2ASRA

The three-dimensional structure of the aspartate receptor from escherichia coli
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
142
structure length
142
Chain Sequence
b'KSFVVSNQLREQQGELTSTWDLMLQTRINLSRSAVRMMMDSSNQQSNAKVELLDSARKTLAQAATHYKKFKSMAPLPEMVATSRNIDEKYKNYYTALTELIDYLDYGNTGAYFAQPTQGMQNAMGERFAQYALSSEKLYRDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE RECEPTOR
publication title The three-dimensional structure of the aspartate receptor from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chemotaxis
total genus 71
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 1994-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 2asrA00
4Z9IA 4Z9JA 3T9OA 1VLSA 1WASA 1JMWA 2D4UA 1WATA 4Z9HA 2ASRA 4H54A 3ATPA 1VLTA 1LIHA 2LIGA
chains in the Genus database with same CATH superfamily
1ZYRF 4JVSA 3JYYA 1Z5ZA 4HFFB 4PJLA 4OD4A 2J9WA 1UFBA 1SYQA 4DRHB 1SZIA 1NU9C 3NRHA 2IXMA 4N6HA 3K6BA 2Q3TA 3B9QA 2OEVA 5CIVA 4PACA 2Y69C 3C63A 3QVYA 4YN0B 2LK4A 1D1BA 1G5ZA 2W45A 3AOUA 1RJ9B 1JR8A 5DQTA 3CAXA 2NUPA 5CI9A 1NBBA 5D92A 2QTVA 2OEXA 256BA 5CI8A 4Q7CA 2TMVP 1H9GA 3AQCA 3IQ6A 2J9BA 4DRIB 3HNJA 2HSBA 3C18A 5L3VA 1A7VA 1Y6DA 3Q6MA 3L8JA 5A69A 2DI3A 5L0FA 1R4TA 1SMYF 1YARO 4K1OA 2W4MA 4XLNF 1VLTA 5T3TA 3A9CA 2W9YA 2R7WA 2M64A 4Z9JA 5JRAA 4YT2A 1G4US 4IAQA 1MQVA 4F4BA 2V3CC 2YRFA 3C7JA 1WN0A 2OJED 3DMDA 1NU7D 4IAOA 2L6HA 5COFA 4CIPA 1WGWA 1ZW3A 3U3FA 4MVSA 1OW7A 4YL3A 1VYIA 4XPYA 2NSGA 1OKKA 1ZVZA 3DM9B 1Q0MA 1PD0A 3ZVRA 3KYIA 3N2ZB 4WGZA 3ZIBA 4GEHA 2WVNA 3SXZA 2LCHA 1TFOB 4U5HA 4JIOA 3QVZA 4KI2A 3NMJA 2EILC 4LERA 1FAPB 3S29A 4N6CA 2VC9A 1IW7F 1VLSA 3RW0A 2G3KA 1ZZPA 3KKBA 1GGQA 3EG9B 1E85A 4BJ1A 3KL4A 2H7BA 3GM3A 3SEOA 1OCRC 1OQCA 2NUTB 3NYMA 3BRJA 4OIRF 3V5ZA 2R7VA 2D5RB 1DOVA 2XLMA 2J0WA 3A11A 3ZTMA 3EGDB 2OQMA 3PCVA 3LS0A 3DM5A 3SP1A 2O9XA 4ER9A 3TJ5A 3RQFA 2R03A 3C62A 4MQ9F 4PJNA 3S28A 3ZSUA 1O3UA 2A6EF 2KJGA 2R25A 1OR3A 1T6QA 3EQLF 2HZ8A 3G50A 5A6BA 2R7XA 3B0PA 3Q7GA 4BPMA 2YWAA 4MTOA 1FR0A 4DXWA 3CQZA 2ETSA 1WASA 2X0CA 3GWNA 3S84A 4B6IA 2EPOA 1OR2A 1HMOA 3V5XA 3NMKA 1NZEA 2LD6A 3RVYA 2QLAA 3M15A 3OEOA 2GDCA 1CGME 3KMIA 1WATA 2KW3C 5D91A 3U9MA 4CDYA 1YJGA 2DYSC 2Y3HA 1JRAA 3L8IA 4EIYA 4XEVA 3U8VA 1AEPA 3V7OA 2A1DD 2XL8A 5JVEA 3DXJF 5IY5C 4O6YA 3EFOB 3K1IA 5BUOA 3SNHA 1JOGA 2C03A 3TD7A 2FGYA 4LDQA 2XSEA 3RVZA 5EGYA 3L1MA 4JTAB 2ZXRA 3HJCA 3FDQA 5F28E 2R7SA 4IGGA 2A0UA 2LP4A 