1Q0GA

Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the state after full x-ray-induced reduction
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVYDPAQARIEAESVKAIQEKMAANDDLHFQIRATVIKEQRAELAKHHLDVLWSDYFKPPHFESYPELHTLVNEAVKALSAAKASTDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of nickel-containing superoxide dismutase reveals another type of active site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Ni]
total genus 51
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1q0gA00
1Q0GA 4NCQA 1T6UA 3G50A 1Q0FA 1T6IA 1Q0KA 1T6QA 3G4XA 1Q0DA 3G4ZA 1Q0MA
chains in the Genus database with same CATH superfamily
2J0WA 3H2UA 4WGZA 2NUTB 3SEOA 2GAQA 3Q6MA 1NU9C 1B68A 2QY9A 3QTHA 2J9WA 4MW3A 4FAPB 3LUTB 2J46A 2LFFA 2OOCA 4BJ5A 3NMJA 3NMKA 4J7TA 1IZMA 3FDQA 2VCCA 4PACA 5EHHA 2YLDA 1J8YF 2NG1A 3EGXA 2RD9A 1OW6A 1WATA 1VMAA 1A7EA 3L1MA 1YYJA 1OKKD 2GWWA 1Q0KA 3SZRA 1VYKA 2HUJA 2R05A 2H7VC 5TJ5E 2XXAA 5JT4A 1W2WA 4MVQA 2IXMA 3DI5A 2Y3BA 1G4WR 1MMAA 1TFOB 2A69F 2OQMA 3JSZA 1FMVA 2GA0A 3O6XA 3ATPA 4J7YA 5E3AA 4YWQA 2XLOA 3DM5A 2PNOA 4JC7A 3DAFA 4U9EA 1M2OA 2ASRA 2L6HA 3QZCA 4CJOA 2CNWD 3EFOA 1ORYA 4U5CE 1DOWA 4RBNA 4P6IC 4E18A 2WVNA 4X0RA 4DVZA 3C63A 5A6KA 4EKWA 1LE2A 1SR2A 2HFIA 2EINC 3O55A 2HKVA 2XLVA 4RD9A 2XL4A 4I1OB 4CS8C 5JLIA 3TJ5A 5IY5C 5DVWA 2I15A 4JVSA 4JW1A 1FFTC 1NLXA 2J7PA 1JOGA 2DYSC 2LIGA 4YT5A 2HZ8A 3IQ6A 3JZ0A 5A6BD 3DWWA 4EHPA 1ORJA 2H7OA 2P1AA 1ZHXA 4CBEA 4KI2A 2VCBA 1F1MA 1Z7Qc 1GM5A 2R7SA 3CEXA 4YL1A 5L0CA 1GQAA 1TKNA 1FR0A 1LI7A 1D1AA 1FFHA 3SXMA 4H54A 4MNDA 1O3UA 5COFA 1ZHZA 2QLAA 3KMIA 4Z9IA 3OWTA 1ZZPA 2MHRA 4N6CA 3EFOB 5GPGB 5DS6A 1U89A 1JAFA 3S0XA 2L6GA 1YZAA 4EWCA 4JCHA 1JR8A 2YL1A 4QDLA 4JCZA 1ZW2A 3E70C 3IEEA 1OXBA 2A6HF 1Q0DA 3U0CA 4P9FA 3Q7LA 1RJ9A 4BJTA 2CDQA 1LKXA 2KSFA 2ZPAA 3PCVA 1LE4A 2Y3DA 1TQGA 3EQLF 1HW1A 4WJ0A 4MQ9F 3VYWA 3W8HA 4CSAA 3ASNC 5JP7A 3JCUQ 1LM3B 2CYDA 4OD4A 1JRAA 2V26A 1BR1A 3U8PA 2L81A 1PD1A 5E2QA 1V74B 4OINF 3ZVRA 2W45A 2HJ3A 3ABMC 4MTFA 3FAPB 4ZLCA 1E85A 3AOUA 2R7XA 1IW7F 4CS9A 3RQFA 4DBRA 4IAOA 5K0IA 4D4XA 4IJJA 1Z3IX 5CI9A 4O6YA 2HMQA 3IHUA 5L3QA 4CIHA 4QI2A 1LVKA 2O9XA 5L0HA 3SP1A 3W2WA 4K1OA 2WZFA 4MVUA 4C7OA 3QMKA 4KC9A 2GDCA 1E2XA 3UGOA 3X1OA 4E7SA 1E86A 1OXKA 5KYUA 1E83A 2YQYA 1PCXA 2EPMX 2PBEA 3SXZA 1SMYF 4YT4A 2WB7A 5KYXB 3K1IC 4IRUA 3ZQVA 3G4ZA 2A6EF 3HKKA 3DAGA 2J9BA 1MMNA 4CIPA 