3K33A

Crystal structure of the phd-doc complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
124
structure length
124
Chain Sequence
b'MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSALLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death on curing protein
publication title Allostery and intrinsic disorder mediate transcription regulation by conditional cooperativity.
pubmed doi rcsb
source organism Enterobacteria phage p1
molecule tags Toxin/antitoxin
total genus 47
structure length 124
sequence length 124
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1870 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3k33A00
3K33A 3DD7A 3KH2A
chains in the Genus database with same CATH superfamily
2MHRA 2P1AA 2HV6A 1ZZPA 4JVSA 3JZ0A 1Z7Qc 4C7OA 3FHDA 1HE9A 3KPHA 5KYNA 1J8YF 2XL6A 4YT8A 3LNRA 4LACB 4ULWA 4MVMA 3O39A 1RMVA 2R7XA 3IQ6A 2XLVA 2KSFA 4I1OB 2HSBA 4CDYA 2LIGA 1OCZC 3Q7LA 5EGYA 1ZW3A 2D5RB 1M6TA 2Q00A 2M64A 3U3BA 1NG1A 4NY3A 1Q0MA 4BPMA 1O3UA 5B3SC 2VH3A 3QZCA 3SP1A 1NSGB 4AK9A 1TWAA 1M2OA 2R9RB 3M79A 3N0TA 5KYUA 3ZVRA 3WODF 4JW1A 3K6BA 1GS9A 2H7VC 1KU2A 2H7OA 4YT4A 1S05A 3KYIA 4IWBA 3VF0A 2QE9A 1AEPA 2WL8A 4GEHA 1U6HA 3JCUQ 4J32B 3MLGA 4J7TA 4KC9A 3POVA 4AL0A 3UGOA 2J7PD 2XM4A 4HEAJ 4AE4A 2OCCC 1WASA 3EZIA 2HJMA 2PFDA 2A6HF 2QUPA 5D92A 1XZQA 2YWAA 4FAPB 2BC5A 2G3KA 3EZHA 1MNDA 4IAOA 5JP7A 2DYSC 2EIJC 2FGYA 5DS6A 3EH2A 1RKEA 1JR8A 4N06A 3VRCA 4JEBA 1YYXA 1VK5A 4JRZA 2R7UA 3W4YA 4NTAA 4LDKA 2R7VA 1WOLA 2R05A 4U5BE 5JRAA 2OQMA 1YARO 5JS5A 1UFBA 1JOGA 4YT2A 1SYQA 1WGWA 3K1IA 2ZXRA 3IQCA 5KYUB 1L3PA 5DQTA 1YZAA 1VTMP 3NDBB 5E3CA 3HNIA 2I8BA 3E9VA 3HKKA 4BJ6C 2HMQA 4PJMA 4RDAA 1YZCA 3EPVA 3VYWA 1QZXA 2MWQA 1I5NA 4CS8A 4MVOA 3QW1A 4PFOA 3U3FA 4CS9C 1T5OA 3NKEA 4EHPA 3AJMA 4EBKA 3ZC4A 4MTOA 4AE4B 3C63A 4IRUA 2DI3A 2XLHA 2YQYA 3GEEA 3JRTA 2OJQA 3PMRA 1A0BA 4CJGA 4ZLCA 5A6BA 4H4KC 3C62A 3T6GB 5HV9A 3NMJA 2NG1A 1GGQA 4I3MA 4OD5A 4WGZA 1DOWA 2OKUA 4P9FA 3U5SA 2PX0A 4W8PA 1H9GA 4IGGA 5T3TA 4DBRA 1VOMA 3FMSA 1M2VA 4JTDB 5JSLA 2H7BA 4EWCA 2W9YA 1AVOB 2EPNA 3LLIA 3IPMO 4Q5SF 3S0XA 4C3DA 1RXQA 2GDCA 2HJ3A 2YHSA 3M4CA 3S28A 2HS5A 3PCVA 4K1OA 4DJ9A 2EIMC 4JZAA 5EHHA 1TKNA 1BR1A 2UUIA 5F28E 3M1CB 1G4US 1Y6DA 2KK1A 4OD4A 3SXMA 4XWJA 1EQ1A 3ECSA 3Q6MA 3RH3A 1EA8A 1HMDA 3RIPA 4IAQA 3LNMB 1WN0A 1RJ9A 1HW1A 2YLIA 3NMKA 1D0YA 2Q3TA 4JKVA 1BR2A 1LKXA 1VB5A 1E85A 4BJ5C 1OKKD 3LJBA 3DZAA 2Z15A 5HSWA 1W2WA 2KYHA 4J30B 3EHMA 3FVYA 4N6CA 2PP4A 4P9TA 4MVSA 5D91A 2X0CA 3AGUA 4P6IC 3NYLA 3R2PA 1JPJA 4WJ0A 1IW7F 3DMDA 4CDVA 2R7TA 1M2VB 2A6EF 4WGYA 3X1OA 1OQCA 2DGJA 3HNKA 5JLIA 2CW0F 4DXWA 4HFFB 4JIOA 1SF8A 3V7OA 4CDAA 3OA1A 4U5DE 2IXMA 2XSEA 3DWWA 4E17A 4ANJA 2LD6A 1SMYF 1ZHZA 1MMNA 2EIKC 5L0IA 3DD7A 3RFYA 3VAYA 3CAXA 2BE5F 5F5FA 2LFDA 3KL4A 4DVYP 3EH1A 3ZTMA 2P61A 3CSKA 1RJ9B 5COFA 3ITFA 3SEOA 5FCLA 2PF4E 2IXNA 1YLMA 1FTSA 2AP3A 2Y3BA 3DAFA 5DS4A 1MMAA 2IM8A 4YL1A 2QNLA 4JJFA 4FWVA 3ZQYA 4YWQA 5JT4A 2YRFA 2RSEB 3KH2A 1SZIA 3E70C 4U9EA 5B1BC 2VCBA 4E18A 1XZPA 2HSQA 5A6AA 1DOVA 5BQHA 3O10A 4YK5A 2WZGA 2LP4A 4OIQF 5CI9A 3SZRA 1A7VA 3ZDLA 5L0HA 3KKBA 1PCXA 4MTFA 3A11A 4G7HF 2CYDA 2P0NA 2LSEA 4MW8A 2D4UA 1BR4A 3NKDA 4JCHA 1ZHYA 4NTBA 2V26A 5T3WA 2AWYA 2ICWG 3UMIA 1AUEA 4G0HA 1E86A 1JPNA 3BEHA 4LLEA 1T9KA 2IXOA 1H9TA 2KJGA 1VYIA 2W4MA 3FDQA 4E7SA 3C8GD 1OW7A 2A69F 3SXKA 2HUJA 5A6KA 2A0UA 2A68F 3AGTA 1M56C 1OCCC 3QW0A 4BJ5A 2ZPAA 2YL0A 3C8ZA 4MS2A 5BUOA 1T6IA 2Y3HA 3S9OA 