMNA 2KYHA 1Z3IX 4XTKA 5CIVA 1WATA 1Q0KA 2GFHA 3GEIA 4EIYA 1T9KA 3AGUA 2LSEA 2JPUA 1L3PA 1DOVA 1MMAA 1N1CA 3LUTB 1ORSC 1LI7A 1NFNA 2G3KA 2IM8A 2LD6A 3KYIA 2CDQA 2AP3A 2MWQA 3Q6MA 2JX0A 1YA7O 3H2UA 4BJ6C 1OXKA 1QPUA 1SF8A 3MLGA 2XLEA 1R5ID 3L8IA 4G0HA 3X1OA 1A7EA 4DOZA 1NU9C 4U5DE 2YVKA 5B3IA 1CPRA 4CSAA 1TQGA 5L0FA 5KYYA 1E85A 1VMAA 4CDAA 3NYLA 2OJED 3NG1A 2Q9AA 2L6HA 3ABMC 4HE8D 4MVZA 3EZHA 2VCCA 1LE4A 3U9JA 1D1CA 3N2ZB 4U5FE 3S9OA 3L8JA 3T6GB 2EINC 3GODA 3NKEA 4I1OB 1HMDA 2KK1A
chains in the Genus database with same CATH topology
4YWQA 3EZIA 1MNEA 2C04A 3S28A 2P7VA 4ANJA 4F4BA 4OIOF 5T3WA 2R7UA 3NRHA 1S7ZA 1ZHXA 4EWCA 2BE5F 4C7OB 4X0RA 3WG7C 3LEVA 5EGYA 5E3AA 3Q6NA 2ZXRA 3RYLA 3ASOC 1NU7D 3B0PA 4M63A 4YT5A 3UMIA 2X51A 3LLIA 2J9VA 1WGWA 3LS0A 2YEVA 4B6IA 2KJGA 1D0YA 2WVNA 4U5EE 1ZU5A 2Y3GA 2NUPB 5D92A 4PJJA 1LS1A 4KI2A 2C03A 3AG1C 1D0XA 2IXOA 4XLPF 3Q7GA 4K0DA 3E9VA 5KYWB 2XRHA 2A1DD 4PJNA 2Y39A 4GYTA 3ABLC 3QZCA 3PHF2 2L81A 2G3VA 4OD4A 3DM9B 4C7OA 4YT2A 3EGXB 3SP1A 2R7WA 2R7RA 4RBNA 5FCLA 1OKKD 1Z23A 3HJCA 3WODF 3ZVRA 4EBBA 5EHHA 4YJWA 4KBLA 3I5PA 4AX2A 4MNDA 4QDLA 4OD5A 2V3CC 2NUPA 3UGPA 4CBEA 1OCOC 2EIJC 4RD9A 3DJUB 4O79A 1PD0A 4FWVA 2VB6A 3LJBA 4HFFB 1BR1A 2J0WA 4PFPA 2CGEA 3DZAA 4E7SA 3ZC4A 2WZLA 3KMIA 4DVYP 5DVWA 4YN0B 3VAYA 5CI9A 5KYWA 4G7OF 3DAFA 2A68F 3I5QA 1LVKA 1W2WA 2Y3DA 3T6JA 5DS5A 5DQZA 3H65A 4IWBA 2A6EF 3EGXA 3K1IC 3FVYA 3EJNA 3W2VA 4G7HF 1JPJA 4Q5SF 1TWAA 1D0ZA 2WZFA 2W9YA 1VYKA 4FESA 2P6VA 3ABKC 4KC9A 4LLEA 2VH3A 1OCZC 3DD7A 3EHNA 3AQCA 1M2VB 4H4KC 3UNGC 4CS8A 3I4UA 2J7PD 3NYMA 3OWTA 3UGOA 1TWCA 1IZMA 3CZ6A 2FGYA 3SYNA 1Z6AA 4XLNF 2CW0F 1FMWA 3AQBA 2WVQA 2ZPAA 5F5HA 4U5GA 3N0TA 3Q7LA 3AG3C 3JYHA 3SEOA 1NG1A 2G62A 4O7GA 4IAOA 3N24A 3CQZA 3PMRA 1MNDA 3KKBA 4QI0A 1V54C 2QTVA 4PJLA 4BG0A 2DGJA 4OIRF 2R7SA 2W4BA 4QI2A 2B0JA 4LLCA 1FTSA 1M57C 4C3BA 3JCUQ 1BR4A 3B9QA 5DLJA 2J45A 4O6NA 1M2VA 2M4EA 3W2WA 1M56C 3SZRA 2ZXWC 3B0UX 2R7XA 2R7OA 1J8YF 2W4MA 4K7BA 4CS8C 4AK9A 2QY9A 4ZLCA 1VOMA 3FAJA 5E33A 1OCRC 2OG2A 5L3QA 1NZEA 2VASA 2Q9CA 3UMKA 5B3SC 4CIHA 2R7TA 2PFDA 3F47A 3L34A 2Q3TA 3DXJF 4KNVA 1JPNA 1G8XA 3M1CB 4BJTA 1D1AA 1ZYRF 2J9UA 5HSWA 2PX0A 5D91A 2H7VC 1J8MF 4JJGA 1BR2A 1ST6A 3ITFA 4C3DA 1RJ9B 4Q7CA 2A69F 4U5HA 1MMDA 2V26A 2IOQA 2KW3C 2I8BA 3DAGA 5E3CA 1FMVA 1O5HA 2PP4A 4OIQF 3OA1A 4HEAJ 3NKDA 3JT1A 3ZG1A 2IYLD 1OCCC 2PF4E 1VK5A 4CS9A 4JVSA 2YZSA 2E87A 1LKXA 3LNRA 2OCCC 2O9XA 3DMDA 1SMYF 3QMKA 1TWHA 4YT8A 4JCHA 2R7VA 2DYSC 2NUTB 3AG4C 5IY5C 2WB7A 3K66A 2HV7A 3ASNC 1QLEC 1RJ9A 