2XS1A 1K04A 4GYTA 4MW8A 1JMWA 3N0TA 2HS5A 3QVYA 1WN0A 4O6MA 1LIHA 4DRIB 3UGPA 1EI7A 2Y3GA 2Q9AA 1WASA 1YYXA 2D4UA 1VYIA 3C7JA 1K05A 4XPYA 3LLIA 2P0NA 3SYNA 4IGGA 3WODF 1BBHA 4G7HF 3J06A 1HY5A 2JX0A 2AWCA 3E9VA 1OKKA 3QVZA 3RKOF 5A69A 2R7UA 2IOQA 1C03A 256BA 1N1CA 3FOOA 2XLEA 4YT2A 4G7ZF 1QPUA 1RKCA 2MWQA 3TOLA 4LLEA 3KH2A 1TR2A 3MYFA 2KJGA 1J8MF 3EJNA 2QTVA 1D0ZA 4H4KC 4NQFA 5CI8A 1QQ3A 1VB5A 5BQIA 4EIYA 1S7ZA 3KPHA 3GWLA 1CPQA 2R25A 1L7CA 1BZ4A 3RIPA 4ER9A 2XL8A 2BE5F 1BR2A 1SF8A 3IQTA 3SNHA 2B0HA 2VCAA 3ABKC 4BPMA 1RJ9B 1T5OA 1WWPA 2OJQA 3KKBA 4JURI 1FAPB 3RH3A 4JEBA 3TJ6A 3U3FA 5L0GA 4U5GA 5BQGA 2OKUA 4K0DA 5T1DB 1YLMA 1MNEA 2DGJA 3NYMA 3K1HA 2PFDA 3GEEA 2XRHA 2Q9CA 2Y39A 3ZTZA 5HV9A 2KGOA 1ZU5A 3EZHA 4PK4A 4HFKB 1U0BB 3B9QA 3U8VA 4F4BA 3ZG1A 2NUPB 2IXOA 1VK5A 2YLIA 3L8JA 4NTBA 4OIRF 3U2MA 1ZU4A 3W8IA 3NDBB 1L3PA 2IBFA 1FNTc 1YVIA 1FMWA 4JTAB 3T6BA 4FESA 4CDAA 2R7TA 3ITFA 4DVYP 2FGYA 2YL0A 3ZQYA 3U5SA 1OCRC 4A2NB 5AC5A 2BC5A 1M56C 3ZIBA 4B6IA 2HMZA 3C8GD 4NTFA 4PFPA 2IYLD 1G8XA 1ORSC 2QUPA 4C3BA 3AGUA 2XSEA 3UMIA 1RMVA 1Z63A 3NMIA 3RF3A 3DD7A 2KNHA 3DM9B 3LAYA 4PFOA 2R9RB 5D91A 3LNRA 2EPKX 3HLZA 3LEOA 3T4RA 4W8KA 3F47A 4E17A 4AE4A 2L9JA 3U3BA 3TD7A 4BJ6C 1H9TA 2RSEB 3O10A 3PHF2 3DE8A 1AEPA 4GQHA 3LESA 3V5YA 4K7BA 3VRCA 3ZWIA 3AQCA 1V55C 1MNDA 2WZGA 1CGME 2H7BA 3S28A 4AL1A 3F46A 1YARO 3LLKA 2HJMA 3N2ZB 3NG1A 3V7OA 4JEAA 5T3TA 4E0HA 1H7IA 2Q3TA 2R02A 4C3DA 1QZXA 5KYYA 2IXNA 2CW0F 2Y3HA 3EGDB 3EGXB 1UFBA 3MFNA 4CSAC 2AWYA 1OQCA 2G3KA 1OCCC 4MVZA 3B0VC 3GEIA 4EBKA 5BUOA 3U9MA 1AVOB 1OR3A 4L6RA 2J9VA 3BEHA 4ULWA 4RDAA 4JJFA 2HV6A 2EIJC 1RCPA 2YWAA 3RVYA 1BR4A 1EQ1A 3DMDA 3RQEA 2P61A 1Z23A 5DS5A 3KYIA 3OA1A 5JS5A 4JJGA 5COGA 1EKYA 4IWBA 4N4WA 3EHNA 2OG2A 2WL8A 1YZCA 4DRHB 4DXWA 5L0DA 3EG9B 2R7OA 5KYXA 3TULA 4Z9HA 1MMDA 1UG7A 2VC9A 3FMSA 4LACB 3I5QA 2YHSA 5KYWA 3JRTA 3EH2A 1D1CA 1NFOA 1QVXA 1NZEA 1OW8A 3KL4A 1C17M 1G5ZA 4E0IA 3MX3A 2J7PD 1GGQA 3ZC4A 1BDJB 2LP4A 1M57C 3US6A 4AX2A 3L0IA 4G0HA 4MVMA 3HNLA 4Q4ZF 2R7VA 4ZLDA 2YRFA 3ECSA 3TOMA 1QKRA 4BEMJ 1PD0A 2YZSA 2F22A 2VASA 3HTKC 1T6UA 3JYYA 4MVOA 5B1BC 1T6IA 4LDRA 1YA7O 2TMVP 3NYLA 3FVYA 3I5PA 3TK0A 4OIOF 3R7CA 2Q4FA 1D0YA 5DS4A 3NYJA 1XWJA 2YVKA 4LLCA 5DQZA 4EUKB 3EH1A 3GM2A 3DZAA 4KBLA 2J8WA 3GEHA 5A6JA 5EGYA 1KNYA 3C18A 2ZXPA 3S27A 4EBBA 4YL0A 2PX0A 3TQOA 2UUHA 3G4XA 4DJ9A 1T01A 2A68F 4HFFB 1XZPA 2EPLX 