1Q0GA

Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the state after full x-ray-induced reduction
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVYDPAQARIEAESVKAIQEKMAANDDLHFQIRATVIKEQRAELAKHHLDVLWSDYFKPPHFESYPELHTLVNEAVKALSAAKASTDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Crystal structure of nickel-containing superoxide dismutase reveals another type of active site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1q0gA00
3G4XA 1Q0FA 1Q0GA 1T6UA 1T6QA 3G4ZA 1T6IA 1Q0KA 1Q0MA 3G50A 4NCQA 1Q0DA
chains in the Genus database with same CATH superfamily
5KYYA 1T9KA 2YVKA 2JPUA 2P7VA 3EFOA 3I5PA 1D0ZA 1YLMA 2A68F 5T3TA 1RMVA 2EIMC 1FMVA 2KNHA 3GM2A 5CI8A 3QW1A 1ZHXA 3G50A 5A6KA 3KH2A 2WZFA 4O7GA 1NSGB 4HEAJ 3O39A 3VRCA 1AEPA 1T6QA 2LCHA 4KI2A 1LE2A 1MNDA 3HNJA 2AVKA 2QNLA 3DE9A 1LS4A 3MX3A 1QLEC 4QDLA 3UR3C 3U3BA 2KK1A 1C03A 2QUPA 4OD4A 3F47A 1FAPB 1OW7A 1O3UA 3C8GD 4O6MA 1ZHYA 4JKVA 3U2MA 5KYUA 1O5HA 3U9MA 2Q00A 3SEOA 3ZQYA 1G4WR 5BUOA 2R7TA 1RCPA 3QW0A 4E0HA 2Y69C 1SYQA 3T9OA 2HKVA 3HLZA 3HTKC 1TFOB 1G8XA 2YLDA 4G0HA 1OXKA 3VYWA 1MMDA 3DAGA 2GA0A 2HV6A 5E2QA 4MVUA 3NKDA 2PP4A 3DM5A 4G78A 2VCAA 4LDKA 3POVA 4J32B 3LS0A 2EILC 3CZ6A 4EWCA 5AC5A 2CGEA 3GWLA 1CGNA 2EPNA 4RD9A 4AX2A 2QE9A 4NCQA 3V5XA 1LPEA 3C18A 2C04A 5EGYA 2IBFA 5AGFA 3GEIA 2UUHA 4IRUA 2VCCA 4MVOA 2YZSA 5JP7A 3S90A 1OXBA 4P9FA 4YL1A 2LD6A 5FCLA 4HFFB 2DB4A 2L6FA 3S9OA 4JEBA 2WL8A 2XS8A 5JS5A 3DWWA 1V55C 4E7SA 1WOLA 1WGWA 2LFFA 1Z3IX 4WGZA 2H7OA 2OKUA 3DM9B 3S29A 1YZCA 3B29A 4WJ0A 3SXMA 3LLIA 1Q0KA 4N4WA 1Y4CA 2L9JA 4UDVA 1LM3B 1ZYRF 3H65A 1BDJB 3PHF2 3AGUA 2MYSA 1IZMA 3FHDA 2H7BA 2QY9A 1H9TA 1HW1A 3KKBA 2G3VA 2FAPB 3LNRA 1NU9C 2OU6A 2HMQA 4H54A 3U5SA 4CJOA 3X1OA 2PX0A 2R03A 1E86A 2PX3A 4W8PA 2R02A 3K6BA 4GEHA 1A7DA 5JT4A 1EQ1A 3N2ZB 1ZZPA 1YZAA 3CEXA 1KNYA 4WGYA 4OINF 5F5HA 3FAJA 2HV7A 2PNOA 1VMAA 1E2XA 2PFDA 1E84A 2WVNA 3JZ0A 4BG0A 4O6YA 1MQVA 1PD1A 1VLSA 3B71A 5F28E 2HJMA 4D4XA 3GEEA 4BJ6C 2XM0A 4JCZA 1JRAA 4DRHB 1BR1A 4DRJB 2Y3GA 3QTHA 4NQFA 2YHSA 3ZTMA 4PFOA 1U89A 2ZXPA 4N6HA 3EGXB 2R9RB 3ABKC 3EPVA 4U5BE 3LAYA 4CDVA 1LI5A 1QKRA 4BJ5C 3M4CA 1D1AA 3NYJA 3PMRA 4MTOA 5B1BC 3FXHA 1K40A 1Q0FA 3TOMA 3B0VC 4E17A 3MFNA 2KC3A 3K1HA 4QI2A 4BJ6A 3DXJF 1FR0A 4LERA 4NTAA 4I3MA 4LDQA 1LE4A 4G7OF 1Q0DA 3ITFA 3KYIA 3ZG1A 4DVYP 4U5FE 1TWHA 1I5NA 1LS1A 1WTYA 1OR3A 3RVZA 4XEVA 