4O6YA 4AE4B 3NDBB 3EHMA 3RKOF 3HTKC 1FFTC 4I3MA 1FFHA 4FX5A 2A6HF 2R7QA 3E70C 1KU2A 1SZIA 3KH2A 1IW7F 2CNWD 3CSKA 2J0XA 5CI8A 4G7ZF 1TR2A 3JRTA 5L3VA 1QZXA 1TKNA 4CS9C 1Z5ZA 2JD3A 4LACB 2NUTA 2WL8A 3K1HA 4C3EA 3AG2C 4U5BE 2HV6A 3ECSA 4GEHA 1MMGA 1ZHWA 4DVZA 4J30B 3DM5A 4AE4A 2PX3A 3VYWA 3EFOB 3LLKA 1ZHZA 2EILC 2FFHA 1PCXA 3X2QC 2DYRC 3O39A 3S29A 3EH1A 2H7OA 3EGDB 4I44A 4BEJA 2IXNA 4O6MA 1ZHYA 4OIPF 1ZU4A 4BJ5A 2XSEA 4KNWA 3LS1A 3T4RA 3W8IA 3SNHA 4PFOA 4ULWA 3EG9B 2NG1A 3GANA 3S27A 5KYNA 2KNHA 2IXPA 2H7BA 3EH2A 5T1DB 3B0VC 1O87A 3KL4A 1V55C 3RFYA 3POVA 2Y69C 3HLZA 4JJFA 3EQLF 3W8HA 4DBRA 3EFOA 4JURI 2Y3HA 3S0XA 4ZLDA 1PD1A 3K7DA 3K33A 2MYSA 4HFKB 4MQ9F 3RIPA 1OKKA 4J32B 4RDAA 2J9WA 3EGDA 5F5FA 4YT4A 5DS6A 4CSAC 4IJJA 3O6XA 4LERA 3F46A 2W45A 2Z15A 3EG9A 5B1BC 4BJ5C 3EPVA 5E2QA 2L9JA 3LESA 5KYXB 4JW1A 1TWGA 2KGOA 4P6IC 2EIKC 2KQ9A 4PK4A 2ZXPA 5KYUB 2XXAB 3FHDA 4I1MA 3DJNB 4NY3A 4W8KA 2WZGA 4N06A 4BJ1A 3IEEA 2Q9BA 2D5RB 3MX3A 2IXMA 4E7ZA 1ZHTA 5T3TA 4WJ0A 4BJ6A 3UMHA 3T6BA 2YHSA 3RH3A 4IRUA 4CS7A 3TD7A 4JZAA 2CNWA 1M2OA 4PJMA 3ZIBA 5DQTA 3NYJA 2XL4A 3UR3C 5KYYB 2J7PA 3OEOA 4Q4ZF 1D1BA 3L0IA 4XWJA 5KYXA 3K6BA 2XXAA 3JSZA 2J46A 5KYUA 2ZXOA 4OINF 3LAYA 4DBQA 1Z63A 4U5CE 5DS4A 5BUOA 3FDQA 3ZSUA 2EIMC 2WVOA 3V7OA 2Y3BA 5B1AC 1VYIA 1MMNA 4XTKA 1Z3IX 2GFHA 2LSEA 1MMAA 1N1CA 4A2NB 2G3KA 3Q6MA 2CDQA 2MWQA 4BJ6C 1SF8A 3MLGA 3X1OA 4G0HA 4DOZA 1NU9C 4U5DE 4CSAA 5KYYA 1VMAA 3NYLA 3NG1A 2Q9AA 3ABMC 4HE8D 3EZHA 1D1CA 3N2ZB 4U5FE 2EINC 3GODA 3NKEA 4I1OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KH2 A;  3K33 A;  3DD7 A; 
#chains in the Genus database with same CATH topology
 4YWQ A;  3EZI A;  4IAR A;  2AWY A;  4E0H A;  1MNE A;  2A0U A;  2C04 A;  2XLD A;  2P7V A;  3AGT A;  3S28 A;  4ANJ A;  1ZVZ A;  4F4B A;  1B68 A;  5COF A;  4OIO F;  5T3W A;  2R7U A;  1RKE A;  5GPG B;  3NRH A;  1Q0G A;  1S7Z A;  4N4W A;  1EQ1 A;  1ZHX A;  1XZQ A;  3SXY A;  2EPM X;  4EWC A;  2BE5 F;  4C7O B;  1WWP A;  5JS5 A;  4X0R A;  4UDV A;  3WG7 C;  3LEV A;  5EGY A;  1VLT A;  5E3A A;  2YQY A;  3Q6N A;  2ZXR A;  3RYL A;  3ASO C;  1NU7 D;  3B0P A;  1JAF A;  3C8Z A;  4M63 A;  4YT5 A;  2OQM A;  3TJ5 A;  3C18 A;  3UMI A;  2X51 A;  1VB5 A;  4AL1 A;  3LLI A;  2J9V A;  2LP4 A;  4NTB A;  3WHN A;  2ZD9 A;  1I4Y A;  1WGW A;  1T6U A;  2XM0 A;  2YEV A;  3LS0 A;  4B6I A;  2KJG A;  1BZ4 A;  1D0Y A;  5A69 A;  2H8A A;  3NMI A;  2WVN A;  4U5E E;  4N6H A;  1ZU5 A;  2Y3G A;  2NUP B;  5D92 A;  3KPH A;  4PJJ A;  1LS1 A;  5JSL A;  4KI2 A;  3NMJ A;  2B0H