4NC3A 5F5FA 1SZIA 4O6NA 1U6HA 4LERA 1NG1A 3GORA 4JIOA 1ZW3A 1XZQA 3MLGA 3B0PA 3I4UA 4U5HA 4XEFA 5FZTA 3POVA 1D0XA 3EPVA 2D5RB 4U5DE 3T6JA 2WVQA 2YL7A 3C8GA 3T6GB 3IQCA 4OIPF 1JPJA 1NSGB 4N6HA 4CDVA 4AE4B 1LS1A 4D4NA 1Z6AA 2Q00A 2XL6A 3CSKA 3M79A 3X2QC 3ZDLA 5AC4A 5T3WA 1A41A 5FCLA 3VAYA 4WABA 1CGNA 2LK4A 1YAUO 3ZSUA 2VB6A 4JTCB 2WVOA 2W9YA 3M4CA 1VOMA 2M4EA 3NKDA 2NUTA 3LEVA 3DKAA 2OCCC 2XM0A 3A9CA 3M4BA 3AGTA 3A11A 3Q7GA 4IB4A 4JZAA 3EGDA 4I44A 4PJMA 3HNJA 5L0JA 5A6AA 2M64A 2NPUA 4XEKA 3U9JA 4C7OB 2HSQA 4M63A 4Z9JA 3NKEA 2EIMC 3SXKA 1WTYA 4NTAA 3WAQA 5JUAA 3UR3C 2XXAB 3HNIA 2R7RA 1T6QA 5L3VA 1T9KA 3K66A 2KK1A 2HSBA 3FAJA 5KYWB 3JT1A 4O79A 2L6FA 1Z5ZA 3FOPA 4W8PA 4C3EA 1ST6A 1WGWA 5JSLA 4BJ1A 3C8GB 3C8ZA 4U9DA 2DI3A 3JYHA 3AG3C 2FAPB 1VLTA 1S05A 2CCYA 3UMHA 3VF0A 4ULVA 4CDYA 1HW2A 4LDQA 4I3MA 1CGOA 4IARA 2X0CA 4BJ6A 4XLPF 2EPOA 2H8AA 2YEVA 3HJCA 1O87A 3DJNB 2XLWA 2W4MA 4KNWA 4LDKA 2LSEA 4N06A 3W4YA 3WHNA 1Q0FA 2XLHA 5F28E 3GANA 4R32A 4JRZA 5AGFA 3VM6A 3IQ5A 1PV3A 3QW1A 1A7DA 1LPEA 2AVKA 4JKVA 2MYSA 4PR9A 3G50A 4A4AA 3DJUB 5DQTA 2R7WA 2CGEA 4GEHA 1APCA 2LQGA 3DXJF 4MS2A 4NY3A 2NUPA 2PF4E 3M1CB 3AG4C 2XLDA 3ASOC 4UDVA 4E7ZA 1V4AA 2C03A 4WGYA 2UUIA 1A0BA 3O39A 2LFDA 1H6GA 1OCOC 2W4BA 2YL3A 4DOZA 5JRAA 3H2VA 4XQ1A 3T9OA 3UMKA 1G4US 1NU7D 3QW0A 4IAQA 3EHMA 5E3CA 1ZHYA 4DBQA 2HV7A 1CPRA 5L0IA 3R2PA 1NBBA 1ZHTA 2A1DD 2LCHA 4ANJA 5B3SC 3L34A 1TFKB 4J32B 2EIKC 3RYLA 2OEXA 3K6BA 3ZTMA 2OEVA 2Y69C 2Z15A 2ZXWC 1V54C 3AQBA 3LS0A 3S29A 1RKEB 1M2VA 2BL2A 2G3VA 4KNVA 4U5BE 4XPXA 3EG9A 2EPNA 3N24A 2NSGA 4XTKA 1LS4A 3RQGA 1MMGA 1TWAA 3RVZA 4XEVA 3RW0A 1HE9A 1R4TA 1D1BA 3SXYA 3S84A 3L8IA 2AP3A 2ZXOA 2YLGA 5D92A 4OIQF 1K40A 3GWNA 1TWCA 4XPWA 4PJJA 1KTMA 1OR2A 1ZVZA 2JD3A 3ABLC 3HNKA 5DLJA 4G78A 5CIVA 3IPMO 2Q9BA 2DYRC 1SYQA 1Y4CA 4QI0A 1I4YA 4U5FE 1I4ZA 1WOLA 1YJGA 2DB4A 2ETSA 2P7VA 5A6BA 4YN0B 5B1AC 4CJGA 2LD6A 4FWVA 2KW3C 2X51A 2V3CC 1MQVA 2A0UA 1OCZC 2OU6A 3JSEO 4HE8D 4JE9A 1E84A 2L7AA 2B0JA 1YDIA 2FFHA 4FX5A 3WG7C 1M2VB 4MVSA 1FTSA 3FXHA 1Q0MA 4ONSA 4EBJA 2Q7RA 4YL3A 5F5HA 3CZ6A 4MVRA 4OD5A 3H65A 4JTDB 4G7OF 3NRHA 3RFYA 3W2VA 2G62A 4BEJA 2VH3A 3U2LA 2IM8A 1QSPA 3MBGA 1Y6DA 5COMA 5KYNA 1HMOA 2QE9A 2WZLA 1ZYRF 5KYYB 4CS8A 1QLEC 3B0UX 4YT8A 3AG1C 1R5ID 2KYHA 1GS9A 1EA8A 1VLSA 5HSWA 1JPNA 3LJBA 5KYUB 4U5EE 2OJED 2ZD9A 1M6TA 2ICWG 3JTLO 1KU2A 3V5ZA 4CS7A 3K7DA 3KYJA 3PDMP 2QNLA 