4E18A 3EH2A 5F5FA 4JIOA 1AVOB 3W4YA 1YDIA 3W8HA 4J7TA 2G62A 4JE9A 3GM3A 3ECSA 4PJNA 4M63A 4BJ5A 2IXOA 3WODF 1SZIA 1C02A 1I4YA 1Z5ZA 3ATPA 3NMKA 2HMZA 3FAPB 3MBGA 1R4TA 1ZW3A 2HUJA 4K0DA 4QI0A 3NMIA 2XLEA 3GORA 1CGOA 2HSBA 4JJGA 4OIRF 4C3DA 4AK9A 4Q4ZF 4MTFA 4IB4A 2AWYA 2M4EA 3HNKA 3L34A 3ZIBA 2LFDA 1QPUA 2J9WA 4JZAA 5FZTA 3DMDA 3DJNB 3MYFA 2X51A 3AG3C 2J9BA 1OW8A 4YK5A 4XLNF 2R7WA 1BR4A 2J9UA 3O10A 2J7PA 1DOVA 4FESA 4P6IC 4DRIB 2CNWD 1A0BA 2VC9A 2YQYA 3RQFA 2LQGA 4ANJA 2OJED 4KNWA 3EJNA 3UMIA 4Q5SF 3LJBA 3TK0A 5JVEA 3JRMO 1HE1A 2EINC 1L3PA 1GGQA 2P0NA 1ORSC 4CDYA 5COGA 1MMGA 3Q7GA 2A6EF 3T6JA 2KGOA 3EQLF 4F4BA 3CAXA 2XL8A 3UMHA 3UMKA 2QLAA 4GQHA 4Z9IA 2F22A 3MLGA 3SP1A 4ZLCA 3N24A 2CCYA 3R7CA 3SYNA 2LK4A 4MVSA 3SZRA 1Q0GA 1H7IA 1TKNA 2B0HA 3NRHA 1UG7A 2R7QA 3TD7A 1QZXA 3FDQA 1LI7A 1NG1A 1BBHA 3ASNC 1NLXA 3MYIA 1OCRC 5L0FA 2YLIA 5BQIA 2Q9CA 4KC9A 4OIQF 2KW3C 2BL2A 2OEVA 3EGXA 3EZHA 3LLKA 4IWBA 5JSLA 2OOCA 4ER9A 5JLIA 1E85A 4H4KC 1OCOC 2TMVP 3BRJA 5L0IA 1IW7F 5DS5A 1SR2A 3KMIA 3ZC4A 2ZD9A 3KL4A 3O6XA 1GM5A 4MW3A 1G5ZA 1EKYA 1GQAA 4AL0A 2NSGA 3LNMB 1OCCC 5BQHA 3DE8A 3U3FA 2GWWA 2VH3A 1ZU5A 3B0PA 4C3BA 1HY5A 1J8MF 3W8IA 2L81A 1F1MA 3V5YA 2ZXOA 2J0WA 3G4ZA 1XZQA 1ZHZA 4IARA 2BE5F 2ZPAA 1VYKA 3AQBA 1SMYF 1YYJA 1YYXA 3IQ5A 5D91A 3US6A 3C7JA 3EHMA 5E3CA 4DJ9A 2QTVA 4EIYA 2GFHA 4NY3A 2P6VA 4U5CE 1LVKA 1VK5A 2G3KA 4JCHA 3ZTZA 2VASA 3A9CA 2Y3BA 4WABA 2O9XA 5K0IA 2XXAB 2YL7A 2YL0A 4XPYA 2V3CC 1ORJA 2AWCA 1VLTA 2IM8A 3L8JA 3C8GB 3X2QC 5KYNA 4YT2A 1QVXA 2XS1A 4NTFA 1TFKB 4YWQA 3VM6A 1MMAA 4PR9A 1V4AA 1Z23A 3M15A 2XLVA 4KBLA 4X0RA 3O55A 1N1CA 3LESA 5BQGA 4BPMA 4E7ZA 5L3VA 1HW2A 1NBBA 2KYHA 1ZHWA 3M4BA 4MVZA 4YL0A 4JRZA 2LP4A 2R7SA 4B6IA 3G4XA 1NU7D 3S0XA 1YA9A 1S7ZA 4XPXA 3W2VA 1NFNA 1HMDA 3QZCA 3GANA 1EI7A 3M1CB 4YT4A 2R7XA 5KYWB 4JTDB 1PV3A 2W9YA 1JOGA 4JJFA 3T6GB 1QSPA 2I15A 4BEMJ 1JAFA 1Z63A 2WB7A 3RFYA 3AG1C 3EGDB 2PF4E 1MMNA 3ASOC 3GWNA 3L1MA 5E3AA 3RYLA 3J06A 1ORYA 3WG7C 1U6HA 4YT8A 1KU2A 1ZU4A 2DI3A 1M56C 3ZQVA 3TJ6A 3EHNA 3U0CA 4YN0B 2ZXWC 2DGJA 2Y39A 2RSEB 3HNIA 1O87A 3I4UA 4LACB 2CDQA 1EA8A 2XSEA 4EBKA 1FNTc 3FVYA 4IGGA 4AE4B 2MWQA 4C7OB 5CI9A 1BZ4A 1W2WA 2CYDA 4PFPA 4FX5A 4BJ1A 3T6BA 4EKWA 4DBRA 3UGPA 2XRHA 1G4US 1T6IA 4E0IA 1OKKA 1R5ID 5KYXB 2Y3HA 2R7UA 4CX9A 1YAUO 3OA1A 2CNWA 3IEEA 1K05A 2KSFA 2NUPB 2ICWG 3JT1A 3S27A 3HKKA 2JX0A 4IAOA 1QQ3A 3U8PA 