A;  1AVO B;  4NTF A;  2C03 A;  3ZQY A;  3AG1 C;  3U2L A;  1D0X A;  2IXO A;  4XLP F;  3Q7G A;  4K0D A;  1S05 A;  2YRF A;  4XPY A;  2AU5 A;  1F1M A;  3E9V A;  1H9T A;  3ZTM A;  5KYW B;  3NMK A;  1U6H A;  2GDC A;  4JC7 A;  4ULV A;  4XPX A;  4AL0 A;  2XRH A;  2R02 A;  3K1I A;  2A1D D;  5L0C A;  2LQG A;  4PJN A;  1GS9 A;  3FAP B;  2Y39 A;  4GYT A;  4MVQ A;  4XEF A;  3ABL C;  3QZC A;  1YYX A;  3PHF 2;  2L81 A;  1GQA A;  2G3V A;  4OD4 A;  3DM9 B;  2OJQ A;  4C7O A;  1M6T A;  5L0I A;  1T5O A;  2HMQ A;  4YT2 A;  3EGX B;  4PR9 A;  3SP1 A;  2R7W A;  2R7R A;  4RBN A;  5FCL A;  5EK0 A;  3PCV A;  1OKK D;  1L7C A;  3TOM A;  1Z23 A;  3HJC A;  1QVX A;  3WOD F;  3ZVR A;  4EBB A;  5EHH A;  3HNI A;  2DB4 A;  4YJW A;  4KBL A;  3I5P A;  4AX2 A;  4MND A;  4QDL A;  4OD5 A;  1K40 A;  2V3C C;  2NUP A;  3UGP A;  2RSE B;  1OCO C;  2EIJ C;  2HS5 A;  4RD9 A;  4CBE A;  4EKW A;  4CDY A;  2YL7 A;  3DJU B;  1YLM A;  4O79 A;  1PD0 A;  4FWV A;  2VB6 A;  2OEV A;  3LJB A;  1G4W R;  4JEB A;  1VTM P;  4HFF B;  1BR1 A;  2J0W A;  4PFP A;  2XS8 A;  3U8P A;  2CGE A;  3DZA A;  4E7S A;  3ZC4 A;  2M64 A;  1APC A;  5L0G A;  2WZL A;  3KMI A;  3PDM P;  4DVY P;  5COG A;  2LIG A;  5DVW A;  4YN0 B;  2J9B A;  4YL3 A;  3VAY A;  2HJ3 A;  5CI9 A;  5KYW A;  4GQH A;  4G7O F;  3DAF A;  2A68 F;  3I5Q A;  1LI5 A;  1LVK A;  1W2W A;  2Y3D A;  3T6J A;  5DS5 A;  5DQZ A;  1KTM A;  3H65 A;  5A6B A;  1OW8 A;  4IWB A;  2A6E F;  3DKA A;  3EGX A;  1AUE A;  2OOC A;  3K1I C;  4MVU A;  3FDQ A;  2GA0 A;  5A6J A;  4E17 A;  1OQC A;  3C8G D;  3FVY A;  5JRA A;  1E86 A;  3EJN A;  3W2V A;  3LNM B;  4G7H F;  2FAP B;  1JPJ A;  1XZP A;  2XL8 A;  3C7J A;  4Q5S F;  1TWA A;  2XLV A;  1D0Z A;  2WZF A;  4WAB A;  2W9Y A;  1VYK A;  4FES A;  2P6V A;  3ABK C;  4JTD B;  4KC9 A;  4LLE A;  4DRH B;  2VH3 A;  1OCZ C;  3DD7 A;  1GGQ A;  3IQC A;  3EHN A;  1YAR O;  3AQC A;  4IB4 A;  1M2V B;  4H4K C;  1LM3 B;  1WTY A;  1ZW2 A;  3U2M A;  3UNG C;  3I4U A;  4CS8 A;  3CAX A;  2J7P D;  3NYM A;  3WAQ A;  3OWT A;  3UGO A;  1RKC A;  2MHR A;  1TWC A;  1IZM A;  3CZ6 A;  2FGY A;  3H2V A;  1RCP A;  3SYN A;  1Z6A A;  4XLN F;  1OR3 A;  2CW0 F;  1FMW A;  1V4A A;  3AQB A;  4MTF A;  2OKU A;  1OXB A;  2WVQ A;  4D4N A;  2ZPA A;  1DOW A;  4MVS A;  4U5G A;  5F5H A;  3QW0 A;  1O3U A;  1XWJ A;  2NSF A;  3N0T A;  1TFK B;  3AG3 C;  3Q7L A;  3JYH A;  3MFN A;  4EBK A;  3SEO A;  3S84 A;  1NG1 A;  2CCY A;  3G4Z A;  3SXM A;  2G62 A;  4O7G A;  4IAO A;  3V5X A;  3N24 A;  4U9E A;  3CQZ A;  3PMR A;  1MND A;  2YWA A;  3TQO