3K33A

Crystal structure of the phd-doc complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
124
structure length
124
Chain Sequence
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSALLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allostery and intrinsic disorder mediate transcription regulation by conditional cooperativity.
pubmed doi rcsb
source organism Enterobacteria phage p1
molecule tags Toxin/antitoxin
molecule keywords Death on curing protein
total genus 47
structure length 124
sequence length 124
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1870 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3k33A00
3DD7A 3KH2A 3K33A
chains in the Genus database with same CATH superfamily
4CBEA 2HMZA 2KC3A 1MMAA 4XPWA 3T6JA 4CS7A 3RQEA 4XTKA 4BEMJ 3QMKA 3GM1A 3Q6NA 3AG1C 2OOCA 3M4BA 3LAYA 5B3IA 2NUTB 2WZFA 4W8PA 5L0CA 2GAQA 1HMDA 2ETSA 1T5OA 1GGQA 1LE2A 4C3DA 3V5YA 2ASRA 2VASA 1ZHZA 5L0JA 3L8IA 1W2WA 4CDYA 2IXNA 3O6XA 3C8ZA 4C3EA 2P7VA 5DS5A 1NFNA 3EFOB 5EK0A 2XLEA 3SP1A 4XQ1A 2XRHA 2QE9A 4BJ5C 2R7TA 3I5QA 2XXAA 1VOMA 3FAPB 1RJ9B 3UMHA 1FNTc 1RJ9A 2XLWA 1HE9A 2NG1A 2ZPAA 5F5HA 1OW8A 1E2XA 4MNDA 1O5HA 2H8AA 1Z7Qc 3U0CA 1ORSC 3A11A 3G4ZA 1HMOA 2LD6A 4I3MA 4AX2A 3GEHA 5T3TA 2IM8A 3T9OA 4FAPB 2Y3BA 4U9DA 1JAFA 3U3FA 2LIGA 1A0BA 3DM5A 3R7CA 3WG7C 2OU6A 4FESA 4KBLA 1H7IA 1ZHXA 2Q9CA 1MNEA 2YVKA 3BRJA 3K6BA 4CJGA 1GQAA 2HUJA 2CW0F 1YYXA 2R03A 1CGNA 4LERA 4N6CA 4CDVA 4DBRA 1WASA 3LLKA 4MTGA 3QVZA 5E33A 2YZSA 4WJ0A 3TD7A 2AWCA 1IW7F 4OD4A 5L0IA 4OD5A 4GQHA 5BQIA 1ZYRF 3VM6A 1ZW3A 3FOPA 3HNJA 2IXMA 5E3AA 3SXYA 3U3BA 3ZSUA 5L0GA 2YEVA 3LNMB 1SYQA 3UNGC 3G4XA 3PDMP 2NSGA 1KTMA 2ZXRA 1OQCA 2XM0A 3Q6MA 1BBHA 5AC4A 2O9XA 5B1AC 3FMSA 3DD7A 1Z6AA 5COFA 1T6IA 3EHMA 3VYWA 2J8WA 3POVA 1A41A 2CCYA 2Q9AA 2FAPB 3HTKC 4RBNA 2J45A 4BJ1A 4DOZA 5JT4A 3O39A 3KYIA 5L0FA 1T6QA 2R9RB 3R2PA 1M2OA 2DGJA 1D1AA 1BR1A 1U89A 2IOQA 3VF0A 4UDVA 2ZXPA 4O6MA 3LEVA 4JCHA 4DJ9A 1OKKA 3GODA 2NUTA 5A6BA 4CIHA 4EHPA 2P0NA 2Y3HA 1V4AA 2YLIA 4FWVA 4U5CE 1T01A 2BC5A 3GEIA 1VMAA 2AWYA 2YQYA 4LDQA 5IY5C 4EUKB 4QDLA 1D0YA 1K40A 4U5BE 1MNDA 4YL3A 3ABKC 3FHDA 3ZVRA 1O3UA 1ZVZA 1RKCA 2AVKA 4XEVA 3LLIA 2XLDA 1GM5A 5CI9A 4LLEA 1YJGA 5DS4A 2XS8A 4L6RA 1Z5ZA 2CGEA 3I4UA 1NU7D 4YK5A 4YT5A 3RIPA 3W2WA 1ZHTA 3CEXA 1VK5A 4RD9A 5L0DA 2CNWD 4H54A 2YL7A 5L3QA 1NSGB 3FDQA 2J9VA 1ZHWA 1R4TA 3U8VA 1JRAA 1HW1A 1VYIA 4XLNF 2QUPA 4YN0B 4MTFA 3M79A 3QW1A 1YYJA 2ZXOA 3TOLA 5KYXA 5F5FA 4W8KA 2MYSA 3RH3A 1H9TA 1CPQA 5DLJA 1KU2A 3DAGA 2H7VC 4CX9A 4XLPF 1LS4A 3K1HA 2YKZA 3RKOF 4HFKB 4ANJA 2GA0A 1MQVA 1A7DA 1Q0FA 1I4YA 3N2ZB 3E70C 1JOGA 3PMRA 4XEFA 4YL0A 4GEHA 2W45A 4WGZA 4NTAA 2Q3TA 4D4XA 2DB4A 3N24A 3SZRA 2P1AA 3EPVA 1QVXA 5JUAA 2R7RA 2R7SA 2HJMA 2LFFA 1D1BA 4KNVA 1Q0MA 4MVZA 4J7YA 1M2VB 4YWQA 4PFPA 3NDBB 1PD0A 1OR3A 2PX0A 2EPLX 1V74B 4O6NA 4NQFA 3V5XA 4EWCA 2X51A 1APCA 3C8GA 3C63A 1HY5A 3EGDA 3ECSA 2PFDA 3FOOA 1GS9A 3U2LA 4AK9A 1RCPA 1NG1A 4CIPA 3L1MA 3ZDLA 3JSZA 4F4BA 1NBBA 1VLTA 1J8MF 2Q7RA 4KC9A 1CGME 2KQ9A 5DVWA 2J7PD 2XL8A 1XZQA 4U5HA 4CSAC 3DKAA 1PCXA 3KMIA 4JTDB 2VCAA 2L81A 3L8JA 3GWNA 5E2QA 3MX3A 1E86A 1H6GA 2HS5A 3DE9A 3IQCA 2WVQA 3AGUA 4I44A 4MQ9F 1QZXA 2PBEA 3AQBA 3ITFA 1ZZPA 256BA 1HE1A 4JW1A 4MVMA 5KYUA 3ZTZA 1LE4A 2R05A 3M4CA 2LK4A 3AJMA 3B71A 1C02A 3NYJA 2D4UA 2L6FA 1D0ZA 2NSFA 4LLCA 4ONSA 3RYLA 1LI7A 3SNHA 3VAYA 3NKDA 1HW2A 1VTMP 1MMNA 4AL0A 1FR0A 2J0XA 1RKEA 5KYYA 3CQZA 2XSEA 1PV3A 2A69F 3BEHA 