3K33A

Crystal structure of the phd-doc complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
124
structure length
124
Chain Sequence
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSALLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death on curing protein
publication title Allostery and intrinsic disorder mediate transcription regulation by conditional cooperativity.
pubmed doi rcsb
source organism Enterobacteria phage p1
molecule tags Toxin/antitoxin
total genus 47
structure length 124
sequence length 124
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1870 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3k33A00
3KH2A 3K33A 3DD7A
chains in the Genus database with same CATH superfamily
1Q0GA 2QNLA 3X1OA 2HJMA 4JURI 4GYTA 4NQFA 4HFFB 4U5FE 3RIPA 3ZVRA 1HW2A 1Q0MA 4N6CA 4U5GA 1K40A 4DVYP 1LIHA 2JPUA 3NG1A 3ZWIA 2Y39A 1LI7A 4DVZA 2Q9CA 5TJ5E 3DZAA 4RBNA 4DXWA 1VLTA 3KYJA 1WATA 2KQ9A 2R05A 1Y4CA 4IRUA 1KNYA 2PX3A 4O79A 1PV3A 4PK4A 5L0HA 2GFHA 2OCCC 4MW8A 1JPJA 2XLMA 1T6UA 1U6HA 1YYXA 1YA9A 2D4UA 1V74B 3U3FA 4E7SA 1A7EA 3MFNA 2NPUA 4BJ6A 3CQZA 2HKVA 1EKYA 2Q3TA 1ZYRF 1MMGA 2YQYA 1VB5A 4U9EA 3C7JA 1W2WA 2WVOA 4JTCB 2XS1A 1S7ZA 5KYWB 2A6EF 4RD9A 1RXQA 1YZAA 3U2LA 3GEIA 1B68A 3ATPA 3RFYA 4MQ9F 4EBBA 1KTMA 3K7DA 2KYHA 4P9FA 2NUPA 1CGOA 1ZHWA 3EHNA 3AG1C 4YL3A 1NU9C 3RQFA 4KNVA 2XRHA 2YKZA 5DS6A 2YLGA 3QW1A 1ZHTA 5KYYA 1AVOB 4GQHA 4MTGA 1LS4A 4PJLA 5KYXB 2CDQA 3U5SA 2EILC 4IJJA 3LNMB 2W9YA 2HV6A 3AOUA 5DQTA 3GM1A 2C04A 3AG3C 4C3DA 3C8ZA 3HNKA 3O39A 5B1AC 1ST6A 3FVYA 2G62A 2FGYA 3O10A 1OW6A 4G0HA 2KSFA 4MS2A 1WOLA 2M64A 2IXOA 2VB6A 3EHMA 2VASA 3RQGA 4RDAA 3V7OA 2J9VA 4QI2A 1GQAA 3NMJA 3JYHA 3SXZA 4XPWA 2HUJA 2WZLA 4ZLCA 1OW8A 4FAPB 1Q0KA 2PX0A 1G8XA 2NUTB 1CGME 3S28A 4P6IC 3NYJA 1XWJA 4JCHA 2B0JA 2TMVP 5COFA 5FCLA 4NTAA 2Q9BA 1YDIA 3H65A 2MYSA 1ZHXA 3G4ZA 3SXYA 4CIPA 2YWAA 4XWJA 1TWHA 1YVIA 4XTKA 3U8VA 1QQ3A 2A6HF 4JW1A 4LLEA 4W8PA 5B1BC 1JPNA 3NMIA 5AC5A 2J9BA 2XS8A 4XEKA 2X51A 3U2MA 4DRJB 1NLXA 1AEPA 4JKVA 3SXMA 4KBLA 4YT5A 4ONSA 4JRZA 4X0RA 2YEVA 2LFDA 3S84A 4YL1A 1EQ1A 1QSPA 4MNDA 1D1BA 2GDCA 2L7AA 1XZQA 2HSQA 1OCRC 2XM4A 5CIVA 3NRHA 4JCZA 2PP4A 4I1OB 4CBEA 1CGNA 1A0BA 1HE9A 1YLMA 3TOMA 3HTKC 3MX3A 1A7VA 1M6TA 4MTFA 4BJ5A 4E0IA 2CGEA 4EKWA 4CIHA 3POVA 2GAQA 1D1AA 3S9OA 3TK0A 4EHPA 1OQCA 2PNOA 2R9RB 4YT8A 5BQHA 3NDBB 1SMYF 1NU7D 1T6QA 2H7VC 3IHUA 3T4RA 4CDAA 3ZC4A 3RKOF 1G4WR 5F5FA 4Q7CA 4O6YA 2OU6A 1TWGA 1EA8A 4N06A 2YLIA 2ZXRA 4J7TA 2L81A 2I8BA 1WWPA 2KK1A 4N6HA 4XQ1A 1BBHA 3T6JA 2VCCA 3N2ZB 3UMHA 1M57C 2IXPA 3C62A 3DXJF 5AC4A 3UMKA 1LI5A 4PR9A 3IQTA 1MMDA 1S05A 2FFHA 5CI8A 2HMQA 1I4YA 1A7DA 2WL8A 3BEHA 4AX2A 4EBJA 1R4TA 1RJ9B 4CS8A 3ABKC 1Z63A 2YVKA 3MLGA 1JRAA 1D1CA 1C17M 1Z5ZA 4FX5A 3FHDA 5T1DB 1TWAA 2A0BA 2MWQA 3DWWA 3A9CA 3KKBA 1CPRA 3JSZA 4BG0A 2XLHA 2A0UA 5B3SC 1BR2A 3I4UA 2EIKC 3GEHA 3PMRA 4E7ZA 4JJFA 5JT4A 2P1AA 3HNJA 3U9JA 3VF0A 4YL0A 4XEFA 1YYJA 2M4EA 3FDQA 3MBGA 1SR2A 3AGTA 2JD3A 3K33A 4PFPA 1D0YA 2ICWG 1E83A 2W4BA 1BR4A 4ANJA 3W4YA 1M2OA 3US6A 2YL3A 3CAXA 4K1OA 1YARO 3OEOA 4U9DA 5E3AA 1E84A 2HFIA 3SEOA 5L0CA 3EG9B 2YL7A 1M2VB 4YN0B 3VRCA 5B3IA 2R7RA 2WZGA 3DI5A 3L8IA 3JSEO 5IY5C 3CSKA 3QZCA 3KL4A 1YZCA 1GS9A 2H8AA 1NSGB 4PJJA 2KW3C 5L3VA 1FR0A 3LNRA 1HY5A 4OD4A 5HV9A 2P61A 3Q6MA 3GWNA 1IW7F 3N24A 4D4XA 5DS5A 1PD0A 3SP1A 4DOZA 3KH2A 1I4ZA 3JT1A 1NG1A 2L6FA 1CPQA 1RMVA 1WGWA 5GPGB 3AGUA 2DB4A 2ZXWC 3RVYA 2PFDA 4XLPF 1LM3B 1TR2A 1H7IA 3HKKA 4C7OA 4CSAA 1FMVA 1SZIA 3K1HA 3KMIA 4LLCA 1NFNA 2EPOA 2XLDA 3AG2C 4P9TA 2PF4E 4JVSA 1MQVA 4MW3A 2EPNA 2J9WA 1YA7O 2VCAA 3DD7A 3NYLA 4LDRA 3EFOB 2B0HA 2QY9A 4OINF 1ORYA 3PCVA 2C03A 1ZW3A 1H9GA 4JTAB 3T6GB 3TULA 2Y3BA 1N1CA 3Q7GA 2OKUA 1VLSA 3K1IC 2H7BA 4PACA 3SNHA 5BQIA 3EGDB 2Y69C 3L1MA 1BZ4A 4J7YA 2RD9A 1TQGA 2KGOA 3EPVA 1QVXA 2EPKX 4EWCA 4OIPF 1FTSA 4PFOA 4BJTA 2YHSA 4IB4A 1J8YF 2W4MA 1VTMP 3U3BA 1JMWA 4B6IA 2UUIA 2HSBA 3IEEA 3U0CA 3W8IA 1VYKA 4N4WA 4AE4B 1R5ID 3V5YA 2AU5A 4CS9A 2IOQA 2Z15A 2H7OA 4JE9A 3DMDA 4EIYA 3IQCA 2KC3A 2NSGA 2O9XA 4JIOA 2WVNA 3DE8A 4WGZA 1LKXA 1YAUO 2OOCA 2LFFA 3GORA 4J30B 4JEAA 4MVUA 3PDMP 2R7UA 1NBBA 1V4AA 3EH2A 4NC3A 1SYQA 1OXKA 4JEBA 2NSFA 5DVWA 4U5DE 4FESA 2VCBA 3IQ5A 1RJ9A 3JRTA 2GA0A 5JRAA 1O5HA 4G78A 4LDQA 3B9QA 4IWBA 3AG4C 3GWLA 2PBEA 2XL6A 5JP7A 1GGQA 1E85A 5L3QA 3ABLC 4CJGA 2CYDA 2HS5A 4G7OF 1DOVA 2IM8A 2R7TA 3Q6NA 4WJ0A 1VOMA 2CNWD 1DOWA 4WABA 5JLIA 2R25A 5KYNA 1WASA 4NTBA 1E2XA 3K66A 5A6BD 3ITFA 3TOLA 3JCUQ 4Z9HA 4DRHB 3DM5A 1HE1A 2CCYA 2XLEA 5CI9A 3R7CA 3SYNA 4QDLA 5F5HA 4A2NB 1HMDA 3V5XA 2R02A 2AP3A 3C8GB 1M2VA 2J9UA 2EPMX 3ZSUA 4NTFA 3KPHA 3SXKA 1ZHYA 4U5HA 4E0HA 2R7QA 1QKRA 3WAQA 3FAJA 3L0IA 4W8KA 1Z7Qc 4Q4ZF 1D0ZA 1ORJA 3LEOA 4IGGA 2BL2A 5L0DA 3ECSA 3RYLA 3CZ6A 1I5NA 1D0XA 2HMZA 2MHRA 2HZ8A 5DS4A 1JOGA 1OCZC 5KYYB 3K6BA 1JAFA 2HV7A 3A11A 3B29A 3RQEA 3FMSA 5KYWA 2EIMC 1H6GA 4DRIB 2L6GA 5A69A 3FOOA 1C02A 2OG2A 2EIJC 2A68F 1FFHA 2R03A 4I3MA 4G7HF 4AL1A 3QVYA 2Q4FA 3VAYA 3WODF 3AJMA 3HJCA 1RKEB 2EINC 3H2VA 3E9VA 4CDYA 3NKEA 3WHNA 3LS0A 5K0IA 3ZTMA 3RW0A 3EFOA 2CW0F 4BPMA 3I5QA 2ASRA 5KYXA 3LS1A 1MMNA 3UGPA 2YL1A 1O3UA 3RF3A 1T01A 1OR3A 2A69F 5E33A 3B0VC 1XZPA 3QW0A 5BUOA 1LE4A 2P0NA 5E3CA 1IZMA 1KU2A 1LS1A 2CNWA 2GWWA 1MNDA 3M79A 4IAQA 2XXAB 5D92A 3N0TA 2DI3A 3C63A 4C3EA 2OEXA 1VYIA 3GEEA 3IQ6A 3NYMA 2J7PD 4MVZA 3GANA 3H2UA 3LAYA 2RSEB 5A6BA 5KYUB 2IXMA 4UDVA 2Q9AA 4XPYA 1ZW2A 4AE4A 4BJ5C 4OIOF 2KJGA 1U0BB 4CX9A 2NUTA 3W2VA 3ZIBA 1OCOC 2WVQA 4XLNF 2ZPAA 3G50A 1UFBA 3DJUB 1Z6AA 2YRFA 1Q0DA 4PJMA 2R7VA 4EBKA 4XPXA 4LDKA 4ULWA 3TJ5A 2J45A 3FOPA 4OIQF 3EGXB 4QI0A 3ASNC 3MYFA 1QPUA 2DGJA 2WB7A 1WTYA 1K04A 3R2PA 1LPEA 3ASOC 3DM9B 1M56C 2ZXPA 3UNGC 2Y3DA 4U5CE 2J0WA 1V55C 3WG7C 4OD5A 2P7VA 1J8MF 2IYLD 5EGYA 4MVOA 3VM6A 1ORSC 3OWTA 2A1DD 2YZSA 2ZXOA 2R7WA 3NKDA 4E17A 5COMA 2LQGA 1OW7A 256BA 3FAPB 5JSLA 3L34A 3TJ6A 5DQZA 3S27A 3ZQVA 4I44A 5E2QA 1LVKA 2AWYA 2OJQA 3L8JA 4K0DA 4CS8C 1V54C 1ZHZA 4Q5SF 3C18A 4MVRA 2V3CC 1TWCA 1VK5A 3KYIA 5EHHA 1GM5A 3U9MA 1Z3IX 2P6VA 1ZVZA 4NY3A 4M63A 1OR2A 2R7XA 5L0FA 4ER9A 4KC9A 3J06A 2WZFA 1TFKB 2QLAA 4KNWA 2LD6A 4PJNA 3B0PA 2G3KA 3EH1A 4GEHA 1PD1A 4O7GA 4WGYA 4DJ9A 3M1CB 3C8GA 2L6HA 4NCQA 1G4US 4BJ1A 2QUPA 5COGA 2X0CA 3QMKA 3JTLO 3G4XA 3B71A 1BR1A 3M15A 4BEJA 1UG7A 3V5ZA 3UGOA 2F22A 4YJWA 3AQBA 3DE9A 2AWCA 1NFOA 5HSWA 1H9TA 4AL0A 3GODA 4JTDB 3RH3A 2J7PA 4DBQA 1EI7A 2J46A 3W2WA 1OXBA 1L7CA 3O6XA 3LLIA 4U5EE 4LERA 2XSEA 2R7OA 3QVZA 3LJBA 5L0JA 1QZXA 3DKAA 4IARA 4ULVA 4F4BA 2D5RB 4H4KC 2LIGA 1ZU5A 3X2QC 4EUKB 3FXHA 4BJ6C 4O6MA 5A6AA 1G5ZA 1APCA 3ZQYA 3U8PA 1YJGA 1RKEA 4LACB 3ABMC 1MMAA 3Q7LA 3UMIA 1Y6DA 1Q0FA 1RKCA 2L9JA 4G7ZF 4C3BA 1TFOB 4YT2A 1VMAA 4AK9A 1LE2A 4JC7A 1U89A 4OIRF 2W45A 1WN0A 2XLVA 4H54A 3RVZA 5L0IA 1SF8A 2IBFA 5F28E 1T5OA 2LP4A 4L6RA 3GM2A 4MTOA 2E87A 3AQCA 1E86A 4XEVA 4CSAC 2ZD9A 4DBRA 5JVEA 4JJGA 1ZU4A 3DAGA 4U5BE 3JRMO 2OJED 1FNTc 1C03A 2Y3GA 3LEVA 2XXAA 1OKKD 2QTVA 