A;  4BEM J;  1Y6D A;  3KKB A;  4YK5 A;  1Q0D A;  4QI0 A;  1V54 C;  2QTV A;  4PJL A;  4BG0 A;  2DGJ A;  1EI7 A;  4OIR F;  2R7S A;  2W4B A;  5L0H A;  2NPU A;  1KNY A;  2NSG A;  1H7I A;  4QI2 A;  2B0J A;  2YL0 A;  1FTS A;  4LLC A;  3U5S A;  2X0C A;  3G50 A;  1M57 C;  1MQV A;  4CJG A;  4CIP A;  3VF0 A;  4C3B A;  3JCU Q;  1BR4 A;  3SXZ A;  3B9Q A;  3TK0 A;  3IQ5 A;  1TFO B;  1Q0M A;  5DLJ A;  2J45 A;  2TMV P;  4O6N A;  1M2V A;  2M4E A;  3W2W A;  5JVE A;  1M56 C;  4LDK A;  3SZR A;  3BEH A;  2ZXW C;  1CGM E;  3B0U X;  1HE9 A;  3DI5 A;  2R7X A;  2R7O A;  4JKV A;  2HMZ A;  2BC5 A;  1AEP A;  1E83 A;  1J8Y F;  2W4M A;  2LFD A;  3JSE O;  4K7B A;  4AK9 A;  4CS8 C;  2QY9 A;  4ZLC A;  1VOM A;  3FAJ A;  3B29 A;  5E33 A;  1OCR C;  2OG2 A;  1PV3 A;  5L3Q A;  3MYF A;  3R7C A;  1NZE A;  5L0J A;  2VAS A;  2Q9C A;  3CEX A;  3U0C A;  3UMK A;  3MBG A;  5B3S C;  4CIH A;  1UFB A;  2R7T A;  3AJM A;  2PFD A;  3F47 A;  3L34 A;  2I15 A;  1E84 A;  2HSB A;  2Q3T A;  3DXJ F;  1I5N A;  4H54 A;  4KNV A;  1HW2 A;  1Y4C A;  1JPN A;  1G8X A;  4JE9 A;  3M1C B;  4DRJ B;  3DE9 A;  4BJT A;  1D1A A;  1ZYR F;  2AWC A;  2J9U A;  1NBB A;  2BL2 A;  4P9T A;  3U3B A;  3TOL A;  4DRI B;  4U9D A;  5HSW A;  1C02 A;  1Z7Q c;  3M15 A;  2PX0 A;  5D91 A;  3GEE A;  2H7V C;  1J8M F;  4MTO A;  1UG7 A;  1BR2 A;  2F22 A;  1ST6 A;  3ITF A;  4JJG A;  4CDV A;  1YDI A;  3QVZ A;  4XEV A;  1RJ9 B;  4Q7C A;  2A69 F;  3GM1 A;  1MMD A;  4U5H A;  4C3D A;  2V26 A;  3AOU A;  1ORY A;  2IOQ A;  2KW3 C;  2I8B A;  3DAG A;  1V74 B;  1H6G A;  5E3C A;  4ONS A;  4D4X A;  3JZ0 A;  1FMV A;  1O5H A;  2PP4 A;  2YL1 A;  4OIQ F;  5FZT A;  3QTH A;  2YLG A;  3OA1 A;  1YAU O;  4HEA J;  4G78 A;  2XLH A;  2A0B A;  3NKD A;  3QW1 A;  3JT1 A;  4W8P A;  3ZG1 A;  2IYL D;  1OCC C;  2PF4 E;  1VK5 A;  3O10 A;  1GM5 A;  1OW6 A;  4XEK A;  4CS9 A;  2P61 A;  4JVS A;  2KSF A;  2YZS A;  2E87 A;  1LKX A;  1JOG A;  1T01 A;  3LNR A;  2ASR A;  2OCC C;  4NCQ A;  2O9X A;  1SMY F;  3DMD A;  3QMK A;  5F28 E;  1WOL A;  1CPQ A;  4MVO A;  4MVM A;  3VM6 A;  3RQG A;  1JRA A;  1TWH A;  4YT8 A;  3FXH A;  1ZZP A;  4JCH A;  2R7V A;  2DYS C;  2NUT B;  3AG4 C;  5IY5 C;  4JCZ A;  2XL6 A;  3RF3 A;  3M4B A;  2WB7 A;  256B A;  3K66 A;  4NTA A;  2HV7 A;  3ASN C;  3IQ6 A;  1QLE C;  5HV9 A;  3LEO A;  1LE2 A;  2CYD A;  4LDQ A;  3V5Z A;  1RJ9 A;  1RXQ A;  2QUP A;  4O6Y A;  2J8W A;  4AE4 B;  3NDB B;  3EHM A;  5K0I A;  2L6G A;  3RKO F;  2HFI A;  4NQF A;  5L0D A;  3IHU A;  2VCA A;  3A9C A;  3HTK C;  1FFT C;  4I3M A;  4A4A A;  