4HE8D 5HSWA 3ECSA 1Q0FA 1ZHXA 4MVZA 1WTYA 2J8WA 2Q9AA 1TWGA 1M2VA 2EPNA 2WB7A 1TFKB 2XM0A 2Y3BA 3HKKA 1V55C 2E87A 2BC5A 4L6RA 3CSKA 4PFOA 1YYXA 5DVWA 3EGXA 2YL1A 1Y4CA 3LNRA 4GYTA 3EH1A 2YVKA 2KK1A 2EIMC 2OCCC 4CS8C 1V4AA 1Z7Qc 3SYNA 2DB4A 2VH3A 1FTSA 3KH2A 3L0IA 1WWPA 3OWTA 4J32B 3W2WA 3UGPA 4OIQF 2YQYA 4AL0A 3EPVA 1EQ1A 1JPJA 3ASNC 2XXAA 2PFDA 4U5BE 3RIPA 4A4AA 1YZCA 1L7CA 2B0HA 3ZC4A 2XL4A 5L0HA 1QLEC 2GA0A 2CW0F 3AG4C 1M6TA 5FZTA 1KNYA 5AGFA 1HW2A 1ZW2A 2XLDA 3AGTA 4HEAJ 3K7DA 2A6HF 2B0JA 3C8GA 1XZQA 2AWCA 2YL0A 2R7RA 3O10A 2EIKC 4RD9A 4E7ZA 2EIJC 1QZXA 1D0YA 3NMIA 4MVOA 2Q9BA 1LS4A 2R05A 1V54C 2HJMA 1N1CA 2Y3GA 4YT8A 3E70C 2AP3A 4MW8A 2Q9CA 2L7AA 4IJJA 1A0BA 1VMAA 1MMNA 2KYHA 3RF3A 4NTFA 3AGUA 5E2QA 4A2NB 5DS6A 1I4YA 4AK9A 5L0CA 2NUPB 4O6NA 3PDMP 1VK5A 3I4UA 4X0RA 3ABKC 4CS8A 2BL2A 2IM8A 2VCBA 4HFKB 2HFIA 1VTMP 5COMA 3X1OA 4C3DA 4Z9IA 4EWCA 2KGOA 1LI7A 3B71A 1VOMA 3UGOA 3ZQYA 3QW0A 4MVRA 1RKCA 3VAYA 2ZXOA 4YL0A 4FX5A 2YL3A 4RBNA 1OCOC 3T6JA 1Q0DA 1QPUA 2NG1A 3G4ZA 4NY3A 3PMRA 2XL6A 4OINF 3H65A 3U8PA 2VCCA 5B3SC 2GAQA 4JJFA 2PBEA 3DAGA 3FXHA 3AG3C 1AUEA 3B0UX 5L0DA 1NFOA 4PJJA 3U2LA 3JTLO 2PP4A 2ZD9A 1QQ3A 2I15A 2J9VA 3MYIA 1H6GA 4FWVA 5TJ5E 3EZHA 5A6JA 3LJBA 4P9FA 2Y39A 1G4WR 4U5FE 3TJ6A 3JRMO 3QW1A 3NYJA 4C3BA 1AVOB 2DYRC 4JTDB 4P9TA 1SF8A 1T6IA 4JURI 1D1CA 4JEBA 2ICWG 4MVMA 1RCPA 4U5CE 3S27A 2OKUA 4DRJB 4GQHA 4KBLA 4MVQA 4G7ZF 3RYLA 1NFNA 2RSEB 4IWBA 1K05A 3ZTZA 1H9TA 1LS1A 3W8HA 3CEXA 2HJ3A 2YLIA 3SXYA 2EPMX 1U0BB 2QUPA 4U9EA 1V74B 1RJ9A 3POVA 3MYFA 3RFYA 1M56C 3FHDA 3DE8A 1FMWA 4XQ1A 1YA9A 4YK5A 3O55A 3DAFA 2AVKA 4PJMA 3H2UA 3GM2A 1M57C 3HNKA 5AC5A 3T9OA 2PX3A 3VF0A 3JT1A 5B1BC 3K1HA 3IQTA 3ZWIA 2I8BA 4MTGA 2ZPAA 4Q4ZF 4DJ9A 5DS5A 1Z3IX 1JAFA 2LFDA 3WAQA 4JJGA 2WZFA 1FNTc 4I44A 4UDVA 2IXOA 2CNWA 2EPKX 4BJ5C 4I1MA 1A7EA 2L6FA 4G78A 4QDLA 1BR2A 4CS9C 4Q5SF 5DS4A 3UMKA 4LACB 5JUAA 1CPRA 1HE9A 5A6KA 4WABA 1XWJA 1Z23A 1R5ID 4NQFA 1K04A 1PCXA 2YL7A 4LDRA 1O5HA 1W2WA 1YVIA 3Q6NA 3IHUA 2V26A 1ORJA 2WZLA 3N24A 3S9OA 2PF4E 5F5HA 2R02A 1I5NA 1LM3B 4MS2A 3ABMC 4JRZA 4CJOA 1TWAA 1E86A 4NTBA 3DD7A 5JT4A 2H7OA 1JMWA 2J0XA 4DBRA 1ST6A 3FOPA 1MMDA 2XRHA 2ZXPA 4M63A 4DVYP 4ZLDA 2J46A 1E2XA 1GQAA 1M2VB 4P6IC 4WGYA 4J7TA 2P0NA 4LLCA 3TOLA 2NUTA 1YZAA 3EGXB 4CIHA 3U5SA 1A41A 4CJGA 2IXPA 2VCAA 3EGDA 3ABLC 4ULVA 1OKKD 1T01A 3PHF2 1RKEA 2EINC 1TQGA 4CS9A 2J7PA 4BJ5A 1EKYA 3TULA 1OXBA 2QNLA 1ORSC 