1Q0GA

Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the state after full x-ray-induced reduction
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVYDPAQARIEAESVKAIQEKMAANDDLHFQIRATVIKEQRAELAKHHLDVLWSDYFKPPHFESYPELHTLVNEAVKALSAAKASTDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Ni]
publication title Crystal structure of nickel-containing superoxide dismutase reveals another type of active site
pubmed doi rcsb
total genus 51
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1q0gA00
1Q0KA 1Q0DA 1Q0FA 4NCQA 1T6IA 1T6QA 3G50A 1T6UA 3G4ZA 1Q0MA 1Q0GA 3G4XA
chains in the Genus database with same CATH superfamily
3W8IA 4HEAJ 5TJ5E 3Q7LA 3C8GA 4IWBA 5F5HA 1K40A 5DS6A 1LIHA 2YHSA 4JCHA 5T3WA 1ZHYA 2IYLD 1DOWA 2NUTA 1GQAA 4WGZA 1JPNA 2G62A 3IQCA 2R7WA 4BEJA 1O3UA 4RD9A 3LJBA 1ZU4A 2J0WA 1OCRC 3GODA 5KYYB 1DOVA 4GQHA 4JW1A 4MVMA 2TMVP 4XLPF 4HFFB 1WN0A 3RQFA 1V54C 1I5NA 5T1DB 3EH1A 3DD7A 4NTBA 3LS1A 2GAQA 2R7OA 2XS1A 1G5ZA 1Z7Qc 2Q00A 2J7PA 3CAXA 3DJUB 1R5ID 4OIRF 1M6TA 2WZLA 4IARA 4Q7CA 3S27A 1V74B 1MNDA 2OOCA 5A6BA 3WG7C 1BR2A 3ZVRA 5KYXB 2CGEA 3NMIA 3FMSA 1KTMA 5E33A 3L34A 3LNRA 3C8ZA 2KSFA 3TOMA 3C62A 2RSEB 3KMIA 2R7XA 2CDQA 2YL3A 2CYDA 3DE9A 3OEOA 3RH3A 3H65A 3K33A 1RMVA 3G50A 5GPGB 1APCA 1VMAA 3SXKA 4CS7A 3HKKA 5KYXA 1A41A 2VCAA 3HNLA 3R2PA 4P6IC 4YN0B 4CJGA 2LQGA 2C03A 1JAFA 5KYNA 4LERA 1WTYA 2XL4A 5L0FA 3NMKA 1FMWA 3DKAA 3K7DA 2G3KA 4G7OF 3Q6MA 4CJOA 4ER9A 1V4AA 2V3CC 1LE4A 2HZ8A 5JP7A 2OU6A 3GM1A 1ORJA 2EPKX 4I1OB 2NSFA 1E83A 4CSAA 3LEVA 2W45A 3NYLA 4RDAA 1LVKA 2R9RB 1PD0A 1B68A 1Q0KA 2HMZA 4YL0A 1HW1A 3JSZA 4DVYP 4OIQF 4G78A 3TJ6A 2FFHA 2YLDA 5CI8A 1EQ1A 3QZCA 2J45A 3S90A 1NLXA 4PJMA 1IZMA 1YA7O 2YVKA 4MTFA 4DRIB 2ZXWC 3ECSA 2IBFA 2L6FA 2JPUA 4JTAB 5BQHA 3O39A 2C04A 1RJ9A 2AWCA 2Y3BA 1NZEA 1LI5A 2XM0A 4PJJA 2AVKA 2DYSC 3FOPA 3JZ0A 1NSGB 3SZRA 1VOMA 5L0CA 2VCBA 2R02A 2XLVA 4U5CE 5COMA 1MQVA 2ETSA 2J9VA 4BG0A 4C3BA 1OW6A 2R25A 4DJ9A 4DBQA 1MMGA 3K1IC 1QKRA 2YLGA 1RKEB 1J8MF 1H6GA 4UDVA 4QI2A 3UR3C 1FR0A 1OQCA 2A69F 4O6MA 2R7RA 3RQEA 4DRHB 5IY5C 4I3MA 4WGYA 3AQCA 3SXYA 2A0BA 1NU7D 3FOOA 1VLSA 3PCVA 3PMRA 2RD9A 1GS9A 1MMNA 4J7YA 2HSQA 2OG2A 3I4UA 4Z9JA 3U9MA 2Q9BA 3UNGC 3UGPA 1SR2A 2P0NA 1RKEA 5T3TA 1PCXA 2KJGA 2YL0A 4G0HA 1KU2A 4IGGA 3DM5A 1YAUO 4L6RA 5KYWB 4P9TA 1U0BB 2HJ3A 2PP4A 4E18A 4C7OB 2YQYA 2YRFA 4JURI 2B0HA 2XLOA 3ZC4A 1PD1A 