2XL4A 4C3EA 3AG2C 3L0IA 3B9QA 2M64A 2HFIA 4G7ZF 1S05A 4DOZA 5AC4A 3RIPA 4CS9C 2NSFA 2WVOA 3PCVA 3K66A 1UFBA 2FGYA 5A6BD 1T5OA 2IXNA 4PJJA 2EIJC 4JC7A 4AL1A 3JSEO 1T01A 2XLHA 3WHNA 1V74B 2J0XA 1D0YA 2XXAA 3GEHA 5DLJA 2L6GA 2XLDA 1RJ9B 2J9VA 3LEOA 2GAQA 3K33A 4HE8D 4Q7CA 4PK4A 3C8GA 1YVIA 2BC5A 1OR2A 3Q6NA 2XM4A 3VF0A 1FFHA 2L7AA 2Q3TA 3DJUB 3GODA 3JRTA 1JPNA 1PD0A 4LLCA 3C63A 2NUTB 2W4BA 3Q6MA 3ABLC 4JVSA 1VOMA 3SXZA 2EIKC 5DQZA 4CS8C 3TJ5A 1M2VB 5IY5C 1KTMA 2X0CA 3T4RA 3RF3A 3KYJA 1LIHA 2R7VA 2IOQA 3IQ6A 4J7YA 1K04A 3EG9B 4MVQA 4R32A 1U0BB 5DS6A 4FAPB 1VB5A 1Q0MA 2HS5A 1DOWA 2A1DD 3RQEA 3TQOA 1XWJA 3RKOF 5B3SC 5KYWA 5HSWA 1J8YF 3AQCA 3EH1A 3JYYA 5E33A 1AUEA 3FOPA 4MTGA 3EGDA 5L0DA 3NDBB 4U9EA 5DQTA 3L8IA 4CBEA 1WATA 3K1IC 4CS8A 4EHPA 1PCXA 2WZLA 2J7PD 4YL3A 4FWVA 1TWAA 5TJ5E 3SXKA 4ULVA 3ZWIA 2IYLD 4ZLDA 5COFA 4AE4A 4C7OA 4KNVA 4NC3A 2EPOA 1CPQA 2W4MA 2PBEA 4I1MA 4MVRA 4K1OA 3M79A 2I8BA 3W2WA 5A6JA 5HV9A 4OD5A 5JUAA 4U5DE 3OEOA 4RBNA 4ULWA 2C03A 3JSZA 1CGME 2R05A 4HFKB 2ETSA 3QVZA 2J45A 4MVMA 3ZDLA 4MS2A 5KYXA 2ZXRA 3IPMO 1TWGA 3K1IA 3NMJA 4O6NA 1Z7Qc 3JYHA 1CPRA 4BJTA 4DXWA 1ZW2A 5L0CA 2EPKX 2OG2A 2NUPA 4I1OB 3V7OA 3AG4C 2Q7RA 2YRFA 4XTKA 3KPHA 1JMWA 1HE9A 2B0JA 4EBJA 2L6HA 4CJGA 5T3WA 1TQGA 5T1DB 1TWCA 3Q7LA 4PJLA 4RDAA 4XWJA 3WAQA 4JEAA 2YLGA 1A7VA 2H8AA 4IAQA 4N6CA 3C62A 256BA 1D0XA 2Q9AA 3IQTA 1RKEB 3ZVRA 4CSAC 4OIPF 3UGOA 1M6TA 4U5EE 2EPLX 2YL3A 1VTMP 2A6HF 2XLOA 3AGTA 4O79A 1MNEA 1FFTC 3IQCA 3I5QA 2JD3A 4MNDA 3HJCA 2P61A 3S28A 2HSQA 1L7CA 3IHUA 1RJ9A 2OQMA 1A7EA 4A2NB 2LSEA 4PJMA 4U9DA 4A4AA 3B0UX 3JTLO 4XQ1A 2MHRA 3VAYA 3AOUA 4BEJA 3DAFA 3E70C 3E9VA 4CSAA 1XZPA 1YA7O 3ABMC 1B68A 3DKAA 3EZIA 2NUTA 3V5ZA 1OQCA 5L3QA 3JCUQ 4P9TA 2YEVA 2YWAA 2OCCC 4IJJA 2FFHA 3U2LA 5JRAA 1M2VA 4N06A 3DD7A 2D5RB 2WVQA 4XEKA 3H2UA 1ST6A 4Z9JA 2RD9A 5KYYB 3EFOB 4YT5A 2E87A 4EBBA 1YARO 3EG9A 4XEFA 2R25A 2NG1A 4OIOF 1Y6DA 4PACA 2IXPA 4LLEA 2R7RA 4D4NA 3GM1A 1GS9A 4U5HA 3UNGC 5EK0A 1V54C 4MQ9F 4ONSA 1VYIA 5D92A 3RW0A 5L0GA 1WN0A 3FMSA 1A41A 1D1CA 2W45A 2OJQA 3F46A 3AJMA 2KQ9A 1OCZC 4Z9HA 3U8VA 4U5GA 2HJ3A 4CDAA 3N0TA 4CS7A 5A6AA 2WZGA 2LIGA 3SNHA 5KYUB 4DVZA 2DYRC 2NPUA 5A6BA 4XPWA 3U9JA 1OW6A 5EHHA 3OWTA 2UUIA 3ZSUA 5A69A 2A0BA 3K7DA 1RXQA 2Y3DA 4I44A 1E83A 1I4ZA 4JTAB 1T6UA 2A0UA 1SF8A 2EPMX 3H2VA 3DI5A 1HMOA 2P1AA 2YL1A 1FMWA 1Z6AA 3LS1A 4J30B 4L6RA 2YKZA 2XL6A 