4P9FA 1Q0DA 1D1CA 2KYHA 2KSFA 4QI0A 3LESA 3QZCA 1ST6A 4PJLA 3HNIA 3AQCA 2DYSC 2UUHA 4AE4B 1K05A 2D5RB 4CS8A 3IHUA 4K0DA 3LJBA 3GANA 4CS9A 3RVYA 3US6A 3QW0A 1SR2A 4CS8C 2KK1A 2G3VA 3TULA 2XL6A 4JIOA 4BJ5A 1ZU4A 5BUOA 1F1MA 2YL3A 1EA8A 3DXJF 4G7ZF 2E87A 3NMJA 3B0PA 4LDKA 4LDRA 2XXAB 2R7XA 1C03A 4PK4A 3B0VC 2GWWA 3O10A 1WN0A 3Q7GA 3X1OA 4D4NA 5A6KA 2EIJC 4U5EE 1SMYF 2HSBA 2P6VA 3DJUB 3S29A 2I15A 5JP7A 2J9WA 2LCHA 3RQGA 1QKRA 1BR2A 1QSPA 1LI5A 1D0XA 1TKNA 3ASNC 2L6HA 3EZHA 4JE9A 3VRCA 1RMVA 3JZ0A 3J06A 4C7OA 1FTSA 3TK0A 4M63A 1Y6DA 3H2VA 4P6IC 3UR3C 4YT4A 5BQHA 2OJED 4IGGA 4NCQA 3S9OA 2Y3GA 3U8PA 1YVIA 2Q00A 4JJFA 2OEXA 1WOLA 4OIPF 4P9TA 2WVNA 5T1DB 4MVQA 4BEJA 1H9GA 1LS1A 1OXKA 1E83A 3B29A 1ZU5A 1JR8A 3Q7LA 2M4EA 1BR4A 1EKYA 4MW3A 1E85A 2L7AA 1MMGA 2WZGA 3MFNA 3C8GD 4FX5A 2NUPA 4Z9JA 4AL1A 2NUPB 2EPMX 3GM2A 4MS2A 3JYYA 2JX0A 2UUIA 3RFYA 4C3BA 1WWPA 1M6TA 2OG2A 3CZ6A 4K7BA 4XPYA 2PX3A 2XM4A 4MW8A 2AU5A 1YAUO 3NMIA 4YL1A 3EG9B 2LSEA 5D92A 1OW6A 5HSWA 4JRZA 3C8GB 1RKEB 3C62A 3O55A 4JJGA 5DS6A 1JPJA 5JS5A 3U9MA 2IXOA 2R7QA 3C18A 3WHNA 3T6GB 3UMKA 2XLOA 2HSQA 2R7OA 2FFHA 4OIOF 3LEOA 3DJNB 3ASOC 1EQ1A 4CJOA 1ZHYA 3ATPA 3IPMO 1FAPB 2EPKX 3RW0A 1BZ4A 3TJ5A 4EKWA 3MYIA 2OJQA 4ZLDA 1G5ZA 4YT2A 4XPXA 3L0IA 2B0JA 1B68A 4DBQA 3K1IC 1LPEA 3WAQA 4O7GA 3LNRA 3FAJA 2KJGA 4NTBA 1OCZC 2YLDA 5JLIA 3ZG1A 4JTAB 3GWLA 3W2VA 1L3PA 1LKXA 5KYUB 1N1CA 2Y3DA 2J0WA 5KYWA 2VB6A 1YA7O 3MYFA 5E3CA 1A7VA 3B0UX 2C03A 3MBGA 3KPHA 1OR2A 2MWQA 2OEVA 1FMVA 2PP4A 2QTVA 3M15A 4JTCB 2RD9A 4PJJA 2X0CA 3X2QC 3QVYA 1OCCC 4MVRA 4ER9A 2XS1A 2AP3A 5JVEA 3EQLF 3AGTA 2W4MA 3ABLC 3K33A 3TJ6A 3SXKA 3GM3A 2IBFA 4U5DE 4X0RA 3JTLO 2L6GA 3S28A 4E18A 2EPOA 4O79A 5B3SC 2HMQA 1QQ3A 4PJMA 2R7VA 3JRMO 2R7UA 2KW3C 4BJTA 1VLSA 4PFOA 5COGA 1LIHA 1OKKD 4JURI 4JKVA 5AGFA 2HKVA 2BE5F 2FGYA 3ABMC 4WGYA 4Z9HA 4IWBA 2CYDA 5T3WA 1KNYA 2RSEB 5COMA 2J9UA 2YWAA 2EINC 2GDCA 1I5NA 1A7EA 2JPUA 4I1MA 2W4BA 1AUEA 2NPUA 1YLMA 3AOUA 1OCRC 3C7JA 3S0XA 1OW7A 3EFOA 4KI2A 4N4WA 1VB5A 4IJJA 4A2NB 5JSLA 1Z63A 1BDJB 1M2VA 1XZPA 1NLXA 1V55C 2QLAA 3NG1A 3NYLA 4U5FE 1JMWA 2IXPA 2HJ3A 3EG9A 4J30B 3RVZA 1UFBA 2PNOA 3HJCA 1WGWA 2Y69C 4K1OA 5FZTA 3KKBA 4CS9C 3S90A 1TWAA 2VCCA 5KYXB 4E0IA 2WL8A 4ULWA 4J7TA 3OA1A 2YHSA 3AG3C 1V54C 4H4KC 3JRTA 2XLHA 2Z15A 3HNKA 2WB7A 1EI7A 3IEEA 4RDAA 3S27A 2OQMA 4EBBA 1IZMA 1C17M 2OCCC 4HEAJ 4BG0A 2B0HA 3EH1A 4Q4ZF 2G3KA 4GYTA 2I8BA 2ZXWC 1U0BB 1S05A 1WATA 4G0HA 3JT1A 4IRUA 4JC7A 3PCVA 4N06A 3FXHA 5A6JA 1M56C 4LACB 5L0HA 3DM9B 3G50A 4E7ZA 1Q0KA 3NYMA 3IQ5A 3UMIA 3HKKA 3WODF 4BPMA 5DQZA 2HFIA 2A1DD 5TJ5E 3ZWIA 2WVOA 4A4AA 4U5GA 4EBJA 4EBKA 3KYJA 2XLMA 3U2MA 2EIKC 1G8XA 5K0IA 3PHF2 1E84A 3EHNA 2V26A 3GEEA 1XWJA 2DI3A 2KNHA 3RF3A 4DXWA 4BJ6A 4CDAA 1WTYA 1YZCA 1NZEA 3HNLA 2A6HF 1RXQA 1PD1A 3H2UA 1QPUA 3EGXA 4E17A 3SXZA 4IB4A 3A9CA 3ZC4A 2H7BA 5BQGA 1TQGA 2XLVA 3DZAA 2YLGA 2ZD9A 1QLEC 4O6YA 4E0HA 3L34A 3F47A 2QNLA 2CNWA 3GORA 3HLZA 1G4US 2R02A 4NY3A 5JRAA 2Q9BA 2EIMC 3LUTB 3CSKA 3U5SA 3NKEA 3K66A 4JVSA 4DVZA 4MVOA 1VYKA 3EZIA 1Z23A 4HFFB 1LM3B 3V7OA 2OKUA 3KL4A 1ORJA 4PJNA 4YT8A 5CIVA 2LFDA 4PACA 3SEOA 2A68F 1J8YF 1TFOB 2YL0A 4XWJA 3T4RA 5HV9A 5A6BD 3ZIBA 4WABA 4I1OB 4IARA 2HV7A 4Z9IA 1T6UA 5A6AA 3RQFA 1K04A 2XL4A 2G62A 4C7OB 3M1CB 3EGDB 1DOVA 2J46A 4MVUA 1O87A 4R32A 3MLGA 3ZTMA 2CDQA 4Q7CA 3W4YA 2YRFA 5AC5A 2JD3A 5KYYB 3K7DA 1TR2A 2L9JA 3I5PA 1TWCA 5GPGB 5KYNA 2DYRC 1NFOA 4QI2A 1JPNA 3CAXA 1L7CA 3OWTA 1LVKA 3W8HA 2WZLA 3LS0A 