2ASRA

The three-dimensional structure of the aspartate receptor from escherichia coli
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
142
structure length
142
Chain Sequence
KSFVVSNQLREQQGELTSTWDLMLQTRINLSRSAVRMMMDSSNQQSNAKVELLDSARKTLAQAATHYKKFKSMAPLPEMVATSRNIDEKYKNYYTALTELIDYLDYGNTGAYFAQPTQGMQNAMGERFAQYALSSEKLYRDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE RECEPTOR
publication title The three-dimensional structure of the aspartate receptor from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chemotaxis
total genus 71
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 1994-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 2asrA00
1VLSA 3T9OA 4Z9HA 4Z9IA 4Z9JA 1WATA 1VLTA 1LIHA 2LIGA 1JMWA 2D4UA 3ATPA 4H54A 1WASA 2ASRA
chains in the Genus database with same CATH superfamily
4JCZA 4MVOA 4DBRA 3QZCA 4ONSA 2W9YA 4WGZA 4RBNA 3C62A 4CS9C 3AG3C 2DYRC 2IBFA 3E9VA 4RDAA 5COMA 2P0NA 3T9OA 2H7BA 3VF0A 5B3IA 4YK5A 1ST6A 3OEOA 2NSFA 2G3VA 3HNKA 4U5EE 3EFOB 3IPMO 5A6BA 3ZDLA 3FXHA 5L0HA 3S90A 4CSAC 4N6HA 3MBGA 3MYIA 4FAPB 2XLHA 3HNLA 1BR2A 4HFFB 2Y3DA 3ZTMA 1Q0FA 3WAQA 4GYTA 4MTOA 1Q0DA 4FESA 3EGDB 1FFHA 2MYSA 4PACA 2JPUA 1U6HA 2J9VA 3C8GD 3X2QC 1HW2A 2M64A 3GWNA 3TJ6A 4Q7CA 5DS5A 3AG1C 1JR8A 3TD7A 1MNDA 1TFKB 1BBHA 1YZAA 4FWVA 4IB4A 4ANJA 5DQZA 5L0FA 1E86A 5JSLA 3K33A 1M57C 3SYNA 3EHMA 3HJCA 2XRHA 3Q7LA 3I5PA 4JC7A 5T3TA 5DQTA 4ZLDA 2PX0A 4E7SA 3I5QA 2EPOA 4P9TA 2J9BA 2KC3A 1AEPA 1J8YF 4QI0A 2XM0A 3B9QA 1EQ1A 4WJ0A 1ZHWA 3LS1A 2HKVA 4MNDA 1J8MF 5JUAA 2G3KA 5L0IA 3EQLF 1M2OA 3RVYA 3NMIA 1T6UA 3DAGA 2KJGA 2ZXWC 2GDCA 3A11A 3DWWA 3LEOA 2CCYA 3GM1A 4I3MA 3Q7GA 4XTKA 2NUPB 5TJ5E 1WTYA 3DD7A 3SNHA 4G7HF 4A4AA 2CYDA 3W2WA 3IQ5A 4B6IA 4BG0A 2L6GA 3KPHA 5EK0A 3IQCA 5KYWA 1QKRA 4DRJB 5BUOA 4MVMA 4EBJA 1HMDA 2XL8A 4C3BA 1K05A 2P6VA 2Q00A 4U5GA 1V4AA 3HNIA 1APCA 2KNHA 2XLWA 3NKDA 4GEHA 3EGXB 3RW0A 3IHUA 1B68A 3L8IA 4CDVA 3M1CB 1QVXA 2YLIA 3KL4A 1JAFA 4JRZA 4YT5A 1HW1A 2UUHA 2ZXPA 3FMSA 5FZTA 3C7JA 4MVZA 5BQGA 2QE9A 1HMOA 2DI3A 3EPVA 3NDBB 4PJNA 4FX5A 3W8HA 5DS6A 2IOQA 3LS0A 2CNWA 3EG9B 2X51A 3H2UA 3ABLC 4IWBA 2WZGA 2R7OA 2RD9A 3K7DA 4KC9A 3A9CA 3ZTZA 