3AG2C 1H9GA 3B71A 3DE9A 3MYIA 1RKEA 2NSFA 1VTMP 3V5XA 2P6VA 1NFNA 3CQZA 1LI5A 2I8BA 1O5HA 1C02A 2YKZA 2AU5A 3OEOA 3S9OA 1RXQA 2XM4A 3GM3A 3UNGC 3M15A 2GFHA 1TWHA 1DOVA 3LNMB 1YA9A 2E87A 1HE1A 1HMDA 2J45A 4YK5A 1OW7A 3C62A 4P9TA 1ZHWA 2KQ9A 4MTGA 5JVEA 2J9UA 2KC3A 1AUEA 3GM1A 5L0FA 4O7GA 2CNWA 4MTOA 2IXPA 3FHDA 3K1IA 3Q6NA 2ZXRA 1A7VA 5EK0A 3S90A 5E33A 5BQHA 2JPUA 4Q7CA 1I5NA 3JRMO 4I1MA 3GODA 2R7QA 3PMRA 1Q0GA 4HEAJ 4NCQA 3LS1A 4BJ5C 4PJLA 3AJMA 4J30B 4XWJA 4AL0A 4XLNF 2EILC 3K33A 2A0BA 2J0XA 2XS8A 5B3IA 3BRJA 2R03A 3B29A 4DRJB 4CX9A 3CAXA 3EZIA 4CS9C 2PX3A 2C04A 4PJNA 4Q5SF 4AK9A 1TWGA 4BG0A 2XLMA 2PP4A 4YJWA
chains in the Genus database with same CATH topology
1Q0GA 4NCQA 1T6UA 3G50A 1Q0FA 1T6IA 1Q0KA 1T6QA 3G4XA 1Q0DA 3G4ZA 1Q0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0G A;  4NCQ A;  1T6U A;  3G50 A;  1Q0F A;  1T6I A;  1Q0K A;  1T6Q A;  3G4X A;  1Q0D A;  3G4Z A;  1Q0M A; 
#chains in the Genus database with same CATH topology
 2J0W A;  3H2U A;  4WGZ A;  2NUT B;  3SEO A;  2GAQ A;  3Q6M A;  1NU9 C;  1B68 A;  2QY9 A;  3QTH A;  2J9W A;  4MW3 A;  4FAP B;  3LUT B;  2J46 A;  2LFF A;  2OOC A;  4BJ5 A;  3NMJ A;  3NMK A;  4J7T A;  1IZM A;  3FDQ A;  2VCC A;  4PAC A;  5EHH A;  2YLD A;  1J8Y F;  2NG1 A;  3EGX A;  2RD9 A;  1OW6 A;  1WAT A;  1VMA A;  1A7E A;  3L1M A;  1YYJ A;  1OKK D;  2GWW A;  1Q0K A;  3SZR A;  1VYK A;  2HUJ A;  2R05 A;  2H7V C;  5TJ5 E;  2XXA A;  5JT4 A;  1W2W A;  4MVQ A;  2IXM A;  3DI5 A;  2Y3B A;  1G4W R;  1MMA A;  1TFO B;  2A69 F;  2OQM A;  3JSZ A;  1FMV A;  2GA0 A;  3O6X A;  3ATP A;  4J7Y A;  5E3A A;  4YWQ A;  2XLO A;  3DM5 A;  2PNO A;  4JC7 A;  3DAF A;  4U9E A;  1M2O A;  2ASR A;  2L6H A;  3QZC A;  4CJO A;  2CNW D;  3EFO A;  1ORY A;  4U5C E;  1DOW A;  4RBN A;  4P6I C;  4E18 A;  2WVN A;  4X0R A;  4DVZ A;  3C63 A;  5A6K A;  4EKW A;  1LE2 A;  1SR2 A;  2HFI A;  2EIN C;  3O55 A;  2HKV A;  2XLV A;  4RD9 A;  2XL4 A;  4I1O B;  4CS8 C;  5JLI A;  3TJ5 A;  5IY5 C;  5DVW A;  2I15 A;  4JVS A;  4JW1 A;  1FFT C;  1NLX A;  2J7P A;  1JOG A;  2DYS C;  2LIG A;  4YT5 A;  2HZ8 A;  3IQ6 A;  3JZ0 A;  5A6B D;  3DWW A;  4EHP A;  1ORJ A;  2H7O A;  2P1A A;  1ZHX A;  4CBE A;  4KI2 A;  2VCB A;  1F1M A;  1Z7Q c;  1GM5 A;  2R7S A;  3CEX A;  4YL1 A;  5L0C A;  1GQA A;  1TKN A;  1FR0 A;  1LI7 A;  1D1A A;  1FFH A;  3SXM A;  4H54 A;  4MND A;  1O3U A;  5COF A;  1ZHZ A;  2QLA A;  3KMI A;  4Z9I A;  3OWT A;  1ZZP A;  2MHR A;  4N6C A;  3EFO B;  5GPG B;  5DS6 A;  1U89 A;  1JAF A;  3S0X A;  2L6G A;  1YZA A;  4EWC A;  4JCH A;  1JR8 A;  2YL1 A;  4QDL A;  4JCZ A;  1ZW2 A;  3E70 C;  3IEE A;  1OXB A;  2A6H F;  1Q0D A;  3U0C A;  4P9F A;  3Q7L A;  1RJ9 A;  4BJT A;  2CDQ A;  1LKX A;  2KSF A;  2ZPA A;  3PCV A;  1LE4 A;  2Y3D A;  1TQG A;  3EQL F;  1HW1 A;  4WJ0 A;  4MQ9 F;  3VYW A;  3W8H A;  4CSA A;  3ASN C;  5JP7 A;  3JCU Q;  1LM3 B;  2CYD A;  4OD4 A;  1JRA A;  2V26 A;  1BR1 A;  3U8P A;  2L81 A;  1PD1 A;  5E2Q A;  1V74 B;  4OIN F;  3ZVR A;  2W45 A;  2HJ3 A;  3ABM C;  4MTF A;  3FAP B;  4ZLC A;  1E85 A;  3AOU A;  2R7X A;  1IW7 F;  4CS9 A;  3RQF A;  4DBR A;  4IAO A;  5K0I A;  4D4X A;  4IJJ A;  1Z3I X;  5CI9 A;  4O6Y A;  2HMQ A;  3IHU A;  5L3Q A;  4CIH A;  4QI2 A;  1LVK A;  2O9X A;  5L0H A;  3SP1 A;  3W2W A;  4K1O A;  2WZF A;  4MVU A;  4C7O A;  3QMK A;  4KC9 A;  2GDC A;  1E2X A;  3UGO A;  3X1O A;  4E7S A;  1E86 A;  1OXK A;  5KYU A;  1E83 A;  2YQY A;  1PCX A;  2EPM X;  2PBE A;  3SXZ A;  1SMY F;  4YT4 A;  2WB7 A;  5KYX B;  3K1I C;  4IRU A;  3ZQV A;  3G4Z A;  2A6E F;  3HKK A;  3DAG A;  2J9B A;  1MMN A;  4CIP A;  2XS1 A;  1K04 A;  4GYT A;  4MW8 A;  1JMW A;  3N0T A;  2HS5 A;  3QVY A;  1WN0 A;  4O6M A;  1LIH A;  4DRI B;  3UGP A;  1EI7 A;  2Y3G A;  2Q9A A;  1WAS A;  1YYX A;  2D4U A;  1VYI A;  3C7J A;  1K05 A;  4XPY A;  3LLI A;  2P0N A;  3SYN A;  4IGG A;  3WOD F;  1BBH A;  4G7H F;  3J06 A;  1HY5 A;  2JX0 A;  2AWC A;  3E9V A;  1OKK A;  3QVZ A;  3RKO F;  5A69 A;  2R7U A;  2IOQ A;  1C03 A;  256B A;  1N1C A;  3FOO A;  2XLE A;  4YT2 A;  4G7Z F;  1QPU A;  1RKC A;  2MWQ A;  3TOL A;  4LLE A;  3KH2 A;  1TR2 A;  3MYF A;  2KJG A;  1J8M F;  3EJN A;  2QTV A;  1D0Z A;  4H4K C;  4NQF A;  5CI8 A;  1QQ3 A;  1VB5 A;  5BQI A;  4EIY A;  1S7Z A;  3KPH A;  3GWL A;  1CPQ A;  2R25 A;  1L7C A;  1BZ4 A;  3RIP A;  4ER9 A;  2XL8 A;  2BE5 F;  1BR2 A;  1SF8 A;  3IQT A;  3SNH A;  2B0H A;  2VCA A;  3ABK C;  4BPM A;  1RJ9 B;  1T5O A;  1WWP A;  2OJQ A;  3KKB A;  4JUR I;  1FAP B;  3RH3 A;  4JEB A;  3TJ6 A;  3U3F A;  5L0G A;  4U5G A;  5BQG A;  2OKU A;  4K0D A;  5T1D B;  1YLM A;  1MNE A;  2DGJ A;  3NYM A;  3K1H A;  2PFD A;  3GEE A;  2XRH A;  2Q9C A;  2Y39 A;  3ZTZ A;  5HV9 A;  2KGO A;  1ZU5 A;  3EZH A;  4PK4 A;  4HFK B;  1U0B B;  3B9Q A;  3U8V A;  4F4B A;  3ZG1 A;  2NUP B;  2IXO