3LLKA 5DLJA 4I1MA 1T6IA 2JX0A 2Q7RA 3PHF2 2OEVA 2UUHA 3EQLF 3MYIA 3HLZA 4MVMA 4R32A 5KYUA 4HFKB 1FFTC 3E70C 2XM0A 5BQGA 2BE5F 3EG9A 3EZIA 3IPMO 3SZRA 3ZTZA 1OCCC 2I15A 4YT4A 2J8WA 2LSEA 4Z9IA 3S29A 4CDVA 4MVSA 5EK0A 4C7OB 3M4CA 2Q00A 1QLEC 2DYRC 3EGXA 2NUPB 5AGFA 4IAOA 3TQOA 4ZLDA 3GM3A 4CS9C 1MNEA 2DYSC 1TKNA 2OQMA 2FAPB 3HNIA 3HNLA 3JYYA 4JZAA 1F1MA 3ZDLA 3S90A 3F46A 2AVKA 2QE9A 3LESA 4J32B 4E18A 4A4AA 5JUAA 2EPLX 3I5PA 2VH3A 3DJNB 3BRJA 3M4BA 4CJOA 2LK4A 4BEMJ 4FWVA 1K05A 1JR8A 3JZ0A 3W8HA 4KI2A 2Y3HA 1FMWA 1A41A 2J0XA 2KNHA 2XL4A 5A6JA 2ETSA 5D91A 3TD7A 3B0UX 2XLOA 1T9KA 4YK5A 5T3WA 4O6NA 3T6BA 1ZZPA 1Z23A 4Z9JA 3CEXA 2HJ3A 3ZG1A 3C8GD 3EGDA 5T3TA 3S0XA 3EJNA 3UR3C 2NG1A 1RCPA 1PCXA 3NMKA 2V26A 3QTHA 3F47A 2G3VA 2LCHA 1HW1A 1HMOA 1BDJB 2VC9A 3LUTB 5JS5A 5L0GA 1OKKA 3EZHA 3DAFA 4HEAJ 4K7BA 1NZEA 2BC5A 2IXNA 1L3PA 2YL0A 2R7SA 5FZTA 4HE8D 1AUEA 1O87A 2XL8A 3OA1A 4CS7A 3T9OA 2YLDA 4D4NA 5A6KA 4MVQA 3VYWA 2XLWA 3K1IA 3O55A 1FAPB 4YWQA
chains in the Genus database with same CATH topology
3X1OA 4JURI 4GYTA 4HFFB 4U5FE 3RIPA 3ZVRA 4U5GA 4DVYP 3NG1A 4DVZA 2Y39A 2Q9CA 3DZAA 4RBNA 5E3CA 3PHF2 2KQ9A 4IRUA 4PK4A 2PX3A 4O79A 2GFHA 2OCCC 1JPJA 4E7SA 4BJ6A 3CQZA 2Q3TA 1ZYRF 1MMGA 1W2WA 2WVOA 5KYWB 1S7ZA 2A6EF 4RD9A 4EBBA 3RFYA 4MQ9F 3K7DA 2NUPA 1ZHWA 3EHNA 3AG1C 1NU9C 4KNVA 2XRHA 5DS6A 1ZHTA 5KYYA 4PJLA 5KYXB 2CDQA 2EILC 4IJJA 2W9YA 2HV6A 5DQTA 2C04A 3AG3C 4C3DA 3O39A 1ST6A 3FVYA 2G62A 2FGYA 4G0HA 2IXOA 2VB6A 3EHMA 2VASA 3V7OA 4RDAA 4QI2A 2J9VA 3JYHA 2WZLA 4ZLCA 2PX0A 1G8XA 2NUTB 3S28A 4P6IC 3NYJA 4JCHA 2B0JA 5FCLA 2Q9BA 3H65A 2MYSA 1ZHXA 4XWJA 1TWHA 4XTKA 2A6HF 4JW1A 5B1BC 4LLEA 1JPNA 2X51A 4KBLA 4YT5A 4X0RA 2YEVA 4MNDA 1D1BA 1OCRC 3NRHA 2PP4A 4I1OB 4CBEA 3HTKC 3MX3A 3POVA 4BJ5A 4CIHA 2CGEA 1D1AA 4YT8A 3NDBB 1SMYF 1NU7D 2H7VC 3T4RA 3ZC4A 3RKOF 5F5FA 4Q7CA 4O6YA 1TWGA 4N06A 2ZXRA 2L81A 2I8BA 3T6JA 3N2ZB 3UMHA 1M57C 2IXPA 3DXJF 3UMKA 1MMDA 5CI8A 2FFHA 2WL8A 4AX2A 1RJ9B 4CS8A 3ABKC 1Z63A 3MLGA 1D1CA 1Z5ZA 4FX5A 3FHDA 5T1DB 1TWAA 2MWQA 3KKBA 3JSZA 4BG0A 5B3SC 1BR2A 3I4UA 2EIKC 3PMRA 4E7ZA 4JJFA 2M4EA 3FDQA 2JD3A 3K33A 4PFPA 1D0YA 2W4BA 1BR4A 4ANJA 1M2OA 5E3AA 3OEOA 3SEOA 3EG9B 1M2VB 4YN0B 2R7RA 2WZGA 5IY5C 3CSKA 3QZCA 3KL4A 4PJJA 5L3VA 2KW3C 3LNRA 4OD4A 3Q6MA 1IW7F 3N24A 5DS5A 1PD0A 3SP1A 4DOZA 3KH2A 3JT1A 1NG1A 1WGWA 2ZXWC 2PFDA 4XLPF 1TR2A 4C7OA 4CSAA 1FMVA 1SZIA 3K1HA 3KMIA 4LLCA 3AG2C 2PF4E 4JVSA 2J9WA 3DD7A 3NYLA 3EFOB 2QY9A 4OINF 2C03A 2Y3BA 1N1CA 3Q7GA 3K1IC 2H7BA 3SNHA 3EGDB 2Y69C 2KGOA 3EPVA 4EWCA 4OIPF 1FTSA 4PFOA 4BJTA 2YHSA 1J8YF 2W4MA 4B6IA 3IEEA 3W8IA 1VYKA 4AE4B 4CS9A 2IOQA 2Z15A 2H7OA 3DMDA 2O9XA 2WVNA 1LKXA 4J30B 2R7UA 3EH2A 5DVWA 4U5DE 4FESA 1RJ9A 3JRTA 1O5HA 3B9QA 4IWBA 3AG4C 5L3QA 3ABLC 4G7OF 2R7TA 3Q6NA 4WJ0A 1VOMA 2CNWD 5KYNA 3K66A 3ITFA 3JCUQ 3DM5A 5CI9A 3SYNA 4QDLA 5F5HA 4A2NB 1M2VA 2J9UA 3ZSUA 1ZHYA 4U5HA 2R7QA 3FAJA 3L0IA 4W8KA 4Q4ZF 1D0ZA 3ECSA 3RYLA 3CZ6A 1D0XA 5DS4A 5KYYB 1OCZC 3K6BA 2HV7A 5KYWA 2EIMC 2OG2A 2EIJC 2A68F 1FFHA 4I3MA 4G7HF 3VAYA 3WODF 3HJCA 2EINC 3E9VA 3NKEA 3LS0A 3EFOA 2CW0F 3I5QA 5KYXA 3LS1A 1MMNA 3UGPA 2A69F 3B0VC 5E33A 5BUOA 1IZMA 1KU2A 1LS1A 2CNWA 1MNDA 2XXAB 5D92A 3N0TA 4C3EA 1VYIA 3NYMA 2J7PD 3GANA 3LAYA 5KYUB 2IXMA 2Q9AA 4BJ5C 4AE4A 4OIOF 2KJGA 2NUTA 3W2VA 3ZIBA 1OCOC 2WVQA 4XLNF 2ZPAA 3DJUB 1Z6AA 4PJMA 2R7VA 4OIQF 4ULWA 2J45A 3EGXB 4QI0A 3ASNC 2DGJA 2WB7A 3ASOC 3DM9B 1M56C 2ZXPA 3UNGC 2Y3DA 4U5CE 2J0WA 1V55C 3WG7C 4OD5A 2P7VA 