3AGUA 1S7ZA 3SEOA 2P1AA 3MYIA 4E17A 3J06A 1C02A 1TQGA 2QY9A 3N2ZB 4OINF 1WWPA 1K04A 1T6UA 3M15A 5JVEA 3JYYA 4HFKB 4W8PA 4EBKA 2WVOA 1GM5A 4CS9C 2HFIA 1YZCA 1E84A 2GFHA 2OJQA 1YYJA 3C18A 4JJGA 5DLJA 2ZPAA 3K6BA 1O87A 5L3QA 1V55C 4BPMA 3C8GD 2HKVA 4LLCA 3TJ5A 3X2QC 4MVOA 4P9FA 5F5FA 2LK4A 2G3VA 2OEXA 5COFA 1T6IA 1OR3A 1JR8A 3V5XA 3V7OA 4CDYA 3NDBB 2XLEA 1UG7A 2AP3A 3RKOF 4QI0A 3A9CA 1YJGA 4NQFA 3KPHA 1UFBA 3MFNA 2AWYA 2L81A 2PF4E 3RVYA 5A6KA 3EQLF 3K1HA 5A6AA 3TQOA 4IAQA 2NPUA 5KYUB 4N6CA 4N4WA 1NG1A 5JSLA 4NCQA 2NUTB 5A6BD 3SYNA 1OKKA 4JZAA 3IHUA 1XWJA 2HSBA 4KNWA 3M4BA 3NKEA 4BJ6C 3IQ5A 4YL1A 4MVSA 3SNHA 3JRMO 1HMOA 5KYUA 3ZTMA 2IM8A 3GWNA 2QNLA 4Q5SF 1G4WR 3M1CB 3JT1A 4XTKA 4DRJB 1E86A 3ZG1A 3ZSUA 2GDCA 2EINC 3AG3C 2EILC 2HV6A 3EHNA 2Y69C 4XWJA 1OR2A 5K0IA 1H7IA 2A0UA 2BC5A 4O6NA 1AEPA 3AG1C 4MNDA 4IRUA 4KI2A 3EG9B 1RKCA 3CSKA 5L0DA 4NTFA 1FAPB 4EKWA 3KKBA 2VH3A 2WZGA 2LSEA 1LKXA 2LD6A 2Y3HA 4MW3A 4AE4B 4CS8C 4CX9A 3UGOA 3FAPB 2R7UA 3O6XA 1NFNA 1CGNA 4AL1A 4I1MA 2JX0A 1Q0FA 3GEIA 3AJMA 1EI7A 1J8YF 1OW7A 1ZZPA 3EG9A 3QW1A 1A7VA 2WB7A 4U5FE 4YJWA 4Z9IA 3AGTA 3GM2A 4AE4A 4ZLCA 3KL4A 2D4UA 2LP4A 2YLIA 1OCZC 3ZWIA 4CS9A 1U6HA 2YWAA 4PJNA 4ULVA 1Z5ZA 2R7TA 2BL2A 4CBEA 5CIVA 4B6IA 3HNKA 4CDVA 2OQMA 3T6BA 4XPWA 1C17M 5CI9A 2A6HF 2I8BA 4OIPF 5JS5A 1M56C 1D1CA 1PV3A 2L6HA 3OA1A 4BEMJ 1I4YA 1RXQA 3FAJA 3LNMB 5AGFA 2XLDA 4DOZA 4MS2A 2XRHA 5L0IA 1JPJA 2EIMC 2R03A 3MLGA 3ZIBA 1TFOB 3B0VC 2P6VA 3DI5A 3B0UX 2XSEA 1EKYA 3DM9B 3U8PA 4BJ5C 1XZPA 2R7SA 4A4AA 2AU5A 1JRAA 1RJ9B 1GGQA 3WHNA 2Q9AA 3L1MA 4RBNA 1CPQA 2XL8A 3DJNB 4LACB 3LUTB 4MTGA 4PFPA 5DQZA 4BJ6A 2CNWD 3TULA 2LCHA 3RIPA 1AVOB 1QVXA 1TWHA 3VM6A 3TK0A 2LFFA 2MYSA 4N6HA 2V26A 2HS5A 4AK9A 2PBEA 3KH2A 2W4MA 2L9JA 2P7VA 2OKUA 3CEXA 3RYLA 4JVSA 4MVZA 4XEKA 3SP1A 5JRAA 2HMQA 2YL1A 4XPXA 1ZU5A 4AX2A 4PFOA 1D0XA 4EIYA 5DS5A 2E87A 1VK5A 4XQ1A 2H7OA 3L8IA 2GWWA 3IEEA 4Z9HA 3AOUA 3KYIA 3U2LA 1YLMA 1FFTC 2A1DD 2XLMA 2ZXOA 4NC3A 1HMDA 1XZQA 2J9UA 4CS8A 1ZYRF 5JT4A 3C7JA 1KNYA 2IXNA 3T9OA 3ZQVA 4J30B 1FTSA 1IW7F 1G8XA 3S0XA 1Z63A 1M57C 3G4ZA 2NUPA 3EJNA 3LAYA 1OXBA 2YZSA 3EH2A 4U5HA 4HE8D 3S29A 4JEBA 2W4BA 2VC9A 3LLKA 2QUPA 3F47A 4YL3A 3S84A 2R7VA 3NMJA 5HV9A 2Q7RA 3GEEA 4LDRA 1QZXA 3RF3A 1I4ZA 1D0ZA 4ZLDA 2KNHA 4MVQA 4N06A 3JCUQ 4O79A 256BA 4EBJA 5L0GA 2Q3TA 5L3VA 3FHDA 2VASA 3W4YA 3JTLO 3LLIA 1OKKD 3QVYA 4O6YA 3FVYA 4K1OA 