5L0DA 3AQCA 4BJ5A 3GORA 5D91A 2YL7A 1LPEA 4YL3A 4CS7A 3BEHA 2EINC 1YARO 4JEAA 3DMDA 4RD9A 4MQ9F 2YZSA 3LESA 2OQMA 2WVOA 2OCCC 3AG2C 1OW7A 1QPUA 4KNVA 4MVRA 5KYWB 1M6TA 4WABA 4NY3A 3ABKC 1OXKA 4K7BA 2XLVA 1MMDA 2AU5A 4N6CA 4PFPA 1A7DA 4E17A 1WN0A 3JYHA 1E2XA 2HZ8A 3GWLA 3U8VA 1D1BA 3ZIBA 1OCRC 3R7CA 4J30B 1D1CA 2FGYA 3POVA 4LERA 2Y69C 2ZPAA 2QY9A 3K1IA 4G7ZF 3EH1A 1CGOA 2NPUA 2WZFA 2HMQA 3UMKA 2IYLD 2A69F 4BJ6A 3JT1A 1O5HA 2EIJC 4EHPA 3ASOC 1RMVA 4E7ZA 4K1OA 3F47A 4J32B 5DVWA 1FFTC 3JCUQ 4EUKB 3MYFA 1V74B 4JW1A 1R5ID 2KGOA 3DJUB 1DOVA 1M56C 5T1DB 3AG4C 4P6IC 2Q9BA 3ZC4A 5A6BD 2ICWG 1JPJA 4A2NB 3ABMC 2VCCA 1BZ4A 3NRHA 2YWAA 1NBBA 3QW0A 3U3BA 4DVZA 1PV3A 3G4ZA 2W4BA 1HE1A 2V3CC 3TJ5A 1LVKA 2RSEB 3LEVA 1WASA 3CSKA 2ASRA 3NYJA 1EA8A 3SXKA 1OR2A 2R7XA 1VLSA 2BC5A 4BJ6C 3TQOA 4CS8A 2L9JA 5AGFA 4OIQF 4JCHA 3B0UX 2HUJA 1E85A 3PDMP 2BL2A 3GEEA 2EILC 1WWPA 5B1AC 2IM8A 2L6HA 2QTVA 3BRJA 1YDIA 2R03A 1G4US 1NFNA 2LFDA 5E3CA 1H7IA 1PD1A 5B3SC 4YJWA 3GEIA 2WVNA 2NUPA 1LS1A 2HS5A 1I5NA 4YWQA 1LE4A 1OCCC 3K6BA 4CDAA 2OJQA 3E70C 4MVSA 4Z9JA 3GM3A 1CGME 2PX3A 2P61A 1UG7A 5JP7A 1V55C 4GQHA 2DGJA 4XPXA 5L0CA 5CIVA 2H8AA 2WZLA 3H65A 1TWAA 3NMJA 1RXQA 3EGXA 3FAJA 2J0XA 3KYJA 1T9KA 4D4NA 3M4BA 1SMYF 2Q3TA 2AVKA 4NTFA 3UR3C 1FAPB 1I4ZA 3NG1A 4K0DA 1L3PA 2R7TA 1PCXA 4JJGA 5JVEA 1C03A 3RQGA 1ZW3A 2NG1A 3S0XA 1KU2A 3NYLA 4IJJA 4O6NA 4G7OF 1U0BB 4JURI 1E84A 5L3QA 1T5OA 3AQBA 4PFOA 4J7YA 4YT4A 2LSEA 3EG9A 1JOGA 3C18A 4MW3A 1Z7Qc 3S29A 2LCHA 4R32A 4ULVA 2EPKX 2GAQA 2A6HF 3FVYA 3KH2A 2OEXA 4I1OB 4OD5A 3Q6MA 3SP1A 1NZEA 1QQ3A 2I15A 2LIGA 2R9RB 2R7SA 2CNWD 2R7QA 1CGNA 3I4UA 3RQEA 3EZHA 3SXZA 3RFYA 3U8PA 1Z3IX 1TFOB 2KSFA 1LIHA 1MQVA 1Z23A 3DJNB 3SEOA 3L34A 1XZPA 3LUTB 3U5SA 3WG7C 2L6FA 1D1AA 1VOMA 2ZXRA 4ULWA 3IQTA 2WVQA 5IY5C 3R2PA 4CJOA 1ORJA 3AGUA 1Y4CA 3VAYA 2NSGA 1JPNA 2XM4A 3DM9B 3JSZA 1TKNA 2W4MA 3NYMA 2GWWA 3ZG1A 2HJMA 1R4TA 3CAXA 1QLEC 4E0HA 4LDQA 3JTLO 3M79A 2R02A 1BDJB 1G5ZA 2AWYA 4XPWA 4Z9IA 3EH2A 1IZMA 2QNLA 3ASNC 3DAFA 4JVSA 3UNGC 5L0GA 3L8JA 1A0BA 5A6JA 3DXJF 1CPRA 4YN0B 4D4XA 3W2VA 4U5BE 1NSGB 3VRCA 1D0ZA 2KQ9A 2J7PD 3JYYA 4PJMA 1NG1A 5D92A 1OQCA 4O6MA 4CS9A 2LQGA 1WATA 