4ONSA 3SZRA 2XXAB 1TKNA 2P61A 3I5PA 4YT5A 2FFHA 3EJNA 4QI0A 5KYXA 2QY9A 1CGNA 4IB4A 4DBQA 3TK0A 1JPNA 4IRUA 4EBBA 4I1OB 4AE4A 2XLVA 2CYDA 2HV7A 3FMSA 3QZCA 3GEEA 2UUHA 4U5GA 3C8GB 1ZHTA 2MWQA 1TWHA 5B1AC 5BQHA 3M4CA 5JS5A 3F47A 4J7YA 1T9KA 3W8IA 4C7OA 4OIOF 2H8AA 2NSFA 5KYUA 2HMZA 3SXMA 1HMDA 3NG1A 2P7VA 5A6BD 1U6HA 4CDAA 3RKOF 2IXNA 5EK0A 1E83A 3UR3C 3DE9A 2FAPB 2JD3A 3GEHA 3H2VA 4MTFA 1LIHA 1D0ZA 1LKXA 5T1DB 3DZAA 2G62A 2IBFA 4NCQA 1YDIA 3U3BA 4JZAA 3I5QA 3S0XA 2RD9A 5KYWA 4KNWA 4DVZA 4PK4A 4O79A 4H4KC 2WL8A 1YLMA 4QI2A 1Q0GA 3FVYA 3HNIA 3LLIA 2WVOA 4U5DE 3R7CA 3TQOA 4FAPB 3LLKA 4BJ6C 2LQGA 5K0IA 4OD5A 3M79A 1MNDA 1BZ4A 4ANJA 2F22A 2H7VC 2HMQA 3TOMA 3LUTB 3RQGA 1G8XA 4CBEA 4EKWA 3N0TA 4G0HA 2A69F 2D4UA 2HUJA 1NLXA 1LPEA 3FAPB 5EHHA 4EHPA 1Z63A 3LEVA 1FFHA 4DOZA 2R7TA 5F5FA 1RXQA 1E84A 2XS8A 2XM4A 2IOQA 2NPUA 1C17M 3K66A 1HW1A 3U2MA 4R32A 1MMAA 5KYYA 2XLEA 4XWJA 1Z6AA 2PX0A 3LEOA 1ZU5A 4K0DA 2J45A 4MVUA 1YYJA 3AG2C 4BG0A 1J8YF 2VASA 4JCHA 5DQZA 1I4ZA 1J8MF 3LNMB 1L3PA 1ZU4A 3ATPA 4ZLCA 5L0IA 1ORYA 4XLPF 2L81A 4XPWA 3S90A 4JE9A 4LLEA 1PD1A 1CPQA 3DWWA 2KC3A 3AJMA 4PFPA 4J30B 2Q00A 4BJ6A 1LI5A 3FOOA 1NG1A 3DJNB 3QTHA 2P1AA 2UUIA 4D4NA 1QVXA 1OW6A 1F1MA 4XPXA 1ZHWA 3LAYA 3W4YA 3QMKA 1VB5A 1TR2A 2A0BA 1XZPA 3C8GD 4U5EE 2Z15A 3MX3A 5FCLA 4G7OF 3GANA 3T4RA 3IEEA 3NYLA 2X51A 3CZ6A 3R2PA 4EUKB 2R7UA 2ASRA 2MHRA 2KSFA 1GM5A 3NDBB 3HLZA 4YJWA 4EBJA 2YZSA 2MYSA 3G4XA 3AG1C 2IYLD 1LVKA 2Q4FA 2AU5A 1DOWA 3NKEA 2W4BA 4W8KA 1M2OA 3WHNA 2XS1A 4JC7A 3RH3A 3LESA 5BQGA 2G3VA 5BQIA 1HY5A 2VB6A 3Q7LA 2JX0A 5GPGB 4KNVA 2GWWA 4U9DA 3V5YA 1MMGA 1VYKA 3JYHA 1D1AA 3KPHA 4AX2A 2P6VA 4JKVA 4C3EA 4OIPF 3JZ0A 1APCA 3GM1A 2QE9A 3IQ5A 3U0CA 3IPMO 1OCZC 3M1CB 3C8ZA 3UMHA 4MW3A 3T6BA 4PR9A 2KNHA 5COGA 1A7DA 5AC4A 5E3CA 3UMIA 2CDQA 2KQ9A 4N06A 4NC3A 1RMVA 2YEVA 3K1IC 3O39A 3JSEO 1PV3A 2WZGA 2CGEA 4KC9A 2XLWA 1FFTC 4JCZA 4I3MA 3L34A 3O6XA 2L9JA 4ULWA 4CSAC 1EA8A 1OCCC 3BEHA 4EBKA 1T6UA 1T5OA 4XTKA 1RKEB 5KYNA 2YKZA 1B68A 1LE4A 3EG9A 2DGJA 1H7IA 3J06A 3VM6A 2YHSA 3EHNA 3AQBA 4Z9HA 1LE2A 2YLGA 4YWQA 3WG7C 1C03A 1ZHYA 4BEJA 2Y3DA 2LIGA 4XEKA 5DLJA 5KYXB 3W2VA 2CCYA 5L0JA 2OOCA 1QKRA 3RQEA 4CDVA 2ZXWC 3ASOC 3VRCA 4AL1A 4H54A 4AE4B 1KTMA 3FAJA 1NSGB 3M4BA 4YL1A 1MNEA 1OXKA 2HSQA 2JPUA 3DKAA 3JRTA 5L3QA 3JCUQ 1YAUO 4C7OB 4O7GA 1FMVA 3UNGC 5KYUB 5HV9A 2OG2A 3X2QC 4BEMJ 1BR1A 3NKDA 1CGOA 1YA7O 3ITFA 5JSLA 1TWCA 5A6AA 2AWYA 3JSZA 