5DQTA 1Z6AA 3H2UA 3MYFA 2J46A 4U9EA 3W2WA 3WODF 2PX3A 1OXKA 5HSWA 3M79A 3BEHA 2I15A 1TKNA 4GYTA 4JC7A 1BBHA 1L3PA 2ZXPA 3AG4C 4J7TA 1OW8A 4MVRA 5COGA 2M64A 4BJ5A 4K0DA 1W2WA 1YDIA 3IQ6A 3U3BA 2CW0F 1M2OA 2KW3C 2Q9CA 3CZ6A 3KYJA 1TWGA 4R32A 1SZIA 3ABLC 3EZIA 3U5SA 3V5ZA 3PDMP 2XXAA 3E9VA 4OIOF 2MWQA 4PR9A 1C03A 2PFDA 1ZVZA 3NRHA 4WABA 4D4XA 1JMWA 2J7PD 5KYYA 2O9XA 1FNTc 1LE2A 3A11A 3C63A 4BJTA 1QQ3A 2YEVA 4K7BA 4PK4A 1VYIA 4D4NA 3EFOA 3RFYA 3W8HA 2X0CA 4IAOA 1MNEA 4C3EA 1ORSC 2R05A 4JE9A 4XLNF 3NYMA 4KNVA 4ONSA 2A68F 5B3IA 1O5HA 1JOGA 3K1IA 4JTDB 3HTKC 1HY5A 4I44A 4JKVA 1ZHXA 2CCYA 3QVZA 4U5GA 4W8KA 1U89A 3EZHA 4CSAC 3MX3A 3ZDLA 2FGYA 3AQBA 1TWAA 3NG1A 2J8WA 2KGOA 2L6GA 2XM4A 3EGDA 1CGOA 4FX5A 4AL0A 1YZAA 3Q7GA 3AG2C 2UUHA 1N1CA 3PHF2 3OWTA 2OJED 1A7DA 3DXJF 3FXHA 3RQGA 2X51A 4JEAA 5EK0A 3TD7A 2Y39A 3QMKA 4JCZA 3JRTA 4FESA 3UMIA 5EGYA 3CQZA 4G7HF 4Q4ZF 1ORYA 2XL6A 2XLWA 3H2VA 4YT5A 1SF8A 2KYHA 5F28E 4EBBA 2NG1A 5E3AA 4BJ1A 2H7BA 3V5YA 3T6JA 3ASOC 2H7VC 1YYXA 4EUKB 3EGXB 2WZFA 3W2VA 1QPUA 3HLZA 1ZHZA 3U8VA 1CGME 2EIKC 2JD3A 1HW2A 4U5EE 2KK1A 2J9WA 5DVWA 4YK5A 4EHPA 4E7ZA 3E70C 3I5PA 4U9DA 3UMHA 5B3SC 3LESA 1E85A 4G7ZF 4M63A 2XS8A 3EGXA 2EPNA 5L0JA 2DB4A 3ABMC 1A7EA 2EPLX 3S28A 3EPVA 4H54A 1NBBA 5EHHA 2R7QA 3IQTA 2QLAA 3UMKA 1HE9A 3LS0A 4O7GA 3HNIA 4JIOA 2B0JA 4A2NB 4CIPA 1ZW3A 2UUIA 1BR4A 4IB4A 1T9KA 3DWWA 2W9YA 1Q0MA 2KC3A 3K66A 4JRZA 4CIHA 2J0XA 1QLEC 1MMAA 2P61A 4OD4A 1E2XA 1BZ4A 2DI3A 2HV7A 4QDLA 5AC5A 5FCLA 2H8AA 1SYQA 2ASRA 1YVIA 1H9GA 1NU9C 1OCCC 3GANA 4DBRA 1NFOA 4YT8A 2HUJA 3WAQA 4EWCA 1K05A 2EIJC 2EPMX 5DS4A 4FWVA 3RW0A 3U3FA 4NY3A 2WVNA 2MHRA 3VF0A 2NUPB 3POVA 1CPRA 3ASNC 2XLHA 1WGWA 3B29A 2A6EF 2F22A 2LFDA 4E0HA 4ULWA 5A6JA 4XEVA 3ZTZA 1VB5A 1Y6DA 4GEHA 4YT2A 4NTAA 1LS4A 4DVZA 3DMDA 1D1BA 4LDKA 3U2MA 2IXPA 1H9TA 1VTMP 2D5RB 2J9BA 3DAGA 2IOQA 1A0BA 3DAFA 4LDQA 2Q4FA 4JTCB 3B0PA 3DE8A 1BR1A 4MVUA 3N24A 1ZHWA 2WVQA 4ANJA 1Y4CA 3JSEO 5FZTA 4H4KC 2QE9A 1WOLA 1L7CA 4MQ9F 4F4BA 4X0RA 4YWQA 1TFKB 2ZXRA 3FDQA 2BE5F 5D91A 3VYWA 3VAYA 1M2VB 3GORA 3NKDA 5BQGA 1RCPA 1F1MA 2DYRC 4KBLA 4XEFA 4XPYA 3VRCA 3GM3A 3X1OA 3T4RA 1SMYF 2M4EA 3ABKC 2DGJA 1LPEA 1Z3IX 3L0IA 5E3CA 3MBGA 2QTVA 1D1AA 1G4US 1VYKA 2Y3DA 1T5OA 2FAPB 3LEOA 1R4TA 1FMVA 2CNWA 3O10A 4PACA 3U9JA 4CDAA 1M2VA 2YL7A 3HJCA 3HNJA 4MTOA 4YT4A 2IXOA 2XXAB 3Q6NA 1WASA 2WL8A 3I5QA 2LIGA 3B9QA 4OD5A 1TR2A 4J32B 