1J8MF 2IYLD 5EGYA 3OWTA 2A1DD 2YZSA 2ZXOA 2R7WA 3NKDA 3L34A 5DQZA 3S27A 4I44A 5E2QA 1LVKA 4K0DA 4CS8C 1V54C 1ZHZA 4Q5SF 2V3CC 1TWCA 1VK5A 5EHHA 1Z3IX 2P6VA 4NY3A 4M63A 2R7XA 4KC9A 2WZFA 4KNWA 4PJNA 3B0PA 2G3KA 3EH1A 4GEHA 1PD1A 4O7GA 3M1CB 4BJ1A 3QMKA 1BR1A 4BEJA 3UGOA 4YJWA 3AQBA 5HSWA 3GODA 3RH3A 2J7PA 4DBQA 2J46A 3W2WA 3O6XA 4U5EE 3LLIA 4LERA 2XSEA 2R7OA 3LJBA 1QZXA 4F4BA 2D5RB 4H4KC 1ZU5A 3X2QC 4BJ6C 4O6MA 4LACB 3ABMC 1MMAA 3Q7LA 3UMIA 2L9JA 4G7ZF 4C3BA 4YT2A 1VMAA 4AK9A 4OIRF 2W45A 1SF8A 4CSAC 2E87A 3AQCA 4DBRA 4JJGA 1ZU4A 3DAGA 4U5BE 2Y3GA 3LEVA 2XXAA 1OKKD 2QTVA 3LLKA 5DLJA 4I1MA 3EQLF 5KYUA 3HLZA 4HFKB 1FFTC 3E70C 2BE5F 3EG9A 3EZIA 3SZRA 1OCCC 4YT4A 2LSEA 3S29A 4C7OB 1QLEC 2DYRC 3EGXA 2NUPB 4IAOA 4ZLDA 4CS9C 1MNEA 2DYSC 1TKNA 4JZAA 3F46A 3LESA 4J32B 3I5PA 2VH3A 3DJNB 4FWVA 3W8HA 4KI2A 2Y3HA 1FMWA 2J0XA 2KNHA 2XL4A 3B0UX 5D91A 3TD7A 5T3WA 3T6BA 4O6NA 1Z23A 3ZG1A 3EGDA 5T3TA 3S0XA 3EJNA 3UR3C 2NG1A 1PCXA 2V26A 3F47A 2G3VA 1OKKA 3EZHA 3DAFA 4HEAJ 4K7BA 1NZEA 2IXNA 2R7SA 4HE8D 1O87A 3OA1A 4CS7A 3VYWA 5B1AC 4YWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KH2 A;  3K33 A;  3DD7 A; 
#chains in the Genus database with same CATH topology
 1Q0G A;  2QNL A;  3X1O A;  2HJM A;  4JUR I;  4GYT A;  4NQF A;  4HFF B;  4U5F E;  3RIP A;  3ZVR A;  1HW2 A;  1Q0M A;  4N6C A;  4U5G A;  1K40 A;  4DVY P;  1LIH A;  2JPU A;  3NG1 A;  3ZWI A;  2Y39 A;  1LI7 A;  4DVZ A;  2Q9C A;  5TJ5 E;  3DZA A;  4RBN A;  4DXW A;  1VLT A;  3KYJ A;  1WAT A;  2KQ9 A;  2R05 A;  1Y4C A;  4IRU A;  1KNY A;  2PX3 A;  4O79 A;  1PV3 A;  4PK4 A;  5L0H A;  2GFH A;  2OCC C;  4MW8 A;  1JPJ A;  2XLM A;  1T6U A;  1U6H A;  1YYX A;  1YA9 A;  2D4U A;  1V74 B;  3U3F A;  4E7S A;  1A7E A;  3MFN A;  2NPU A;  4BJ6 A;  3CQZ A;  2HKV A;  1EKY A;  2Q3T A;  1ZYR F;  1MMG A;  2YQY A;  1VB5 A;  4U9E A;  3C7J A;  1W2W A;  2WVO A;  4JTC B;  2XS1 A;  1S7Z A;  5KYW B;  2A6E F;  4RD9 A;  1RXQ A;  1YZA A;  3U2L A;  3GEI A;  1B68 A;  3ATP A;  3RFY A;  4MQ9 F;  4EBB A;  1KTM A;  3K7D A;  2KYH A;  4P9F A;  2NUP A;  1CGO A;  1ZHW A;  3EHN A;  3AG1 C;  4YL3 A;  1NU9 C;  3RQF A;  4KNV A;  2XRH A;  2YKZ A;  5DS6 A;  2YLG A;  3QW1 A;  1ZHT A;  5KYY A;  1AVO B;  4GQH A;  4MTG A;  1LS4 A;  4PJL A;  5KYX B;  2CDQ A;  3U5S A;  2EIL C;  4IJJ A;  3LNM B;  2W9Y A;  2HV6 A;  3AOU A;  5DQT A;  3GM1 A;  2C04 A;  3AG3 C;  4C3D A;  3C8Z A;  3HNK A;  3O39 A;  5B1A C;  1ST6 A;  3FVY A;  2G62 A;  2FGY A;  3O10 A;  1OW6 A;  4G0H A;  2KSF A;  4MS2 A;  1WOL A;  2M64 A;  2IXO A;  2VB6 A;  3EHM A;  2VAS A;  3RQG A;  4RDA A;  3V7O A;  2J9V A;  4QI2 A;  1GQA A;  3NMJ A;  3JYH A;  3SXZ A;  4XPW A;  2HUJ A;  2WZL A;  4ZLC A;  1OW8 A;  4FAP B;  1Q0K A;  2PX0 A;  1G8X A;  2NUT B;  1CGM E;  3S28 A;  4P6I C;  3NYJ A;  1XWJ A;  4JCH A;  2B0J A;  2TMV P;  5COF A;  5FCL A;  4NTA A;  2Q9B A;  1YDI A;  3H65 A;  2MYS A;  1ZHX A;  3G4Z A;  3SXY A;  4CIP A;  2YWA A;  4XWJ A;  1TWH A;  1YVI A;  4XTK A;  3U8V A;  1QQ3 A;  2A6H F;  4JW1 A;  4LLE A;  4W8P A;  5B1B C;  1JPN A;  3NMI A;  5AC5 A;  2J9B A;  2XS8 A;  4XEK A;  2X51 A;  3U2M A;  4DRJ B;  1NLX A;  1AEP A;  4JKV A;  3SXM A;  4KBL A;  4YT5 A;  4ONS A;  4JRZ A;  4X0R A;  2YEV A;  2LFD A;  3S84 A;  4YL1 A;  1EQ1 A;  1QSP A;  4MND A;  1D1B A;  2GDC A;  2L7A A;  1XZQ A;  2HSQ A;  1OCR C;  2XM4 A;  5CIV A;  3NRH A;  4JCZ A;  2PP4 A;  4I1O B;  4CBE A;  1CGN A;  1A0B A;  1HE9 A;  1YLM A;  3TOM A;  3HTK C;  3MX3 A;  1A7V