4CS8C 1Q0GA 1V54C 1OKKD 4G78A 4BEMJ 1GM5A 3C8ZA 4I1MA 4XLNF 3TULA 2YLDA 4M63A 2L81A 2WL8A 3EJNA 1I4YA 3JRTA 4XWJA 4MVUA 4U9DA 4YL0A 1EI7A 1FMVA 2YLGA 3RQFA 3NMKA 2QLAA 2YL3A 4NCQA 3O55A 4CSAA 4JTCB 4XEVA 2G62A 3SZRA 2ZD9A 5COGA 2IXPA 1YVIA 3B71A 2W45A 4O79A 3U9JA 4JJFA 1JRAA 3L0IA 2R7RA 1TWHA 1O3UA 3RKOF 2DYSC 4PR9A 1OW6A 2OOCA 4JE9A 1N1CA 2C04A 2L7AA 2UUIA 3FHDA 2XS1A 3JZ0A 3K66A 4P9FA 4X0RA 1ZHTA 2Y3BA 1VMAA 1LM3B 1WGWA 4OINF 5A6KA 3MX3A 4C3EA 3O10A 3OWTA 2ETSA 3N2ZB 3DI5A 2NUTB 2YEVA 3DZAA 2B0JA 4JZAA 2EPMX 2J46A 2VASA 4NTAA 3NKEA 2XLDA 3AOUA 1G4WR 4HEAJ 1MNEA 4U5HA 4U5DE 5A6AA 5A69A 2XL6A 4JEBA 4DRHB 3ZQYA 3G50A 3U0CA 4CBEA 2BE5F 4PJLA 1GQAA 4DOZA 3FAPB 2B0HA 2YQYA 4IARA 1Y6DA 3KKBA 1G8XA 2E87A 2YL1A 4G0HA 4N4WA 2A1DD 4OD4A 2R7UA 2Y39A 3K1HA 3S9OA 1BR4A 4AL0A 2VH3A 4IGGA 2YKZA 2YRFA 3PHF2 3ZWIA 4ER9A 4CIHA 3HTKC 4O7GA 1C02A 5AC5A 1YYXA 3QVYA 3V7OA 2HMZA 3PCVA 2R05A 2PFDA 3LNRA 3O6XA 3S27A 3VM6A 3QVZA 4UDVA 5AC4A 5K0IA 4MW8A 3MLGA 3B29A 1S05A 3JRMO 4LDRA 2EIMC 5JS5A 2LD6A 5BQHA 1K04A 2C03A 3IEEA 1YLMA 1XZQA 1Q0MA 1A7VA 4F4BA 1M2VA 4EBKA 1Q0KA 2OU6A 2VCBA 3RVZA 4U9EA 3X1OA 5FCLA 1NFOA 4XEFA 2HFIA 3TOMA 5JT4A 1ZVZA 2HSQA 1K40A 1YJGA 3DM5A 5L3VA 4C7OA 3DE8A 4BJ5C 5CI9A 2J0WA 3CEXA 3V5YA 2QUPA 4AL1A 2AP3A 2TMVP 2A6EF 3B0PA 2AWCA 4MTGA 4U5CE 5EGYA 2XXAB 1RKEA 4LLEA 4YT2A 4U5FE 1ZYRF 1OCOC 4CIPA 2O9XA 1FR0A 4NQFA 5E2QA 1H9TA 1LS4A 4ZLCA 4E18A 1LI7A 1RJ9A 3F46A 2VCAA 3CZ6A 4W8PA 2R7VA 5KYUB 1WOLA 2FFHA 3RH3A 4OIRF 3DE9A 1UFBA 3UGOA 2P1AA 3LAYA 1QSPA 1H9GA 3U2LA 5F5FA 1D0XA 2IXOA 1ZZPA 4I44A 2OJED 4EBBA 5BQIA 1JMWA 2D4UA 3VYWA 4OIPF 3U9MA 3T6GB 1VB5A 5CI8A 3TK0A 3QTHA 3UGPA 3MFNA 2EPLX 3Q6NA 1M2VB 4PJJA 4AX2A 3FDQA 2J8WA 1QZXA 1GGQA 3DKAA 3AJMA 1D0YA 5KYXA 3K1IC 2CW0F 3ECSA 1NU7D 1LKXA 4XQ1A 4BPMA 4C7OB 1ZHYA 1NU9C 2Q9CA 4IRUA 1AVOB 1GS9A 1T6QA 4QDLA 1W2WA 2M4EA 2V26A 2XSEA 1H6GA 3IQ6A 1S7ZA 1EKYA 2LK4A 3GODA 3CQZA 2KYHA 2HSBA 1RCPA 4XPYA 3RIPA 2GFHA 3V5ZA 5DS4A 5EHHA 2Y3HA 4HFKB 5HV9A 3M15A 5T3WA 1CPQA 1TWCA 3T6BA 1RKEB 1T01A 4MS2A 4JTAB 1VYKA 3C8GA 4XLPF 1TQGA 1T6IA 1A41A 2PBEA 3J06A 2DB4A 2NUTA 1VK5A 1BR1A 1RJ9B 3LJBA 4CDYA 2KK1A 1ZHZA 4BEJA 2VC9A 3ZQVA 