4G7HF 2M4EA 4JTCB 2C04A 3ZDLA 4CSAA 3SXKA 2XLHA 2R7OA 2CNWD 4CS7A 2OU6A 1K40A 2L6GA 1OW8A 2XLOA 4JEAA 3ZQVA 4E7SA 5KYWB 3B0VC 1EI7A 3EFOA 1C02A 3E9VA 3EZIA 3OA1A 2LSEA 3DJUB 4FESA 5E33A 3ZG1A 3VYWA 1S05A 2OJQA 1BDJB 3GWLA 2Q7RA 1BR4A 2R7QA 3B29A 1WOLA 2A68F 3MBGA 2EPLX 5T3WA 3DI5A 3GEIA 2PNOA 2YLDA 5E3AA 1Q0KA 4K7BA 4YT4A 4NTAA 3K33A 4N4WA 1O87A 2BE5F 3EHMA 3HNLA 3IQCA 4IARA 1SR2A 3HTKC 3U9JA 1IZMA 4E17A 1HE1A 4E0IA 1UG7A 2J9UA 1S7ZA 2LFFA 2WVQA 3GODA 4E0HA 2GFHA 4CX9A 4XEFA 2HS5A 3EH2A 5JP7A 3MFNA 3T6GB 2HKVA 4O6MA 3US6A 4D4XA 4MNDA 5B3IA 3MLGA 1U89A 2HV6A 5KYYB 1GS9A 1QSPA 1KU2A 4WJ0A 1BBHA 3LS1A 4RDAA 4E18A 1D0XA 2J7PD 4JW1A 5L0GA 4BJTA 4LDKA 3KYJA 2R9RB 4W8PA 3WODF 5JLIA 1ZHZA 3F46A 3GORA
chains in the Genus database with same CATH topology
4Z9IA 4Z9JA 3T9OA 1VLSA 1WASA 1JMWA 2D4UA 1WATA 4Z9HA 2ASRA 4H54A 3ATPA 1VLTA 1LIHA 2LIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z9I A;  4Z9J A;  3T9O A;  1VLS A;  1WAS A;  1JMW A;  2D4U A;  1WAT A;  4Z9H A;  2ASR A;  4H54 A;  3ATP A;  1VLT A;  1LIH A;  2LIG A; 
#chains in the Genus database with same CATH topology
 1ZYR F;  4JVS A;  3JYY A;  1Z5Z A;  4HFF B;  4PJL A;  4OD4 A;  2J9W A;  1UFB A;  1SYQ A;  4DRH B;  1SZI A;  1NU9 C;  3NRH A;  2IXM A;  4N6H A;  3K6B A;  2Q3T A;  3B9Q A;  2OEV A;  5CIV A;  4PAC A;  2Y69 C;  3C63 A;  3QVY A;  4YN0 B;  2LK4 A;  1D1B A;  1G5Z A;  2W45 A;  3AOU A;  1RJ9 B;  1JR8 A;  5DQT A;  3CAX A;  2NUP A;  5CI9 A;  1NBB A;  5D92 A;  2QTV A;  2OEX A;  256B A;  5CI8 A;  4Q7C A;  2TMV P;  1H9G A;  3AQC A;  3IQ6 A;  2J9B A;  4DRI B;  3HNJ A;  2HSB A;  3C18 A;  5L3V A;  1A7V A;  1Y6D A;  3Q6M A;  3L8J A;  5A69 A;  2DI3 A;  5L0F A;  1R4T A;  1SMY F;  1YAR O;  4K1O A;  2W4M A;  4XLN F;  1VLT A;  5T3T A;  3A9C A;  2W9Y A;  2R7W A;  2M64 A;  4Z9J A;  5JRA A;  4YT2 A;  1G4U S;  4IAQ A;  1MQV A;  4F4B A;  2V3C C;  2YRF A;  3C7J A;  1WN0 A;  2OJE D;  3DMD A;  1NU7 D;  4IAO A;  2L6H A;  5COF A;  4CIP A;  1WGW A;  1ZW3 A;  3U3F A;  4MVS A;  1OW7 A;  4YL3 A;  1VYI A;  4XPY A;  2NSG A;  1OKK A;  1ZVZ A;  3DM9 B;  1Q0M A;  1PD0 A;  3ZVR A;  3KYI A;  3N2Z B;  4WGZ A;  3ZIB A;  4GEH A;  2WVN A;  3SXZ A;  2LCH A;  1TFO B;  4U5H A;  4JIO A;  3QVZ A;  4KI2 A;  3NMJ A;  2EIL C;  4LER A;  1FAP B;  3S29 A;  4N6C A;  2VC9 A;  1IW7 F;  1VLS A;  3RW0 A;  2G3K A;  1ZZP A;  3KKB A;  1GGQ A;  3EG9 B;  1E85 A;  4BJ1 A;  3KL4 A;  2H7B