A;  1VK5 A;  2YLI A;  3L8J A;  4NTB A;  4OIR F;  3U2M A;  1ZU4 A;  3W8I A;  3NDB B;  1L3P A;  2IBF A;  1FNT c;  1YVI A;  1FMW A;  4JTA B;  3T6B A;  4FES A;  4CDA A;  2R7T A;  3ITF A;  4DVY P;  2FGY A;  2YL0 A;  3ZQY A;  3U5S A;  1OCR C;  4A2N B;  5AC5 A;  2BC5 A;  1M56 C;  3ZIB A;  4B6I A;  2HMZ A;  3C8G D;  4NTF A;  4PFP A;  2IYL D;  1G8X A;  1ORS C;  2QUP A;  4C3B A;  3AGU A;  2XSE A;  3UMI A;  1RMV A;  1Z63 A;  3NMI A;  3RF3 A;  3DD7 A;  2KNH A;  3DM9 B;  3LAY A;  4PFO A;  2R9R B;  5D91 A;  3LNR A;  2EPK X;  3HLZ A;  3LEO A;  3T4R A;  4W8K A;  3F47 A;  4E17 A;  4AE4 A;  2L9J A;  3U3B A;  3TD7 A;  4BJ6 C;  1H9T A;  2RSE B;  3O10 A;  3PHF 2;  3DE8 A;  1AEP A;  4GQH A;  3LES A;  3V5Y A;  4K7B A;  3VRC A;  3ZWI A;  3AQC A;  1V55 C;  1MND A;  2WZG A;  1CGM E;  2H7B A;  3S28 A;  4AL1 A;  3F46 A;  1YAR O;  3LLK A;  2HJM A;  3N2Z B;  3NG1 A;  3V7O A;  4JEA A;  5T3T A;  4E0H A;  1H7I A;  2Q3T A;  2R02 A;  4C3D A;  1QZX A;  5KYY A;  2IXN A;  2CW0 F;  2Y3H A;  3EGD B;  3EGX B;  1UFB A;  3MFN A;  4CSA C;  2AWY A;  1OQC A;  2G3K A;  1OCC C;  4MVZ A;  3B0V C;  3GEI A;  4EBK A;  5BUO A;  3U9M A;  1AVO B;  1OR3 A;  4L6R A;  2J9V A;  3BEH A;  4ULW A;  4RDA A;  4JJF A;  2HV6 A;  2EIJ C;  1RCP A;  2YWA A;  3RVY A;  1BR4 A;  1EQ1 A;  3DMD A;  3RQE A;  2P61 A;  1Z23 A;  5DS5 A;  3KYI A;  3OA1 A;  5JS5 A;  4JJG A;  5COG A;  1EKY A;  4IWB A;  4N4W A;  3EHN A;  2OG2 A;  2WL8 A;  1YZC A;  4DRH B;  4DXW A;  5L0D A;  3EG9 B;  2R7O A;  5KYX A;  3TUL A;  4Z9H A;  1MMD A;  1UG7 A;  2VC9 A;  3FMS A;  4LAC B;  3I5Q A;  2YHS A;  5KYW A;  3JRT A;  3EH2 A;  1D1C A;  1NFO A;  1QVX A;  1NZE A;  1OW8 A;  3KL4 A;  1C17 M;  1G5Z A;  4E0I A;  3MX3 A;  2J7P D;  1GGQ A;  3ZC4 A;  1BDJ B;  2LP4 A;  1M57 C;  3US6 A;  4AX2 A;  3L0I A;  4G0H A;  4MVM A;  3HNL A;  4Q4Z F;  2R7V A;  4ZLD A;  2YRF A;  3ECS A;  3TOM A;  1QKR A;  4BEM J;  1PD0 A;  2YZS A;  2F22 A;  2VAS A;  3HTK C;  1T6U A;  3JYY A;  4MVO A;  5B1B C;  1T6I A;  4LDR A;  1YA7 O;  2TMV P;  3NYL A;  3FVY A;  3I5P A;  3TK0 A;  4OIO F;  3R7C A;  2Q4F A;  1D0Y A;  5DS4 A;  3NYJ A;  1XWJ A;  2YVK A;  4LLC A;  5DQZ A;  4EUK B;  3EH1 A;  3GM2 A;  3DZA A;  4KBL A;  2J8W A;  3GEH A;  5A6J A;  5EGY A;  1KNY A;  3C18 A;  2ZXP A;  3S27 A;  4EBB A;  4YL0 A;  2PX0 A;  3TQO A;  2UUH A;  3G4X A;  4DJ9 A;  1T01 A;  2A68 F;  4HFF B;  1XZP A;  2EPL X;  