1FFH A;  5BQI A;  4FX5 A;  4K1O A;  4JEA A;  2QNL A;  4MTG A;  2A6H F;  1K04 A;  4JIO A;  2R7Q A;  2HKV A;  4ER9 A;  3E70 C;  1KU2 A;  1SZI A;  3GM2 A;  3KH2 A;  1IW7 F;  2CNW D;  3CSK A;  4JTA B;  2J0X A;  2KC3 A;  5CI8 A;  3L1M A;  1FAP B;  3C63 A;  3U3F A;  1TR2 A;  4G7Z F;  3JRT A;  4MW8 A;  1FNT c;  2R03 A;  5L3V A;  5BQH A;  1CGN A;  2IBF A;  1QZX A;  1YJG A;  1E2X A;  1TKN A;  3ZDL A;  4CS9 C;  1Z5Z A;  2JD3 A;  2QE9 A;  5AC5 A;  3T9O A;  5AGF A;  5AC4 A;  1A0B A;  4XQ1 A;  3TJ6 A;  4LAC B;  2P1A A;  2NUT A;  1BBH A;  2WL8 A;  3G4X A;  3K1H A;  3RVY A;  4C3E A;  3AG2 C;  4U5B E;  2HV6 A;  3ECS A;  4GEH A;  1MMG A;  3RVZ A;  1ZHW A;  2PNO A;  4XPW A;  4DVZ A;  5JLI A;  4P9F A;  2XLM A;  3V5Y A;  4J30 B;  3U8V A;  3DM5 A;  1NSG B;  3KYJ A;  2R25 A;  4AE4 A;  1A7V A;  3A11 A;  4YL1 A;  2GAQ A;  2PBE A;  2PX3 A;  3FMS A;  3VYW A;  5A6K A;  1T6Q A;  3EFO B;  3LLK A;  1FR0 A;  1OW7 A;  4EHP A;  2R9R B;  5JP7 A;  4BPM A;  1ZHZ A;  2UUI A;  2EIL C;  1BDJ B;  2FFH A;  4CX9 A;  4Z9J A;  2EPK X;  4DXW A;  2HSQ A;  1PCX A;  3M79 A;  3X2Q C;  2DYR C;  3O39 A;  3GM3 A;  3EH1 A;  3S29 A;  1T6I A;  2H7O A;  3EGD B;  2EPO A;  4I44 A;  4PAC A;  4BEJ A;  3BRJ A;  3W4Y A;  2IXN A;  2UUH A;  4Z9I A;  4WGY A;  4O6M A;  1C17 M;  1ZHY A;  3JTL O;  4OIP F;  1ORJ A;  1ZU4 A;  4BJ5 A;  2XSE A;  4KNW A;  2EPL X;  3LS1 A;  4L6R A;  1ZW3 A;  1A7D A;  1QQ3 A;  3T4R A;  3W8I A;  4Z9H A;  5JT4 A;  5A6A A;  3SNH A;  4PFO A;  3US6 A;  3HKK A;  4ULW A;  5COM A;  3ATP A;  3ZQV A;  4IGG A;  3EG9 B;  1NLX A;  2NG1 A;  2VCB A;  4MS2 A;  3GAN A;  1YVI A;  3S27 A;  2GWW A;  5KYN A;  1SR2 A;  3TUL A;  2KNH A;  2IXP A;  2H7B A;  3EH2 A;  4CJO A;  2LCH A;  1LS4 A;  5T1D B;  3M4C A;  3B0V C;  1O87 A;  3KL4 A;  1V55 C;  4WGZ A;  2XLO A;  2Q4F A;  3RFY A;  1LIH A;  2LK4 A;  2D4U A;  3POV A;  3C62 A;  1JR8 A;  1WAS A;  2Y69 C;  3HLZ A;  4JJF A;  3U9M A;  3VRC A;  1QSP A;  3EQL F;  1YYJ A;  3W8H A;  3ZTZ A;  3EFO A;  4NC3 A;  4JUR I;  4DBR A;  1CGO A;  3JYY A;  4JTC B;  2R05 A;  2Y3H A;  3S0X A;  4ZLD A;  1PD1 A;  3K33 A;  2MYS A;  3K7D A;  4HFK B;  4MQ9 F;  3C8G B;  2ETS A;  3S90 A;  1WN0 A;  1OKK A;  3RIP A;  1G4U S;  1SYQ A;  4J32 B;  1HMO A;  4RDA A;  2J9W A;  3EGD A;  3HNJ A;  5F5F A;  2Q7R A;  4R32 A;  4YT4 A;  5DS6 A;  4CSA C;  4IJJ A;  2DI3 A;  3O6X A;  1K05 A;  4LER A;  1A41 A;  1YZC A;  4IAQ A;  3F46 A;  4MVR A;  1U0B B;  3FOO A;  2W45 A;  1OR2 A;  2Z15 A;  2YLD A;  2HZ8 A;  3QVY A;  3RW0 A;  1HE1 A;  3B71 A;  3EG9 A;  