5EGYA 4HE8D 3DMDA 4KNWA 3U9JA 3JCUQ 2J9BA 4JCZA 1AVOB 4MTOA 1OXBA 3AG4C 2LP4A 2A0UA 2ICWG 5B1BC 4OINF 1CGOA 3DAFA 4BJ6C 4NC3A 1FFTC 4PR9A 2A0BA 2HV6A 2V3CC 2A6EF 3E9VA 4ULVA 3SXMA 2EPNA 2C04A 1G4WR 1UG7A 1YDIA 2PF4E 3EH2A 3TQOA 5DQTA 2R25A 1SF8A 4DRIB 4JZAA 1OCOC 5KYWB 3DWWA 2VC9A 4G7HF 2M64A 2KGOA 3K1IA 3ZQVA 5CI8A 1FFHA 1R5ID 1TWGA 2R7WA 3FVYA 4JEBA 5EHHA 4U9EA 3IQ6A 4N6HA 2J7PA 1Q0GA 1TFKB 2Y39A 4XEKA 1U6HA 3SYNA 3NMKA 3EJNA 3B9QA 3DI5A 5L3VA 4OIRF 3DE8A 3N0TA 1MMDA 4B6IA 2TMVP 4J32B 5A69A 1ZW2A 3EGXB 4DRHB 1SZIA 3LS1A 2GFHA 1CPRA 3V5ZA 4G78A 1Y4CA 3IQTA 3AG2C 2BL2A 2VH3A 3KH2A 2Q4FA 4OIQF 4G7OF 2HZ8A 4NTFA 1YA9A 3NRHA 4IAQA 2P61A 4DRJB 3JYHA 3H65A 3QTHA 5F28E 3T6BA 1YARO 5D91A 4Q5SF 4AE4A 4CSAA 2QY9A 1AEPA 2H7OA 2EILC 2IYLD 1YZAA 1ORYA 1M57C 4DVYP 3W8IA 2MHRA 3UGPA 1T9KA 4YJWA 4MVSA 1TWHA 1FMWA 3ZQYA 4ZLCA 1S7ZA 3S84A 5FCLA 2W9YA 4IAOA 1Z3IX 1I4ZA 4JEAA 3TOMA 4E7SA 2VCBA 3OEOA 1DOWA 3UGOA 2F22A 2LQGA 4EIYA 3F46A 3JSEO 2YL1A 1NU9C
chains in the Genus database with same CATH topology
4CBEA 1MMAA 3T6JA 4CS7A 4XTKA 3QMKA 3Q6NA 3AG1C 3LAYA 2NUTB 2WZFA 4C3DA 2VASA 1ZHZA 1W2WA 2IXNA 3O6XA 4C3EA 2P7VA 5DS5A 3EFOB 3SP1A 2XRHA 4BJ5C 2R7TA 3I5QA 2XXAA 1VOMA 1RJ9B 3UMHA 1RJ9A 2NG1A 2ZPAA 5F5HA 4MNDA 1O5HA 4I3MA 4AX2A 5T3TA 2Y3BA 3DM5A 3WG7C 4FESA 4KBLA 1ZHXA 2Q9CA 1MNEA 3K6BA 4DBRA 2CW0F 4LERA 3LLKA 5E33A 2YZSA 4WJ0A 3TD7A 1IW7F 4OD4A 4OD5A 1ZYRF 2IXMA 5E3AA 2YEVA 3UNGC 2ZXRA 3Q6MA 2O9XA 5B1AC 3DD7A 1Z6AA 3EHMA 3VYWA 3POVA 2Q9AA 4BJ1A 3HTKC 4RBNA 4DOZA 2J45A 3O39A 1M2OA 2DGJA 1D1AA 1BR1A 2IOQA 2ZXPA 4O6MA 3LEVA 4JCHA 1OKKA 3GODA 2NUTA 4CIHA 2Y3HA 4FWVA 4U5CE 1VMAA 5IY5C 4QDLA 1D0YA 4U5BE 1MNDA 3ABKC 3FHDA 3ZVRA 3LLIA 5CI9A 4LLEA 5DS4A 1Z5ZA 2CGEA 3I4UA 1NU7D 3RIPA 4YT5A 3W2WA 1ZHTA 1VK5A 4RD9A 2CNWD 5L3QA 3FDQA 2J9VA 1ZHWA 1VYIA 4XLNF 4YN0B 5KYXA 5F5FA 2ZXOA 4W8KA 2MYSA 3RH3A 5DLJA 1KU2A 3DAGA 2H7VC 4XLPF 3K1HA 3RKOF 4HFKB 4ANJA 3N2ZB 3E70C 3PMRA 4GEHA 2W45A 2Q3TA 3N24A 3SZRA 3EPVA 2R7RA 2R7SA 1D1BA 4KNVA 1M2VB 4YWQA 4PFPA 3NDBB 1PD0A 2PX0A 4O6NA 4EWCA 2X51A 3EGDA 3ECSA 2PFDA 4AK9A 1NG1A 4F4BA 3JSZA 1J8MF 4KC9A 2KQ9A 5DVWA 2J7PD 4U5HA 4CSAC 1PCXA 3KMIA 2L81A 5E2QA 3MX3A 2WVQA 4I44A 4MQ9F 1QZXA 3AQBA 3ITFA 4JW1A 5KYUA 3NYJA 3VAYA 3RYLA 1D0ZA 4LLCA 3ZSUA 3SNHA 3NKDA 1MMNA 2J0XA 5KYYA 3CQZA 2XSEA 2A69F 1D1CA 4QI0A 3LESA 3QZCA 1ST6A 4PJLA 3AQCA 2DYSC 4AE4B 2D5RB 4CS8A 4K0DA 3LJBA 3GANA 4CS9A 4CS8C 2G3VA 4BJ5A 1ZU4A 5BUOA 3DXJF 4G7ZF 2E87A 3B0PA 2XXAB 4PK4A 3B0VC 3Q7GA 3X1OA 2EIJC 4U5EE 1SMYF 2P6VA 3DJUB 3S29A 2J9WA 1BR2A 3ASNC 1D0XA 1TKNA 3EZHA 4C7OA 1FTSA 4M63A 4P6IC 3UR3C 4YT4A 2Y3GA 4JJFA 4OIPF 2WVNA 5T1DB 4BEJA 1LS1A 1ZU5A 3Q7LA 2M4EA 1BR4A 1MMGA 2WZGA 4FX5A 2NUPA 2NUPB 3RFYA 4C3BA 2OG2A 3CZ6A 4K7BA 2PX3A 3EG9B 2LSEA 5D92A 5HSWA 4JJGA 5DS6A 1JPJA 2IXOA 2R7QA 3UMKA 2R7OA 2FFHA 4OIOF 3DJNB 3ASOC 1ZHYA 4ZLDA 4YT2A 3L0IA 2B0JA 4DBQA 3K1IC 4O7GA 3LNRA 3FAJA 2KJGA 1OCZC 3ZG1A 3W2VA 5KYWA 1LKXA 5KYUB 1N1CA 2Y3DA 2J0WA 2VB6A 5E3CA 3B0UX 2C03A 2MWQA 2PP4A 1FMVA 2QTVA 4PJJA 3X2QC 1OCCC 3EQLF 2W4MA 3ABLC 3K33A 4U5DE 4X0RA 3S28A 4O79A 5B3SC 4PJMA 2R7VA 2R7UA 2KW3C 4BJTA 4PFOA 4JURI 1OKKD 2BE5F 2FGYA 3ABMC 4IWBA 5T3WA 2J9UA 2EINC 4I1MA 2W4BA 1OCRC 3S0XA 4KI2A 3EFOA 4IJJA 4A2NB 1Z63A 1M2VA 3NG1A 1V55C 3NYLA 4U5FE 2R7XA 2IXPA 3EG9A 4J30B 3HJCA 1WGWA 2Y69C 4CS9C 3KKBA 1TWAA 5KYXB 2WL8A 4ULWA 3OA1A 2YHSA 3AG3C 1V54C 4H4KC 3JRTA 2Z15A 3S27A 2WB7A 3IEEA 4RDAA 4EBBA 1IZMA 2OCCC 4HEAJ 4BG0A 