1Q0GA

Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the state after full x-ray-induced reduction
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVYDPAQARIEAESVKAIQEKMAANDDLHFQIRATVIKEQRAELAKHHLDVLWSDYFKPPHFESYPELHTLVNEAVKALSAAKASTDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Crystal structure of nickel-containing superoxide dismutase reveals another type of active site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1q0gA00
1Q0FA 1Q0KA 1Q0GA 1T6IA 3G4XA 3G50A 1T6QA 4NCQA 1Q0MA 1T6UA 1Q0DA 3G4ZA
chains in the Genus database with same CATH superfamily
1M57C 1Z23A 2YKZA 1L7CA 3SEOA 4P9FA 3S29A 3EQLF 1VTMP 2H7VC 2XSEA 4IWBA 1AVOB 3LEVA 2NSFA 1ST6A 3C18A 1V54C 4U9EA 3ZIBA 1M2VA 4AX2A 1Q0KA 5EK0A 2R7WA 4PR9A 4MTGA 3HNJA 2HJ3A 1ZHTA 2IM8A 2Y3BA 3K7DA 4CS9A 1O3UA 3B9QA 3EH1A 2J9UA 4KI2A 4H4KC 3AG3C 2LFDA 3DI5A 2IBFA 1RCPA 2Q9BA 1CGNA 4ZLDA 3LUTB 2OJQA 4EIYA 4CX9A 3POVA 4MVSA 4LACB 4W8PA 1TWAA 4MQ9F 2KC3A 3NKDA 4OIOF 4EUKB 3DAFA 3DD7A 1OW7A 1UG7A 1LE2A 1WN0A 1YYXA 3DKAA 2A6HF 3DM5A 3H65A 4JEBA 4JCHA 3BEHA 4U5HA 3JT1A 3X2QC 4E0HA 3DJUB 1TR2A 4ONSA 2YL3A 1GQAA 2EILC 3T4RA 4PFPA 3ZDLA 2OJED 2XLHA 2PFDA 3ATPA 3HKKA 4CBEA 2NUTB 3RQFA 2BC5A 3RVYA 1JMWA 3EHMA 1IW7F 4BJ5C 3A11A 3RF3A 3T9OA 3DAGA 3AG2C 3ZSUA 2CNWA 2J0XA 4JTDB 1OKKA 2H7OA 1XWJA 2NUPA 1QZXA 1LIHA 3M15A 3Q6MA 5L0FA 4UDVA 2UUHA 3JYHA 2XS1A 4BJ5A 5DQTA 5KYYB 2IXOA 5AC4A 1MMDA 2KJGA 3DM9B 4YK5A 3RVZA 3U0CA 5T1DB 4Q5SF 1OCOC 3KH2A 1FMWA 3ZVRA 2H7BA 2W9YA 1I4ZA 1OCZC 3K33A 3TOLA 4NTAA 3A9CA 4FAPB 1SMYF 3UGPA 5E3CA 3LESA 3VM6A 3S27A 3WAQA 1MMGA 3UMKA 3Q7LA 4BEMJ 5A6AA 2YL0A 3NKEA 5L3VA 2R02A 2DI3A 3GM2A 4JE9A 3VYWA 5KYUB 3AQCA 2XRHA 3EG9B 5FZTA 4NQFA 3TJ5A 1NBBA 3LJBA 4IJJA 1G5ZA 2DB4A 1RKEA 5EGYA 1W2WA 4MVMA 4Q7CA 1V74B 2XL4A 2CCYA 2YZSA 2IXMA 4K7BA 2R7XA 2XXAA 4G7OF 1VYIA 3H2UA 1U89A 1NU9C 4FESA 2LFFA 3FVYA 4PJLA 4W8KA 4WJ0A 5DVWA 4C7OB 2DYSC 2Y39A 1T5OA 3MYIA 3IQ6A 3SP1A 3SXKA 1RMVA 1C17M 1D0YA 2JPUA 3EGDB 4NCQA 1XZPA 3RW0A 2WVQA 2RSEB 1K40A 4OIRF 3UMIA 2P61A 2C03A 2I8BA 1CPRA 4MVZA 4D4NA 4E18A 1VLTA 4PFOA 4CIPA 5E3AA 5KYXB 1J8YF 2XL6A 4WGYA 3FHDA 5T3WA 1D0ZA 1K05A 3EGXB 5L0IA 4U5EE 3TOMA 3IQ5A 1ZHZA 3SXYA 5EHHA 1EKYA 2HSBA 1OXKA 2P7VA 1F1MA 4O79A 4DRJB 2LQGA 4OD5A 4HFKB 3N24A 4CIHA 2HSQA 2EPOA 2YLIA 4G0HA 4DRIB 3IQCA 1Z5ZA 2HV6A 3NG1A 2IOQA 2R05A 3OEOA 3TQOA 2L9JA 1RJ9A 1ORSC 