1LI5A 3HTKC 2B0HA 3SXZA 5K0IA 2UUHA 3V5XA 3TD7A 4CSAC 3IQ5A 1O5HA 2LCHA 1A41A 4MVRA 2IOQA 2A1DD 2YL3A 1H6GA 2XXAA 4FESA 3EGDA 4MVQA 3RQFA 3VM6A 4E7ZA 4DOZA 5L0DA 1Z63A 3V5YA 1K04A 1OXKA 4AL1A 2LQGA 1JRAA 2XLDA 2WZFA 2EPOA 1QPUA 2HFIA 2CNWA 3HNLA 1FR0A 3QVYA 3RKOF 2AU5A 3GANA 1NLXA 2BL2A 1Q0FA 2IYLD 4G78A 4XLPF 4NTFA 1SR2A 2W4BA 2WVNA 3NYMA 5JUAA 2A0BA 4EKWA 1YJGA 2Q7RA 4FX5A 4O79A 5FZTA 4E0HA 4ZLDA 4XLNF 4XEVA 3DJUB 3ASOC 4EBJA 2YL1A 5L3VA 1CGME 3M4BA 4DRIB 2NPUA 2PX3A 2ZXPA 3HNJA 1ZU4A 4N4WA 2XL8A 2OJED 1ORJA 4PACA 4OIOF 1PV3A 2ZXWC 4O6MA 4QI0A 1QVXA 2NSFA 4K0DA 3TULA 3AG1C 2ETSA 2XXAB 3Q7GA 3EGDB 1YYJA 5COGA 2G62A 4A2NB 2MYSA 1Z5ZA 4U5CE 4PK4A 3IHUA 3UGPA 2ZD9A 4DRHB 3C7JA 3LLKA 5COMA 3WHNA 5CI8A 2XRHA 3O6XA 4D4XA 1BBHA 1A7EA 4XTKA 2M4EA 2J9UA 4IARA 5BQIA 1OR3A 3H2UA 4AX2A 1BDJB 4BJ1A 4EIYA 5E33A 2FAPB 1ST6A 1MMGA 3UMHA 2J0XA 2L9JA 2EPMX 3KYJA 1TR2A 4U5HA 3V5ZA 5KYWA 2QTVA 5A69A 2R7RA 2WVOA 3K33A 3K7DA 3B29A 1HW2A 3QTHA 1LI7A 1OCOC 1LM3B 3HJCA 4N6HA 3TJ6A 1FMVA 1G8XA 4PJJA 1FFTC 3W8HA 3US6A 3MBGA 4Z9HA 1ZU5A 3L0IA 4YJWA 2XLMA 3UMKA 1ZHTA 3G4ZA 5E3AA 5L3QA 3SNHA 1E83A 2ASRA 1VLTA 3RQEA 1NU7D 3U8VA 5L0FA 1VLSA 2Q4FA 3DAGA 2L81A 2VASA 3AG2C 3ZSUA 4E0IA 1OW6A 256BA 2OOCA 4QI2A 3B71A 2IBFA 2QY9A 1JMWA 1Y4CA 1JAFA 2KGOA 3FOPA 3RW0A 4IB4A 4I1MA 4JJGA 4QDLA 1U0BB 1M57C 3T6BA 3FAPB 5L0GA 1ZW2A 1TFKB 1UG7A 4I44A 2NUPA 5KYWB 2R7SA 4BJ6A 3CZ6A 4JE9A 1C02A 2OEVA 2J0WA 2GFHA 4M63A 4NCQA 3ATPA 2LFFA 4PJNA 2ZXOA 2AVKA 3SXYA 3T9OA 3TJ5A 3I5PA 4CS9A 3I4UA 4WABA 3JSEO 2YLGA 1ORSC 3EG9A 1G5ZA 1CGOA 1NU9C 1NZEA 2XL4A 4Q7CA 3RVYA 2HZ8A 4CJOA 4IJJA 3PHF2 1Z3IX 1O87A 1WTYA 1WWPA 2Q9BA 1CGNA 1E2XA 3N2ZB 2J45A 2KNHA 3DJNB 2VCAA 1PD1A 1OW8A 2OU6A 3JT1A 1T01A 4O7GA 3C8GA 4YL0A 2Y3GA 3AG4C 3I5QA 2EPKX 3NG1A 1ZYRF 1YA9A 1ZVZA 2C03A 3ZWIA 2HMZA 5L0CA 4ULVA 1CPQA 3AQCA 3NRHA 1V74B 3AOUA 1QSPA 1D0XA 1RKCA 2DB4A 2WB7A 2J9BA 2KQ9A 4KBLA 4U5FE 2R7OA 2V3CC 1VMAA 5BQGA 2IXPA 2NUPB 2GWWA 3K1IC 2WVQA 4CBEA 4MW3A 4L6RA 3X2QC 2Q9AA 3TOMA 4DVZA 2OEXA 1TWGA 5B3IA 5CIVA 3QVZA 2AWCA 2CDQA 2J7PA 3GEHA 4YN0B 3ABKC 1L7CA 4CS8C 4DRJB 3GWLA 4XPXA 4NC3A 1R4TA 3EG9B 3L8JA 1HY5A 4KI2A 3JSZA 3IQTA 3TQOA 1R5ID 2R25A 2JX0A 2L6HA 1KTMA 2R02A 1G4WR 1RCPA 3KMIA 2DYRC 1N1CA 2XLWA 3MYFA 3RF3A 1T6UA 2L6FA 3C8GB 3LS0A 3U2LA 1FFHA 2L6GA 4PR9A 1QLEC 4JURI 1KNYA 2P7VA 1EKYA 1NBBA 1TFOB 3Q6NA 4ONSA 3T4RA 2CGEA 4BEJA 3EHNA 2Y3DA 2PBEA 3ASNC 3MX3A 3DE9A 5T1DB 3GWNA 5AC5A 5EK0A 2L7AA 1Q0GA 3H2VA 3JTLO 4HFKB 2R03A 3TK0A 5KYXA 3RQGA 3DKAA 4F4BA 1LE4A 5F5HA 3EFOA 1MQVA 2VC9A 1Z23A 1LPEA 2Q9CA 4XEFA 3EGXA 3MFNA 1D1AA 3C18A 3TOLA 1ZHXA 2YZSA 2LK4A 3M15A 1V4AA 2H8AA 1D0ZA 3SYNA 4D4NA 2TMVP 3S84A 4X0RA 2J9VA 3K66A 1LS1A 4PJLA 2HKVA 2HV7A 4GYTA 2YEVA 2XS8A 1YVIA 2X51A 3NMIA 4XQ1A 4HE8D 3WG7C 3F46A 1XWJA 4OIRF 2I15A 2EPLX 3BRJA 3FOOA 4MVUA 1OR2A 3W8IA 1EI7A 4EBBA 2R7QA 4B6IA 3N24A 4Z9JA 1E84A 1WATA 4U5GA 3DE8A 3DM5A 2O9XA 1Q0DA 2XS1A 3L1MA 3LAYA 3LEVA 3GEIA 3LEOA 4RBNA 3T6JA 3UR3C 3EQLF 4LDRA 3UNGC 3IEEA 4O6NA 3ZG1A 2CNWD 3U2MA 2J46A 4CIPA 5KYXB 3B0VC 3GM3A 4C3EA 1OKKA 2XM0A 3EFOB 4A4AA 4CX9A 1OCRC 3A9CA 1Q0KA 2QLAA 3CEXA 3EGXB 5A6JA 2GAQA 3H65A 1QQ3A 4JTAB 3B0PA 3WAQA 1NFNA 3JYHA 2NUTA 1FMWA 4CSAA 1LIHA 3W2WA 2OG2A 2P6VA 4MNDA 2JPUA 3G4XA 1RKEB 4KNVA 4BEMJ 1MNEA 5E2QA 1Z6AA 1NFOA 3QMKA 3L34A 3PDMP 1GM5A 1PD0A 1MMDA 3FXHA 2NSGA 2GA0A 4MTGA 5AC4A 4MVZA 3F47A 3U9JA 5AGFA 1D1BA 3CQZA 1D1CA 1B68A 1H7IA 3LS1A 4OINF 5A6BD 2EINC 4PFPA 4JEAA 3R7CA 