3EH1A 4Q4ZF 2G3KA 4GYTA 2I8BA 2ZXWC 4G0HA 3JT1A 4IRUA 4N06A 1M56C 4LACB 3DM9B 4E7ZA 3NYMA 3UMIA 3WODF 5DQZA 2A1DD 2WVOA 4U5GA 2EIKC 1G8XA 3PHF2 3EHNA 2V26A 2KNHA 4BJ6A 1NZEA 2A6HF 1PD1A 3EGXA 3ZC4A 2H7BA 3DZAA 4O6YA 1QLEC 3L34A 3F47A 2CNWA 3HLZA 4NY3A 2Q9BA 2EIMC 3CSKA 3NKEA 3K66A 4JVSA 4DVZA 1VYKA 3EZIA 1Z23A 4HFFB 3V7OA 3KL4A 4PJNA 4YT8A 3SEOA 2A68F 1J8YF 3T4RA 4XWJA 3ZIBA 4I1OB 2HV7A 2XL4A 2G62A 4C7OB 3M1CB 3EGDB 2J46A 1O87A 3MLGA 2CDQA 4Q7CA 2JD3A 5KYYB 3K7DA 1TR2A 2L9JA 3I5PA 1TWCA 5KYNA 2DYRC 4QI2A 1JPNA 3OWTA 1LVKA 3W8HA 2WZLA 3LS0A 5EGYA 4HE8D 3DMDA 4KNWA 3JCUQ 3AG4C 5B1BC 4OINF 3DAFA 4BJ6C 1FFTC 2HV6A 2V3CC 2A6EF 3E9VA 2C04A 3EH2A 2PF4E 5DQTA 1SF8A 4JZAA 1OCOC 5KYWB 4G7HF 2KGOA 5CI8A 1FFHA 1TWGA 2R7WA 3FVYA 5EHHA 2J7PA 2Y39A 3SYNA 3EJNA 3B9QA 5L3VA 4OIRF 4B6IA 3N0TA 1MMDA 4J32B 3EGXB 1SZIA 3LS1A 2GFHA 3AG2C 4OIQF 2VH3A 3KH2A 4G7OF 3NRHA 3JYHA 3H65A 3T6BA 5D91A 4Q5SF 4AE4A 4CSAA 2QY9A 2H7OA 2EILC 2IYLD 1M57C 4DVYP 3W8IA 3UGPA 4YJWA 1TWHA 1FMWA 4ZLCA 1S7ZA 5FCLA 2W9YA 4IAOA 1Z3IX 4E7SA 3UGOA 3OEOA 3F46A 1NU9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DD7 A;  3KH2 A;  3K33 A; 
#chains in the Genus database with same CATH topology
 4CBE A;  2HMZ A;  2KC3 A;  1MMA A;  4XPW A;  3T6J A;  4CS7 A;  3RQE A;  4XTK A;  4BEM J;  3QMK A;  3GM1 A;  3Q6N A;  3AG1 C;  2OOC A;  3M4B A;  3LAY A;  5B3I A;  2NUT B;  2WZF A;  4W8P A;  5L0C A;  2GAQ A;  1HMD A;  2ETS A;  1T5O A;  1GGQ A;  1LE2 A;  4C3D A;  3V5Y A;  2ASR A;  2VAS A;  1ZHZ A;  5L0J A;  3L8I A;  1W2W A;  4CDY A;  2IXN A;  3O6X A;  3C8Z A;  4C3E A;  2P7V A;  5DS5 A;  1NFN A;  3EFO B;  5EK0 A;  2XLE A;  3SP1 A;  4XQ1 A;  2XRH A;  2QE9 A;  4BJ5 C;  2R7T A;  3I5Q A;  2XXA A;  1VOM A;  3FAP B;  1RJ9 B;  3UMH A;  1FNT c;  1RJ9 A;  2XLW A;  1HE9 A;  2NG1 A;  2ZPA A;  5F5H A;  1OW8 A;  1E2X A;  4MND A;  1O5H A;  2H8A A;  1Z7Q c;  3U0C A;  1ORS C;  3A11 A;  3G4Z A;  1HMO A;  2LD6 A;  4I3M A;  4AX2 A;  3GEH A;  5T3T A;  2IM8 A;  3T9O A;  4FAP B;  2Y3B A;  4U9D A;  1JAF A;  3U3F A;  2LIG A;  1A0B A;  3DM5 A;  3R7C A;  3WG7 C;  2OU6 A;  4FES A;  4KBL A;  1H7I A;  1ZHX A;  2Q9C A;  1MNE A;  2YVK A;  3BRJ A;  3K6B A;  4CJG A;  1GQA A;  2HUJ A;  2CW0 F;  1YYX A;  2R03 A;  1CGN A;  4LER A;  4N6C A;  4CDV A;  4DBR A;  1WAS A;  3LLK A;  4MTG A;  3QVZ A;  5E33 A;  2YZS A;  4WJ0 A;  3TD7 A;  2AWC A;  1IW7 F;  4OD4 A;  5L0I A;  4OD5 A;  4GQH A;  5BQI A;  1ZYR F;  3VM6 A;  1ZW3 A;  3FOP A;  3HNJ A;  2IXM A;  5E3A A;  3SXY A;  3U3B A;  3ZSU A;  5L0G A;  2YEV A;  3LNM B;  1SYQ A;  3UNG C;  3G4X A;  3PDM P;  2NSG A;  1KTM A;  2ZXR A;  1OQC A;  2XM0 A;  3Q6M A;  1BBH A;  5AC4 A;  2O9X A;  5B1A C;  3FMS A;  3DD7 A;  1Z6A A;  5COF A;  1T6I A;  3EHM A;  3VYW A;  2J8W A;  3POV A;  1A41 A;  2CCY A;  2Q9A A;  2FAP B;  3HTK C;  4RBN A;  2J45 A;  4BJ1 A;  4DOZ A;  5JT4 A;  3O39 A;  3KYI A;  5L0F A;  1T6Q A;  2R9R B;  3R2P A;  1M2O A;  2DGJ A;  1D1A A;  1BR1 A;  1U89 A;  2IOQ A;  3VF0 A;  4UDV A;  2ZXP A;  4O6M A;  3LEV A;  4JCH A;  4DJ9 A;  1OKK A;  3GOD A;  2NUT A;  5A6B A;  4CIH A;  4EHP A;  2P0N A;  2Y3H A;  1V4A A;  2YLI A;  4FWV A;  4U5C E;  1T01 A;  2BC5 A;  3GEI A;  1VMA A;  2AWY A;  2YQY A;  4LDQ A;  5IY5 C;  4EUK B;  4QDL A;  1D0Y A;  1K40 A;  4U5B E;  1MND A;  4YL3 A;  3ABK C;  3FHD A;  3ZVR A;  1O3U A;  1ZVZ A;  1RKC A;  2AVK A;  4XEV A;  3LLI A;  2XLD A;  1GM5 A;  5CI9 A;  4LLE A;  1YJG A;  5DS4 A;  2XS8 A;  4L6R A;  1Z5Z