3UMHA 2R9RB 2PBEA 3R7CA 1T01A 3QMKA 4J30B 4NTFA 2XLEA 3U5SA 3C8GD 3W2WA 1APCA 4I1OB 1HW2A 4JVSA 1VMAA 1NLXA 1WOLA 1PD1A 3GM1A 5TJ5E 3QW1A 2MYSA 4YN0B 4U5DE 4CDYA 3GEEA 2R7RA 3I5PA 2XM0A 1WWPA 4ER9A 4XEKA 4K1OA 4XEFA 1GS9A 4JTCB 1Q0MA 4CJGA 5L3QA 1Z63A 1ZHYA 3U9JA 3H2VA 3EFOA 1EA8A 3DE8A 3I4UA 4KBLA 5JT4A 2WL8A 3ASOC 3RIPA 3U8PA 4ULWA 1RXQA 5JRAA 1U0BB 2EPLX 1YARO 2AWCA 1YJGA 4HEAJ 4LLEA 3IQTA 3TULA 3AQBA 4I3MA 5KYWB 3IHUA 4YT4A 3RKOF 5JS5A 1V4AA 2KYHA 2CNWD 1OQCA 4JJFA 1OKKD 4OINF 2YRFA 3AG4C 3V7OA 3ZTMA 2Y3DA 3LS0A 2OOCA 4CS9C 5F5HA 3JTLO 2YLDA 2WZGA 2QLAA 4PJNA 3EHNA 1WATA 1ZHWA 4A4AA 2OG2A 3ABKC 3B0PA 3K66A 1ZW2A 3C8GA 3FDQA 1A7DA 1M2OA 2B0HA 3ZWIA 1I4YA 2YWAA 3KYJA 3JSZA 4K0DA 2M64A 1MNEA 1ORYA 1VOMA 3DXJF 1GGQA 3NMKA 1DOVA 3LS1A 3U9MA 5A6KA 3RFYA 5CIVA 2VH3A 4EBJA 1E86A 2HV7A 4I1MA 3DWWA 2YHSA 2G3KA 1LI7A 2EPNA 4N6HA 2NPUA 3KL4A 3LLIA 3F47A 2ZD9A 3RQGA 4DRHB 4YWQA 3RH3A 256BA 1O87A 3EJNA 2J0WA 2D5RB 3MLGA 4JZAA 1YLMA 3KYIA 4P9TA 4U9DA 4XPXA 4Z9JA 2R7QA 4FX5A 2D4UA 3ZTZA 4Z9IA 4U5BE 1BR1A 1R5ID 4O6NA 3U2LA 3CEXA 4IAQA 4YL1A 2FAPB 1QSPA 1QKRA 4RD9A 3EG9A 1C03A 3U8VA 2IYLD 3LLKA 2EINC 5COFA 4G7ZF 3NMIA 1CGOA 1NFNA 1HW1A 2A6EF 4AL1A 4YL3A 3HNIA 2GFHA 2A1DD 2VC9A 2QNLA 4JW1A 4ULVA 5D91A 4Z9HA 3V5YA 1M56C 1ZYRF 2HMQA 1OW8A 1JPJA 1NU7D 3SXZA 1G8XA 4XQ1A 3UNGC 2CGEA 4LLCA 2OU6A 1OCCC 3AG1C 2AVKA 3IPMO 4C7OA 4MNDA 2CDQA 1QQ3A 1M2VB 1Y6DA 2ZXRA 3EGDA 2F22A 4XEVA 1TQGA 5FCLA 3U2MA 3M4CA 1TWCA 1I5NA 3CSKA 4C3EA 5JSLA 2DYRC 2GDCA 1B68A 2ETSA 4MW3A 2J7PD 1HY5A 3EGXA 4YJWA 5T3TA 4EHPA 1JPNA 2OKUA 3HLZA 5E2QA 2GA0A 4N4WA 1ZZPA 4N06A 3AOUA 3E9VA 1E84A 2LD6A 4XPYA 3N2ZB 1FTSA 1LS4A 3ECSA 3LNMB 1ZHXA 3K1HA 2G3VA 1R4TA 4DOZA 4ANJA 2NSGA 1T9KA 3LAYA 4JJGA 2RD9A 1Q0FA 2ZXPA 2W45A 4GEHA 5CI8A 4CSAC 3HNLA 4MTOA 2AU5A 1OR3A 4LERA 1WGWA 1YVIA 5BQHA 2HUJA 3U3BA 2MWQA 4MVRA 5L0DA 3SZRA 4CS8A 4OIPF 4YT8A 3M79A 5BQIA 3BRJA 2X0CA 3ABLC 1VB5A 3PCVA 3NYMA 5B1AC 4CSAA 1D0XA 2NUPB 2WZFA 3SNHA 5HV9A 1YDIA 2R7VA 3O6XA 1YA9A 1FMVA 2HJMA 3I5QA 2Z15A 3K1IA 5B3SC 5L0HA 1GM5A 5COGA 5L0JA 2PNOA 1L3PA 3DJNB 2R7TA 1TFOB 2EIMC 3U3FA 2HMZA 4AL0A 1BR2A 4I44A 3W8IA 3US6A 2VCAA 4XPWA 3OWTA 2HS5A 4JTAB 2Y3HA 3B71A 2XLDA 3FOPA 4J7TA 4IB4A 4CDAA 2J7PA 3T6JA 4E7ZA 2J9VA 1MMNA 2E87A 3EZHA 1FFTC 3O39A 1A7VA 1MMAA 1OXBA 2LCHA 2VCBA 3JRTA 4U5CE 2LK4A 3UR3C 3W2VA 4JEAA 4KNWA 4DXWA 5DS4A 1G4WR 1ORJA 