3DXJF 3U9MA 3ZQVA 2XLOA 1A7DA 3AQBA 2JD3A 5DQZA 2EILC 2F22A 2XLEA 1LVKA 1I4YA 3RVZA 1TWHA 1QKRA 4CIHA 1FAPB 5JVEA 5DVWA 1YDIA 2Y39A 3GM2A 4G7ZF 3GM1A 1HE1A 1OXBA 3LUTB 3JRMO 1J8MF 2C04A 4U9DA 3B9QA 4BJTA 1YA7O 4YL3A 3B0UX 3L8IA 3O55A 4LERA 4Z9IA 2NUTB 1T6QA 1HMOA 3EJNA 3MYIA 5B1AC 4U5EE 1U89A 3DM9B 4ER9A 1V55C 3K1HA 4KNWA 2YLDA 4C3BA 5IY5C 4G7OF 1TQGA 5KYYA 1V54C 4LLCA 2YL7A 1K40A 4XPWA 4K7BA 4XEKA 4W8KA 3LESA 4DBQA 3NYJA 1APCA 1GQAA 3G50A 2KW3C 2YKZA 3HLZA 4YT5A 4NQFA 4UDVA 3S29A 3AG3C 4BG0A 3ABLC 4RD9A 3RYLA 2CCYA 4JCZA 5DS5A 1F1MA 1C03A 1LS4A 4GQHA 1BZ4A 2G3VA 4JC7A 3S90A 1IZMA 2RD9A 1YAUO 4R32A 3DI5A 1ORYA 3J06A 2E87A 4LDQA 2J8WA 2WZLA 1FNTc 4OIPF 4H54A 4MQ9F 1S7ZA 2VCCA 1VYKA 2KC3A 3OEOA 1I4ZA 3S27A 4CS7A 4C7OB 3OWTA 3U8PA 4O6YA 1ZHWA 3GODA 3W2VA 2FFHA 4EUKB 5DLJA 4Q4ZF 3GORA 2YVKA 2J9WA 5L0JA 1K05A 5KYYB 2VB6A 4XPYA 3ABMC 4J7YA 2B0JA 3U0CA 5GPGB 3FAJA 3JYYA 3ZTZA 2Y69C 5TJ5E 3ZIBA 1C17M 2PNOA 1LE2A 2W45A 4JTCB 2R7WA 1TWCA 1CPRA
chains in the Genus database with same CATH topology
2HV6A 4JVSA 3FHDA 5KYNA 1J8YF 4YT8A 3LNRA 4LACB 4ULWA 2R7XA 3O39A 4I1OB 1OCZC 3Q7LA 5EGYA 2D5RB 1NG1A 4NY3A 5B3SC 2VH3A 3QZCA 3SP1A 4AK9A 1TWAA 1M2OA 3N0TA 5KYUA 3ZVRA 3WODF 4JW1A 3K6BA 2H7VC 1KU2A 2H7OA 4YT4A 4IWBA 4GEHA 2WL8A 3JCUQ 4J32B 3MLGA 4KC9A 3POVA 3UGOA 2J7PD 4HEAJ 4AE4A 2OCCC 3EZIA 2PFDA 5D92A 2A6HF 2G3KA 3EZHA 1MNDA 4IAOA 2DYSC 2EIJC 2FGYA 5DS6A 3EH2A 4N06A 2R7UA 1VK5A 2R7VA 4U5BE 4YT2A 1WGWA 2ZXRA 5KYUB 5DQTA 3NDBB 5E3CA 2I8BA 3E9VA 4BJ6C 4PJMA 4RDAA 3EPVA 3VYWA 1QZXA 2MWQA 4CS8A 4PFOA 4CS9C 3NKEA 3ZC4A 4AE4B 4IRUA 3PMRA 3JRTA 4ZLCA 4H4KC 2NG1A 4I3MA 4OD5A 2PX0A 5T3TA 1VOMA 1M2VA 2H7BA 4EWCA 2W9YA 3LLIA 4Q5SF 3S0XA 4C3DA 2YHSA 3S28A 2EIMC 4JZAA 5EHHA 1TKNA 1BR1A 3M1CB 4OD4A 4XWJA 3ECSA 3Q6MA 3RH3A 3RIPA 1RJ9A 1D0YA 2Q3TA 1BR2A 1LKXA 4BJ5C 1OKKD 3LJBA 3DZAA 2Z15A 5HSWA 1W2WA 3TD7A 4J30B 3EHMA 3FVYA 5D91A 2PP4A 4P6IC 3NYLA 1JPJA 4WJ0A 1IW7F 3DMDA 2R7TA 1M2VB 2A6EF 3X1OA 2DGJA 2CW0F 4HFFB 3V7OA 1SF8A 3OA1A 4U5DE 2IXMA 2XSEA 4ANJA 1SMYF 1ZHZA 1MMNA 2EIKC 3DD7A 3RFYA 3VAYA 2BE5F 3KL4A 4DVYP 3EH1A 3CSKA 3SEOA 1RJ9B 5FCLA 3ITFA 2PF4E 2IXNA 1FTSA 2Y3BA 3DAFA 5DS4A 1MMAA 4JJFA 4FWVA 4YWQA 3KH2A 4DBRA 1SZIA 3E70C 5B1BC 2WZGA 4OIQF 5CI9A 3SZRA 3KKBA 1PCXA 4G7HF 2LSEA 1BR4A 3NKDA 4JCHA 1ZHYA 2V26A 5T3WA 3UMIA 4G0HA 1JPNA 4LLEA 2IXOA 2KJGA 1VYIA 2W4MA 3FDQA 4E7SA 2A69F 2A68F 1M56C 1OCCC 4BJ5A 2ZPAA 5BUOA 2Y3HA 3HTKC 4CSAC 1O5HA 2IOQA 2A1DD 2XXAA 4FESA 3EGDA 4E7ZA 4DOZA 1Z63A 2WZFA 2CNWA 3RKOF 3GANA 4XLPF 2IYLD 2W4BA 2WVNA 3NYMA 4FX5A 4O79A 4ZLDA 4XLNF 3DJUB 3ASOC 5L3VA 2PX3A 2ZXPA 1ZU4A 4OIOF 2ZXWC 4O6MA 4QI0A 4K0DA 3AG1C 2XXAB 3Q7GA 3EGDB 2G62A 4A2NB 2MYSA 1Z5ZA 4U5CE 4PK4A 3UGPA 3LLKA 5CI8A 2XRHA 3O6XA 4XTKA 2M4EA 2J9UA 4AX2A 4BJ1A 5E33A 3UMHA 1ST6A 1MMGA 2J0XA 2L9JA 4U5HA 1TR2A 5KYWA 2QTVA 2R7RA 2WVOA 3K33A 3K7DA 1OCOC 3HJCA 1FMVA 1G8XA 4PJJA 1FFTC 3W8HA 1ZU5A 3L0IA 4YJWA 3UMKA 1ZHTA 5E3AA 5L3QA 3SNHA 1NU7D 3DAGA 2L81A 2VASA 3AG2C 4QI2A 2QY9A 2KGOA 4I1MA 4JJGA 4QDLA 1M57C 3T6BA 4I44A 5KYWB 2R7SA 2NUPA 4BJ6A 3CZ6A 2J0WA 2GFHA 4M63A 4PJNA 2ZXOA 3I5PA 4CS9A 3I4UA 3EG9A 1NZEA 1NU9C 2XL4A 4Q7CA 3PHF2 4IJJA 1O87A 1Z3IX 2Q9BA 3N2ZB 2J45A 2KNHA 3DJNB 1PD1A 3JT1A 4O7GA 2Y3GA 3AG4C 3NG1A 3I5QA 1ZYRF 2C03A 3AQCA 3NRHA 2WB7A 1D0XA 2KQ9A 4KBLA 4U5FE 2R7OA 2V3CC 1VMAA 2IXPA 2NUPB 3K1IC 4CBEA 2WVQA 3X2QC 2Q9AA 4DVZA 1TWGA 2CDQA 2J7PA 4YN0B 3ABKC 4CS8C 3EG9B 4KI2A 3JSZA 3KMIA 2DYRC 1N1CA 