A;  2CGE A;  3I4U A;  1NU7 D;  4YK5 A;  4YT5 A;  3RIP A;  3W2W A;  1ZHT A;  3CEX A;  1VK5 A;  4RD9 A;  5L0D A;  2CNW D;  4H54 A;  2YL7 A;  5L3Q A;  1NSG B;  3FDQ A;  2J9V A;  1ZHW A;  1R4T A;  3U8V A;  1JRA A;  1HW1 A;  1VYI A;  4XLN F;  2QUP A;  4YN0 B;  4MTF A;  3M79 A;  3QW1 A;  1YYJ A;  2ZXO A;  3TOL A;  5KYX A;  5F5F A;  4W8K A;  2MYS A;  3RH3 A;  1H9T A;  1CPQ A;  5DLJ A;  1KU2 A;  3DAG A;  2H7V C;  4CX9 A;  4XLP F;  1LS4 A;  3K1H A;  2YKZ A;  3RKO F;  4HFK B;  4ANJ A;  2GA0 A;  1MQV A;  1A7D A;  1Q0F A;  1I4Y A;  3N2Z B;  3E70 C;  1JOG A;  3PMR A;  4XEF A;  4YL0 A;  4GEH A;  2W45 A;  4WGZ A;  4NTA A;  2Q3T A;  4D4X A;  2DB4 A;  3N24 A;  3SZR A;  2P1A A;  3EPV A;  1QVX A;  5JUA A;  2R7R A;  2R7S A;  2HJM A;  2LFF A;  1D1B A;  4KNV A;  1Q0M A;  4MVZ A;  4J7Y A;  1M2V B;  4YWQ A;  4PFP A;  3NDB B;  1PD0 A;  1OR3 A;  2PX0 A;  2EPL X;  1V74 B;  4O6N A;  4NQF A;  3V5X A;  4EWC A;  2X51 A;  1APC A;  3C8G A;  3C63 A;  1HY5 A;  3EGD A;  3ECS A;  2PFD A;  3FOO A;  1GS9 A;  3U2L A;  4AK9 A;  1RCP A;  1NG1 A;  4CIP A;  3L1M A;  3ZDL A;  3JSZ A;  4F4B A;  1NBB A;  1VLT A;  1J8M F;  2Q7R A;  4KC9 A;  1CGM E;  2KQ9 A;  5DVW A;  2J7P D;  2XL8 A;  1XZQ A;  4U5H A;  4CSA C;  3DKA A;  1PCX A;  3KMI A;  4JTD B;  2VCA A;  2L81 A;  3L8J A;  3GWN A;  5E2Q A;  3MX3 A;  1E86 A;  1H6G A;  2HS5 A;  3DE9 A;  3IQC A;  2WVQ A;  3AGU A;  4I44 A;  4MQ9 F;  1QZX A;  2PBE A;  3AQB A;  3ITF A;  1ZZP A;  256B A;  1HE1 A;  4JW1 A;  4MVM A;  5KYU A;  3ZTZ A;  1LE4 A;  2R05 A;  3M4C A;  2LK4 A;  3AJM A;  3B71 A;  1C02 A;  3NYJ A;  2D4U A;  2L6F A;  1D0Z A;  2NSF A;  4LLC A;  4ONS A;  3RYL A;  1LI7 A;  3SNH A;  3VAY A;  3NKD A;  1HW2 A;  1VTM P;  1MMN A;  4AL0 A;  1FR0 A;  2J0X A;  1RKE A;  5KYY A;  3CQZ A;  2XSE A;  1PV3 A;  2A69 F;  3BEH A;  4P9F A;  1Q0D A;  1D1C A;  2KYH A;  2KSF A;  4QI0 A;  3LES A;  3QZC A;  1ST6 A;  4PJL A;  3HNI A;  3AQC A;  2DYS C;  2UUH A;  4AE4 B;  1K05 A;  2D5R B;  4CS8 A;  3IHU A;  4K0D A;  3LJB A;  3GAN A;  4CS9 A;  3RVY A;  3US6 A;  3QW0 A;  1SR2 A;  4CS8 C;  2KK1 A;  2G3V A;  3TUL A;  2XL6 A;  4JIO A;  4BJ5 A;  1ZU4 A;  5BUO A;  1F1M A;  2YL3 A;  1EA8 A;  3DXJ F;  4G7Z F;  2E87 A;  3NMJ A;  3B0P A;  4LDK A;  4LDR A;  2XXA B;  2R7X A;  1C03 A;  4PK4 A;  3B0V C;  2GWW A;  3O10 A;  1WN0 A;  3Q7G A;  3X1O A;  4D4N A;  5A6K A;  2EIJ C;  4U5E E;  1SMY F;  2HSB A;  2P6V A;  3DJU B;  3S29 A;  2I15 A;  5JP7 A;  2J9W A;  2LCH A;  3RQG A;  1QKR A;  1BR2 A;  1QSP A;  1LI5 A;  1D0X A;  1TKN A;  3ASN C;  2L6H A;  3EZH A;  4JE9 A;  3VRC A;  1RMV A;  3JZ0 A;  3J06 A;  4C7O A;  1FTS A;  3TK0 A;  4M63 A;  1Y6D A;  3H2V A;  4P6I C;  3UR3 C;  4YT4 A;  5BQH A;  2OJE D;  4IGG A;  4NCQ A;  3S9O A;  2Y3G A;  3U8P A;  1YVI A;  2Q00 A;  4JJF A;  2OEX A;  1WOL A;  4OIP F;  4P9T A;  2WVN A;  5T1D B;  4MVQ A;  4BEJ A;  1H9G A;  1LS1 A;  1OXK A;  1E83 A;  3B29 A;  1ZU5 A;  1JR8 A;  3Q7L A;  2M4E A;  1BR4 A;  1EKY A;  4MW3 A;  1E85 A;  2L7A A;  1MMG A;  2WZG A;  3MFN A;  3C8G D;  4FX5 A;  2NUP A;  4Z9J A;  4AL1 A;  2NUP B;  2EPM X;  3GM2 A;  4MS2 A;  3JYY A;  2JX0 A;  2UUI A;  3RFY A;  4C3B A;  1WWP A;  1M6T A;  2OG2 A;  3CZ6 A;  4K7B A;  4XPY A;  2PX3 A;  2XM4 A;  4MW8 A;  2AU5 A;  1YAU O;  3NMI A;  4YL1 A;  3EG9 B;  2LSE A;  5D92 A;  1OW6 A;  5HSW A;  4JRZ A;  3C8G B;  1RKE B;  3C62 A;  3O55 A;  4JJG A;  5DS6 A;  1JPJ A;  5JS5 A;  3U9M A;  2IXO A;  2R7Q A;  3C18 A;  3WHN A;  3T6G B;  