1N1CA 3HJCA 3KPHA 1S05A 2HKVA 4MVUA 3WODF 1WTYA 2BE5F 3V5XA 2NG1A 2V26A 4XLNF 4H54A 3QZCA 1Z3IX 1EI7A 3RQEA 2MHRA 3SYNA 4WGZA 1OCRC 3G4XA 5CI9A 1E85A 3L8IA 3R2PA 5A6BD 3GANA 1E2XA 1QLEC 1NFOA 2GWWA 2CYDA 4QI0A 5B1BC 3MX3A 4EBBA 4IARA 2QUPA 1YZAA 5BUOA 2J9WA 4XWJA 3V5ZA 3PDMP 4G78A 2QTVA 3WG7C 4E17A 2P6VA 4EBKA 1K04A 4BJ6A 2OEVA 1HMOA 5DS5A 1O5HA 4C3BA 4EWCA 4ZLCA 1C02A 3M1CB 3CAXA 4X0RA 3UGOA 1KTMA 4PJMA 1JOGA 2NUTA 3L0IA 4MVOA 4G7HF 4IGGA 2XLVA 4E0IA 4RBNA 3ITFA 4JKVA 2ICWG 5A69A 1TFKB 4BEJA 4DBQA 5JVEA 4U5FE 3HNKA 4XTKA 3DZAA 3GWLA 2C04A 2J9BA 1BDJB 3G50A 3AGUA 1MQVA 2EPKX 1ZU4A 4DVZA 5KYYA 2P0NA 5HSWA 1Q0DA 2DGJA 3VF0A 3S90A 4Q4ZF 4OIQF 2H8AA 1JRAA 1A41A 1IZMA 2CW0F 2GAQA 2LIGA 3AGTA 2Q7RA 2ZPAA 4DVYP 1H7IA 4NC3A 1DOWA 2FFHA 2KGOA 2KQ9A 1MNDA 3EFOB 2Y69C 3ASNC 3QTHA 4RDAA 1D1BA 2A69F 5A6BA 1XZQA 1CPQA 4AE4B 2A0BA 3JCUQ 1Y4CA 1KNYA 2QY9A 5KYUA 4DJ9A 2LSEA 2AP3A 1J8MF 2VB6A 3S9OA 3MYFA 4XLPF 1YYJA 3TK0A 3AJMA 3B0UX 2KNHA 1LE4A 3N0TA 3TD7A 3NDBB 4FWVA 4U5GA 2WVNA 4N6CA 3T6GB 4D4XA 3S0XA 3ABMC 4KNVA 5GPGB 3ZC4A 4YL0A 2Q4FA 2L81A 1QPUA 3GEHA 2PX0A 3JYYA 4A2NB 3NYLA 4JIOA 5K0IA 3C62A 1FAPB 3C63A 4E7SA 2EPMX 2JD3A 5A6JA 4GYTA 3C8GB 2KW3C 1A0BA 3JRMO 2WB7A 1Z7Qc 3QW0A 4M63A 3T6BA 1VYKA 4HE8D 3QVZA 2R25A 5B3IA 3FOOA 1TWHA 5KYXA 1BR4A 1D1CA 4AK9A 3CZ6A 5KYNA 3ZQVA 4J7YA 1NZEA 5JUAA 3PHF2 2XS8A 4CJOA 2L6HA 2PX3A 3DE9A 1TKNA 3NRHA 2AWYA 2Q3TA 4LDQA 2PP4A 1PD0A 3W8HA 5JLIA 1NSGB 2YLGA 2VCCA 1PV3A 4CS8C 4YT2A 2XLOA 2YL7A 1Q0GA 1T6IA 4NTBA 2IXNA 3FXHA 4QDLA 1U6HA 4BG0A 4BJ1A 4C3DA 2OQMA 3DMDA 5L0CA 2Q9AA 2B0JA 1EQ1A 2UUIA 2YVKA 3C8ZA 3K1IC 3VRCA 1VLSA 1A7EA 3OA1A 5F28E 4DBRA 2LP4A 2VASA 3GWNA 3MFNA 3NMJA 1BBHA 1TWGA 2EIKC 1QVXA 2WVOA 4JURI 4BPMA 1RKCA 4CDVA 4F4BA 1G4US 3IEEA 4L6RA 3ZG1A 3WHNA 1LS1A 5DS6A 1BZ4A 3SXMA 3EPVA 3GEIA 1SZIA 2J46A 3HTKC 4EKWA 2KSFA 2TMVP 5DLJA 2EIJC 2XM4A 4O6YA 2HZ8A 2A0UA 4LDKA 1SF8A 4JRZA 3ZQYA 2IXPA 2M4EA 1JR8A 3NYJA 5BQGA 1SR2A 3CQZA 3MBGA 4MTFA 2V3CC 4MW8A 4P6IC 2XL8A 3F46A 3E70C 2O9XA 5IY5C 3L34A 1AUEA 1ZW3A 5COMA 3G4ZA 3LEOA 1OW6A 2Y3GA 5DQZA 3GORA 2ZXOA 3JZ0A 3PMRA 5KYWA 2J45A 2YL1A 1FFHA 3L1MA 1T6QA 3W4YA 3EZIA 4PACA 4PJJA 4R32A 1RKEB 3X1OA 4YT5A 1FNTc 1KU2A 3S28A 3TJ6A 4NY3A 2G62A 4O6MA 5F5FA 4GQHA 4IRUA 3RYLA 2A68F 1H9GA 5E33A 4OD4A 4JCZA 3VAYA 2WZLA 1CGME 1AEPA 1NG1A 5JP7A 2L6GA 2BL2A 2OCCC 1OR2A 2L6FA 5AC5A 3M4BA 3L8JA 