A;  3GM3 A;  3SEO A;  1OCR C;  1OQC A;  2NUT B;  3NYM A;  3BRJ A;  4OIR F;  3V5Z A;  2R7V A;  2D5R B;  1DOV A;  2XLM A;  2J0W A;  3A11 A;  3ZTM A;  3EGD B;  2OQM A;  3PCV A;  3LS0 A;  3DM5 A;  3SP1 A;  2O9X A;  4ER9 A;  3TJ5 A;  3RQF A;  2R03 A;  3C62 A;  4MQ9 F;  4PJN A;  3S28 A;  3ZSU A;  1O3U A;  2A6E F;  2KJG A;  2R25 A;  1OR3 A;  1T6Q A;  3EQL F;  2HZ8 A;  3G50 A;  5A6B A;  2R7X A;  3B0P A;  3Q7G A;  4BPM A;  2YWA A;  4MTO A;  1FR0 A;  4DXW A;  3CQZ A;  2ETS A;  1WAS A;  2X0C A;  3GWN A;  3S84 A;  4B6I A;  2EPO A;  1OR2 A;  1HMO A;  3V5X A;  3NMK A;  1NZE A;  2LD6 A;  3RVY A;  2QLA A;  3M15 A;  3OEO A;  2GDC A;  1CGM E;  3KMI A;  1WAT A;  2KW3 C;  5D91 A;  3U9M A;  4CDY A;  1YJG A;  2DYS C;  2Y3H A;  1JRA A;  3L8I A;  4EIY A;  4XEV A;  3U8V A;  1AEP A;  3V7O A;  2A1D D;  2XL8 A;  5JVE A;  3DXJ F;  5IY5 C;  4O6Y A;  3EFO B;  3K1I A;  5BUO A;  3SNH A;  1JOG A;  2C03 A;  3TD7 A;  2FGY A;  4LDQ A;  2XSE A;  3RVZ A;  5EGY A;  3L1M A;  4JTA B;  2ZXR A;  3HJC A;  3FDQ A;  5F28 E;  2R7S A;  4IGG A;  2A0U A;  2LP4 A;  4HE8 D;  5HSW A;  3ECS A;  1Q0F A;  1ZHX A;  4MVZ A;  1WTY A;  2J8W A;  2Q9A A;  1TWG A;  1M2V A;  2EPN A;  2WB7 A;  1TFK B;  2XM0 A;  2Y3B A;  3HKK A;  1V55 C;  2E87 A;  2BC5 A;  4L6R A;  3CSK A;  4PFO A;  1YYX A;  5DVW A;  3EGX A;  2YL1 A;  1Y4C A;  3LNR A;  4GYT A;  3EH1 A;  2YVK A;  2KK1 A;  2EIM C;  2OCC C;  4CS8 C;  1V4A A;  1Z7Q c;  3SYN A;  2DB4 A;  2VH3 A;  1FTS A;  3KH2 A;  3L0I A;  1WWP A;  3OWT A;  4J32 B;  3W2W A;  3UGP A;  4OIQ F;  2YQY A;  4AL0 A;  3EPV A;  1EQ1 A;  1JPJ A;  3ASN C;  2XXA A;  2PFD A;  4U5B E;  3RIP A;  4A4A A;  1YZC A;  1L7C A;  2B0H A;  3ZC4 A;  2XL4 A;  5L0H A;  1QLE C;  2GA0 A;  2CW0 F;  3AG4 C;  1M6T A;  5FZT A;  1KNY A;  5AGF A;  1HW2 A;  1ZW2 A;  2XLD A;  3AGT A;  4HEA J;  3K7D A;  2A6H F;  2B0J A;  3C8G A;  1XZQ A;  2AWC A;  2YL0 A;  2R7R A;  3O10 A;  2EIK C;  4RD9 A;  4E7Z A;  2EIJ C;  1QZX A;  1D0Y A;  3NMI A;  4MVO A;  2Q9B A;  1LS4 A;  2R05 A;  1V54 C;  2HJM A;  1N1C A;  2Y3G A;  4YT8 A;  3E70 C;  2AP3 A;  4MW8 A;  2Q9C A;  2L7A A;  4IJJ A;  1A0B A;  1VMA A;  1MMN A;  2KYH A;  3RF3 A;  4NTF A;  3AGU A;  5E2Q A;  4A2N B;  5DS6 A;  1I4Y A;  4AK9 A;  5L0C A;  2NUP B;  4O6N A;  3PDM P;  1VK5 A;  3I4U A;  4X0R A;  3ABK C;  4CS8 A;  2BL2 A;  2IM8 A;  2VCB A;  4HFK B;  2HFI A;  1VTM P;  5COM A;  3X1O A;  4C3D A;  4Z9I A;  4EWC A;  2KGO A;  