A;  1M6T A;  4MTF A;  4BJ5 A;  4E0I A;  2CGE A;  4EKW A;  4CIH A;  3POV A;  2GAQ A;  1D1A A;  3S9O A;  3TK0 A;  4EHP A;  1OQC A;  2PNO A;  2R9R B;  4YT8 A;  5BQH A;  3NDB B;  1SMY F;  1NU7 D;  1T6Q A;  2H7V C;  3IHU A;  3T4R A;  4CDA A;  3ZC4 A;  3RKO F;  1G4W R;  5F5F A;  4Q7C A;  4O6Y A;  2OU6 A;  1TWG A;  1EA8 A;  4N06 A;  2YLI A;  2ZXR A;  4J7T A;  2L81 A;  2I8B A;  1WWP A;  2KK1 A;  4N6H A;  4XQ1 A;  1BBH A;  3T6J A;  2VCC A;  3N2Z B;  3UMH A;  1M57 C;  2IXP A;  3C62 A;  3DXJ F;  5AC4 A;  3UMK A;  1LI5 A;  4PR9 A;  3IQT A;  1MMD A;  1S05 A;  2FFH A;  5CI8 A;  2HMQ A;  1I4Y A;  1A7D A;  2WL8 A;  3BEH A;  4AX2 A;  4EBJ A;  1R4T A;  1RJ9 B;  4CS8 A;  3ABK C;  1Z63 A;  2YVK A;  3MLG A;  1JRA A;  1D1C A;  1C17 M;  1Z5Z A;  4FX5 A;  3FHD A;  5T1D B;  1TWA A;  2A0B A;  2MWQ A;  3DWW A;  3A9C A;  3KKB A;  1CPR A;  3JSZ A;  4BG0 A;  2XLH A;  2A0U A;  5B3S C;  1BR2 A;  3I4U A;  2EIK C;  3GEH A;  3PMR A;  4E7Z A;  4JJF A;  5JT4 A;  2P1A A;  3HNJ A;  3U9J A;  3VF0 A;  4YL0 A;  4XEF A;  1YYJ A;  2M4E A;  3FDQ A;  3MBG A;  1SR2 A;  3AGT A;  2JD3 A;  3K33 A;  4PFP A;  1D0Y A;  2ICW G;  1E83 A;  2W4B A;  1BR4 A;  4ANJ A;  3W4Y A;  1M2O A;  3US6 A;  2YL3 A;  3CAX A;  4K1O A;  1YAR O;  3OEO A;  4U9D A;  5E3A A;  1E84 A;  2HFI A;  3SEO A;  5L0C A;  3EG9 B;  2YL7 A;  1M2V B;  4YN0 B;  3VRC A;  5B3I A;  2R7R A;  2WZG A;  3DI5 A;  3L8I A;  3JSE O;  5IY5 C;  3CSK A;  3QZC A;  3KL4 A;  1YZC A;  1GS9 A;  2H8A A;  1NSG B;  4PJJ A;  2KW3 C;  5L3V A;  1FR0 A;  3LNR A;  1HY5 A;  4OD4 A;  5HV9 A;  2P61 A;  3Q6M A;  3GWN A;  1IW7 F;  3N24 A;  4D4X A;  5DS5 A;  1PD0 A;  3SP1 A;  4DOZ A;  3KH2 A;  1I4Z A;  3JT1 A;  1NG1 A;  2L6F A;  1CPQ A;  1RMV A;  1WGW A;  5GPG B;  3AGU A;  2DB4 A;  2ZXW C;  3RVY A;  2PFD A;  4XLP F;  1LM3 B;  1TR2 A;  1H7I A;  3HKK A;  4C7O A;  4CSA A;  1FMV A;  1SZI A;  3K1H A;  3KMI A;  4LLC A;  1NFN A;  2EPO A;  2XLD A;  3AG2 C;  4P9T A;  2PF4 E;  4JVS A;  1MQV A;  4MW3 A;  2EPN A;  2J9W A;  1YA7 O;  2VCA A;  3DD7 A;  3NYL A;  4LDR A;  3EFO B;  2B0H A;  2QY9 A;  4OIN F;  1ORY A;  3PCV A;  2C03 A;  1ZW3 A;  1H9G A;  4JTA B;  3T6G B;  3TUL A;  2Y3B A;  1N1C A;  3Q7G A;  2OKU A;  1VLS A;  3K1I C;  2H7B A;  4PAC A;  3SNH A;  5BQI A;  3EGD B;  2Y69 C;  3L1M A;  1BZ4 A;  4J7Y A;  2RD9 A;  1TQG A;  2KGO A;  3EPV A;  1QVX A;  2EPK X;  4EWC A;  4OIP F;  1FTS A;  4PFO A;  4BJT A;  2YHS A;  4IB4 A;  1J8Y F;  2W4M A;  1VTM P;  3U3B A;  1JMW A;  4B6I A;  2UUI A;  2HSB A;  3IEE A;  3U0C A;  3W8I A;  1VYK A;  4N4W A;  4AE4 B;  1R5I D;  3V5Y A;  2AU5 A;  4CS9 A;  2IOQ A;  2Z15 A;  2H7O A;  4JE9 A;  3DMD A;  4EIY A;  3IQC A;  2KC3 A;  2NSG A;  2O9X A;  4JIO A;  2WVN A;  3DE8 A;  4WGZ A;  1LKX A;  1YAU O;  2OOC A;  2LFF A;  3GOR A;  4J30 B;  4JEA A;  4MVU A;  3PDM P;  2R7U A;  1NBB A;  1V4A A;  3EH2 A;  4NC3 A;  1SYQ A;  1OXK A;  4JEB A;  2NSF A;  5DVW A;  4U5D E;  4FES A;  2VCB A;  3IQ5 A;  1RJ9 A;  3JRT A;  2GA0 A;  5JRA A;  1O5H A;  4G78 A;  4LDQ A;  3B9Q A;  4IWB A;  3AG4 C;  3GWL A;  2PBE A;  2XL6 A;  5JP7 A;  1GGQ A;  1E85 A;  5L3Q A;  3ABL C;  4CJG A;  2CYD A;  2HS5 A;  4G7O F;  1DOV A;  2IM8 A;  2R7T A;  3Q6N A;  4WJ0 A;  1VOM A;  2CNW D;  1DOW A;  4WAB A;  5JLI A;  2R25 A;  5KYN A;  1WAS A;  4NTB A;  1E2X A;  3K66 A;  5A6B D;  3ITF A;  3TOL A;  3JCU Q;  4Z9H A;  4DRH B;  3DM5 A;  1HE1 A;  2CCY A;  2XLE A;  5CI9 A;  3R7C A;  3SYN A;  4QDL A;  5F5H A;  4A2N B;  1HMD A;  