3UMK A;  2XLO A;  2HSQ A;  2R7O A;  2FFH A;  4OIO F;  3LEO A;  3DJN B;  3ASO C;  1EQ1 A;  4CJO A;  1ZHY A;  3ATP A;  3IPM O;  1FAP B;  2EPK X;  3RW0 A;  1BZ4 A;  3TJ5 A;  4EKW A;  3MYI A;  2OJQ A;  4ZLD A;  1G5Z A;  4YT2 A;  4XPX A;  3L0I A;  2B0J A;  1B68 A;  4DBQ A;  3K1I C;  1LPE A;  3WAQ A;  4O7G A;  3LNR A;  3FAJ A;  2KJG A;  4NTB A;  1OCZ C;  2YLD A;  5JLI A;  3ZG1 A;  4JTA B;  3GWL A;  3W2V A;  1L3P A;  1LKX A;  5KYU B;  1N1C A;  2Y3D A;  2J0W A;  5KYW A;  2VB6 A;  1YA7 O;  3MYF A;  5E3C A;  1A7V A;  3B0U X;  2C03 A;  3MBG A;  3KPH A;  1OR2 A;  2MWQ A;  2OEV A;  1FMV A;  2PP4 A;  2QTV A;  3M15 A;  4JTC B;  2RD9 A;  4PJJ A;  2X0C A;  3X2Q C;  3QVY A;  1OCC C;  4MVR A;  4ER9 A;  2XS1 A;  2AP3 A;  5JVE A;  3EQL F;  3AGT A;  2W4M A;  3ABL C;  3K33 A;  3TJ6 A;  3SXK A;  3GM3 A;  2IBF A;  4U5D E;  4X0R A;  3JTL O;  2L6G A;  3S28 A;  4E18 A;  2EPO A;  4O79 A;  5B3S C;  2HMQ A;  1QQ3 A;  4PJM A;  2R7V A;  3JRM O;  2R7U A;  2KW3 C;  4BJT A;  1VLS A;  4PFO A;  5COG A;  1LIH A;  1OKK D;  4JUR I;  4JKV A;  5AGF A;  2HKV A;  2BE5 F;  2FGY A;  3ABM C;  4WGY A;  4Z9H A;  4IWB A;  2CYD A;  5T3W A;  1KNY A;  2RSE B;  5COM A;  2J9U A;  2YWA A;  2EIN C;  2GDC A;  1I5N A;  1A7E A;  2JPU A;  4I1M A;  2W4B A;  1AUE A;  2NPU A;  1YLM A;  3AOU A;  1OCR C;  3C7J A;  3S0X A;  1OW7 A;  3EFO A;  4KI2 A;  4N4W A;  1VB5 A;  4IJJ A;  4A2N B;  5JSL A;  1Z63 A;  1BDJ B;  1M2V A;  1XZP A;  1NLX A;  1V55 C;  2QLA A;  3NG1 A;  3NYL A;  4U5F E;  1JMW A;  2IXP A;  2HJ3 A;  3EG9 A;  4J30 B;  3RVZ A;  1UFB A;  2PNO A;  3HJC A;  1WGW A;  2Y69 C;  4K1O A;  5FZT A;  3KKB A;  4CS9 C;  3S90 A;  1TWA A;  2VCC A;  5KYX B;  4E0I A;  2WL8 A;  4ULW A;  4J7T A;  3OA1 A;  2YHS A;  3AG3 C;  1V54 C;  4H4K C;  3JRT A;  2XLH A;  2Z15 A;  3HNK A;  2WB7 A;  1EI7 A;  3IEE A;  4RDA A;  3S27 A;  2OQM A;  4EBB A;  1IZM A;  1C17 M;  2OCC C;  4HEA J;  4BG0 A;  2B0H A;  3EH1 A;  4Q4Z F;  2G3K A;  4GYT A;  2I8B A;  2ZXW C;  1U0B B;  1S05 A;  1WAT A;  4G0H A;  3JT1 A;  4IRU A;  4JC7 A;  3PCV A;  4N06 A;  3FXH A;  5A6J A;  1M56 C;  4LAC B;  5L0H A;  3DM9 B;  3G50 A;  4E7Z A;  1Q0K A;  3NYM A;  3IQ5 A;  3UMI A;  3HKK A;  3WOD F;  4BPM A;  5DQZ A;  2HFI A;  2A1D D;  5TJ5 E;  3ZWI A;  2WVO A;  4A4A A;  4U5G A;  4EBJ A;  4EBK A;  3KYJ A;  2XLM A;  3U2M A;  2EIK C;  1G8X A;  5K0I A;  3PHF 2;  1E84 A;  3EHN A;  2V26 A;  3GEE A;  1XWJ A;  2DI3 A;  2KNH A;  3RF3 A;  4DXW A;  4BJ6 A;  4CDA A;  1WTY A;  1YZC A;  1NZE A;  3HNL A;  2A6H F;  1RXQ A;  1PD1 A;  3H2U A;  1QPU A;  3EGX A;  4E17 A;  3SXZ A;  4IB4 A;  3A9C A;  3ZC4 A;  2H7B A;  5BQG A;  1TQG A;  2XLV A;  3DZA A;  2YLG A;  2ZD9 A;  1QLE C;  4O6Y A;  4E0H A;  3L34 A;  3F47 A;  2QNL A;  2CNW A;  3GOR A;  3HLZ A;  1G4U S;  2R02 A;  4NY3 A;  5JRA A;  2Q9B A;  2EIM C;  3LUT B;  3CSK A;  3U5S A;  3NKE A;  3K66 A;  4JVS A;  4DVZ A;  4MVO A;  1VYK A;  3EZI A;  1Z23 A;  4HFF B;  1LM3 B;  3V7O A;  2OKU A;  3KL4 A;  1ORJ A;  4PJN A;  4YT8 A;  5CIV A;  2LFD A;  4PAC A;  3SEO A;  2A68 F;  1J8Y F;  1TFO B;  2YL0 A;  4XWJ A;  3T4R A;  5HV9 A;  5A6B D;  3ZIB A;  4WAB A;  4I1O B;  4IAR A;  2HV7 A;  4Z9I A;  1T6U A;  5A6A A;  3RQF A;  1K04 A;  2XL4 A;  2G62 A;  4C7O B;  3M1C B;  3EGD B;  1DOV A;  2J46 A;  4MVU A;  1O87 A;  4R32 A;  3MLG A;  3ZTM A;  2CDQ A;  4Q7C A;  3W4Y A;  2YRF A;  5AC5 A;  2JD3 A;  5KYY B;  3K7D A;  1TR2 A;  2L9J A;  3I5P A;  1TWC A;  5GPG B;  5KYN A;  2DYR C;  1NFO A;  