1LI7 A;  3B71 A;  1VOM A;  3UGO A;  3ZQY A;  3QW0 A;  4MVR A;  1RKC A;  3VAY A;  2ZXO A;  4YL0 A;  4FX5 A;  2YL3 A;  4RBN A;  1OCO C;  3T6J A;  1Q0D A;  1QPU A;  2NG1 A;  3G4Z A;  4NY3 A;  3PMR A;  2XL6 A;  4OIN F;  3H65 A;  3U8P A;  2VCC A;  5B3S C;  2GAQ A;  4JJF A;  2PBE A;  3DAG A;  3FXH A;  3AG3 C;  1AUE A;  3B0U X;  5L0D A;  1NFO A;  4PJJ A;  3U2L A;  3JTL O;  2PP4 A;  2ZD9 A;  1QQ3 A;  2I15 A;  2J9V A;  3MYI A;  1H6G A;  4FWV A;  5TJ5 E;  3EZH A;  5A6J A;  3LJB A;  4P9F A;  2Y39 A;  1G4W R;  4U5F E;  3TJ6 A;  3JRM O;  3QW1 A;  3NYJ A;  4C3B A;  1AVO B;  2DYR C;  4JTD B;  4P9T A;  1SF8 A;  1T6I A;  4JUR I;  1D1C A;  4JEB A;  2ICW G;  4MVM A;  1RCP A;  4U5C E;  3S27 A;  2OKU A;  4DRJ B;  4GQH A;  4KBL A;  4MVQ A;  4G7Z F;  3RYL A;  1NFN A;  2RSE B;  4IWB A;  1K05 A;  3ZTZ A;  1H9T A;  1LS1 A;  3W8H A;  3CEX A;  2HJ3 A;  2YLI A;  3SXY A;  2EPM X;  1U0B B;  2QUP A;  4U9E A;  1V74 B;  1RJ9 A;  3POV A;  3MYF A;  3RFY A;  1M56 C;  3FHD A;  3DE8 A;  1FMW A;  4XQ1 A;  1YA9 A;  4YK5 A;  3O55 A;  3DAF A;  2AVK A;  4PJM A;  3H2U A;  3GM2 A;  1M57 C;  3HNK A;  5AC5 A;  3T9O A;  2PX3 A;  3VF0 A;  3JT1 A;  5B1B C;  3K1H A;  3IQT A;  3ZWI A;  2I8B A;  4MTG A;  2ZPA A;  4Q4Z F;  4DJ9 A;  5DS5 A;  1Z3I X;  1JAF A;  2LFD A;  3WAQ A;  4JJG A;  2WZF A;  1FNT c;  4I44 A;  4UDV A;  2IXO A;  2CNW A;  2EPK X;  4BJ5 C;  4I1M A;  1A7E A;  2L6F A;  4G78 A;  4QDL A;  1BR2 A;  4CS9 C;  4Q5S F;  5DS4 A;  3UMK A;  4LAC B;  5JUA A;  1CPR A;  1HE9 A;  5A6K A;  4WAB A;  1XWJ A;  1Z23 A;  1R5I D;  4NQF A;  1K04 A;  1PCX A;  2YL7 A;  4LDR A;  1O5H A;  1W2W A;  1YVI A;  3Q6N A;  3IHU A;  2V26 A;  1ORJ A;  2WZL A;  3N24 A;  3S9O A;  2PF4 E;  5F5H A;  2R02 A;  1I5N A;  1LM3 B;  4MS2 A;  3ABM C;  4JRZ A;  4CJO A;  1TWA A;  1E86 A;  4NTB A;  3DD7 A;  5JT4 A;  2H7O A;  1JMW A;  2J0X A;  4DBR A;  1ST6 A;  3FOP A;  1MMD A;  2XRH A;  2ZXP A;  4M63 A;  4DVY P;  4ZLD A;  2J46 A;  1E2X A;  1GQA A;  1M2V B;  4P6I C;  4WGY A;  4J7T A;  2P0N A;  4LLC A;  3TOL A;  2NUT A;  1YZA A;  3EGX B;  4CIH A;  3U5S A;  1A41 A;  4CJG A;  2IXP A;  2VCA A;  3EGD A;  3ABL C;  4ULV A;  1OKK D;  1T01 A;  3PHF 2;  1RKE A;  2EIN C;  1TQG A;  4CS9 A;  2J7P A;  4BJ5 A;  1EKY A;  3TUL A;  1OXB A;  2QNL A;  1ORS C;  4ONS A;  3SZR A;  2XXA B;  1TKN A;  2P61 A;  3I5P A;  4YT5 A;  2FFH A;  3EJN A;  4QI0 A;  5KYX A;  2QY9 A;  1CGN A;  4IB4 A;  4DBQ A;  