2EPN A;  5B1B C;  4BJ5 C;  3EPV A;  1EKY A;  2YL3 A;  1EA8 A;  5E2Q A;  2L9J A;  2L6F A;  3IPM O;  3LES A;  5KYX B;  4JW1 A;  1TWG A;  3RQF A;  2KGO A;  2OEX A;  3O55 A;  4J7Y A;  4P6I C;  2EIK C;  2KQ9 A;  4PK4 A;  2ZXP A;  5KYU B;  2XXA B;  3FHD A;  4FAP B;  4I1M A;  3DJN B;  4NY3 A;  3HNK A;  4W8K A;  2WZG A;  2YLI A;  1YA9 A;  4N06 A;  3IEE A;  4BJ1 A;  4E18 A;  2Q9B A;  2D5R B;  3MX3 A;  2XLW A;  4DJ9 A;  2IXM A;  4E7Z A;  4LDR A;  1ZHT A;  2P0N A;  3IQT A;  5T3T A;  4WJ0 A;  2AVK A;  3RQE A;  3GWN A;  1G5Z A;  4BJ6 A;  3UMH A;  3C8G A;  3T6B A;  2QLA A;  1HY5 A;  1H9G A;  2YHS A;  3ZWI A;  3RH3 A;  2HUJ A;  1U89 A;  1RMV A;  1YZA A;  4IRU A;  4E0I A;  4MW3 A;  3GOR A;  4YL0 A;  3R2P A;  4CS7 A;  2Q00 A;  3TD7 A;  5TJ5 E;  4JZA A;  4EUK B;  2XM4 A;  1I4Z A;  2CNW A;  1M2O A;  4PJM A;  3ZIB A;  4JRZ A;  1QKR A;  1HW1 A;  5DQT A;  3NYJ A;  4A2N B;  3GEH A;  2XL4 A;  3UR3 C;  5KYY B;  5BQG A;  2J7P A;  2OU6 A;  1VLS A;  3OEO A;  4Q4Z F;  3HNL A;  1D1B A;  3MYI A;  3SXK A;  3DE8 A;  3L0I A;  2L7A A;  4XWJ A;  4EBJ A;  5KYX A;  3K6B A;  2RD9 A;  2ICW G;  1C03 A;  2J46 A;  2YKZ A;  3JSZ A;  5KYU A;  5JUA A;  2XXA A;  1JMW A;  1R4T A;  2ZXO A;  4OIN F;  2XS1 A;  3LAY A;  4DBQ A;  4N6C A;  1Z63 A;  2HJM A;  1LPE A;  1RKE B;  2LFF A;  2VC9 A;  4U5C E;  5DS4 A;  5BUO A;  5A6B D;  1Q0F A;  3GWL A;  4J7T A;  2EIM C;  2WVO A;  3V7O A;  3FOP A;  3ZSU A;  2Y3B A;  5B1A C;  3DWW A;  1NFO A;  3JRM O;  3J06 A;  1VYI A;  1MMN A;  2KYH A;  1Z3I X;  4XTK A;  5CIV A;  1WAT A;  1Q0K A;  2GFH A;  3GEI A;  4EIY A;  1T9K A;  3AGU A;  2LSE A;  2JPU A;  1L3P A;  1DOV A;  1MMA A;  1N1C A;  3LUT B;  1ORS C;  1LI7 A;  1NFN A;  2G3K A;  2IM8 A;  2LD6 A;  3KYI A;  2CDQ A;  2AP3 A;  2MWQ A;  3Q6M A;  2JX0 A;  1YA7 O;  3H2U A;  4BJ6 C;  1OXK A;  1QPU A;  1SF8 A;  3MLG A;  2XLE A;  1R5I D;  3L8I A;  4G0H A;  3X1O A;  1A7E A;  4DOZ A;  1NU9 C;  4U5D E;  2YVK A;  5B3I A;  1CPR A;  4CSA A;  1TQG A;  5L0F A;  5KYY A;  1E85 A;  1VMA A;  4CDA A;  3NYL A;  2OJE D;  3NG1 A;  2Q9A A;  2L6H A;  3ABM C;  4HE8 D;  4MVZ A;  3EZH A;  2VCC A;  1LE4 A;  3U9J A;  1D1C A;  3N2Z B;  4U5F E;  3S9O A;  3L8J A;  3T6G B;  2EIN C;  3GOD A;  3NKE A;  4I1O B;  1HMD A;  2KK1 A; 
#chains in the Genus database with same CATH homology