1Z6AA 1ZU5A 3GM3A 5D92A 4B6IA 1T6UA 1PCXA 1SYQA 4LDRA 2KK1A 2W4MA 4JC7A 4BJ6C 1YAUO 2JX0A 3Q6NA 1H6GA 2YEVA 3JSEO 4KC9A 3Q7GA 1LPEA 2HFIA 4WABA 1V55C 1UFBA 2X51A 2I15A 2FGYA 4MS2A 2ASRA 2J8WA 2Q00A 2XXAB 2XLMA 3QVYA 2R7OA 2PF4E 1LKXA 2OEXA 3B29A 3K6BA 4BJTA 1YA7O 3KMIA 3O10A 2R7UA 2YQYA 3EH2A 1LM3B 1RJ9B 3J06A 2ZXWC 2P1AA 1WASA 2W4BA 2XLWA 4AE4A 3GODA 1HE9A 3FAJA 4CS7A 3FMSA 3C7JA 2R7SA 1JAFA 4O7GA 1FR0A 2QE9A 5AGFA 1E83A 1HE1A 3B0VC 1VK5A 3FAPB 4PK4A 1YZCA 1H9TA 1D1AA 1S7ZA 3LNRA 2L7AA 2Q9CA 3O55A 4MVQA 4HFFB 2R03A 1M6TA 1HMDA 3S84A 4IAOA 1ZVZA 3KKBA 4QI2A 1LVKA 1LI5A 4J32B 5L0GA
chains in the Genus database with same CATH topology
1Q0FA 1Q0KA 1Q0GA 1T6IA 3G4XA 3G50A 1T6QA 4NCQA 1Q0MA 1T6UA 1Q0DA 3G4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0F A;  1Q0K A;  1Q0G A;  1T6I A;  3G4X A;  3G50 A;  1T6Q A;  4NCQ A;  1Q0M A;  1T6U A;  1Q0D A;  3G4Z A; 
#chains in the Genus database with same CATH topology
 1M57 C;  1Z23 A;  2YKZ A;  1L7C A;  3SEO A;  4P9F A;  3S29 A;  3EQL F;  1VTM P;  2H7V C;  2XSE A;  4IWB A;  1AVO B;  3LEV A;  2NSF A;  1ST6 A;  3C18 A;  1V54 C;  4U9E A;  3ZIB A;  1M2V A;  4AX2 A;  1Q0K A;  5EK0 A;  2R7W A;  4PR9 A;  4MTG A;  3HNJ A;  2HJ3 A;  1ZHT A;  2IM8 A;  2Y3B A;  3K7D A;  4CS9 A;  1O3U A;  3B9Q A;  3EH1 A;  2J9U A;  4KI2 A;  4H4K C;  3AG3 C;  2LFD A;  3DI5 A;  2IBF A;  1RCP A;  2Q9B A;  1CGN A;  4ZLD A;  3LUT B;  2OJQ A;  4EIY A;  4CX9 A;  3POV A;  4MVS A;  4LAC B;  4W8P A;  1TWA A;  4MQ9 F;  2KC3 A;  3NKD A;  4OIO F;  4EUK B;  3DAF A;  3DD7 A;  1OW7 A;  1UG7 A;  1LE2 A;  1WN0 A;  1YYX A;  3DKA A;  2A6H F;  3DM5 A;  3H65 A;  4JEB A;  4JCH A;  3BEH A;  4U5H A;  3JT1 A;  3X2Q C;  4E0H A;  3DJU B;  1TR2 A;  4ONS A;  2YL3 A;  1GQA A;  2EIL C;  3T4R A;  4PFP A;  3ZDL A;  2OJE D;  2XLH A;  2PFD A;  3ATP A;  3HKK A;  4CBE A;  2NUT B;  3RQF A;  2BC5 A;  3RVY A;  1JMW A;  3EHM A;  1IW7 F;  4BJ5 C;  3A11 A;  3RF3 A;  3T9O A;  3DAG A;  3AG2 C;  3ZSU A;  2CNW A;  2J0X A;  4JTD B;  1OKK A;  2H7O A;  1XWJ A;  2NUP A;  1QZX A;  1LIH A;  3M15 A;  3Q6M A;  5L0F A;  4UDV A;  2UUH A;  3JYH A;  2XS1 A;  4BJ5 A;  5DQT A;  5KYY B;  2IXO A;  5AC4 A;  1MMD A;  2KJG A;  3DM9 B;  4YK5 A;  3RVZ A;  3U0C A;  5T1D B;  4Q5S F;  1OCO C;  3KH2 A;  1FMW A;  3ZVR A;  2H7B A;  2W9Y A;  1I4Z A;  1OCZ C;  3K33 A;  3TOL A;  4NTA A;  3A9C A;  4FAP B;  1SMY