3V5X A;  2R02 A;  2AP3 A;  3C8G B;  1M2V A;  2J9U A;  2EPM X;  3ZSU A;  4NTF A;  3KPH A;  3SXK A;  1ZHY A;  4U5H A;  4E0H A;  2R7Q A;  1QKR A;  3WAQ A;  3FAJ A;  3L0I A;  4W8K A;  1Z7Q c;  4Q4Z F;  1D0Z A;  1ORJ A;  3LEO A;  4IGG A;  2BL2 A;  5L0D A;  3ECS A;  3RYL A;  3CZ6 A;  1I5N A;  1D0X A;  2HMZ A;  2MHR A;  2HZ8 A;  5DS4 A;  1JOG A;  1OCZ C;  5KYY B;  3K6B A;  1JAF A;  2HV7 A;  3A11 A;  3B29 A;  3RQE A;  3FMS A;  5KYW A;  2EIM C;  1H6G A;  4DRI B;  2L6G A;  5A69 A;  3FOO A;  1C02 A;  2OG2 A;  2EIJ C;  2A68 F;  1FFH A;  2R03 A;  4I3M A;  4G7H F;  4AL1 A;  3QVY A;  2Q4F A;  3VAY A;  3WOD F;  3AJM A;  3HJC A;  1RKE B;  2EIN C;  3H2V A;  3E9V A;  4CDY A;  3NKE A;  3WHN A;  3LS0 A;  5K0I A;  3ZTM A;  3RW0 A;  3EFO A;  2CW0 F;  4BPM A;  3I5Q A;  2ASR A;  5KYX A;  3LS1 A;  1MMN A;  3UGP A;  2YL1 A;  1O3U A;  3RF3 A;  1T01 A;  1OR3 A;  2A69 F;  5E33 A;  3B0V C;  1XZP A;  3QW0 A;  5BUO A;  1LE4 A;  2P0N A;  5E3C A;  1IZM A;  1KU2 A;  1LS1 A;  2CNW A;  2GWW A;  1MND A;  3M79 A;  4IAQ A;  2XXA B;  5D92 A;  3N0T A;  2DI3 A;  3C63 A;  4C3E A;  2OEX A;  1VYI A;  3GEE A;  3IQ6 A;  3NYM A;  2J7P D;  4MVZ A;  3GAN A;  3H2U A;  3LAY A;  2RSE B;  5A6B A;  5KYU B;  2IXM A;  4UDV A;  2Q9A A;  4XPY A;  1ZW2 A;  4AE4 A;  4BJ5 C;  4OIO F;  2KJG A;  1U0B B;  4CX9 A;  2NUT A;  3W2V A;  3ZIB A;  1OCO C;  2WVQ A;  4XLN F;  2ZPA A;  3G50 A;  1UFB A;  3DJU B;  1Z6A A;  2YRF A;  1Q0D A;  4PJM A;  2R7V A;  4EBK A;  4XPX A;  4LDK A;  4ULW A;  3TJ5 A;  2J45 A;  3FOP A;  4OIQ F;  3EGX B;  4QI0 A;  3ASN C;  3MYF A;  1QPU A;  2DGJ A;  2WB7 A;  1WTY A;  1K04 A;  3R2P A;  1LPE A;  3ASO C;  3DM9 B;  1M56 C;  2ZXP A;  3UNG C;  2Y3D A;  4U5C E;  2J0W A;  1V55 C;  3WG7 C;  4OD5 A;  2P7V A;  1J8M F;  2IYL D;  5EGY A;  4MVO A;  3VM6 A;  1ORS C;  3OWT A;  2A1D D;  2YZS A;  2ZXO A;  2R7W A;  3NKD A;  4E17 A;  5COM A;  2LQG A;  1OW7 A;  256B A;  3FAP B;  5JSL A;  3L34 A;  3TJ6 A;  5DQZ A;  3S27 A;  3ZQV A;  4I44 A;  5E2Q A;  1LVK A;  2AWY A;  2OJQ A;  3L8J A;  4K0D A;  4CS8 C;  1V54 C;  1ZHZ A;  4Q5S F;  3C18 A;  4MVR A;  2V3C C;  1TWC A;  1VK5 A;  3KYI A;  5EHH A;  1GM5 A;  3U9M A;  1Z3I X;  2P6V A;  1ZVZ A;  4NY3 A;  4M63 A;  1OR2 A;  2R7X A;  5L0F A;  4ER9 A;  4KC9 A;  3J06 A;  2WZF A;  1TFK B;  2QLA A;  4KNW A;  2LD6 A;  4PJN A;  3B0P A;  2G3K A;  3EH1 A;  4GEH A;  1PD1 A;  4O7G A;  4WGY A;  4DJ9 A;  3M1C B;  3C8G A;  2L6H A;  4NCQ A;  1G4U S;  4BJ1 A;  2QUP A;  5COG A;  2X0C A;  3QMK A;  3JTL O;  3G4X A;  3B71 A;  1BR1 A;  3M15 A;  4BEJ A;  1UG7 A;  3V5Z A;  3UGO A;  2F22 A;  4YJW A;  3AQB A;  3DE9 A;  2AWC A;  1NFO A;  5HSW A;  1H9T A;  4AL0 A;  3GOD A;  4JTD B;  3RH3 A;  2J7P A;  4DBQ A;  1EI7 A;  2J46 A;  3W2W A;  1OXB A;  1L7C A;  3O6X A;  3LLI A;  4U5E E;  4LER A;  2XSE A;  2R7O A;  3QVZ A;  3LJB A;  5L0J A;  1QZX A;  3DKA A;  4IAR A;  4ULV A;  4F4B A;  2D5R B;  4H4K C;  2LIG A;  1ZU5 A;  3X2Q C;  4EUK B;  3FXH A;  4BJ6 C;  4O6M A;  5A6A A;  1G5Z A;  1APC A;  3ZQY A;  3U8P A;  1YJG A;  1RKE A;  4LAC B;  3ABM C;  1MMA A;  3Q7L A;  3UMI A;  1Y6D A;  1Q0F A;  1RKC A;  2L9J A;  4G7Z F;  4C3B A;  1TFO B;  4YT2 A;  1VMA A;  4AK9 A;  1LE2 A;  4JC7 A;  1U89 A;  4OIR F;  2W45 A;  1WN0 A;  2XLV A;  4H54 A;  3RVZ A;  5L0I A;  1SF8 A;  2IBF A;  5F28 E;  1T5O A;  2LP4 A;  4L6R A;  3GM2 A;  4MTO A;  2E87 A;  3AQC A;  1E86 A;  4XEV A;  4CSA C;  2ZD9 A;  4DBR A;  5JVE A;  4JJG A;  1ZU4 A;  3DAG A;  4U5B E;  