1LI7A 2PNOA 2PX0A 2VCCA 2NSGA 5B1BC 1VLTA 3L8JA 5D92A 4DXWA 5BUOA 4C7OA 3SXZA 3N0TA 4PJLA 2Z15A 1S05A 2YKZA 5E2QA 3EFOB 4MW8A 3RVZA 3IPMO 2HJMA 3F46A 4LLEA 3M4CA 5JUAA 1QSPA 4E0IA 2ZD9A 1T6QA 1ZHTA 5KYWA 3U0CA 3GEHA 1MMDA 1TWCA 1LS1A 1Q0DA 3EHMA 3NYJA 3QTHA 4JJFA 3DZAA 4E7SA 5A69A 3ATPA 1WATA 3T6GB 2OCCC 2EPOA 3EGDB 4IJJA 2GA0A 2VB6A 1EA8A 2ICWG 1FFHA 5L0HA 2IXMA 1OCOC 5B1AC 3G4XA 5AC4A 4WJ0A 3S9OA 3US6A 4C3DA 2L7AA 1HE1A 1ST6A 3R7CA 1D0YA 1ZW2A 4U5DE 1Z23A 1YA9A 1AUEA 1LM3B 1BDJB 1Q0GA 1YARO 3C8GB 4U5BE 3ZQYA 3SXMA 3QW0A 3JYHA 3ITFA 3B71A 3BRJA 3TOLA 4FAPB 5BQIA 3GWLA 4KC9A 5JLIA 2Y3GA 2KQ9A 1T01A 2OEVA 3O55A
chains in the Genus database with same CATH topology
1Q0KA 1Q0DA 1Q0FA 4NCQA 1T6IA 1T6QA 3G50A 1T6UA 3G4ZA 1Q0MA 1Q0GA 3G4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0K A;  1Q0D A;  1Q0F A;  4NCQ A;  1T6I A;  1T6Q A;  3G50 A;  1T6U A;  3G4Z A;  1Q0M A;  1Q0G A;  3G4X A; 
#chains in the Genus database with same CATH topology
 3W8I A;  4HEA J;  5TJ5 E;  3Q7L A;  3C8G A;  4IWB A;  5F5H A;  1K40 A;  5DS6 A;  1LIH A;  2YHS A;  4JCH A;  5T3W A;  1ZHY A;  2IYL D;  1DOW A;  2NUT A;  1GQA A;  4WGZ A;  1JPN A;  2G62 A;  3IQC A;  2R7W A;  4BEJ A;  1O3U A;  4RD9 A;  3LJB A;  1ZU4 A;  2J0W A;  1OCR C;  3GOD A;  5KYY B;  1DOV A;  4GQH A;  4JW1 A;  4MVM A;  2TMV P;  4XLP F;  4HFF B;  1WN0 A;  3RQF A;  1V54 C;  1I5N A;  5T1D B;  3EH1 A;  3DD7 A;  4NTB A;  3LS1 A;  2GAQ A;  2R7O A;  2XS1 A;  1G5Z A;  1Z7Q c;  2Q00 A;  2J7P A;  3CAX A;  3DJU B;  1R5I D;  4OIR F;  1M6T A;  2WZL A;  4IAR A;  4Q7C A;  3S27 A;  1V74 B;  1MND A;  2OOC A;  5A6B A;  3WG7 C;  1BR2 A;  3ZVR A;  5KYX B;  2CGE A;  3NMI A;  3FMS A;  1KTM A;  5E33 A;  3L34 A;  3LNR A;  3C8Z A;  2KSF A;  3TOM A;  3C62 A;  2RSE B;  3KMI A;  2R7X A;  2CDQ A;  2YL3 A;  2CYD A;  3DE9 A;  3OEO A;  3RH3 A;  3H65 A;  3K33 A;  1RMV A;  3G50 A;  5GPG B;  1APC A;  1VMA A;  3SXK A;  4CS7 A;  3HKK A;  5KYX A;  1A41 A;  2VCA A;  3HNL A;  3R2P A;  4P6I C;  4YN0 B;  4CJG A;  2LQG A;  2C03 A;  1JAF A;  5KYN A;  4LER A;  1WTY A;  2XL4 A;  5L0F A;  3NMK A;  1FMW A;  3DKA A;  3K7D A;  2G3K A;  4G7O F;  3Q6M A;  4CJO A;  4ER9 A;  1V4A A;  2V3C C;  1LE4 A;  2HZ8 A;  5JP7 A;  2OU6 A;  3GM1 A;  1ORJ A;  2EPK X;  4I1O B;  2NSF A;  1E83 A;  4CSA A;  3LEV A;  2W45 A;  3NYL A;  4RDA A;  1LVK A;  2R9R B;  1PD0 A;  1B68 A;  1Q0K