3LS0A 1FFHA 1QLEC 4JURI 2P7VA 3Q6NA 3T4RA 2CGEA 4BEJA 3EHNA 2Y3DA 3ASNC 3MX3A 5T1DB 4HFKB 5KYXA 4F4BA 5F5HA 3EFOA 1Z23A 2Q9CA 3EGXA 3ZSUA 1D1AA 1ZHXA 2YZSA 1D0ZA 3SYNA 4X0RA 2J9VA 3K66A 1LS1A 4PJLA 2HV7A 4GYTA 2YEVA 2X51A 4HE8D 3WG7C 3F46A 4OIRF 3W8IA 4EBBA 2R7QA 4B6IA 3N24A 4U5GA 3DM5A 4RBNA 2O9XA 3LAYA 3LEVA 3T6JA 3UR3C 3EQLF 3UNGC 3IEEA 4O6NA 3ZG1A 2CNWD 3B0VC 2J46A 5KYXB 4C3EA 1OKKA 3EFOB 1OCRC 3EGXB 3H65A 3B0PA 3JYHA 2NUTA 1FMWA 4CSAA 3W2WA 2OG2A 2P6VA 4MNDA 4KNVA 1MNEA 5E2QA 1Z6AA 3QMKA 3L34A 1PD0A 1MMDA 3F47A 1D1BA 3CQZA 1D1CA 3LS1A 4OINF 2EINC 4PFPA 3DXJF 3AQBA 2JD3A 5DQZA 2EILC 1LVKA 1TWHA 4CIHA 5DVWA 2Y39A 4G7ZF 5F5FA 1J8MF 2C04A 3B9QA 4BJTA 3B0UX 4LERA 4C7OA 5B1AC 2NUTB 3EJNA 4U5EE 3DM9B 1V55C 3K1HA 4KNWA 5IY5C 4C3BA 4G7OF 5KYYA 1V54C 4LLCA 4K7BA 4DBQA 4W8KA 3LESA 3NYJA 2KW3C 3HLZA 4YT5A 3S29A 3AG3C 4BG0A 3ABLC 4RD9A 3RYLA 5DS5A 2G3VA 1IZMA 2E87A 2WZLA 4OIPF 4MQ9F 1S7ZA 3OEOA 1VYKA 3S27A 4CS7A 4C7OB 3OWTA 4O6YA 1ZHWA 3GODA 3W2VA 2FFHA 4Q4ZF 5DLJA 2J9WA 5KYYB 2VB6A 3ABMC 2B0JA 3FAJA 2Y69C 3ZIBA 2R7WA 2W45A 1TWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K33 A;  3DD7 A;  3KH2 A; 
#chains in the Genus database with same CATH topology
 2MHR A;  2P1A A;  2HV6 A;  1ZZP A;  4JVS A;  3JZ0 A;  1Z7Q c;  4C7O A;  3FHD A;  1HE9 A;  3KPH A;  5KYN A;  1J8Y F;  2XL6 A;  4YT8 A;  3LNR A;  4LAC B;  4ULW A;  4MVM A;  3O39 A;  1RMV A;  2R7X A;  3IQ6 A;  2XLV A;  2KSF A;  4I1O B;  2HSB A;  4CDY A;  2LIG A;  1OCZ C;  3Q7L A;  5EGY A;  1ZW3 A;  2D5R B;  1M6T A;  2Q00 A;  2M64 A;  3U3B A;  1NG1 A;  4NY3 A;  1Q0M A;  4BPM A;  1O3U A;  5B3S C;  2VH3 A;  3QZC A;  3SP1 A;  1NSG B;  4AK9 A;  1TWA A;  1M2O A;  2R9R B;  3M79 A;  3N0T A;  5KYU A;  3ZVR A;  3WOD F;  4JW1 A;  3K6B A;  1GS9 A;  2H7V C;  1KU2 A;  2H7O A;  4YT4 A;  1S05 A;  3KYI A;  4IWB A;  3VF0 A;  2QE9 A;  1AEP A;  2WL8 A;  4GEH A;  1U6H A;  3JCU Q;  4J32 B;  3MLG A;  4J7T A;  4KC9 A;  3POV A;  4AL0 A;  3UGO A;  2J7P D;  2XM4 A;  4HEA J;  4AE4 A;  2OCC C;  1WAS A;  3EZI A;  2HJM A;  2PFD A;  2A6H F;  2QUP A;  5D92 A;  1XZQ A;  2YWA A;  4FAP B;  2BC5 A;  2G3K A;  3EZH A;  1MND A;  4IAO A;  5JP7 A;  2DYS C;  2EIJ C;  2FGY A;  5DS6 A;  3EH2 A;  1RKE A;  1JR8 A;  4N06 A;  3VRC A;  4JEB A;  1YYX A;  1VK5 A;  4JRZ A;  2R7U A;  3W4Y A;  4NTA A;  4LDK A;  2R7V A;  1WOL A;  2R05 A;  4U5B E;  5JRA A;  2OQM A;  1YAR O;  5JS5 A;  1UFB A;  1JOG A;  4YT2 A;  1SYQ A;  1WGW A;  3K1I A;  2ZXR A;  3IQC A;  5KYU B;  1L3P A;  5DQT A;  1YZA A;  1VTM P;  3NDB B;  5E3C A;  3HNI A;  2I8B A;  3E9V A;  3HKK A;  4BJ6 C;  2HMQ A;  4PJM A;  4RDA A;  1YZC A;  3EPV A;  3VYW A;  1QZX A;  2MWQ A;  1I5N A;  4CS8 A;  4MVO A;  3QW1 A;  4PFO A;  3U3F A;  4CS9 C;  1T5O A;  3NKE A;  4EHP A;  3AJM A;  4EBK A;  3ZC4 A;  4MTO A;  4AE4 B;  3C63 A;  4IRU A;  2DI3 A;  2XLH A;  2YQY A;  3GEE A;  3JRT A;  2OJQ A;  3PMR A;  1A0B A;  4CJG A;  4ZLC A;  5A6B A;  4H4K C;  3C62 A;  3T6G B;  5HV9 A;  3NMJ A;  2NG1 A;  1GGQ A;  4I3M A;  4OD5 A;  4WGZ A;  1DOW A;  2OKU A;  4P9F A;  3U5S A;  2PX0 A;  4W8P A;  1H9G A;  4IGG A;  5T3T A;  4DBR A;  1VOM A;  3FMS A;  1M2V A;  4JTD B;  5JSL A;  2H7B A;  4EWC A;  2W9Y A;  1AVO B;  2EPN A;  3LLI A;  3IPM O;  4Q5S F;  3S0X A;  4C3D A;  1RXQ A;  2GDC A;  2HJ3 A;  2YHS A;  3M4C A;  3S28 A;  2HS5 A;  3PCV A;  4K1O A;  4DJ9 A;  2EIM C;  4JZA A;  5EHH A;  1TKN A;  1BR1 A;  2UUI A;  5F28 E;  3M1C B;  1G4U S;  1Y6D A;  2KK1 A;  