3JRM O;  2OJE D;  1FNT c;  1C03 A;  2Y3G A;  3LEV A;  2XXA A;  1OKK D;  2QTV A;  3LLK A;  5DLJ A;  4I1M A;  1T6I A;  2JX0 A;  2Q7R A;  3PHF 2;  2OEV A;  2UUH A;  3EQL F;  3MYI A;  3HLZ A;  4MVM A;  4R32 A;  5KYU A;  4HFK B;  1FFT C;  3E70 C;  2XM0 A;  5BQG A;  2BE5 F;  3EG9 A;  3EZI A;  3IPM O;  3SZR A;  3ZTZ A;  1OCC C;  2I15 A;  4YT4 A;  2J8W A;  2LSE A;  4Z9I A;  3S29 A;  4CDV A;  4MVS A;  5EK0 A;  4C7O B;  3M4C A;  2Q00 A;  1QLE C;  2DYR C;  3EGX A;  2NUP B;  5AGF A;  4IAO A;  3TQO A;  4ZLD A;  3GM3 A;  4CS9 C;  1MNE A;  2DYS C;  1TKN A;  2OQM A;  2FAP B;  3HNI A;  3HNL A;  3JYY A;  4JZA A;  1F1M A;  3ZDL A;  3S90 A;  3F46 A;  2AVK A;  2QE9 A;  3LES A;  4J32 B;  4E18 A;  4A4A A;  5JUA A;  2EPL X;  3I5P A;  2VH3 A;  3DJN B;  3BRJ A;  3M4B A;  4CJO A;  2LK4 A;  4BEM J;  4FWV A;  1K05 A;  1JR8 A;  3JZ0 A;  3W8H A;  4KI2 A;  2Y3H A;  1FMW A;  1A41 A;  2J0X A;  2KNH A;  2XL4 A;  5A6J A;  2ETS A;  5D91 A;  3TD7 A;  3B0U X;  2XLO A;  1T9K A;  4YK5 A;  5T3W A;  4O6N A;  3T6B A;  1ZZP A;  1Z23 A;  4Z9J A;  3CEX A;  2HJ3 A;  3ZG1 A;  3C8G D;  3EGD A;  5T3T A;  3S0X A;  3EJN A;  3UR3 C;  2NG1 A;  1RCP A;  1PCX A;  3NMK A;  2V26 A;  3QTH A;  3F47 A;  2G3V A;  2LCH A;  1HW1 A;  1HMO A;  1BDJ B;  2VC9 A;  3LUT B;  5JS5 A;  5L0G A;  1OKK A;  3EZH A;  3DAF A;  4HEA J;  4K7B A;  1NZE A;  2BC5 A;  2IXN A;  1L3P A;  2YL0 A;  2R7S A;  5FZT A;  4HE8 D;  1AUE A;  1O87 A;  2XL8 A;  3OA1 A;  4CS7 A;  3T9O A;  2YLD A;  4D4N A;  5A6K A;  4MVQ A;  3VYW A;  2XLW A;  3K1I A;  3O55 A;  1FAP B;  4YWQ A; 
#chains in the Genus database with same CATH homology
 3X1O A;  4JUR I;  4GYT A;  4HFF B;  4U5F E;  3RIP A;  3ZVR A;  4U5G A;  4DVY P;  3NG1 A;  4DVZ A;  2Y39 A;  2Q9C A;  3DZA A;  4RBN A;  5E3C A;  3PHF 2;  2KQ9 A;  4IRU A;  4PK4 A;  2PX3 A;  4O79 A;  2GFH A;  2OCC C;  1JPJ A;  4E7S A;  4BJ6 A;  3CQZ A;  2Q3T A;  1ZYR F;  1MMG A;  1W2W A;  2WVO A;  5KYW B;  1S7Z A;  2A6E F;  4RD9 A;  4EBB A;  3RFY A;  4MQ9 F;  3K7D A;  2NUP A;  1ZHW A;  3EHN A;  3AG1 C;  1NU9 C;  4KNV A;  2XRH A;  5DS6 A;  1ZHT A;  5KYY A;  4PJL A;  5KYX B;  2CDQ A;  2EIL C;  4IJJ A;  2W9Y A;  2HV6 A;  5DQT A;  2C04 A;  3AG3 C;  4C3D A;  3O39 A;  1ST6 A;  3FVY A;  2G62 A;  2FGY A;  4G0H A;  2IXO A;  2VB6 A;  3EHM A;  2VAS A;  3V7O A;  4RDA A;  4QI2 A;  2J9V A;  3JYH A;  2WZL A;  4ZLC A;  2PX0 A;  1G8X A;  2NUT B;  3S28 A;  4P6I C;  3NYJ A;  4JCH A;  2B0J A;  5FCL A;  2Q9B A;  3H65 A;  2MYS A;  1ZHX A;  4XWJ A;  1TWH A;  4XTK A;  2A6H F;  4JW1 A;  5B1B C;  4LLE A;  1JPN A;  2X51 A;  4KBL A;  4YT5 A;  4X0R A;  2YEV A;  4MND A;  1D1B A;  1OCR C;  3NRH A;  2PP4 A;  4I1O B;  4CBE A;  3HTK C;  3MX3 A;  3POV A;  4BJ5 A;  4CIH A;  2CGE A;  1D1A A;  4YT8 A;  3NDB B;  1SMY F;  1NU7 D;  2H7V C;  3T4R A;  3ZC4 A;  3RKO F;  5F5F A;  4Q7C A;  4O6Y A;  1TWG A;  4N06 A;  2ZXR A;  2L81 A;  2I8B A;  3T6J A;  3N2Z B;  3UMH A;  1M57 C;  2IXP A;  3DXJ F;  3UMK A;  1MMD A;  5CI8 A;  2FFH A;  2WL8 A;  4AX2 A;  1RJ9 B;  4CS8 A;  3ABK C;  1Z63 A;  3MLG A;  1D1C A;  1Z5Z A;  4FX5 A;  3FHD A;  5T1D B;  1TWA A;  2MWQ A;  3KKB A;  3JSZ A;  4BG0 A;  5B3S C;  1BR2 A;  3I4U A;  2EIK C;  3PMR A;  4E7Z A;  4JJF A;  2M4E A;  3FDQ A;  2JD3 A;  3K33 A;  4PFP A;  1D0Y A;  2W4B A;  1BR4 A;  4ANJ A;  1M2O A;  5E3A A;  3OEO A;  3SEO A;  3EG9 B;  1M2V B;  4YN0 B;  2R7R A;  2WZG A;  5IY5 C;  3CSK A;  3QZC A;  3KL4 A;  4PJJ A;  5L3V A;  2KW3 C;  3LNR A;  4OD4 