3C8ZA 4GYTA 2GDCA 1ZVZA 3RQGA 2OEXA 3CSKA 4CIPA 2J8WA 2Z15A 1ZHTA 2Q4FA 2VB6A 5B3IA 2ASRA 3CQZA 1FTSA 4W8KA 5L0HA 1M2OA 1WWPA 1RKEA 2HZ8A 3LEVA 2R7OA 1M57C 2V26A 4JW1A 5B1AC 3TULA 4G7HF 2J46A 4MW8A 1JPJA 3FOOA 4NTBA 3DZAA 3SXYA 1H9GA 3QVYA 3QMKA 3A11A 5COMA 4CS9A 1RKCA 5DVWA 3HNLA 2D4UA 2CW0F 3LUTB 4XLPF 2KJGA 1BR2A 3BEHA 3NYLA 3NYMA 2DYSC 1NFOA 2H7VC 3RVYA 5L0JA 2XLMA 5DS4A 1TR2A 3PDMP 1LKXA 3RH3A 1OKKD 4DBQA 2VCBA 3NKEA 1C17M 3NG1A 2IXMA 2A69F 3R2PA 2AU5A 1JR8A 4K7BA 4YJWA 4CIHA 1APCA 1WASA 2AP3A 5CIVA 2Q9BA 2XLWA 4EUKB 1D1BA 1H6GA 4JTCB 4LDRA 3TOLA 5GPGB 3S84A 1NZEA 4JURI 1YJGA
chains in the Genus database with same CATH topology
3G4XA 1Q0FA 1Q0GA 1T6UA 1T6QA 3G4ZA 1T6IA 1Q0KA 1Q0MA 3G50A 4NCQA 1Q0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4X A;  1Q0F A;  1Q0G A;  1T6U A;  1T6Q A;  3G4Z A;  1T6I A;  1Q0K A;  1Q0M A;  3G50 A;  4NCQ A;  1Q0D A; 
#chains in the Genus database with same CATH topology
 5KYY A;  1T9K A;  2YVK A;  2JPU A;  2P7V A;  3EFO A;  3I5P A;  1D0Z A;  1YLM A;  2A68 F;  5T3T A;  1RMV A;  2EIM C;  1FMV A;  2KNH A;  3GM2 A;  5CI8 A;  3QW1 A;  1ZHX A;  3G50 A;  5A6K A;  3KH2 A;  2WZF A;  4O7G A;  1NSG B;  4HEA J;  3O39 A;  3VRC A;  1AEP A;  1T6Q A;  2LCH A;  4KI2 A;  1LE2 A;  1MND A;  3HNJ A;  2AVK A;  2QNL A;  3DE9 A;  1LS4 A;  3MX3 A;  1QLE C;  4QDL A;  3UR3 C;  3U3B A;  2KK1 A;  1C03 A;  2QUP A;  4OD4 A;  3F47 A;  1FAP B;  1OW7 A;  1O3U A;  3C8G D;  4O6M A;  1ZHY A;  4JKV A;  3U2M A;  5KYU A;  1O5H A;  3U9M A;  2Q00 A;  3SEO A;  3ZQY A;  1G4W R;  5BUO A;  2R7T A;  1RCP A;  3QW0 A;  4E0H A;  2Y69 C;  1SYQ A;  3T9O A;  2HKV A;  3HLZ A;  3HTK C;  1TFO B;  1G8X A;  2YLD A;  4G0H A;  1OXK A;  3VYW A;  1MMD A;  3DAG A;  2GA0 A;  2HV6 A;  5E2Q A;  4MVU A;  3NKD A;  2PP4 A;  3DM5 A;  4G78 A;  2VCA A;  4LDK A;  3POV A;  4J32 B;  3LS0 A;  2EIL C;  3CZ6 A;  4EWC A;  5AC5 A;  2CGE A;  3GWL A;  1CGN A;  2EPN A;  4RD9 A;  4AX2 A;  2QE9 A;  4NCQ A;  3V5X A;  1LPE A;  3C18 A;  2C04 A;  5EGY A;  2IBF A;  5AGF A;  3GEI A;  2UUH A;  4IRU A;  2VCC A;  4MVO A;  2YZS A;  5JP7 A;  3S90 A;  1OXB A;  4P9F A;  4YL1 A;  2LD6 A;  5FCL A;  4HFF B;  2DB4 A;  2L6F A;  3S9O A;  4JEB A;  2WL8 A;  2XS8 A;  5JS5 A;  3DWW A;  1V55 C;  4E7S A;  1WOL A;  1WGW A;  2LFF A;  1Z3I X;  4WGZ A;  2H7O A;  2OKU A;  3DM9 B;  3S29 A;  1YZC A;  3B29 A;  4WJ0 A;  3SXM