3TK0 A;  1JPN A;  4IRU A;  4EBB A;  4I1O B;  4AE4 A;  2XLV A;  2CYD A;  2HV7 A;  3FMS A;  3QZC A;  3GEE A;  2UUH A;  4U5G A;  3C8G B;  1ZHT A;  2MWQ A;  1TWH A;  5B1A C;  5BQH A;  3M4C A;  5JS5 A;  3F47 A;  4J7Y A;  1T9K A;  3W8I A;  4C7O A;  4OIO F;  2H8A A;  2NSF A;  5KYU A;  2HMZ A;  3SXM A;  1HMD A;  3NG1 A;  2P7V A;  5A6B D;  1U6H A;  4CDA A;  3RKO F;  2IXN A;  5EK0 A;  1E83 A;  3UR3 C;  3DE9 A;  2FAP B;  2JD3 A;  3GEH A;  3H2V A;  4MTF A;  1LIH A;  1D0Z A;  1LKX A;  5T1D B;  3DZA A;  2G62 A;  2IBF A;  4NCQ A;  1YDI A;  3U3B A;  4JZA A;  3I5Q A;  3S0X A;  2RD9 A;  5KYW A;  4KNW A;  4DVZ A;  4PK4 A;  4O79 A;  4H4K C;  2WL8 A;  1YLM A;  4QI2 A;  1Q0G A;  3FVY A;  3HNI A;  3LLI A;  2WVO A;  4U5D E;  3R7C A;  3TQO A;  4FAP B;  3LLK A;  4BJ6 C;  2LQG A;  5K0I A;  4OD5 A;  3M79 A;  1MND A;  1BZ4 A;  4ANJ A;  2F22 A;  2H7V C;  2HMQ A;  3TOM A;  3LUT B;  3RQG A;  1G8X A;  4CBE A;  4EKW A;  3N0T A;  4G0H A;  2A69 F;  2D4U A;  2HUJ A;  1NLX A;  1LPE A;  3FAP B;  5EHH A;  4EHP A;  1Z63 A;  3LEV A;  1FFH A;  4DOZ A;  2R7T A;  5F5F A;  1RXQ A;  1E84 A;  2XS8 A;  2XM4 A;  2IOQ A;  2NPU A;  1C17 M;  3K66 A;  1HW1 A;  3U2M A;  4R32 A;  1MMA A;  5KYY A;  2XLE A;  4XWJ A;  1Z6A A;  2PX0 A;  3LEO A;  1ZU5 A;  4K0D A;  2J45 A;  4MVU A;  1YYJ A;  3AG2 C;  4BG0 A;  1J8Y F;  2VAS A;  4JCH A;  5DQZ A;  1I4Z A;  1J8M F;  3LNM B;  1L3P A;  1ZU4 A;  3ATP A;  4ZLC A;  5L0I A;  1ORY A;  4XLP F;  2L81 A;  4XPW A;  3S90 A;  4JE9 A;  4LLE A;  1PD1 A;  1CPQ A;  3DWW A;  2KC3 A;  3AJM A;  4PFP A;  4J30 B;  2Q00 A;  4BJ6 A;  1LI5 A;  3FOO A;  1NG1 A;  3DJN B;  3QTH A;  2P1A A;  2UUI A;  4D4N A;  1QVX A;  1OW6 A;  1F1M A;  4XPX A;  1ZHW A;  3LAY A;  3W4Y A;  3QMK A;  1VB5 A;  1TR2 A;  2A0B A;  1XZP A;  3C8G D;  4U5E E;  2Z15 A;  3MX3 A;  5FCL A;  4G7O F;  3GAN A;  3T4R A;  3IEE A;  3NYL A;  2X51 A;  3CZ6 A;  3R2P A;  4EUK B;  2R7U A;  2ASR A;  2MHR A;  2KSF A;  1GM5 A;  3NDB B;  3HLZ A;  4YJW A;  4EBJ A;  2YZS A;  2MYS A;  3G4X A;  3AG1 C;  2IYL D;  1LVK A;  2Q4F A;  2AU5 A;  1DOW A;  3NKE A;  2W4B A;  4W8K A;  1M2O A;  3WHN A;  2XS1 A;  4JC7 A;  3RH3 A;  3LES A;  5BQG A;  2G3V A;  5BQI A;  1HY5 A;  2VB6 A;  3Q7L A;  2JX0 A;  5GPG B;  4KNV A;  2GWW A;  4U9D A;  3V5Y A;  1MMG A;  1VYK A;  3JYH A;  1D1A A;  3KPH A;  4AX2 A;  2P6V A;  4JKV A;  4C3E A;  4OIP F;  3JZ0 A;  1APC A;  3GM1 A;  2QE9 A;  3IQ5 A;  3U0C A;  3IPM