 4YWQ A;  3EZI A;  1MNE A;  2C04 A;  3S28 A;  2P7V A;  4ANJ A;  4F4B A;  4OIO F;  5T3W A;  2R7U A;  3NRH A;  1S7Z A;  1ZHX A;  4EWC A;  2BE5 F;  4C7O B;  4X0R A;  3WG7 C;  3LEV A;  5EGY A;  5E3A A;  3Q6N A;  2ZXR A;  3RYL A;  3ASO C;  1NU7 D;  3B0P A;  4M63 A;  4YT5 A;  3UMI A;  2X51 A;  3LLI A;  2J9V A;  1WGW A;  3LS0 A;  2YEV A;  4B6I A;  2KJG A;  1D0Y A;  2WVN A;  4U5E E;  1ZU5 A;  2Y3G A;  2NUP B;  5D92 A;  4PJJ A;  1LS1 A;  4KI2 A;  2C03 A;  3AG1 C;  1D0X A;  2IXO A;  4XLP F;  3Q7G A;  4K0D A;  3E9V A;  5KYW B;  2XRH A;  2A1D D;  4PJN A;  2Y39 A;  4GYT A;  3ABL C;  3QZC A;  3PHF 2;  2L81 A;  2G3V A;  4OD4 A;  3DM9 B;  4C7O A;  4YT2 A;  3EGX B;  3SP1 A;  2R7W A;  2R7R A;  4RBN A;  5FCL A;  1OKK D;  1Z23 A;  3HJC A;  3WOD F;  3ZVR A;  4EBB A;  5EHH A;  4YJW A;  4KBL A;  3I5P A;  4AX2 A;  4MND A;  4QDL A;  4OD5 A;  2V3C C;  2NUP A;  3UGP A;  4CBE A;  1OCO C;  2EIJ C;  4RD9 A;  3DJU B;  4O79 A;  1PD0 A;  4FWV A;  2VB6 A;  3LJB A;  4HFF B;  1BR1 A;  2J0W A;  4PFP A;  2CGE A;  3DZA A;  4E7S A;  3ZC4 A;  2WZL A;  3KMI A;  4DVY P;  5DVW A;  4YN0 B;  3VAY A;  5CI9 A;  5KYW A;  4G7O F;  3DAF A;  2A68 F;  3I5Q A;  1LVK A;  1W2W A;  2Y3D A;  3T6J A;  5DS5 A;  5DQZ A;  3H65 A;  4IWB A;  2A6E F;  3EGX A;  3K1I C;  3FVY A;  3EJN A;  3W2V A;  4G7H F;  1JPJ A;  4Q5S F;  1TWA A;  1D0Z A;  2WZF A;  2W9Y A;  1VYK A;  4FES A;  2P6V A;  3ABK C;  4KC9 A;  4LLE A;  2VH3 A;  1OCZ C;  3DD7 A;  3EHN A;  3AQC A;  1M2V B;  4H4K C;  3UNG C;  4CS8 A;  3I4U A;  2J7P D;  3NYM A;  3OWT A;  3UGO A;  1TWC A;  1IZM A;  3CZ6 A;  2FGY A;  3SYN A;  1Z6A A;  4XLN F;  2CW0 F;  1FMW A;  3AQB A;  2WVQ A;  2ZPA A;  5F5H A;  4U5G A;  3N0T A;  3Q7L A;  3AG3 C;  3JYH A;  3SEO A;  1NG1 A;  2G62 A;  4O7G A;  4IAO A;  3N24 A;  3CQZ A;  3PMR A;  1MND A;  3KKB A;  4QI0 A;  1V54 C;  2QTV A;  4PJL A;  4BG0 A;  2DGJ A;  4OIR F;  2R7S A;  2W4B A;  4QI2 A;  2B0J A;  4LLC A;  1FTS A;  1M57 C;  4C3B A;  3JCU Q;  1BR4 A;  3B9Q A;  5DLJ A;  2J45 A;  4O6N A;  1M2V A;  2M4E A;  3W2W A;  1M56 C;  3SZR A;  2ZXW C;  3B0U X;  2R7X A;  2R7O A;  1J8Y F;  2W4M A;  4K7B A;  4CS8 C;  4AK9 A;  2QY9 A;  4ZLC A;  1VOM A;  3FAJ A;  5E33 A;  1OCR C;  2OG2 A;  5L3Q A;  1NZE A;  2VAS A;  2Q9C A;  3UMK A;  5B3S C;  4CIH A;  2R7T A;  2PFD A;  3F47 A;  3L34 A;  2Q3T A;  3DXJ F;  4KNV A;  1JPN A;  1G8X A;  3M1C B;  4BJT A;  1D1A A;  1ZYR F;  2J9U A;  5HSW A;  2PX0 A;  5D91 A;  2H7V C;  1J8M F;  4JJG A;  1BR2 A;  1ST6 A;  3ITF A;  4C3D A;  1RJ9 B;  4Q7C A;  2A69 F;  4U5H A;  1MMD A;  2V26 A;  2IOQ A;  2KW3 C;  2I8B A;  3DAG A;  5E3C A;  1FMV A;  1O5H A;  2PP4 A;  4OIQ F;  3OA1 A;  4HEA J;  3NKD A;  3JT1 A;  3ZG1 A;  2IYL D;  1OCC C;  2PF4 E;  1VK5 A;  4CS9 A;  4JVS A;  2YZS A;  2E87 