A;  3LLI A;  1Q0K A;  4N4W A;  1Y4C A;  2L9J A;  4UDV A;  1LM3 B;  1ZYR F;  3H65 A;  1BDJ B;  3PHF 2;  3AGU A;  2MYS A;  1IZM A;  3FHD A;  2H7B A;  2QY9 A;  1H9T A;  1HW1 A;  3KKB A;  2G3V A;  2FAP B;  3LNR A;  1NU9 C;  2OU6 A;  2HMQ A;  4H54 A;  3U5S A;  4CJO A;  3X1O A;  2PX0 A;  2R03 A;  1E86 A;  2PX3 A;  4W8P A;  2R02 A;  3K6B A;  4GEH A;  1A7D A;  5JT4 A;  1EQ1 A;  3N2Z B;  1ZZP A;  1YZA A;  3CEX A;  1KNY A;  4WGY A;  4OIN F;  5F5H A;  3FAJ A;  2HV7 A;  2PNO A;  1VMA A;  1E2X A;  2PFD A;  1E84 A;  2WVN A;  3JZ0 A;  4BG0 A;  4O6Y A;  1MQV A;  1PD1 A;  1VLS A;  3B71 A;  5F28 E;  2HJM A;  4D4X A;  3GEE A;  4BJ6 C;  2XM0 A;  4JCZ A;  1JRA A;  4DRH B;  1BR1 A;  4DRJ B;  2Y3G A;  3QTH A;  4NQF A;  2YHS A;  3ZTM A;  4PFO A;  1U89 A;  2ZXP A;  4N6H A;  3EGX B;  2R9R B;  3ABK C;  3EPV A;  4U5B E;  3LAY A;  4CDV A;  1LI5 A;  1QKR A;  4BJ5 C;  3M4C A;  1D1A A;  3NYJ A;  3PMR A;  4MTO A;  5B1B C;  3FXH A;  1K40 A;  1Q0F A;  3TOM A;  3B0V C;  4E17 A;  3MFN A;  2KC3 A;  3K1H A;  4QI2 A;  4BJ6 A;  3DXJ F;  1FR0 A;  4LER A;  4NTA A;  4I3M A;  4LDQ A;  1LE4 A;  4G7O F;  1Q0D A;  3ITF A;  3KYI A;  3ZG1 A;  4DVY P;  4U5F E;  1TWH A;  1I5N A;  1LS1 A;  1WTY A;  1OR3 A;  3RVZ A;  4XEV A;  4E18 A;  3EH2 A;  5F5F A;  4JIO A;  1AVO B;  3W4Y A;  1YDI A;  3W8H A;  4J7T A;  2G62 A;  4JE9 A;  3GM3 A;  3ECS A;  4PJN A;  4M63 A;  4BJ5 A;  2IXO A;  3WOD F;  1SZI A;  1C02 A;  1I4Y A;  1Z5Z A;  3ATP A;  3NMK A;  2HMZ A;  3FAP B;  3MBG A;  1R4T A;  1ZW3 A;  2HUJ A;  4K0D A;  4QI0 A;  3NMI A;  2XLE A;  3GOR A;  1CGO A;  2HSB A;  4JJG A;  4OIR F;  4C3D A;  4AK9 A;  4Q4Z F;  4MTF A;  4IB4 A;  2AWY A;  2M4E A;  3HNK A;  3L34 A;  3ZIB A;  2LFD A;  1QPU A;  2J9W A;  4JZA A;  5FZT A;  3DMD A;  3DJN B;  3MYF A;  2X51 A;  3AG3 C;  2J9B A;  1OW8 A;  4YK5 A;  4XLN F;  2R7W A;  1BR4 A;  2J9U A;  3O10 A;  2J7P A;  1DOV A;  4FES A;  4P6I C;  4DRI B;  2CNW D;  1A0B A;  2VC9 A;  2YQY A;  3RQF A;  2LQG A;  4ANJ A;  2OJE D;  4KNW A;  3EJN A;  3UMI A;  4Q5S F;  3LJB A;  3TK0 A;  5JVE A;  3JRM O;  1HE1 A;  2EIN C;  1L3P A;  1GGQ A;  2P0N A;  1ORS C;  4CDY A;  5COG A;  1MMG A;  3Q7G A;  2A6E F;  3T6J A;  2KGO A;  3EQL F;  4F4B A;  3CAX A;  2XL8 A;  3UMH A;  3UMK A;  2QLA A;  4GQH A;  4Z9I A;  2F22 A;  3MLG A;  3SP1 A;  4ZLC A;  3N24 A;  2CCY A;  3R7C A;  3SYN A;  2LK4 A;  4MVS A;  3SZR A;  1Q0G