A;  2HMZ A;  4YL0 A;  1HW1 A;  3JSZ A;  4DVY P;  4OIQ F;  4G78 A;  3TJ6 A;  2FFH A;  2YLD A;  5CI8 A;  1EQ1 A;  3QZC A;  2J45 A;  3S90 A;  1NLX A;  4PJM A;  1IZM A;  1YA7 O;  2YVK A;  4MTF A;  4DRI B;  2ZXW C;  3ECS A;  2IBF A;  2L6F A;  2JPU A;  4JTA B;  5BQH A;  3O39 A;  2C04 A;  1RJ9 A;  2AWC A;  2Y3B A;  1NZE A;  1LI5 A;  2XM0 A;  4PJJ A;  2AVK A;  2DYS C;  3FOP A;  3JZ0 A;  1NSG B;  3SZR A;  1VOM A;  5L0C A;  2VCB A;  2R02 A;  2XLV A;  4U5C E;  5COM A;  1MQV A;  2ETS A;  2J9V A;  4BG0 A;  4C3B A;  1OW6 A;  2R25 A;  4DJ9 A;  4DBQ A;  1MMG A;  3K1I C;  1QKR A;  2YLG A;  1RKE B;  1J8M F;  1H6G A;  4UDV A;  4QI2 A;  3UR3 C;  1FR0 A;  1OQC A;  2A69 F;  4O6M A;  2R7R A;  3RQE A;  4DRH B;  5IY5 C;  4I3M A;  4WGY A;  3AQC A;  3SXY A;  2A0B A;  1NU7 D;  3FOO A;  1VLS A;  3PCV A;  3PMR A;  2RD9 A;  1GS9 A;  1MMN A;  4J7Y A;  2HSQ A;  2OG2 A;  3I4U A;  4Z9J A;  3U9M A;  2Q9B A;  3UNG C;  3UGP A;  1SR2 A;  2P0N A;  1RKE A;  5T3T A;  1PCX A;  2KJG A;  2YL0 A;  4G0H A;  1KU2 A;  4IGG A;  3DM5 A;  1YAU O;  4L6R A;  5KYW B;  4P9T A;  1U0B B;  2HJ3 A;  2PP4 A;  4E18 A;  4C7O B;  2YQY A;  2YRF A;  4JUR I;  2B0H A;  2XLO A;  3ZC4 A;  1PD1 A;  3AGU A;  1S7Z A;  3SEO A;  2P1A A;  3MYI A;  4E17 A;  3J06 A;  1C02 A;  1TQG A;  2QY9 A;  3N2Z B;  4OIN F;  1WWP A;  1K04 A;  1T6U A;  3M15 A;  5JVE A;  3JYY A;  4HFK B;  4W8P A;  4EBK A;  2WVO A;  1GM5 A;  4CS9 C;  2HFI A;  1YZC A;  1E84 A;  2GFH A;  2OJQ A;  1YYJ A;  3C18 A;  4JJG A;  5DLJ A;  2ZPA A;  3K6B A;  1O87 A;  5L3Q A;  1V55 C;  4BPM A;  3C8G D;  2HKV A;  4LLC A;  3TJ5 A;  3X2Q C;  4MVO A;  4P9F A;  5F5F A;  2LK4 A;  2G3V A;  2OEX A;  5COF A;  1T6I A;  1OR3 A;  1JR8 A;  3V5X A;  3V7O A;  4CDY A;  3NDB B;  2XLE A;  1UG7 A;  2AP3 A;  3RKO F;  4QI0 A;  3A9C A;  1YJG A;  4NQF A;  3KPH A;  1UFB A;  3MFN A;  2AWY A;  2L81 A;  2PF4 E;  3RVY A;  5A6K A;  3EQL F;  3K1H A;  5A6A A;  3TQO A;  4IAQ A;  2NPU A;  5KYU B;  4N6C A;  4N4W A;  1NG1 A;  5JSL A;  4NCQ A;  2NUT B;  5A6B D;  3SYN A;  1OKK A;  4JZA A;  3IHU A;  1XWJ A;  2HSB A;  4KNW A;  3M4B A;  3NKE A;  4BJ6 C;  3IQ5 A;  4YL1 A;  4MVS A;  3SNH A;  3JRM O;  1HMO A;  5KYU A;  3ZTM A;  2IM8 A;  3GWN A;  2QNL A;  4Q5S F;  1G4W R;  3M1C B;  3JT1 A;  4XTK A;  4DRJ B;  1E86 A;  3ZG1 A;  3ZSU A;  2GDC A;  2EIN C;  3AG3 C;  2EIL C;  2HV6 A;  3EHN A;  2Y69 C;  4XWJ A;  1OR2 A;  5K0I