4QI2 A;  1JPN A;  3CAX A;  1L7C A;  3OWT A;  1LVK A;  3W8H A;  2WZL A;  3LS0 A;  5EGY A;  4HE8 D;  3DMD A;  4KNW A;  3U9J A;  3JCU Q;  2J9B A;  4JCZ A;  1AVO B;  4MTO A;  1OXB A;  3AG4 C;  2LP4 A;  2A0U A;  2ICW G;  5B1B C;  4OIN F;  1CGO A;  3DAF A;  4BJ6 C;  4NC3 A;  1FFT C;  4PR9 A;  2A0B A;  2HV6 A;  2V3C C;  2A6E F;  3E9V A;  4ULV A;  3SXM A;  2EPN A;  2C04 A;  1G4W R;  1UG7 A;  1YDI A;  2PF4 E;  3EH2 A;  3TQO A;  5DQT A;  2R25 A;  1SF8 A;  4DRI B;  4JZA A;  1OCO C;  5KYW B;  3DWW A;  2VC9 A;  4G7H F;  2M64 A;  2KGO A;  3K1I A;  3ZQV A;  5CI8 A;  1FFH A;  1R5I D;  1TWG A;  2R7W A;  3FVY A;  4JEB A;  5EHH A;  4U9E A;  3IQ6 A;  4N6H A;  2J7P A;  1Q0G A;  1TFK B;  2Y39 A;  4XEK A;  1U6H A;  3SYN A;  3NMK A;  3EJN A;  3B9Q A;  3DI5 A;  5L3V A;  4OIR F;  3DE8 A;  3N0T A;  1MMD A;  4B6I A;  2TMV P;  4J32 B;  5A69 A;  1ZW2 A;  3EGX B;  4DRH B;  1SZI A;  3LS1 A;  2GFH A;  1CPR A;  3V5Z A;  4G78 A;  1Y4C A;  3IQT A;  3AG2 C;  2BL2 A;  2VH3 A;  3KH2 A;  2Q4F A;  4OIQ F;  4G7O F;  2HZ8 A;  4NTF A;  1YA9 A;  3NRH A;  4IAQ A;  2P61 A;  4DRJ B;  3JYH A;  3H65 A;  3QTH A;  5F28 E;  3T6B A;  1YAR O;  5D91 A;  4Q5S F;  4AE4 A;  4CSA A;  2QY9 A;  1AEP A;  2H7O A;  2EIL C;  2IYL D;  1YZA A;  1ORY A;  1M57 C;  4DVY P;  3W8I A;  2MHR A;  3UGP A;  1T9K A;  4YJW A;  4MVS A;  1TWH A;  1FMW A;  3ZQY A;  4ZLC A;  1S7Z A;  3S84 A;  5FCL A;  2W9Y A;  4IAO A;  1Z3I X;  1I4Z A;  4JEA A;  3TOM A;  4E7S A;  2VCB A;  3OEO A;  1DOW A;  3UGO A;  2F22 A;  2LQG A;  4EIY A;  3F46 A;  3JSE O;  2YL1 A;  1NU9 C; 
#chains in the Genus database with same CATH homology
 4CBE A;  1MMA A;  3T6J A;  4CS7 A;  4XTK A;  3QMK A;  3Q6N A;  3AG1 C;  3LAY A;  2NUT B;  2WZF A;  4C3D A;  2VAS A;  1ZHZ A;  1W2W A;  2IXN A;  3O6X A;  4C3E A;  2P7V A;  5DS5 A;  3EFO B;  3SP1 A;  2XRH A;  4BJ5 C;  2R7T A;  3I5Q A;  2XXA A;  1VOM A;  1RJ9 B;  3UMH A;  1RJ9 A;  2NG1 A;  2ZPA A;  5F5H A;  4MND A;  1O5H A;  4I3M A;  4AX2 A;  5T3T A;  2Y3B A;  3DM5 A;  3WG7 C;  4FES A;  4KBL A;  1ZHX A;  2Q9C A;  1MNE A;  3K6B A;  4DBR A;  2CW0 F;  4LER A;  3LLK A;  5E33 A;  2YZS A;  4WJ0 A;  3TD7 A;  1IW7 F;  4OD4 A;  4OD5 A;  1ZYR F;  2IXM A;  5E3A A;  2YEV A;  3UNG C;  2ZXR A;  3Q6M A;  2O9X A;  5B1A C;  3DD7 A;  1Z6A A;  3EHM A;  3VYW A;  3POV A;  2Q9A A;  4BJ1 A;  3HTK C;  4RBN A;  4DOZ A;  2J45 A;  3O39 A;  1M2O A;  2DGJ A;  1D1A A;  1BR1 A;  2IOQ A;  2ZXP A;  4O6M A;  3LEV A;  4JCH A;  1OKK A;  3GOD A;  2NUT A;  4CIH A;  2Y3H A;  4FWV A;  4U5C E;  1VMA A;  5IY5 C;  4QDL A;  1D0Y A;  4U5B E;  1MND A;  3ABK C;  3FHD A;  3ZVR A;  3LLI A;  5CI9 A;  4LLE A;  5DS4 A;  1Z5Z A;  2CGE A;  3I4U A;  1NU7 D;  3RIP A;  4YT5 A;  3W2W A;  1ZHT A;  1VK5 A;  4RD9 A;  2CNW D;  5L3Q A;  3FDQ A;  2J9V A;  1ZHW A;  1VYI A;  4XLN F;  4YN0 B;  5KYX A;  5F5F A;  2ZXO A;  4W8K A;  2MYS A;  3RH3 A;  5DLJ A;  1KU2 A;  3DAG A;  2H7V C;  4XLP F;  3K1H A;  3RKO F;  4HFK B;  4ANJ A;  3N2Z B;  3E70 C;  3PMR A;  4GEH A;  2W45 A;  2Q3T A;  3N24 A;  3SZR A;  3EPV A;  2R7R A;  2R7S A;  1D1B A;  4KNV A;  1M2V B;  4YWQ A;  4PFP A;  3NDB B;  1PD0 A;  2PX0 A;  4O6N A;  4EWC A;  2X51 A;  3EGD A;  3ECS A;  2PFD A;  4AK9 A;  1NG1 A;  4F4B A;  3JSZ A;  1J8M F;  4KC9 A;  2KQ9 A;  5DVW A;  2J7P D;  4U5H A;  4CSA C;  1PCX A;  3KMI A;  2L81 A;  5E2Q A;  3MX3 A;  2WVQ A;  4I44 A;  4MQ9 F;  1QZX A;  3AQB A;  3ITF A;  4JW1 A;  5KYU A;  3NYJ A;  3VAY A;  3RYL A;  1D0Z A;  4LLC A;  