F;  3UGP A;  5E3C A;  3LES A;  3VM6 A;  3S27 A;  3WAQ A;  1MMG A;  3UMK A;  3Q7L A;  4BEM J;  5A6A A;  2YL0 A;  3NKE A;  5L3V A;  2R02 A;  2DI3 A;  3GM2 A;  4JE9 A;  3VYW A;  5KYU B;  3AQC A;  2XRH A;  3EG9 B;  5FZT A;  4NQF A;  3TJ5 A;  1NBB A;  3LJB A;  4IJJ A;  1G5Z A;  2DB4 A;  1RKE A;  5EGY A;  1W2W A;  4MVM A;  4Q7C A;  1V74 B;  2XL4 A;  2CCY A;  2YZS A;  2IXM A;  4K7B A;  2R7X A;  2XXA A;  4G7O F;  1VYI A;  3H2U A;  1U89 A;  1NU9 C;  4FES A;  2LFF A;  3FVY A;  4PJL A;  4W8K A;  4WJ0 A;  5DVW A;  4C7O B;  2DYS C;  2Y39 A;  1T5O A;  3MYI A;  3IQ6 A;  3SP1 A;  3SXK A;  1RMV A;  1C17 M;  1D0Y A;  2JPU A;  3EGD B;  4NCQ A;  1XZP A;  3RW0 A;  2WVQ A;  2RSE B;  1K40 A;  4OIR F;  3UMI A;  2P61 A;  2C03 A;  2I8B A;  1CPR A;  4MVZ A;  4D4N A;  4E18 A;  1VLT A;  4PFO A;  4CIP A;  5E3A A;  5KYX B;  1J8Y F;  2XL6 A;  4WGY A;  3FHD A;  5T3W A;  1D0Z A;  1K05 A;  3EGX B;  5L0I A;  4U5E E;  3TOM A;  3IQ5 A;  1ZHZ A;  3SXY A;  5EHH A;  1EKY A;  2HSB A;  1OXK A;  2P7V A;  1F1M A;  4O79 A;  4DRJ B;  2LQG A;  4OD5 A;  4HFK B;  3N24 A;  4CIH A;  2HSQ A;  2EPO A;  2YLI A;  4G0H A;  4DRI B;  3IQC A;  1Z5Z A;  2HV6 A;  3NG1 A;  2IOQ A;  2R05 A;  3OEO A;  3TQO A;  2L9J A;  1RJ9 A;  1ORS C;  3UMH A;  2R9R B;  2PBE A;  3R7C A;  1T01 A;  3QMK A;  4J30 B;  4NTF A;  2XLE A;  3U5S A;  3C8G D;  3W2W A;  1APC A;  4I1O B;  1HW2 A;  4JVS A;  1VMA A;  1NLX A;  1WOL A;  1PD1 A;  3GM1 A;  5TJ5 E;  3QW1 A;  2MYS A;  4YN0 B;  4U5D E;  4CDY A;  3GEE A;  2R7R A;  3I5P A;  2XM0 A;  1WWP A;  4ER9 A;  4XEK A;  4K1O A;  4XEF A;  1GS9 A;  4JTC B;  1Q0M A;  4CJG A;  5L3Q A;  1Z63 A;  1ZHY A;  3U9J A;  3H2V A;  3EFO A;  1EA8 A;  3DE8 A;  3I4U A;  4KBL A;  5JT4 A;  2WL8 A;  3ASO C;  3RIP A;  3U8P A;  4ULW A;  1RXQ A;  5JRA A;  1U0B B;  2EPL X;  1YAR O;  2AWC A;  1YJG A;  4HEA J;  4LLE A;  3IQT A;  3TUL A;  3AQB A;  4I3M A;  5KYW B;  3IHU A;  4YT4 A;  3RKO F;  5JS5 A;  1V4A A;  2KYH A;  2CNW D;  1OQC A;  4JJF A;  1OKK D;  4OIN F;  2YRF A;  3AG4 C;  3V7O A;  3ZTM A;  2Y3D A;  3LS0 A;  2OOC A;  4CS9 C;  5F5H A;  3JTL O;  2YLD A;  2WZG A;  2QLA A;  4PJN A;  3EHN A;  1WAT A;  1ZHW A;  4A4A A;  2OG2 A;  3ABK C;  3B0P A;  3K66 A;  1ZW2 A;  3C8G A;  3FDQ A;  1A7D A;  1M2O A;  2B0H A;  3ZWI A;  1I4Y A;  2YWA A;  3KYJ A;  3JSZ A;  4K0D A;  2M64 A;  1MNE A;  1ORY A;  1VOM A;  3DXJ F;  1GGQ A;  3NMK