4OD4 A;  3SXM A;  4XWJ A;  1EQ1 A;  3ECS A;  3Q6M A;  3RH3 A;  1EA8 A;  1HMD A;  3RIP A;  4IAQ A;  3LNM B;  1WN0 A;  1RJ9 A;  1HW1 A;  2YLI A;  3NMK A;  1D0Y A;  2Q3T A;  4JKV A;  1BR2 A;  1LKX A;  1VB5 A;  1E85 A;  4BJ5 C;  1OKK D;  3LJB A;  3DZA A;  2Z15 A;  5HSW A;  1W2W A;  2KYH A;  4J30 B;  3EHM A;  3FVY A;  4N6C A;  2PP4 A;  4P9T A;  4MVS A;  5D91 A;  2X0C A;  3AGU A;  4P6I C;  3NYL A;  3R2P A;  1JPJ A;  4WJ0 A;  1IW7 F;  3DMD A;  4CDV A;  2R7T A;  1M2V B;  2A6E F;  4WGY A;  3X1O A;  1OQC A;  2DGJ A;  3HNK A;  5JLI A;  2CW0 F;  4DXW A;  4HFF B;  4JIO A;  1SF8 A;  3V7O A;  4CDA A;  3OA1 A;  4U5D E;  2IXM A;  2XSE A;  3DWW A;  4E17 A;  4ANJ A;  2LD6 A;  1SMY F;  1ZHZ A;  1MMN A;  2EIK C;  5L0I A;  3DD7 A;  3RFY A;  3VAY A;  3CAX A;  2BE5 F;  5F5F A;  2LFD A;  3KL4 A;  4DVY P;  3EH1 A;  3ZTM A;  2P61 A;  3CSK A;  1RJ9 B;  5COF A;  3ITF A;  3SEO A;  5FCL A;  2PF4 E;  2IXN A;  1YLM A;  1FTS A;  2AP3 A;  2Y3B A;  3DAF A;  5DS4 A;  1MMA A;  2IM8 A;  4YL1 A;  2QNL A;  4JJF A;  4FWV A;  3ZQY A;  4YWQ A;  5JT4 A;  2YRF A;  2RSE B;  3KH2 A;  1SZI A;  3E70 C;  4U9E A;  5B1B C;  2VCB A;  4E18 A;  1XZP A;  2HSQ A;  5A6A A;  1DOV A;  5BQH A;  3O10 A;  4YK5 A;  2WZG A;  2LP4 A;  4OIQ F;  5CI9 A;  3SZR A;  1A7V A;  3ZDL A;  5L0H A;  3KKB A;  1PCX A;  4MTF A;  3A11 A;  4G7H F;  2CYD A;  2P0N A;  2LSE A;  4MW8 A;  2D4U A;  1BR4 A;  3NKD A;  4JCH A;  1ZHY A;  4NTB A;  2V26 A;  5T3W A;  2AWY A;  2ICW G;  3UMI A;  1AUE A;  4G0H A;  1E86 A;  1JPN A;  3BEH A;  4LLE A;  1T9K A;  2IXO A;  1H9T A;  2KJG A;  1VYI A;  2W4M A;  3FDQ A;  4E7S A;  3C8G D;  1OW7 A;  2A69 F;  3SXK A;  2HUJ A;  5A6K A;  2A0U A;  2A68 F;  3AGT A;  1M56 C;  1OCC C;  3QW0 A;  4BJ5 A;  2ZPA A;  2YL0 A;  3C8Z A;  4MS2 A;  5BUO A;  1T6I A;  2Y3H A;  3S9O A;  1LI5 A;  3HTK C;  2B0H A;  3SXZ A;  5K0I A;  2UUH A;  3V5X A;  3TD7 A;  4CSA C;  3IQ5 A;  1O5H A;  2LCH A;  1A41 A;  4MVR A;  2IOQ A;  2A1D D;  2YL3 A;  1H6G A;  2XXA A;  4FES A;  3EGD A;  4MVQ A;  3RQF A;  3VM6 A;  4E7Z A;  4DOZ A;  5L0D A;  1Z63 A;  3V5Y A;  1K04 A;  1OXK A;  4AL1 A;  2LQG A;  1JRA A;  2XLD A;  2WZF A;  2EPO A;  1QPU A;  2HFI A;  2CNW A;  3HNL A;  1FR0 A;  3QVY A;  3RKO F;  2AU5 A;  3GAN A;  1NLX A;  2BL2 A;  1Q0F A;  2IYL D;  4G78 A;  4XLP F;  4NTF A;  1SR2 A;  2W4B A;  2WVN A;  3NYM A;  5JUA A;  2A0B A;  4EKW A;  1YJG A;  2Q7R A;  4FX5 A;  4O79 A;  5FZT A;  4E0H A;  4ZLD A;  4XLN F;  4XEV A;  3DJU B;  3ASO C;  4EBJ A;  2YL1 A;  5L3V A;  1CGM E;  3M4B A;  4DRI B;  2NPU A;  2PX3 A;  2ZXP A;  3HNJ A;  1ZU4 A;  4N4W A;  2XL8 A;  2OJE D;  1ORJ A;  4PAC A;  4OIO F;  1PV3 A;  2ZXW C;  4O6M A;  4QI0 A;  1QVX A;  2NSF A;  4K0D A;  3TUL A;  3AG1 C;  2ETS A;  2XXA B;  3Q7G A;  3EGD B;  1YYJ A;  5COG A;  2G62 A;  4A2N B;  2MYS A;  1Z5Z A;  4U5C E;  4PK4 A;  3IHU A;  3UGP A;  2ZD9 A;  4DRH B;  3C7J A;  3LLK A;  5COM A;  3WHN A;  5CI8 A;  2XRH A;  3O6X A;  4D4X A;  1BBH A;  1A7E A;  4XTK A;  2M4E A;  2J9U A;  4IAR A;  5BQI A;  1OR3 A;  3H2U A;  4AX2 A;  1BDJ B;  4BJ1 A;  4EIY A;  5E33 A;  2FAP B;  1ST6 A;  1MMG A;  3UMH A;  2J0X A;  2L9J A;  2EPM X;  3KYJ A;  1TR2 A;  4U5H A;  3V5Z A;  5KYW A;  2QTV A;  5A69 A;  2R7R A;  2WVO A;  3K33 A;  3K7D A;  3B29 A;  1HW2 A;  3QTH A;  1LI7 A;  1OCO C;  1LM3 B;  3HJC A;  4N6H A;  3TJ6 A;  1FMV A;  1G8X A;  4PJJ A;  1FFT C;  3W8H A;  3US6 A;  3MBG A;  4Z9H A;  1ZU5 A;  3L0I A;  4YJW A;  2XLM A;  3UMK A;  1ZHT A;  