A;  1H7I A;  1TKN A;  2B0H A;  3NRH A;  1UG7 A;  2R7Q A;  3TD7 A;  1QZX A;  3FDQ A;  1LI7 A;  1NG1 A;  1BBH A;  3ASN C;  1NLX A;  3MYI A;  1OCR C;  5L0F A;  2YLI A;  5BQI A;  2Q9C A;  4KC9 A;  4OIQ F;  2KW3 C;  2BL2 A;  2OEV A;  3EGX A;  3EZH A;  3LLK A;  4IWB A;  5JSL A;  2OOC A;  4ER9 A;  5JLI A;  1E85 A;  4H4K C;  1OCO C;  2TMV P;  3BRJ A;  5L0I A;  1IW7 F;  5DS5 A;  1SR2 A;  3KMI A;  3ZC4 A;  2ZD9 A;  3KL4 A;  3O6X A;  1GM5 A;  4MW3 A;  1G5Z A;  1EKY A;  1GQA A;  4AL0 A;  2NSG A;  3LNM B;  1OCC C;  5BQH A;  3DE8 A;  3U3F A;  2GWW A;  2VH3 A;  1ZU5 A;  3B0P A;  4C3B A;  1HY5 A;  1J8M F;  3W8I A;  2L81 A;  1F1M A;  3V5Y A;  2ZXO A;  2J0W A;  3G4Z A;  1XZQ A;  1ZHZ A;  4IAR A;  2BE5 F;  2ZPA A;  1VYK A;  3AQB A;  1SMY F;  1YYJ A;  1YYX A;  3IQ5 A;  5D91 A;  3US6 A;  3C7J A;  3EHM A;  5E3C A;  4DJ9 A;  2QTV A;  4EIY A;  2GFH A;  4NY3 A;  2P6V A;  4U5C E;  1LVK A;  1VK5 A;  2G3K A;  4JCH A;  3ZTZ A;  2VAS A;  3A9C A;  2Y3B A;  4WAB A;  2O9X A;  5K0I A;  2XXA B;  2YL7 A;  2YL0 A;  4XPY A;  2V3C C;  1ORJ A;  2AWC A;  1VLT A;  2IM8 A;  3L8J A;  3C8G B;  3X2Q C;  5KYN A;  4YT2 A;  1QVX A;  2XS1 A;  4NTF A;  1TFK B;  4YWQ A;  3VM6 A;  1MMA A;  4PR9 A;  1V4A A;  1Z23 A;  3M15 A;  2XLV A;  4KBL A;  4X0R A;  3O55 A;  1N1C A;  3LES A;  5BQG A;  4BPM A;  4E7Z A;  5L3V A;  1HW2 A;  1NBB A;  2KYH A;  1ZHW A;  3M4B A;  4MVZ A;  4YL0 A;  4JRZ A;  2LP4 A;  2R7S A;  4B6I A;  3G4X A;  1NU7 D;  3S0X A;  1YA9 A;  1S7Z A;  4XPX A;  3W2V A;  1NFN A;  1HMD A;  3QZC A;  3GAN A;  1EI7 A;  3M1C B;  4YT4 A;  2R7X A;  5KYW B;  4JTD B;  1PV3 A;  2W9Y A;  1JOG A;  4JJF A;  3T6G B;  1QSP A;  2I15 A;  4BEM J;  1JAF A;  1Z63 A;  2WB7 A;  3RFY A;  3AG1 C;  3EGD B;  2PF4 E;  1MMN A;  3ASO C;  3GWN A;  3L1M A;  5E3A A;  3RYL A;  3J06 A;  1ORY A;  3WG7 C;  1U6H A;  4YT8 A;  1KU2 A;  1ZU4 A;  2DI3 A;  1M56 C;  3ZQV A;  3TJ6 A;  3EHN A;  3U0C A;  4YN0 B;  2ZXW C;  2DGJ A;  2Y39 A;  2RSE B;  3HNI A;  1O87 A;  3I4U A;  4LAC B;  2CDQ A;  1EA8 A;  2XSE A;  4EBK A;  1FNT c;  3FVY A;  4IGG A;  4AE4 B;  2MWQ A;  4C7O B;  5CI9 A;  1BZ4 A;  1W2W A;  2CYD A;  4PFP A;  4FX5 A;  4BJ1 A;  3T6B A;  4EKW A;  4DBR A;  3UGP A;  2XRH A;  1G4U S;  1T6I A;  4E0I A;  1OKK A;  1R5I D;  5KYX B;  2Y3H A;  2R7U A;  4CX9 A;  1YAU O;  3OA1 A;  2CNW A;  3IEE A;  1K05 A;  2KSF A;  2NUP B;  2ICW G;  3JT1 A;  3S27 