A;  1DOV A;  3LS1 A;  3U9M A;  5A6K A;  3RFY A;  5CIV A;  2VH3 A;  4EBJ A;  1E86 A;  2HV7 A;  4I1M A;  3DWW A;  2YHS A;  2G3K A;  1LI7 A;  2EPN A;  4N6H A;  2NPU A;  3KL4 A;  3LLI A;  3F47 A;  2ZD9 A;  3RQG A;  4DRH B;  4YWQ A;  3RH3 A;  256B A;  1O87 A;  3EJN A;  2J0W A;  2D5R B;  3MLG A;  4JZA A;  1YLM A;  3KYI A;  4P9T A;  4U9D A;  4XPX A;  4Z9J A;  2R7Q A;  4FX5 A;  2D4U A;  3ZTZ A;  4Z9I A;  4U5B E;  1BR1 A;  1R5I D;  4O6N A;  3U2L A;  3CEX A;  4IAQ A;  4YL1 A;  2FAP B;  1QSP A;  1QKR A;  4RD9 A;  3EG9 A;  1C03 A;  3U8V A;  2IYL D;  3LLK A;  2EIN C;  5COF A;  4G7Z F;  3NMI A;  1CGO A;  1NFN A;  1HW1 A;  2A6E F;  4AL1 A;  4YL3 A;  3HNI A;  2GFH A;  2A1D D;  2VC9 A;  2QNL A;  4JW1 A;  4ULV A;  5D91 A;  4Z9H A;  3V5Y A;  1M56 C;  1ZYR F;  2HMQ A;  1OW8 A;  1JPJ A;  1NU7 D;  3SXZ A;  1G8X A;  4XQ1 A;  3UNG C;  2CGE A;  4LLC A;  2OU6 A;  1OCC C;  3AG1 C;  2AVK A;  3IPM O;  4C7O A;  4MND A;  2CDQ A;  1QQ3 A;  1M2V B;  1Y6D A;  2ZXR A;  3EGD A;  2F22 A;  4XEV A;  1TQG A;  5FCL A;  3U2M A;  3M4C A;  1TWC A;  1I5N A;  3CSK A;  4C3E A;  5JSL A;  2DYR C;  2GDC A;  1B68 A;  2ETS A;  4MW3 A;  2J7P D;  1HY5 A;  3EGX A;  4YJW A;  5T3T A;  4EHP A;  1JPN A;  2OKU A;  3HLZ A;  5E2Q A;  2GA0 A;  4N4W A;  1ZZP A;  4N06 A;  3AOU A;  3E9V A;  1E84 A;  2LD6 A;  4XPY A;  3N2Z B;  1FTS A;  1LS4 A;  3ECS A;  3LNM B;  1ZHX A;  3K1H A;  2G3V A;  1R4T A;  4DOZ A;  4ANJ A;  2NSG A;  1T9K A;  3LAY A;  4JJG A;  2RD9 A;  1Q0F A;  2ZXP A;  2W45 A;  4GEH A;  5CI8 A;  4CSA C;  3HNL A;  4MTO A;  2AU5 A;  1OR3 A;  4LER A;  1WGW A;  1YVI A;  5BQH A;  2HUJ A;  3U3B A;  2MWQ A;  4MVR A;  5L0D A;  3SZR A;  4CS8 A;  4OIP F;  4YT8 A;  3M79 A;  5BQI A;  3BRJ A;  2X0C A;  3ABL C;  1VB5 A;  3PCV A;  3NYM A;  5B1A C;  4CSA A;  1D0X A;  2NUP B;  2WZF A;  3SNH A;  5HV9 A;  1YDI A;  2R7V A;  3O6X A;  1YA9 A;  1FMV A;  2HJM A;  3I5Q A;  2Z15 A;  3K1I A;  5B3S C;  5L0H A;  1GM5 A;  5COG A;  5L0J A;  2PNO A;  1L3P A;  3DJN B;  2R7T A;  1TFO B;  2EIM C;  3U3F A;  2HMZ A;  4AL0 A;  1BR2 A;  4I44 A;  3W8I A;  3US6 A;  2VCA A;  4XPW A;  3OWT A;  2HS5 A;  4JTA B;  2Y3H A;  3B71 A;  2XLD A;  3FOP A;  4J7T A;  4IB4 A;  4CDA A;  2J7P A;  3T6J A;  4E7Z A;  2J9V A;  1MMN A;  2E87 A;  3EZH A;  1FFT C;  3O39 A;  1A7V A;  1MMA A;  1OXB A;  2LCH A;  2VCB A;  3JRT A;  4U5C E;  2LK4 A;  3UR3 C;  3W2V A;  4JEA