3G4Z A;  5E3A A;  5L3Q A;  3SNH A;  1E83 A;  2ASR A;  1VLT A;  3RQE A;  1NU7 D;  3U8V A;  5L0F A;  1VLS A;  2Q4F A;  3DAG A;  2L81 A;  2VAS A;  3AG2 C;  3ZSU A;  4E0I A;  1OW6 A;  256B A;  2OOC A;  4QI2 A;  3B71 A;  2IBF A;  2QY9 A;  1JMW A;  1Y4C A;  1JAF A;  2KGO A;  3FOP A;  3RW0 A;  4IB4 A;  4I1M A;  4JJG A;  4QDL A;  1U0B B;  1M57 C;  3T6B A;  3FAP B;  5L0G A;  1ZW2 A;  1TFK B;  1UG7 A;  4I44 A;  2NUP A;  5KYW B;  2R7S A;  4BJ6 A;  3CZ6 A;  4JE9 A;  1C02 A;  2OEV A;  2J0W A;  2GFH A;  4M63 A;  4NCQ A;  3ATP A;  2LFF A;  4PJN A;  2ZXO A;  2AVK A;  3SXY A;  3T9O A;  3TJ5 A;  3I5P A;  4CS9 A;  3I4U A;  4WAB A;  3JSE O;  2YLG A;  1ORS C;  3EG9 A;  1G5Z A;  1CGO A;  1NU9 C;  1NZE A;  2XL4 A;  4Q7C A;  3RVY A;  2HZ8 A;  4CJO A;  4IJJ A;  3PHF 2;  1Z3I X;  1O87 A;  1WTY A;  1WWP A;  2Q9B A;  1CGN A;  1E2X A;  3N2Z B;  2J45 A;  2KNH A;  3DJN B;  2VCA A;  1PD1 A;  1OW8 A;  2OU6 A;  3JT1 A;  1T01 A;  4O7G A;  3C8G A;  4YL0 A;  2Y3G A;  3AG4 C;  3I5Q A;  2EPK X;  3NG1 A;  1ZYR F;  1YA9 A;  1ZVZ A;  2C03 A;  3ZWI A;  2HMZ A;  5L0C A;  4ULV A;  1CPQ A;  3AQC A;  3NRH A;  1V74 B;  3AOU A;  1QSP A;  1D0X A;  1RKC A;  2DB4 A;  2WB7 A;  2J9B A;  2KQ9 A;  4KBL A;  4U5F E;  2R7O A;  2V3C C;  1VMA A;  5BQG A;  2IXP A;  2NUP B;  2GWW A;  3K1I C;  2WVQ A;  4CBE A;  4MW3 A;  4L6R A;  3X2Q C;  2Q9A A;  3TOM A;  4DVZ A;  2OEX A;  1TWG A;  5B3I A;  5CIV A;  3QVZ A;  2AWC A;  2CDQ A;  2J7P A;  3GEH A;  4YN0 B;  3ABK C;  1L7C A;  4CS8 C;  4DRJ B;  3GWL A;  4XPX A;  4NC3 A;  1R4T A;  3EG9 B;  3L8J A;  1HY5 A;  4KI2 A;  3JSZ A;  3IQT A;  3TQO A;  1R5I D;  2R25 A;  2JX0 A;  2L6H A;  1KTM A;  2R02 A;  1G4W R;  1RCP A;  3KMI A;  2DYR C;  1N1C A;  2XLW A;  3MYF A;  3RF3 A;  1T6U A;  2L6F A;  3C8G B;  3LS0 A;  3U2L A;  1FFH A;  2L6G A;  4PR9 A;  1QLE C;  4JUR I;  1KNY A;  2P7V A;  1EKY A;  1NBB A;  1TFO B;  3Q6N A;  4ONS A;  3T4R A;  2CGE A;  4BEJ A;  3EHN A;  2Y3D A;  2PBE A;  3ASN C;  3MX3 A;  3DE9 A;  5T1D B;  3GWN A;  5AC5 A;  5EK0 A;  2L7A A;  1Q0G A;  3H2V A;  3JTL O;  4HFK B;  2R03 A;  3TK0 A;  5KYX A;  3RQG A;  3DKA A;  4F4B A;  1LE4 A;  5F5H A;  3EFO A;  1MQV A;  2VC9 A;  1Z23 A;  1LPE A;  2Q9C A;  4XEF A;  3EGX A;  3MFN A;  1D1A A;  3C18 A;  3TOL A;  1ZHX A;  2YZS A;  2LK4 A;  3M15 A;  1V4A A;  2H8A A;  1D0Z A;  3SYN A;  4D4N A;  2TMV P;  3S84 A;  4X0R A;  2J9V A;  3K66 A;  1LS1 A;  4PJL A;  2HKV A;  2HV7 A;  4GYT A;  2YEV A;  2XS8 A;  1YVI A;  2X51 A;  3NMI A;  4XQ1 A;  4HE8 D;  3WG7 C;  3F46 A;  1XWJ A;  4OIR F;  2I15 A;  2EPL X;  3BRJ A;  3FOO A;  4MVU A;  1OR2 A;  3W8I A;  1EI7 A;  4EBB A;  2R7Q A;  4B6I A;  3N24 A;  4Z9J A;  1E84 A;  1WAT A;  4U5G A;  3DE8 A;  3DM5 A;  2O9X A;  1Q0D A;  2XS1 A;  3L1M A;  3LAY A;  3LEV A;  3GEI A;  3LEO A;  4RBN A;  3T6J A;  3UR3 C;  3EQL F;  4LDR A;  3UNG C;  3IEE A;  4O6N A;  3ZG1 A;  2CNW D;  3U2M A;  2J46 A;  4CIP A;  5KYX B;  3B0V C;  3GM3 A;  4C3E A;  1OKK A;  2XM0 A;  3EFO B;  4A4A A;  4CX9 A;  1OCR C;  3A9C A;  1Q0K A;  2QLA A;  3CEX A;  3EGX B;  5A6J A;  2GAQ A;  3H65 A;  1QQ3 A;  4JTA B;  3B0P A;  3WAQ A;  1NFN A;  3JYH A;  2NUT A;  1FMW A;  4CSA A;  1LIH A;  3W2W A;  2OG2 A;  2P6V A;  4MND A;  2JPU A;  3G4X A;  1RKE B;  4KNV A;  4BEM J;  1MNE A;  5E2Q A;  1Z6A A;  1NFO A;  3QMK A;  3L34 A;  3PDM P;  1GM5 A;  1PD0 A;  1MMD A;  3FXH A;  2NSG A;  2GA0 A;  4MTG A;  5AC4 A;  4MVZ A;  3F47 A;  3U9J A;  5AGF A;  1D1B A;  3CQZ A;  1D1C A;  