A;  1H7I A;  2A0U A;  2BC5 A;  4O6N A;  1AEP A;  3AG1 C;  4MND A;  4IRU A;  4KI2 A;  3EG9 B;  1RKC A;  3CSK A;  5L0D A;  4NTF A;  1FAP B;  4EKW A;  3KKB A;  2VH3 A;  2WZG A;  2LSE A;  1LKX A;  2LD6 A;  2Y3H A;  4MW3 A;  4AE4 B;  4CS8 C;  4CX9 A;  3UGO A;  3FAP B;  2R7U A;  3O6X A;  1NFN A;  1CGN A;  4AL1 A;  4I1M A;  2JX0 A;  1Q0F A;  3GEI A;  3AJM A;  1EI7 A;  1J8Y F;  1OW7 A;  1ZZP A;  3EG9 A;  3QW1 A;  1A7V A;  2WB7 A;  4U5F E;  4YJW A;  4Z9I A;  3AGT A;  3GM2 A;  4AE4 A;  4ZLC A;  3KL4 A;  2D4U A;  2LP4 A;  2YLI A;  1OCZ C;  3ZWI A;  4CS9 A;  1U6H A;  2YWA A;  4PJN A;  4ULV A;  1Z5Z A;  2R7T A;  2BL2 A;  4CBE A;  5CIV A;  4B6I A;  3HNK A;  4CDV A;  2OQM A;  3T6B A;  4XPW A;  1C17 M;  5CI9 A;  2A6H F;  2I8B A;  4OIP F;  5JS5 A;  1M56 C;  1D1C A;  1PV3 A;  2L6H A;  3OA1 A;  4BEM J;  1I4Y A;  1RXQ A;  3FAJ A;  3LNM B;  5AGF A;  2XLD A;  4DOZ A;  4MS2 A;  2XRH A;  5L0I A;  1JPJ A;  2EIM C;  2R03 A;  3MLG A;  3ZIB A;  1TFO B;  3B0V C;  2P6V A;  3DI5 A;  3B0U X;  2XSE A;  1EKY A;  3DM9 B;  3U8P A;  4BJ5 C;  1XZP A;  2R7S A;  4A4A A;  2AU5 A;  1JRA A;  1RJ9 B;  1GGQ A;  3WHN A;  2Q9A A;  3L1M A;  4RBN A;  1CPQ A;  2XL8 A;  3DJN B;  4LAC B;  3LUT B;  4MTG A;  4PFP A;  5DQZ A;  4BJ6 A;  2CNW D;  3TUL A;  2LCH A;  3RIP A;  1AVO B;  1QVX A;  1TWH A;  3VM6 A;  3TK0 A;  2LFF A;  2MYS A;  4N6H A;  2V26 A;  2HS5 A;  4AK9 A;  2PBE A;  3KH2 A;  2W4M A;  2L9J A;  2P7V A;  2OKU A;  3CEX A;  3RYL A;  4JVS A;  4MVZ A;  4XEK A;  3SP1 A;  5JRA A;  2HMQ A;  2YL1 A;  4XPX A;  1ZU5 A;  4AX2 A;  4PFO A;  1D0X A;  4EIY A;  5DS5 A;  2E87 A;  1VK5 A;  4XQ1 A;  2H7O A;  3L8I A;  2GWW A;  3IEE A;  4Z9H A;  3AOU A;  3KYI A;  3U2L A;  1YLM A;  1FFT C;  2A1D D;  2XLM A;  2ZXO A;  4NC3 A;  1HMD A;  1XZQ A;  2J9U A;  4CS8 A;  1ZYR F;  5JT4 A;  3C7J A;  1KNY A;  2IXN A;  3T9O A;  3ZQV A;  4J30 B;  1FTS A;  1IW7 F;  1G8X A;  3S0X A;  1Z63 A;  1M57 C;  3G4Z A;  2NUP A;  3EJN A;  3LAY A;  1OXB A;  2YZS A;  3EH2 A;  4U5H A;  4HE8 D;  3S29 A;  4JEB A;  2W4B A;  2VC9 A;  3LLK A;  2QUP A;  3F47 A;  4YL3 A;  3S84 A;  2R7V A;  3NMJ A;  5HV9 A;  2Q7R A;  3GEE A;  4LDR A;  1QZX A;  3RF3 A;  1I4Z A;  1D0Z A;  4ZLD A;  2KNH A;  4MVQ A;  4N06 A;  3JCU Q;  4O79 A;  256B A;  4EBJ A;  5L0G A;  2Q3T A;  5L3V A;  3FHD A;  2VAS A;  3W4Y A;  3JTL O;  3LLI A;  1OKK D;  3QVY A;  4O6Y A;  3FVY A;  4K1O A;  