A;  3HKK A;  2JX0 A;  4IAO A;  1QQ3 A;  3U8P A;  2XL4 A;  4C3E A;  3AG2 C;  3L0I A;  3B9Q A;  2M64 A;  2HFI A;  4G7Z F;  1S05 A;  4DOZ A;  5AC4 A;  3RIP A;  4CS9 C;  2NSF A;  2WVO A;  3PCV A;  3K66 A;  1UFB A;  2FGY A;  5A6B D;  1T5O A;  2IXN A;  4PJJ A;  2EIJ C;  4JC7 A;  4AL1 A;  3JSE O;  1T01 A;  2XLH A;  3WHN A;  1V74 B;  2J0X A;  1D0Y A;  2XXA A;  3GEH A;  5DLJ A;  2L6G A;  2XLD A;  1RJ9 B;  2J9V A;  3LEO A;  2GAQ A;  3K33 A;  4HE8 D;  4Q7C A;  4PK4 A;  3C8G A;  1YVI A;  2BC5 A;  1OR2 A;  3Q6N A;  2XM4 A;  3VF0 A;  1FFH A;  2L7A A;  2Q3T A;  3DJU B;  3GOD A;  3JRT A;  1JPN A;  1PD0 A;  4LLC A;  3C63 A;  2NUT B;  2W4B A;  3Q6M A;  3ABL C;  4JVS A;  1VOM A;  3SXZ A;  2EIK C;  5DQZ A;  4CS8 C;  3TJ5 A;  1M2V B;  5IY5 C;  1KTM A;  2X0C A;  3T4R A;  3RF3 A;  3KYJ A;  1LIH A;  2R7V A;  2IOQ A;  3IQ6 A;  4J7Y A;  1K04 A;  3EG9 B;  4MVQ A;  4R32 A;  1U0B B;  5DS6 A;  4FAP B;  1VB5 A;  1Q0M A;  2HS5 A;  1DOW A;  2A1D D;  3RQE A;  3TQO A;  1XWJ A;  3RKO F;  5B3S C;  5KYW A;  5HSW A;  1J8Y F;  3AQC A;  3EH1 A;  3JYY A;  5E33 A;  1AUE A;  3FOP A;  4MTG A;  3EGD A;  5L0D A;  3NDB B;  4U9E A;  5DQT A;  3L8I A;  4CBE A;  1WAT A;  3K1I C;  4CS8 A;  4EHP A;  1PCX A;  2WZL A;  2J7P D;  4YL3 A;  4FWV A;  1TWA A;  5TJ5 E;  3SXK A;  4ULV A;  3ZWI A;  2IYL D;  4ZLD A;  5COF A;  4AE4 A;  4C7O A;  4KNV A;  4NC3 A;  2EPO A;  1CPQ A;  2W4M A;  2PBE A;  4I1M A;  4MVR A;  4K1O A;  3M79 A;  2I8B A;  3W2W A;  5A6J A;  5HV9 A;  4OD5 A;  5JUA A;  4U5D E;  3OEO A;  4RBN A;  4ULW A;  2C03 A;  3JSZ A;  1CGM E;  2R05 A;  4HFK B;  2ETS A;  3QVZ A;  2J45 A;  4MVM A;  3ZDL A;  4MS2 A;  5KYX A;  2ZXR A;  3IPM O;  1TWG A;  3K1I A;  3NMJ A;  4O6N A;  1Z7Q c;  3JYH A;  1CPR A;  4BJT A;  4DXW A;  1ZW2 A;  5L0C A;  2EPK X;  2OG2 A;  2NUP A;  4I1O B;  3V7O A;  3AG4 C;  2Q7R A;  2YRF A;  4XTK A;  3KPH A;  1JMW A;  1HE9 A;  2B0J A;  4EBJ A;  2L6H A;  4CJG A;  5T3W A;  1TQG A;  5T1D B;  1TWC A;  3Q7L A;  4PJL A;  4RDA A;  4XWJ A;  3WAQ A;  4JEA A;  2YLG A;  1A7V A;  2H8A A;  4IAQ A;  4N6C A;  3C62 A;  256B A;  1D0X A;  2Q9A A;  3IQT A;  1RKE B;  3ZVR A;  4CSA C;  4OIP F;  3UGO A;  1M6T A;  4U5E E;  2EPL X;  2YL3 A;  1VTM P;  2A6H F;  2XLO A;  3AGT A;  4O79 A;  1MNE A;  1FFT C;  3IQC A;  3I5Q A;  2JD3 A;  4MND A;  3HJC A;  2P61 A;  3S28 A;  2HSQ A;  1L7C A;  3IHU A;  1RJ9 A;  2OQM A;  1A7E