1B68 A;  1H7I A;  3LS1 A;  4OIN F;  5A6B D;  2EIN C;  4PFP A;  4JEA A;  3R7C A;  3DXJ F;  3U9M A;  3ZQV A;  2XLO A;  1A7D A;  3AQB A;  2JD3 A;  5DQZ A;  2EIL C;  2F22 A;  2XLE A;  1LVK A;  1I4Y A;  3RVZ A;  1TWH A;  1QKR A;  4CIH A;  1FAP B;  5JVE A;  5DVW A;  1YDI A;  2Y39 A;  3GM2 A;  4G7Z F;  3GM1 A;  1HE1 A;  1OXB A;  3LUT B;  3JRM O;  1J8M F;  2C04 A;  4U9D A;  3B9Q A;  4BJT A;  1YA7 O;  4YL3 A;  3B0U X;  3L8I A;  3O55 A;  4LER A;  4Z9I A;  2NUT B;  1T6Q A;  1HMO A;  3EJN A;  3MYI A;  5B1A C;  4U5E E;  1U89 A;  3DM9 B;  4ER9 A;  1V55 C;  3K1H A;  4KNW A;  2YLD A;  4C3B A;  5IY5 C;  4G7O F;  1TQG A;  5KYY A;  1V54 C;  4LLC A;  2YL7 A;  1K40 A;  4XPW A;  4K7B A;  4XEK A;  4W8K A;  3LES A;  4DBQ A;  3NYJ A;  1APC A;  1GQA A;  3G50 A;  2KW3 C;  2YKZ A;  3HLZ A;  4YT5 A;  4NQF A;  4UDV A;  3S29 A;  3AG3 C;  4BG0 A;  3ABL C;  4RD9 A;  3RYL A;  2CCY A;  4JCZ A;  5DS5 A;  1F1M A;  1C03 A;  1LS4 A;  4GQH A;  1BZ4 A;  2G3V A;  4JC7 A;  3S90 A;  1IZM A;  2RD9 A;  1YAU O;  4R32 A;  3DI5 A;  1ORY A;  3J06 A;  2E87 A;  4LDQ A;  2J8W A;  2WZL A;  1FNT c;  4OIP F;  4H54 A;  4MQ9 F;  1S7Z A;  2VCC A;  1VYK A;  2KC3 A;  3OEO A;  1I4Z A;  3S27 A;  4CS7 A;  4C7O B;  3OWT A;  3U8P A;  4O6Y A;  1ZHW A;  3GOD A;  3W2V A;  2FFH A;  4EUK B;  5DLJ A;  4Q4Z F;  3GOR A;  2YVK A;  2J9W A;  5L0J A;  1K05 A;  5KYY B;  2VB6 A;  4XPY A;  3ABM C;  4J7Y A;  2B0J A;  3U0C A;  5GPG B;  3FAJ A;  3JYY A;  3ZTZ A;  2Y69 C;  5TJ5 E;  3ZIB A;  1C17 M;  2PNO A;  1LE2 A;  2W45 A;  4JTC B;  2R7W A;  1TWC A;  1CPR A; 
#chains in the Genus database with same CATH homology
 2HV6 A;  4JVS A;  3FHD A;  5KYN A;  1J8Y F;  4YT8 A;  3LNR A;  4LAC B;  4ULW A;  2R7X A;  3O39 A;  4I1O B;  1OCZ C;  3Q7L A;  5EGY A;  2D5R B;  1NG1 A;  4NY3 A;  5B3S C;  2VH3 A;  3QZC A;  3SP1 A;  4AK9 A;  1TWA A;  1M2O A;  3N0T A;  5KYU A;  3ZVR A;  3WOD F;  4JW1 A;  3K6B A;  2H7V C;  1KU2 A;  2H7O A;  4YT4 A;  4IWB A;  4GEH A;  2WL8 A;  3JCU Q;  4J32 B;  3MLG A;  4KC9 A;  3POV A;  3UGO A;  2J7P D;  4HEA J;  4AE4 A;  2OCC C;  3EZI A;  2PFD A;  5D92 A;  2A6H F;  2G3K A;  3EZH A;  1MND A;  4IAO A;  2DYS C;  2EIJ C;  2FGY A;  5DS6 A;  3EH2 A;  4N06 A;  2R7U A;  1VK5 A;  2R7V A;  4U5B E;  4YT2 A;  1WGW A;  2ZXR A;  5KYU B;  5DQT A;  3NDB B;  5E3C A;  2I8B A;  3E9V A;  4BJ6 C;  4PJM A;  4RDA A;  3EPV A;  3VYW A;  1QZX A;  2MWQ A;  4CS8 A;  4PFO A;  4CS9 C;  3NKE A;  3ZC4 A;  4AE4 B;  4IRU A;  3PMR A;  3JRT A;  4ZLC A;  4H4K C;  2NG1 A;  4I3M A;  4OD5 A;  2PX0 A;  5T3T A;  1VOM A;  1M2V A;  2H7B A;  4EWC A;  2W9Y A;  3LLI A;  4Q5S F;  3S0X A;  4C3D A;  2YHS A;  3S28 A;  2EIM C;  4JZA A;  5EHH A;  1TKN A;  1BR1 A;  3M1C B;  4OD4 A;  4XWJ A;  3ECS A;  3Q6M A;  3RH3 A;  3RIP A;  1RJ9 A;  1D0Y A;  2Q3T A;  1BR2 A;  1LKX A;  4BJ5 C;  1OKK D;  3LJB A;  3DZA A;  2Z15 A;  5HSW A;  1W2W A;  3TD7 A;  4J30 B;  3EHM A;  3FVY A;  5D91 A;  2PP4 A;  4P6I C;  3NYL A;  1JPJ A;  4WJ0 A;  1IW7 F;  3DMD A;  2R7T A;  1M2V B;  2A6E F;  3X1O A;  2DGJ A;  2CW0 F;  4HFF B;  3V7O A;  1SF8 A;  3OA1 A;  4U5D E;  2IXM A;  2XSE A;  4ANJ A;  1SMY F;  1ZHZ A;  1MMN A;  2EIK C;  3DD7 A;  3RFY A;  3VAY A;  2BE5 F;  3KL4 A;  4DVY P;  3EH1 A;  3CSK A;  3SEO A;  1RJ9 B;  5FCL A;  3ITF A;  2PF4 E;  2IXN A;  1FTS A;  2Y3B A;  3DAF A;  5DS4 A;  1MMA A;  4JJF A;  4FWV A;  4YWQ A;  3KH2 A;  4DBR A;  1SZI A;  3E70 C;  5B1B C;  2WZG A;  4OIQ F;  5CI9 A;  3SZR A;  3KKB A;  1PCX