5DQT A;  1Z6A A;  3H2U A;  3MYF A;  2J46 A;  4U9E A;  3W2W A;  3WOD F;  2PX3 A;  1OXK A;  5HSW A;  3M79 A;  3BEH A;  2I15 A;  1TKN A;  4GYT A;  4JC7 A;  1BBH A;  1L3P A;  2ZXP A;  3AG4 C;  4J7T A;  1OW8 A;  4MVR A;  5COG A;  2M64 A;  4BJ5 A;  4K0D A;  1W2W A;  1YDI A;  3IQ6 A;  3U3B A;  2CW0 F;  1M2O A;  2KW3 C;  2Q9C A;  3CZ6 A;  3KYJ A;  1TWG A;  4R32 A;  1SZI A;  3ABL C;  3EZI A;  3U5S A;  3V5Z A;  3PDM P;  2XXA A;  3E9V A;  4OIO F;  2MWQ A;  4PR9 A;  1C03 A;  2PFD A;  1ZVZ A;  3NRH A;  4WAB A;  4D4X A;  1JMW A;  2J7P D;  5KYY A;  2O9X A;  1FNT c;  1LE2 A;  3A11 A;  3C63 A;  4BJT A;  1QQ3 A;  2YEV A;  4K7B A;  4PK4 A;  1VYI A;  4D4N A;  3EFO A;  3RFY A;  3W8H A;  2X0C A;  4IAO A;  1MNE A;  4C3E A;  1ORS C;  2R05 A;  4JE9 A;  4XLN F;  3NYM A;  4KNV A;  4ONS A;  2A68 F;  5B3I A;  1O5H A;  1JOG A;  3K1I A;  4JTD B;  3HTK C;  1HY5 A;  4I44 A;  4JKV A;  1ZHX A;  2CCY A;  3QVZ A;  4U5G A;  4W8K A;  1U89 A;  3EZH A;  4CSA C;  3MX3 A;  3ZDL A;  2FGY A;  3AQB A;  1TWA A;  3NG1 A;  2J8W A;  2KGO A;  2L6G A;  2XM4 A;  3EGD A;  1CGO A;  4FX5 A;  4AL0 A;  1YZA A;  3Q7G A;  3AG2 C;  2UUH A;  1N1C A;  3PHF 2;  3OWT A;  2OJE D;  1A7D A;  3DXJ F;  3FXH A;  3RQG A;  2X51 A;  4JEA A;  5EK0 A;  3TD7 A;  2Y39 A;  3QMK A;  4JCZ A;  3JRT A;  4FES A;  3UMI A;  5EGY A;  3CQZ A;  4G7H F;  4Q4Z F;  1ORY A;  2XL6 A;  2XLW A;  3H2V A;  4YT5 A;  1SF8 A;  2KYH A;  5F28 E;  4EBB A;  2NG1 A;  5E3A A;  4BJ1 A;  2H7B A;  3V5Y A;  3T6J A;  3ASO C;  2H7V C;  1YYX A;  4EUK B;  3EGX B;  2WZF A;  3W2V A;  1QPU A;  3HLZ A;  1ZHZ A;  3U8V A;  1CGM E;  2EIK C;  2JD3 A;  1HW2 A;  4U5E E;  2KK1 A;  2J9W A;  5DVW A;  4YK5 A;  4EHP A;  4E7Z A;  3E70 C;  3I5P A;  4U9D A;  3UMH A;  5B3S C;  3LES A;  1E85 A;  4G7Z F;  4M63 A;  2XS8 A;  3EGX A;  2EPN A;  5L0J A;  2DB4 A;  3ABM C;  1A7E A;  2EPL X;  3S28 A;  3EPV A;  4H54 A;  1NBB A;  5EHH A;  2R7Q A;  3IQT A;  2QLA A;  3UMK A;  1HE9 A;  3LS0 A;  4O7G A;  3HNI A;  4JIO A;  2B0J A;  4A2N B;  4CIP A;  1ZW3 A;  2UUI A;  1BR4 A;  4IB4 A;  1T9K A;  3DWW A;  2W9Y A;  1Q0M A;  2KC3 A;  3K66 A;  4JRZ A;  4CIH A;  2J0X A;  1QLE C;  1MMA A;  2P61 A;  4OD4 A;  1E2X A;  1BZ4 A;  2DI3 A;  2HV7 A;  4QDL A;  5AC5 A;  5FCL A;  2H8A A;  1SYQ A;  2ASR A;  1YVI A;  1H9G A;  1NU9 C;  1OCC C;  3GAN A;  4DBR A;  1NFO A;  4YT8 A;  2HUJ A;  3WAQ A;  4EWC A;  1K05 A;  2EIJ C;  