A;  4KNW A;  4DXW A;  5DS4 A;  1G4W R;  1ORJ A;  1N1C A;  3HJC A;  3KPH A;  1S05 A;  2HKV A;  4MVU A;  3WOD F;  1WTY A;  2BE5 F;  3V5X A;  2NG1 A;  2V26 A;  4XLN F;  4H54 A;  3QZC A;  1Z3I X;  1EI7 A;  3RQE A;  2MHR A;  3SYN A;  4WGZ A;  1OCR C;  3G4X A;  5CI9 A;  1E85 A;  3L8I A;  3R2P A;  5A6B D;  3GAN A;  1E2X A;  1QLE C;  1NFO A;  2GWW A;  2CYD A;  4QI0 A;  5B1B C;  3MX3 A;  4EBB A;  4IAR A;  2QUP A;  1YZA A;  5BUO A;  2J9W A;  4XWJ A;  3V5Z A;  3PDM P;  4G78 A;  2QTV A;  3WG7 C;  4E17 A;  2P6V A;  4EBK A;  1K04 A;  4BJ6 A;  2OEV A;  1HMO A;  5DS5 A;  1O5H A;  4C3B A;  4EWC A;  4ZLC A;  1C02 A;  3M1C B;  3CAX A;  4X0R A;  3UGO A;  1KTM A;  4PJM A;  1JOG A;  2NUT A;  3L0I A;  4MVO A;  4G7H F;  4IGG A;  2XLV A;  4E0I A;  4RBN A;  3ITF A;  4JKV A;  2ICW G;  5A69 A;  1TFK B;  4BEJ A;  4DBQ A;  5JVE A;  4U5F E;  3HNK A;  4XTK A;  3DZA A;  3GWL A;  2C04 A;  2J9B A;  1BDJ B;  3G50 A;  3AGU A;  1MQV A;  2EPK X;  1ZU4 A;  4DVZ A;  5KYY A;  2P0N A;  5HSW A;  1Q0D A;  2DGJ A;  3VF0 A;  3S90 A;  4Q4Z F;  4OIQ F;  2H8A A;  1JRA A;  1A41 A;  1IZM A;  2CW0 F;  2GAQ A;  2LIG A;  3AGT A;  2Q7R A;  2ZPA A;  4DVY P;  1H7I A;  4NC3 A;  1DOW A;  2FFH A;  2KGO A;  2KQ9 A;  1MND A;  3EFO B;  2Y69 C;  3ASN C;  3QTH A;  4RDA A;  1D1B A;  2A69 F;  5A6B A;  1XZQ A;  1CPQ A;  4AE4 B;  2A0B A;  3JCU Q;  1Y4C A;  1KNY A;  2QY9 A;  5KYU A;  4DJ9 A;  2LSE A;  2AP3 A;  1J8M F;  2VB6 A;  3S9O A;  3MYF A;  4XLP F;  1YYJ A;  3TK0 A;  3AJM A;  3B0U X;  2KNH A;  1LE4 A;  3N0T A;  3TD7 A;  3NDB B;  4FWV A;  4U5G A;  2WVN A;  4N6C A;  3T6G B;  4D4X A;  3S0X A;  3ABM C;  4KNV A;  5GPG B;  3ZC4 A;  4YL0 A;  2Q4F A;  2L81 A;  1QPU A;  3GEH A;  2PX0 A;  3JYY A;  4A2N B;  3NYL A;  4JIO A;  5K0I A;  3C62 A;  1FAP B;  3C63 A;  4E7S A;  2EPM X;  2JD3 A;  5A6J A;  4GYT A;  3C8G B;  2KW3 C;  1A0B A;  3JRM O;  2WB7 A;  1Z7Q c;  3QW0 A;  4M63 A;  3T6B A;  1VYK A;  4HE8 D;  3QVZ A;  2R25 A;  5B3I A;  3FOO A;  1TWH A;  5KYX A;  1BR4 A;  1D1C A;  4AK9 A;  3CZ6 A;  5KYN A;  3ZQV A;  4J7Y A;  1NZE A;  5JUA A;  3PHF 2;  2XS8 A;  4CJO A;  2L6H A;  2PX3 A;  3DE9 A;  1TKN A;  3NRH A;  2AWY A;  2Q3T A;  4LDQ A;  2PP4 A;  1PD0 A;  3W8H A;  5JLI A;  1NSG B;  2YLG A;  2VCC A;  1PV3 A;  4CS8 C;  4YT2 A;  2XLO A;  2YL7 A;  1Q0G A;  1T6I A;  4NTB A;  2IXN A;  3FXH A;  4QDL A;  1U6H A;  4BG0 A;  4BJ1 A;  4C3D