A;  4G7H F;  2LSE A;  1BR4 A;  3NKD A;  4JCH A;  1ZHY A;  2V26 A;  5T3W A;  3UMI A;  4G0H A;  1JPN A;  4LLE A;  2IXO A;  2KJG A;  1VYI A;  2W4M A;  3FDQ A;  4E7S A;  2A69 F;  2A68 F;  1M56 C;  1OCC C;  4BJ5 A;  2ZPA A;  5BUO A;  2Y3H A;  3HTK C;  4CSA C;  1O5H A;  2IOQ A;  2A1D D;  2XXA A;  4FES A;  3EGD A;  4E7Z A;  4DOZ A;  1Z63 A;  2WZF A;  2CNW A;  3RKO F;  3GAN A;  4XLP F;  2IYL D;  2W4B A;  2WVN A;  3NYM A;  4FX5 A;  4O79 A;  4ZLD A;  4XLN F;  3DJU B;  3ASO C;  5L3V A;  2PX3 A;  2ZXP A;  1ZU4 A;  4OIO F;  2ZXW C;  4O6M A;  4QI0 A;  4K0D A;  3AG1 C;  2XXA B;  3Q7G A;  3EGD B;  2G62 A;  4A2N B;  2MYS A;  1Z5Z A;  4U5C E;  4PK4 A;  3UGP A;  3LLK A;  5CI8 A;  2XRH A;  3O6X A;  4XTK A;  2M4E A;  2J9U A;  4AX2 A;  4BJ1 A;  5E33 A;  3UMH A;  1ST6 A;  1MMG A;  2J0X A;  2L9J A;  4U5H A;  1TR2 A;  5KYW A;  2QTV A;  2R7R A;  2WVO A;  3K33 A;  3K7D A;  1OCO C;  3HJC A;  1FMV A;  1G8X A;  4PJJ A;  1FFT C;  3W8H A;  1ZU5 A;  3L0I A;  4YJW A;  3UMK A;  1ZHT A;  5E3A A;  5L3Q A;  3SNH A;  1NU7 D;  3DAG A;  2L81 A;  2VAS A;  3AG2 C;  4QI2 A;  2QY9 A;  2KGO A;  4I1M A;  4JJG A;  4QDL A;  1M57 C;  3T6B A;  4I44 A;  5KYW B;  2R7S A;  2NUP A;  4BJ6 A;  3CZ6 A;  2J0W A;  2GFH A;  4M63 A;  4PJN A;  2ZXO A;  3I5P A;  4CS9 A;  3I4U A;  3EG9 A;  1NZE A;  1NU9 C;  2XL4 A;  4Q7C A;  3PHF 2;  4IJJ A;  1O87 A;  1Z3I X;  2Q9B A;  3N2Z B;  2J45 A;  2KNH A;  3DJN B;  1PD1 A;  3JT1 A;  4O7G A;  2Y3G A;  3AG4 C;  3NG1 A;  3I5Q A;  1ZYR F;  2C03 A;  3AQC A;  3NRH A;  2WB7 A;  1D0X A;  2KQ9 A;  4KBL A;  4U5F E;  2R7O A;  2V3C C;  1VMA A;  2IXP A;  2NUP B;  3K1I C;  4CBE A;  2WVQ A;  3X2Q C;  2Q9A A;  4DVZ A;  1TWG A;  2CDQ A;  2J7P A;  4YN0 B;  3ABK C;  4CS8 C;  3EG9 B;  4KI2 A;  3JSZ A;  3KMI A;  2DYR C;  1N1C A;  3LS0 A;  1FFH A;  1QLE C;  4JUR I;  2P7V A;  3Q6N A;  3T4R A;  2CGE A;  4BEJ A;  3EHN A;  2Y3D A;  3ASN C;  3MX3 A;  5T1D B;  4HFK B;  5KYX A;  4F4B A;  5F5H A;  3EFO A;  1Z23 A;  2Q9C A;  3EGX A;  3ZSU A;  1D1A A;  1ZHX A;  2YZS A;  1D0Z A;  3SYN A;  4X0R A;  2J9V A;  3K66 A;  1LS1 A;  4PJL A;  2HV7 A;  4GYT A;  2YEV A;  2X51 A;  4HE8 D;  3WG7 C;  3F46 A;  4OIR F;  3W8I A;  4EBB A;  2R7Q A;  4B6I A;  3N24 A;  4U5G A;  3DM5 A;  4RBN A;  2O9X A;  3LAY A;  3LEV A;  3T6J A;  3UR3 C;  3EQL F;  3UNG C;  3IEE A;  4O6N A;  3ZG1 A;  2CNW D;  3B0V C;  2J46 A;  5KYX B;  4C3E A;  1OKK A;  3EFO B;  1OCR C;  3EGX B;  3H65 A;  3B0P A;  3JYH A;  2NUT A;  1FMW A;  4CSA A;  3W2W A;  2OG2 A;  2P6V A;  4MND A;  4KNV A;  1MNE A;  5E2Q A;  1Z6A A;  3QMK A;  3L34 A;  1PD0 A;  1MMD A;  3F47 A;  1D1B A;  3CQZ A;  1D1C A;  3LS1 A;  4OIN F;  2EIN C;  4PFP A;  3DXJ F;  3AQB A;  2JD3 A;  5DQZ A;  2EIL C;  1LVK A;  1TWH A;  4CIH A;  5DVW A;  2Y39 A;  4G7Z F;  5F5F A;  1J8M F;  2C04 A;  3B9Q A;  4BJT A;  3B0U X;  4LER A;  4C7O A;  5B1A C;  2NUT B;  3EJN A;  4U5E E;  3DM9 B;  1V55 C;  3K1H A;  4KNW A;  5IY5 C;  4C3B A;  4G7O F;  5KYY A;  1V54 C;  4LLC A;  4K7B A;  4DBQ A;  4W8K A;  3LES A;  3NYJ A;  2KW3 C;  3HLZ A;  4YT5 A;  3S29 A;  3AG3 C;  4BG0 A;  3ABL C;  4RD9 A;  3RYL A;  5DS5 A;  2G3V A;  1IZM A;  2E87 A;  2WZL A;  4OIP F;  4MQ9 F;  1S7Z A;  3OEO A;  1VYK A;  3S27 A;  4CS7 A;  4C7O B;  3OWT A;  4O6Y A;  1ZHW A;  3GOD A;  3W2V A;  2FFH A;  4Q4Z F;  5DLJ A;  2J9W A;  5KYY B;  2VB6 A;  3ABM C;  2B0J A;  3FAJ A;  2Y69 C;  3ZIB A;  2R7W A;  2W45 A;  1TWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...