A;  4A2N B;  2LSE A;  4PJM A;  4U9D A;  4A4A A;  3B0U X;  3JTL O;  4XQ1 A;  2MHR A;  3VAY A;  3AOU A;  4BEJ A;  3DAF A;  3E70 C;  3E9V A;  4CSA A;  1XZP A;  1YA7 O;  3ABM C;  1B68 A;  3DKA A;  3EZI A;  2NUT A;  3V5Z A;  1OQC A;  5L3Q A;  3JCU Q;  4P9T A;  2YEV A;  2YWA A;  2OCC C;  4IJJ A;  2FFH A;  3U2L A;  5JRA A;  1M2V A;  4N06 A;  3DD7 A;  2D5R B;  2WVQ A;  4XEK A;  3H2U A;  1ST6 A;  4Z9J A;  2RD9 A;  5KYY B;  3EFO B;  4YT5 A;  2E87 A;  4EBB A;  1YAR O;  3EG9 A;  4XEF A;  2R25 A;  2NG1 A;  4OIO F;  1Y6D A;  4PAC A;  2IXP A;  4LLE A;  2R7R A;  4D4N A;  3GM1 A;  1GS9 A;  4U5H A;  3UNG C;  5EK0 A;  1V54 C;  4MQ9 F;  4ONS A;  1VYI A;  5D92 A;  3RW0 A;  5L0G A;  1WN0 A;  3FMS A;  1A41 A;  1D1C A;  2W45 A;  2OJQ A;  3F46 A;  3AJM A;  2KQ9 A;  1OCZ C;  4Z9H A;  3U8V A;  4U5G A;  2HJ3 A;  4CDA A;  3N0T A;  4CS7 A;  5A6A A;  2WZG A;  2LIG A;  3SNH A;  5KYU B;  4DVZ A;  2DYR C;  2NPU A;  5A6B A;  4XPW A;  3U9J A;  1OW6 A;  5EHH A;  3OWT A;  2UUI A;  3ZSU A;  5A69 A;  2A0B A;  3K7D A;  1RXQ A;  2Y3D A;  4I44 A;  1E83 A;  1I4Z A;  4JTA B;  1T6U A;  2A0U A;  1SF8 A;  2EPM X;  3H2V A;  3DI5 A;  1HMO A;  2P1A A;  2YL1 A;  1FMW A;  1Z6A A;  3LS1 A;  4J30 B;  4L6R A;  2YKZ A;  2XL6 A;  3C8Z A;  4GYT A;  2GDC A;  1ZVZ A;  3RQG A;  2OEX A;  3CSK A;  4CIP A;  2J8W A;  2Z15 A;  1ZHT A;  2Q4F A;  2VB6 A;  5B3I A;  2ASR A;  3CQZ A;  1FTS A;  4W8K A;  5L0H A;  1M2O A;  1WWP A;  1RKE A;  2HZ8 A;  3LEV A;  2R7O A;  1M57 C;  2V26 A;  4JW1 A;  5B1A C;  3TUL A;  4G7H F;  2J46 A;  4MW8 A;  1JPJ A;  3FOO A;  4NTB A;  3DZA A;  3SXY A;  1H9G A;  3QVY A;  3QMK A;  3A11 A;  5COM A;  4CS9 A;  1RKC A;  5DVW A;  3HNL A;  2D4U A;  2CW0 F;  3LUT B;  4XLP F;  2KJG A;  1BR2 A;  3BEH A;  3NYL A;  3NYM A;  2DYS C;  1NFO A;  2H7V C;  3RVY A;  5L0J A;  2XLM A;  5DS4 A;  1TR2 A;  3PDM P;  1LKX A;  3RH3 A;  1OKK D;  4DBQ A;  2VCB A;  3NKE A;  1C17 M;  3NG1 A;  2IXM A;  2A69 F;  3R2P A;  2AU5 A;  1JR8 A;  4K7B A;  4YJW A;  4CIH A;  1APC A;  1WAS A;  2AP3 A;  5CIV A;  2Q9B A;  2XLW A;  4EUK B;  1D1B A;  1H6G A;  4JTC B;  4LDR A;  3TOL A;  5GPG B;  3S84 A;  1NZE A;  4JUR I;  1YJG A; 
#chains in the Genus database with same CATH homology
 3G4X A;  1Q0F A;  1Q0G A;  1T6U A;  1T6Q A;  3G4Z A;  1T6I A;  1Q0K A;  1Q0M A;  3G50 A;  4NCQ A;  1Q0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...