A;  1LKX A;  3LNR A;  2OCC C;  2O9X A;  3DMD A;  1SMY F;  3QMK A;  1TWH A;  4YT8 A;  4JCH A;  2R7V A;  2DYS C;  2NUT B;  3AG4 C;  5IY5 C;  2WB7 A;  3K66 A;  2HV7 A;  3ASN C;  1QLE C;  1RJ9 A;  4O6Y A;  4AE4 B;  3NDB B;  3EHM A;  3RKO F;  3HTK C;  1FFT C;  4I3M A;  1FFH A;  4FX5 A;  2A6H F;  2R7Q A;  3E70 C;  1KU2 A;  1SZI A;  3KH2 A;  1IW7 F;  2CNW D;  3CSK A;  2J0X A;  5CI8 A;  4G7Z F;  1TR2 A;  3JRT A;  5L3V A;  1QZX A;  1TKN A;  4CS9 C;  1Z5Z A;  2JD3 A;  4LAC B;  2NUT A;  2WL8 A;  3K1H A;  4C3E A;  3AG2 C;  4U5B E;  2HV6 A;  3ECS A;  4GEH A;  1MMG A;  1ZHW A;  4DVZ A;  4J30 B;  3DM5 A;  4AE4 A;  2PX3 A;  3VYW A;  3EFO B;  3LLK A;  1ZHZ A;  2EIL C;  2FFH A;  1PCX A;  3X2Q C;  2DYR C;  3O39 A;  3S29 A;  3EH1 A;  2H7O A;  3EGD B;  4I44 A;  4BEJ A;  2IXN A;  4O6M A;  1ZHY A;  4OIP F;  1ZU4 A;  4BJ5 A;  2XSE A;  4KNW A;  3LS1 A;  3T4R A;  3W8I A;  3SNH A;  4PFO A;  4ULW A;  3EG9 B;  2NG1 A;  3GAN A;  3S27 A;  5KYN A;  2KNH A;  2IXP A;  2H7B A;  3EH2 A;  5T1D B;  3B0V C;  1O87 A;  3KL4 A;  1V55 C;  3RFY A;  3POV A;  2Y69 C;  3HLZ A;  4JJF A;  3EQL F;  3W8H A;  4DBR A;  3EFO A;  4JUR I;  2Y3H A;  3S0X A;  4ZLD A;  1PD1 A;  3K7D A;  3K33 A;  2MYS A;  4HFK B;  4MQ9 F;  3RIP A;  1OKK A;  4J32 B;  4RDA A;  2J9W A;  3EGD A;  5F5F A;  4YT4 A;  5DS6 A;  4CSA C;  4IJJ A;  3O6X A;  4LER A;  3F46 A;  2W45 A;  2Z15 A;  3EG9 A;  5B1B C;  4BJ5 C;  3EPV A;  5E2Q A;  2L9J A;  3LES A;  5KYX B;  4JW1 A;  1TWG A;  2KGO A;  4P6I C;  2EIK C;  2KQ9 A;  4PK4 A;  2ZXP A;  5KYU B;  2XXA B;  3FHD A;  4I1M A;  3DJN B;  4NY3 A;  4W8K A;  2WZG A;  4N06 A;  4BJ1 A;  3IEE A;  2Q9B A;  2D5R B;  3MX3 A;  2IXM A;  4E7Z A;  1ZHT A;  5T3T A;  4WJ0 A;  4BJ6 A;  3UMH A;  3T6B A;  2YHS A;  3RH3 A;  4IRU A;  4CS7 A;  3TD7 A;  4JZA A;  2CNW A;  1M2O A;  4PJM A;  3ZIB A;  5DQT A;  3NYJ A;  2XL4 A;  3UR3 C;  5KYY B;  2J7P A;  3OEO A;  4Q4Z F;  1D1B A;  3L0I A;  4XWJ A;  5KYX A;  3K6B A;  2XXA A;  3JSZ A;  2J46 A;  5KYU A;  2ZXO A;  4OIN F;  3LAY A;  4DBQ A;  1Z63 A;  4U5C E;  5DS4 A;  5BUO A;  3FDQ A;  3ZSU A;  2EIM C;  2WVO A;  3V7O A;  2Y3B A;  5B1A C;  1VYI A;  1MMN A;  4XTK A;  1Z3I X;  2GFH A;  2LSE A;  1MMA A;  1N1C A;  4A2N B;  2G3K A;  3Q6M A;  2CDQ A;  2MWQ A;  4BJ6 C;  1SF8 A;  3MLG A;  3X1O A;  4G0H A;  4DOZ A;  1NU9 C;  4U5D E;  4CSA A;  5KYY A;  1VMA A;  3NYL A;  3NG1 A;  2Q9A A;  3ABM C;  4HE8 D;  3EZH A;  1D1C A;  3N2Z B;  4U5F E;  2EIN C;  3GOD A;  3NKE A;  4I1O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...