O;  1OCZ C;  3M1C B;  3C8Z A;  3UMH A;  4MW3 A;  3T6B A;  4PR9 A;  2KNH A;  5COG A;  1A7D A;  5AC4 A;  5E3C A;  3UMI A;  2CDQ A;  2KQ9 A;  4N06 A;  4NC3 A;  1RMV A;  2YEV A;  3K1I C;  3O39 A;  3JSE O;  1PV3 A;  2WZG A;  2CGE A;  4KC9 A;  2XLW A;  1FFT C;  4JCZ A;  4I3M A;  3L34 A;  3O6X A;  2L9J A;  4ULW A;  4CSA C;  1EA8 A;  1OCC C;  3BEH A;  4EBK A;  1T6U A;  1T5O A;  4XTK A;  1RKE B;  5KYN A;  2YKZ A;  1B68 A;  1LE4 A;  3EG9 A;  2DGJ A;  1H7I A;  3J06 A;  3VM6 A;  2YHS A;  3EHN A;  3AQB A;  4Z9H A;  1LE2 A;  2YLG A;  4YWQ A;  3WG7 C;  1C03 A;  1ZHY A;  4BEJ A;  2Y3D A;  2LIG A;  4XEK A;  5DLJ A;  5KYX B;  3W2V A;  2CCY A;  5L0J A;  2OOC A;  1QKR A;  3RQE A;  4CDV A;  2ZXW C;  3ASO C;  3VRC A;  4AL1 A;  4H54 A;  4AE4 B;  1KTM A;  3FAJ A;  1NSG B;  3M4B A;  4YL1 A;  1MNE A;  1OXK A;  2HSQ A;  2JPU A;  3DKA A;  3JRT A;  5L3Q A;  3JCU Q;  1YAU O;  4C7O B;  4O7G A;  1FMV A;  3UNG C;  5KYU B;  5HV9 A;  2OG2 A;  3X2Q C;  4BEM J;  1BR1 A;  3NKD A;  1CGO A;  1YA7 O;  3ITF A;  5JSL A;  1TWC A;  5A6A A;  2AWY A;  3JSZ A;  4G7H F;  2M4E A;  4JTC B;  2C04 A;  3ZDL A;  4CSA A;  3SXK A;  2XLH A;  2R7O A;  2CNW D;  4CS7 A;  2OU6 A;  1K40 A;  2L6G A;  1OW8 A;  2XLO A;  4JEA A;  3ZQV A;  4E7S A;  5KYW B;  3B0V C;  1EI7 A;  3EFO A;  1C02 A;  3E9V A;  3EZI A;  3OA1 A;  2LSE A;  3DJU B;  4FES A;  5E33 A;  3ZG1 A;  3VYW A;  1S05 A;  2OJQ A;  1BDJ B;  3GWL A;  2Q7R A;  1BR4 A;  2R7Q A;  3B29 A;  1WOL A;  2A68 F;  3MBG A;  2EPL X;  5T3W A;  3DI5 A;  3GEI A;  2PNO A;  2YLD A;  5E3A A;  1Q0K A;  4K7B A;  4YT4 A;  4NTA A;  3K33 A;  4N4W A;  1O87 A;  2BE5 F;  3EHM A;  3HNL A;  3IQC A;  4IAR A;  1SR2 A;  3HTK C;  3U9J A;  1IZM A;  4E17 A;  1HE1 A;  4E0I A;  1UG7 A;  2J9U A;  1S7Z A;  2LFF A;  2WVQ A;  3GOD A;  4E0H A;  2GFH A;  4CX9 A;  4XEF A;  2HS5 A;  3EH2 A;  5JP7 A;  3MFN A;  3T6G B;  2HKV A;  4O6M A;  3US6 A;  4D4X A;  4MND A;  5B3I A;  3MLG A;  1U89 A;  2HV6 A;  5KYY B;  1GS9 A;  1QSP A;  1KU2 A;  4WJ0 A;  1BBH A;  3LS1 A;  4RDA A;  4E18 A;  1D0X A;  2J7P D;  4JW1 A;  5L0G A;  4BJT A;  4LDK A;  3KYJ A;  2R9R B;  4W8P A;  3WOD F;  5JLI A;  1ZHZ A;  3F46 A;  3GOR A; 
#chains in the Genus database with same CATH homology
 4Z9I A;  4Z9J A;  3T9O A;  1VLS A;  1WAS A;  1JMW A;  2D4U A;  1WAT A;  4Z9H A;  2ASR A;  4H54 A;  3ATP A;  1VLT A;  1LIH A;  2LIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...