A;  2OQM A;  3DMD A;  5L0C A;  2Q9A A;  2B0J A;  1EQ1 A;  2UUI A;  2YVK A;  3C8Z A;  3K1I C;  3VRC A;  1VLS A;  1A7E A;  3OA1 A;  5F28 E;  4DBR A;  2LP4 A;  2VAS A;  3GWN A;  3MFN A;  3NMJ A;  1BBH A;  1TWG A;  2EIK C;  1QVX A;  2WVO A;  4JUR I;  4BPM A;  1RKC A;  4CDV A;  4F4B A;  1G4U S;  3IEE A;  4L6R A;  3ZG1 A;  3WHN A;  1LS1 A;  5DS6 A;  1BZ4 A;  3SXM A;  3EPV A;  3GEI A;  1SZI A;  2J46 A;  3HTK C;  4EKW A;  2KSF A;  2TMV P;  5DLJ A;  2EIJ C;  2XM4 A;  4O6Y A;  2HZ8 A;  2A0U A;  4LDK A;  1SF8 A;  4JRZ A;  3ZQY A;  2IXP A;  2M4E A;  1JR8 A;  3NYJ A;  5BQG A;  1SR2 A;  3CQZ A;  3MBG A;  4MTF A;  2V3C C;  4MW8 A;  4P6I C;  2XL8 A;  3F46 A;  3E70 C;  2O9X A;  5IY5 C;  3L34 A;  1AUE A;  1ZW3 A;  5COM A;  3G4Z A;  3LEO A;  1OW6 A;  2Y3G A;  5DQZ A;  3GOR A;  2ZXO A;  3JZ0 A;  3PMR A;  5KYW A;  2J45 A;  2YL1 A;  1FFH A;  3L1M A;  1T6Q A;  3W4Y A;  3EZI A;  4PAC A;  4PJJ A;  4R32 A;  1RKE B;  3X1O A;  4YT5 A;  1FNT c;  1KU2 A;  3S28 A;  3TJ6 A;  4NY3 A;  2G62 A;  4O6M A;  5F5F A;  4GQH A;  4IRU A;  3RYL A;  2A68 F;  1H9G A;  5E33 A;  4OD4 A;  4JCZ A;  3VAY A;  2WZL A;  1CGM E;  1AEP A;  1NG1 A;  5JP7 A;  2L6G A;  2BL2 A;  2OCC C;  1OR2 A;  2L6F A;  5AC5 A;  3M4B A;  3L8J A;  1Z6A A;  1ZU5 A;  3GM3 A;  5D92 A;  4B6I A;  1T6U A;  1PCX A;  1SYQ A;  4LDR A;  2KK1 A;  2W4M A;  4JC7 A;  4BJ6 C;  1YAU O;  2JX0 A;  3Q6N A;  1H6G A;  2YEV A;  3JSE O;  4KC9 A;  3Q7G A;  1LPE A;  2HFI A;  4WAB A;  1V55 C;  1UFB A;  2X51 A;  2I15 A;  2FGY A;  4MS2 A;  2ASR A;  2J8W A;  2Q00 A;  2XXA B;  2XLM A;  3QVY A;  2R7O A;  2PF4 E;  1LKX A;  2OEX A;  3B29 A;  3K6B A;  4BJT A;  1YA7 O;  3KMI A;  3O10 A;  2R7U A;  2YQY A;  3EH2 A;  1LM3 B;  1RJ9 B;  3J06 A;  2ZXW C;  2P1A A;  1WAS A;  2W4B A;  2XLW A;  4AE4 A;  3GOD A;  1HE9 A;  3FAJ A;  4CS7 A;  3FMS A;  3C7J A;  2R7S A;  1JAF A;  4O7G A;  1FR0 A;  2QE9 A;  5AGF A;  1E83 A;  1HE1 A;  3B0V C;  1VK5 A;  3FAP B;  4PK4 A;  1YZC A;  1H9T A;  1D1A A;  1S7Z A;  3LNR A;  2L7A A;  2Q9C A;  3O55 A;  4MVQ A;  4HFF B;  2R03 A;  1M6T A;  1HMD A;  3S84 A;  4IAO A;  1ZVZ A;  3KKB A;  4QI2 A;  1LVK A;  1LI5 A;  4J32 B;  5L0G A; 
#chains in the Genus database with same CATH homology
 1Q0F A;  1Q0K A;  1Q0G A;  1T6I A;  3G4X A;  3G50 A;  1T6Q A;  4NCQ A;  1Q0M A;  1T6U A;  1Q0D A;  3G4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...