2EPM X;  5DS4 A;  4FWV A;  3RW0 A;  3U3F A;  4NY3 A;  2WVN A;  2MHR A;  3VF0 A;  2NUP B;  3POV A;  1CPR A;  3ASN C;  2XLH A;  1WGW A;  3B29 A;  2A6E F;  2F22 A;  2LFD A;  4E0H A;  4ULW A;  5A6J A;  4XEV A;  3ZTZ A;  1VB5 A;  1Y6D A;  4GEH A;  4YT2 A;  4NTA A;  1LS4 A;  4DVZ A;  3DMD A;  1D1B A;  4LDK A;  3U2M A;  2IXP A;  1H9T A;  1VTM P;  2D5R B;  2J9B A;  3DAG A;  2IOQ A;  1A0B A;  3DAF A;  4LDQ A;  2Q4F A;  4JTC B;  3B0P A;  3DE8 A;  1BR1 A;  4MVU A;  3N24 A;  1ZHW A;  2WVQ A;  4ANJ A;  1Y4C A;  3JSE O;  5FZT A;  4H4K C;  2QE9 A;  1WOL A;  1L7C A;  4MQ9 F;  4F4B A;  4X0R A;  4YWQ A;  1TFK B;  2ZXR A;  3FDQ A;  2BE5 F;  5D91 A;  3VYW A;  3VAY A;  1M2V B;  3GOR A;  3NKD A;  5BQG A;  1RCP A;  1F1M A;  2DYR C;  4KBL A;  4XEF A;  4XPY A;  3VRC A;  3GM3 A;  3X1O A;  3T4R A;  1SMY F;  2M4E A;  3ABK C;  2DGJ A;  1LPE A;  1Z3I X;  3L0I A;  5E3C A;  3MBG A;  2QTV A;  1D1A A;  1G4U S;  1VYK A;  2Y3D A;  1T5O A;  2FAP B;  3LEO A;  1R4T A;  1FMV A;  2CNW A;  3O10 A;  4PAC A;  3U9J A;  4CDA A;  1M2V A;  2YL7 A;  3HJC A;  3HNJ A;  4MTO A;  4YT4 A;  2IXO A;  2XXA B;  3Q6N A;  1WAS A;  2WL8 A;  3I5Q A;  2LIG A;  3B9Q A;  4OD5 A;  1TR2 A;  4J32 B;  1LI7 A;  2PNO A;  2PX0 A;  2VCC A;  2NSG A;  5B1B C;  1VLT A;  3L8J A;  5D92 A;  4DXW A;  5BUO A;  4C7O A;  3SXZ A;  3N0T A;  4PJL A;  2Z15 A;  1S05 A;  2YKZ A;  5E2Q A;  3EFO B;  4MW8 A;  3RVZ A;  3IPM O;  2HJM A;  3F46 A;  4LLE A;  3M4C A;  5JUA A;  1QSP A;  4E0I A;  2ZD9 A;  1T6Q A;  1ZHT A;  5KYW A;  3U0C A;  3GEH A;  1MMD A;  1TWC A;  1LS1 A;  1Q0D A;  3EHM A;  3NYJ A;  3QTH A;  4JJF A;  3DZA A;  4E7S A;  5A69 A;  3ATP A;  1WAT A;  3T6G B;  2OCC C;  2EPO A;  3EGD B;  4IJJ A;  2GA0 A;  2VB6 A;  1EA8 A;  2ICW G;  1FFH A;  5L0H A;  2IXM A;  1OCO C;  5B1A C;  3G4X A;  5AC4 A;  4WJ0 A;  3S9O A;  3US6 A;  4C3D A;  2L7A A;  1HE1 A;  1ST6 A;  3R7C A;  1D0Y A;  1ZW2 A;  4U5D E;  1Z23 A;  1YA9 A;  1AUE A;  1LM3 B;  1BDJ B;  1Q0G A;  1YAR O;  3C8G B;  4U5B E;  3ZQY A;  3SXM A;  3QW0 A;  3JYH A;  3ITF A;  3B71 A;  3BRJ A;  3TOL A;  4FAP B;  5BQI A;  3GWL A;  4KC9 A;  5JLI A;  2Y3G A;  2KQ9 A;  1T01 A;  2OEV A;  3O55 A; 
#chains in the Genus database with same CATH homology
 1Q0K A;  1Q0D A;  1Q0F A;  4NCQ A;  1T6I A;  1T6Q A;  3G50 A;  1T6U A;  3G4Z A;  1Q0M A;  1Q0G A;  3G4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...