3ZSU A;  3SNH A;  3NKD A;  1MMN A;  2J0X A;  5KYY A;  3CQZ A;  2XSE A;  2A69 F;  1D1C A;  4QI0 A;  3LES A;  3QZC A;  1ST6 A;  4PJL A;  3AQC A;  2DYS C;  4AE4 B;  2D5R B;  4CS8 A;  4K0D A;  3LJB A;  3GAN A;  4CS9 A;  4CS8 C;  2G3V A;  4BJ5 A;  1ZU4 A;  5BUO A;  3DXJ F;  4G7Z F;  2E87 A;  3B0P A;  2XXA B;  4PK4 A;  3B0V C;  3Q7G A;  3X1O A;  2EIJ C;  4U5E E;  1SMY F;  2P6V A;  3DJU B;  3S29 A;  2J9W A;  1BR2 A;  3ASN C;  1D0X A;  1TKN A;  3EZH A;  4C7O A;  1FTS A;  4M63 A;  4P6I C;  3UR3 C;  4YT4 A;  2Y3G A;  4JJF A;  4OIP F;  2WVN A;  5T1D B;  4BEJ A;  1LS1 A;  1ZU5 A;  3Q7L A;  2M4E A;  1BR4 A;  1MMG A;  2WZG A;  4FX5 A;  2NUP A;  2NUP B;  3RFY A;  4C3B A;  2OG2 A;  3CZ6 A;  4K7B A;  2PX3 A;  3EG9 B;  2LSE A;  5D92 A;  5HSW A;  4JJG A;  5DS6 A;  1JPJ A;  2IXO A;  2R7Q A;  3UMK A;  2R7O A;  2FFH A;  4OIO F;  3DJN B;  3ASO C;  1ZHY A;  4ZLD A;  4YT2 A;  3L0I A;  2B0J A;  4DBQ A;  3K1I C;  4O7G A;  3LNR A;  3FAJ A;  2KJG A;  1OCZ C;  3ZG1 A;  3W2V A;  5KYW A;  1LKX A;  5KYU B;  1N1C A;  2Y3D A;  2J0W A;  2VB6 A;  5E3C A;  3B0U X;  2C03 A;  2MWQ A;  2PP4 A;  1FMV A;  2QTV A;  4PJJ A;  3X2Q C;  1OCC C;  3EQL F;  2W4M A;  3ABL C;  3K33 A;  4U5D E;  4X0R A;  3S28 A;  4O79 A;  5B3S C;  4PJM A;  2R7V A;  2R7U A;  2KW3 C;  4BJT A;  4PFO A;  4JUR I;  1OKK D;  2BE5 F;  2FGY A;  3ABM C;  4IWB A;  5T3W A;  2J9U A;  2EIN C;  4I1M A;  2W4B A;  1OCR C;  3S0X A;  4KI2 A;  3EFO A;  4IJJ A;  4A2N B;  1Z63 A;  1M2V A;  3NG1 A;  1V55 C;  3NYL A;  4U5F E;  2R7X A;  2IXP A;  3EG9 A;  4J30 B;  3HJC A;  1WGW A;  2Y69 C;  4CS9 C;  3KKB A;  1TWA A;  5KYX B;  2WL8 A;  4ULW A;  3OA1 A;  2YHS A;  3AG3 C;  1V54 C;  4H4K C;  3JRT A;  2Z15 A;  3S27 A;  2WB7 A;  3IEE A;  4RDA A;  4EBB A;  1IZM A;  2OCC C;  4HEA J;  4BG0 A;  3EH1 A;  4Q4Z F;  2G3K A;  4GYT A;  2I8B A;  2ZXW C;  4G0H A;  3JT1 A;  4IRU A;  4N06 A;  1M56 C;  4LAC B;  3DM9 B;  4E7Z A;  3NYM A;  3UMI A;  3WOD F;  5DQZ A;  2A1D D;  2WVO A;  4U5G A;  2EIK C;  1G8X A;  3PHF 2;  3EHN A;  2V26 A;  2KNH A;  4BJ6 A;  1NZE A;  2A6H F;  1PD1 A;  3EGX A;  3ZC4 A;  2H7B A;  3DZA A;  4O6Y A;  1QLE C;  3L34 A;  3F47 A;  2CNW A;  3HLZ A;  4NY3 A;  2Q9B A;  2EIM C;  3CSK A;  3NKE A;  3K66 A;  4JVS A;  4DVZ A;  1VYK A;  3EZI A;  1Z23 A;  4HFF B;  3V7O A;  3KL4 A;  4PJN A;  4YT8 A;  3SEO A;  2A68 F;  1J8Y F;  3T4R A;  4XWJ A;  3ZIB A;  4I1O B;  2HV7 A;  2XL4 A;  2G62 A;  4C7O B;  3M1C B;  3EGD B;  2J46 A;  1O87 A;  3MLG A;  2CDQ A;  4Q7C A;  2JD3 A;  5KYY B;  3K7D A;  1TR2 A;  2L9J A;  3I5P A;  1TWC A;  5KYN A;  2DYR C;  4QI2 A;  1JPN A;  3OWT A;  1LVK A;  3W8H A;  2WZL A;  3LS0 A;  5EGY A;  4HE8 D;  3DMD A;  4KNW A;  3JCU Q;  3AG4 C;  5B1B C;  4OIN F;  3DAF A;  4BJ6 C;  1FFT C;  2HV6 A;  2V3C C;  2A6E F;  3E9V A;  2C04 A;  3EH2 A;  2PF4 E;  5DQT A;  1SF8 A;  4JZA A;  1OCO C;  5KYW B;  4G7H F;  2KGO A;  5CI8 A;  1FFH A;  1TWG A;  2R7W A;  3FVY A;  5EHH A;  2J7P A;  2Y39 A;  3SYN A;  3EJN A;  3B9Q A;  5L3V A;  4OIR F;  4B6I A;  3N0T A;  1MMD A;  4J32 B;  3EGX B;  1SZI A;  3LS1 A;  2GFH A;  3AG2 C;  4OIQ F;  2VH3 A;  3KH2 A;  4G7O F;  3NRH A;  3JYH A;  3H65 A;  3T6B A;  5D91 A;  4Q5S F;  4AE4 A;  4CSA A;  2QY9 A;  2H7O A;  2EIL C;  2IYL D;  1M57 C;  4DVY P;  3W8I A;  3UGP A;  4YJW A;  1TWH A;  1FMW A;  4ZLC A;  1S7Z A;  5FCL A;  2W9Y A;  4IAO A;  1Z3I X;  4E7S A;  3UGO A;  3OEO A;  3F46 A;  1NU9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...