4NC3 A;  5F5F A;  1SZI A;  4O6N A;  1U6H A;  4LER A;  1NG1 A;  3GOR A;  4JIO A;  1ZW3 A;  1XZQ A;  3MLG A;  3B0P A;  3I4U A;  4U5H A;  4XEF A;  5FZT A;  3POV A;  1D0X A;  3EPV A;  2D5R B;  4U5D E;  3T6J A;  2WVQ A;  2YL7 A;  3C8G A;  3T6G B;  3IQC A;  4OIP F;  1JPJ A;  1NSG B;  4N6H A;  4CDV A;  4AE4 B;  1LS1 A;  4D4N A;  1Z6A A;  2Q00 A;  2XL6 A;  3CSK A;  3M79 A;  3X2Q C;  3ZDL A;  5AC4 A;  5T3W A;  1A41 A;  5FCL A;  3VAY A;  4WAB A;  1CGN A;  2LK4 A;  1YAU O;  3ZSU A;  2VB6 A;  4JTC B;  2WVO A;  2W9Y A;  3M4C A;  1VOM A;  2M4E A;  3NKD A;  2NUT A;  3LEV A;  3DKA A;  2OCC C;  2XM0 A;  3A9C A;  3M4B A;  3AGT A;  3A11 A;  3Q7G A;  4IB4 A;  4JZA A;  3EGD A;  4I44 A;  4PJM A;  3HNJ A;  5L0J A;  5A6A A;  2M64 A;  2NPU A;  4XEK A;  3U9J A;  4C7O B;  2HSQ A;  4M63 A;  4Z9J A;  3NKE A;  2EIM C;  3SXK A;  1WTY A;  4NTA A;  3WAQ A;  5JUA A;  3UR3 C;  2XXA B;  3HNI A;  2R7R A;  1T6Q A;  5L3V A;  1T9K A;  3K66 A;  2KK1 A;  2HSB A;  3FAJ A;  5KYW B;  3JT1 A;  4O79 A;  2L6F A;  1Z5Z A;  3FOP A;  4W8P A;  4C3E A;  1ST6 A;  1WGW A;  5JSL A;  4BJ1 A;  3C8G B;  3C8Z A;  4U9D A;  2DI3 A;  3JYH A;  3AG3 C;  2FAP B;  1VLT A;  1S05 A;  2CCY A;  3UMH A;  3VF0 A;  4ULV A;  4CDY A;  1HW2 A;  4LDQ A;  4I3M A;  1CGO A;  4IAR A;  2X0C A;  4BJ6 A;  4XLP F;  2EPO A;  2H8A A;  2YEV A;  3HJC A;  1O87 A;  3DJN B;  2XLW A;  2W4M A;  4KNW A;  4LDK A;  2LSE A;  4N06 A;  3W4Y A;  3WHN A;  1Q0F A;  2XLH A;  5F28 E;  3GAN A;  4R32 A;  4JRZ A;  5AGF A;  3VM6 A;  3IQ5 A;  1PV3 A;  3QW1 A;  1A7D A;  1LPE A;  2AVK A;  4JKV A;  2MYS A;  4PR9 A;  3G50 A;  4A4A A;  3DJU B;  5DQT A;  2R7W A;  2CGE A;  4GEH A;  1APC A;  2LQG A;  3DXJ F;  4MS2 A;  4NY3 A;  2NUP A;  2PF4 E;  3M1C B;  3AG4 C;  2XLD A;  3ASO C;  4UDV A;  4E7Z A;  1V4A A;  2C03 A;  4WGY A;  2UUI A;  1A0B A;  3O39 A;  2LFD A;  1H6G A;  1OCO C;  2W4B A;  2YL3 A;  4DOZ A;  5JRA A;  3H2V A;  4XQ1 A;  3T9O A;  3UMK A;  1G4U S;  1NU7 D;  3QW0 A;  4IAQ A;  3EHM A;  5E3C A;  1ZHY A;  4DBQ A;  2HV7 A;  1CPR A;  5L0I A;  3R2P A;  1NBB A;  1ZHT A;  2A1D D;  2LCH A;  4ANJ A;  5B3S C;  3L34 A;  1TFK B;  4J32 B;  2EIK C;  3RYL A;  2OEX A;  3K6B A;  3ZTM A;  2OEV A;  2Y69 C;  2Z15 A;  2ZXW C;  1V54 C;  3AQB A;  3LS0 A;  3S29 A;  1RKE B;  1M2V A;  2BL2 A;  2G3V A;  4KNV A;  4U5B E;  4XPX A;  3EG9 A;  2EPN A;  3N24 A;  2NSG A;  4XTK A;  1LS4 A;  3RQG A;  