A;  3Q6M A;  1IW7 F;  3N24 A;  5DS5 A;  1PD0 A;  3SP1 A;  4DOZ A;  3KH2 A;  3JT1 A;  1NG1 A;  1WGW A;  2ZXW C;  2PFD A;  4XLP F;  1TR2 A;  4C7O A;  4CSA A;  1FMV A;  1SZI A;  3K1H A;  3KMI A;  4LLC A;  3AG2 C;  2PF4 E;  4JVS A;  2J9W A;  3DD7 A;  3NYL A;  3EFO B;  2QY9 A;  4OIN F;  2C03 A;  2Y3B A;  1N1C A;  3Q7G A;  3K1I C;  2H7B A;  3SNH A;  3EGD B;  2Y69 C;  2KGO A;  3EPV A;  4EWC A;  4OIP F;  1FTS A;  4PFO A;  4BJT A;  2YHS A;  1J8Y F;  2W4M A;  4B6I A;  3IEE A;  3W8I A;  1VYK A;  4AE4 B;  4CS9 A;  2IOQ A;  2Z15 A;  2H7O A;  3DMD A;  2O9X A;  2WVN A;  1LKX A;  4J30 B;  2R7U A;  3EH2 A;  5DVW A;  4U5D E;  4FES A;  1RJ9 A;  3JRT A;  1O5H A;  3B9Q A;  4IWB A;  3AG4 C;  5L3Q A;  3ABL C;  4G7O F;  2R7T A;  3Q6N A;  4WJ0 A;  1VOM A;  2CNW D;  5KYN A;  3K66 A;  3ITF A;  3JCU Q;  3DM5 A;  5CI9 A;  3SYN A;  4QDL A;  5F5H A;  4A2N B;  1M2V A;  2J9U A;  3ZSU A;  1ZHY A;  4U5H A;  2R7Q A;  3FAJ A;  3L0I A;  4W8K A;  4Q4Z F;  1D0Z A;  3ECS A;  3RYL A;  3CZ6 A;  1D0X A;  5DS4 A;  5KYY B;  1OCZ C;  3K6B A;  2HV7 A;  5KYW A;  2EIM C;  2OG2 A;  2EIJ C;  2A68 F;  1FFH A;  4I3M A;  4G7H F;  3VAY A;  3WOD F;  3HJC A;  2EIN C;  3E9V A;  3NKE A;  3LS0 A;  3EFO A;  2CW0 F;  3I5Q A;  5KYX A;  3LS1 A;  1MMN A;  3UGP A;  2A69 F;  3B0V C;  5E33 A;  5BUO A;  1IZM A;  1KU2 A;  1LS1 A;  2CNW A;  1MND A;  2XXA B;  5D92 A;  3N0T A;  4C3E A;  1VYI A;  3NYM A;  2J7P D;  3GAN A;  3LAY A;  5KYU B;  2IXM A;  2Q9A A;  4BJ5 C;  4AE4 A;  4OIO F;  2KJG A;  2NUT A;  3W2V A;  3ZIB A;  1OCO C;  2WVQ A;  4XLN F;  2ZPA A;  3DJU B;  1Z6A A;  4PJM A;  2R7V A;  4OIQ F;  4ULW A;  2J45 A;  3EGX B;  4QI0 A;  3ASN C;  2DGJ A;  2WB7 A;  3ASO C;  3DM9 B;  1M56 C;  2ZXP A;  3UNG C;  2Y3D A;  4U5C E;  2J0W A;  1V55 C;  3WG7 C;  4OD5 A;  2P7V A;  1J8M F;  2IYL D;  5EGY A;  3OWT A;  2A1D D;  2YZS A;  2ZXO A;  2R7W A;  3NKD A;  3L34 A;  5DQZ A;  3S27 A;  4I44 A;  5E2Q A;  1LVK A;  4K0D A;  4CS8 C;  1V54 C;  1ZHZ A;  4Q5S F;  2V3C C;  1TWC A;  1VK5 A;  5EHH A;  1Z3I X;  2P6V A;  4NY3 A;  4M63 A;  2R7X A;  4KC9 A;  2WZF A;  4KNW A;  4PJN A;  3B0P A;  2G3K A;  3EH1 A;  4GEH A;  1PD1 A;  4O7G A;  3M1C B;  4BJ1 A;  3QMK A;  1BR1 A;  4BEJ A;  3UGO A;  4YJW A;  3AQB A;  5HSW A;  3GOD A;  3RH3 A;  2J7P A;  4DBQ A;  2J46 A;  3W2W A;  3O6X A;  4U5E E;  3LLI A;  4LER A;  2XSE A;  2R7O A;  3LJB A;  1QZX A;  4F4B A;  2D5R B;  4H4K C;  1ZU5 A;  3X2Q C;  4BJ6 C;  4O6M A;  4LAC B;  3ABM C;  1MMA A;  3Q7L A;  3UMI A;  2L9J A;  4G7Z F;  4C3B A;  4YT2 A;  1VMA A;  4AK9 A;  4OIR F;  2W45 A;  1SF8 A;  4CSA C;  2E87 A;  3AQC A;  4DBR A;  4JJG A;  1ZU4 A;  3DAG A;  4U5B E;  2Y3G A;  3LEV A;  2XXA A;  1OKK D;  2QTV A;  3LLK A;  5DLJ A;  4I1M A;  3EQL F;  5KYU A;  3HLZ A;  4HFK B;  1FFT C;  3E70 C;  2BE5 F;  3EG9 A;  3EZI A;  3SZR A;  1OCC C;  4YT4 A;  2LSE A;  3S29 A;  4C7O B;  1QLE C;  2DYR C;  3EGX A;  2NUP B;  4IAO A;  4ZLD A;  4CS9 C;  1MNE A;  2DYS C;  1TKN A;  4JZA A;  3F46 A;  3LES A;  4J32 B;  3I5P A;  2VH3 A;  3DJN B;  4FWV A;  3W8H A;  4KI2 A;  2Y3H A;  1FMW A;  2J0X A;  2KNH A;  2XL4 A;  3B0U X;  5D91 A;  3TD7 A;  5T3W A;  3T6B A;  4O6N A;  1Z23 A;  3ZG1 A;  3EGD A;  5T3T A;  3S0X A;  3EJN A;  3UR3 C;  2NG1 A;  1PCX A;  2V26 A;  3F47 A;  2G3V A;  1OKK A;  3EZH A;  3DAF A;  4HEA J;  4K7B A;  1NZE A;  2IXN A;  2R7S A;  4HE8 D;  1O87 A;  3OA1 A;  4CS7 A;  3VYW A;  5B1A C;  4YWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...