1MMG A;  1TWA A;  3RVZ A;  4XEV A;  3RW0 A;  1HE9 A;  1R4T A;  1D1B A;  3SXY A;  3S84 A;  3L8I A;  2AP3 A;  2ZXO A;  2YLG A;  5D92 A;  4OIQ F;  1K40 A;  3GWN A;  1TWC A;  4XPW A;  4PJJ A;  1KTM A;  1OR2 A;  1ZVZ A;  2JD3 A;  3ABL C;  3HNK A;  5DLJ A;  4G78 A;  5CIV A;  3IPM O;  2Q9B A;  2DYR C;  1SYQ A;  1Y4C A;  4QI0 A;  1I4Y A;  4U5F E;  1I4Z A;  1WOL A;  1YJG A;  2DB4 A;  2ETS A;  2P7V A;  5A6B A;  4YN0 B;  5B1A C;  4CJG A;  2LD6 A;  4FWV A;  2KW3 C;  2X51 A;  2V3C C;  1MQV A;  2A0U A;  1OCZ C;  2OU6 A;  3JSE O;  4HE8 D;  4JE9 A;  1E84 A;  2L7A A;  2B0J A;  1YDI A;  2FFH A;  4FX5 A;  3WG7 C;  1M2V B;  4MVS A;  1FTS A;  3FXH A;  1Q0M A;  4ONS A;  4EBJ A;  2Q7R A;  4YL3 A;  5F5H A;  3CZ6 A;  4MVR A;  4OD5 A;  3H65 A;  4JTD B;  4G7O F;  3NRH A;  3RFY A;  3W2V A;  2G62 A;  4BEJ A;  2VH3 A;  3U2L A;  2IM8 A;  1QSP A;  3MBG A;  1Y6D A;  5COM A;  5KYN A;  1HMO A;  2QE9 A;  2WZL A;  1ZYR F;  5KYY B;  4CS8 A;  1QLE C;  3B0U X;  4YT8 A;  3AG1 C;  1R5I D;  2KYH A;  1GS9 A;  1EA8 A;  1VLS A;  5HSW A;  1JPN A;  3LJB A;  5KYU B;  4U5E E;  2OJE D;  2ZD9 A;  1M6T A;  2ICW G;  3JTL O;  1KU2 A;  3V5Z A;  4CS7 A;  3K7D A;  3KYJ A;  3PDM P;  2QNL A;  3AG2 C;  1H9G A;  3B71 A;  3DE9 A;  3MYI A;  1RKE A;  2NSF A;  1VTM P;  3V5X A;  2P6V A;  1NFN A;  3CQZ A;  1LI5 A;  2I8B A;  1O5H A;  1C02 A;  2YKZ A;  2AU5 A;  3OEO A;  3S9O A;  1RXQ A;  2XM4 A;  3GM3 A;  3UNG C;  3M15 A;  2GFH A;  1TWH A;  1DOV A;  3LNM B;  1YA9 A;  2E87 A;  1HE1 A;  1HMD A;  2J45 A;  4YK5 A;  1OW7 A;  3C62 A;  4P9T A;  1ZHW A;  2KQ9 A;  4MTG A;  5JVE A;  2J9U A;  2KC3 A;  1AUE A;  3GM1 A;  5L0F A;  4O7G A;  2CNW A;  4MTO A;  2IXP A;  3FHD A;  3K1I A;  3Q6N A;  2ZXR A;  1A7V A;  5EK0 A;  3S90 A;  5E33 A;  5BQH A;  2JPU A;  4Q7C A;  1I5N A;  3JRM O;  4I1M A;  3GOD A;  2R7Q A;  3PMR A;  1Q0G A;  4HEA J;  4NCQ A;  3LS1 A;  4BJ5 C;  4PJL A;  3AJM A;  4J30 B;  4XWJ A;  4AL0 A;  4XLN F;  2EIL C;  3K33 A;  2A0B A;  2J0X A;  2XS8 A;  5B3I A;  3BRJ A;  2R03 A;  3B29 A;  4DRJ B;  4CX9 A;  3CAX A;  3EZI A;  4CS9 C;  2PX3 A;  2C04 A;  4PJN A;  4Q5S F;  4AK9 A;  1TWG A;  4BG0 A;  2XLM A;  2PP4 A;  4YJW A; 
#chains in the Genus database with same CATH homology
 1Q0G A;  4NCQ A;  1T6U A;  3G50 A;  1Q0F A;  1T6I A;  1Q0K A;  1T6Q A;  3G4X A;  1Q0D A;  3G4Z A;  1Q0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...