3EZIA 1KNYA 4H4KC 1MMNA 2X0CA 2Q4FA 3QW1A 3U3FA 2WB7A 1TR2A 3HKKA 3JSEO 1RKCA 3RF3A 3WHNA 5JLIA 3B0VC 1HE9A 5KYYA 1MMGA 5F5HA 4MTFA 1PD0A 3LNMB 3LLIA 4N06A 4XEKA 2EPNA 5F28E 2J9WA 4DJ9A 2LP4A 3W8IA 4NC3A 5KYXB 4DVYP 2VB6A 1U89A 4C3DA 2Z15A 1YZCA 1O87A 4DBQA 1YA7O 3PMRA 3ITFA 4IAQA 4KNWA 3UMHA 3HLZA 1Z6AA 1KTMA 3SXYA 2OKUA 1C17M 2EIKC 1LE2A 4KI2A 1ZHXA 1ZU4A 3U2MA 3S84A 2YL0A 3OA1A 4BJ1A 1ZU5A 4J7TA 4EKWA 1YAUO 4JTDB 2YHSA 3C8GB 4LLCA 3V5XA 1SZIA 2A0UA 3N24A 2JD3A 1FNTc 2MWQA 1YA9A 1OR3A 2JX0A 2ZXOA 3SXMA 3T4RA 2PF4E 4O6YA 1Z5ZA 3KMIA 2Y3GA 1VTMP 4KBLA 1F1MA 3M4CA 5L0JA 4DRIB 4QI2A 2P7VA 1ORYA 4AK9A 3TOLA 3W4YA 2MHRA 5COFA 4CJGA 1SR2A 2XS8A 2Q9AA 3O39A 4JIOA 3RYLA 4AE4A 5HSWA 2CDQA 4OIOF 1ORSC 5KYYB 2IXNA 1OCZC 3S28A 4Q4ZF 1HY5A 1YYJA 4W8KA 1ZW2A 2R25A 5GPGB 3HNJA 1A7EA 2J7PA 1LI5A 3FOOA 4PK4A 3ATPA 4JKVA 1MMAA 1Z63A 1DOWA 2OEVA 3H2VA 3ZSUA 3FOPA 2HV7A 2XXAA 2D5RB 1OKKA 3GM2A 4DXWA 1XWJA 2IXMA 3GEHA 1VYIA 4L6RA 2A68F 2CGEA 3EFOA 3T6JA 2KW3C 1IW7F 4NTBA 3UMIA 4CX9A 4LDKA 5B1BC 4EIYA 3L1MA 2HJ3A 1FMWA 256BA 3LLKA 4HE8D 3US6A 1TWGA 2FAPB 2I8BA 2H7OA 3GANA 3N0TA 1FTSA 5KYUA 2XLEA 3QMKA 4LACB 5E33A 4E0IA 4EWCA 3G4XA 3WODF 3EHNA 2PP4A 3EGDA 1SF8A 3C63A 4MVQA 2YVKA 4WGYA 4YL1A 3ZVRA 1L7CA 2H7VC 5DLJA 5KYNA 1E83A 2XL4A 4YT8A 4Q5SF 1VLTA 2OG2A 5E3AA 3KYIA 2J9UA 1OXBA 5JRAA 4IAOA 2HV6A 2XLOA 3AGTA 2GA0A 1OW8A 1SYQA 2A0BA 2Q7RA 4Z9HA 2R7WA 2F22A 4BJTA 2J45A 2LFFA 1AUEA 2XLMA 4H54A 2PNOA 4AE4B 1NLXA
chains in the Genus database with same CATH topology
1VLSA 3T9OA 4Z9HA 4Z9IA 4Z9JA 1WATA 1VLTA 1LIHA 2LIGA 1JMWA 2D4UA 3ATPA 4H54A 1WASA 2ASRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLS A;  3T9O A;  4Z9H A;  4Z9I A;  4Z9J A;  1WAT A;  1VLT A;  1LIH A;  2LIG A;  1JMW A;  2D4U A;  3ATP A;  4H54 A;  1WAS A;  2ASR A; 
#chains in the Genus database with same CATH topology
 4JCZ A;  4MVO A;  4DBR A;  3QZC A;  4ONS A;  2W9Y A;  4WGZ A;  4RBN A;  3C62 A;  4CS9 C;  3AG3 C;  2DYR C;  2IBF A;  3E9V A;  4RDA A;  5COM A;  2P0N A;  3T9O A;  2H7B A;  3VF0 A;  5B3I A;  4YK5 A;  1ST6 A;  3OEO A;  2NSF A;  2G3V A;  3HNK A;  4U5E E;  3EFO B;  3IPM O;  5A6B A;  3ZDL A;  3FXH A;  5L0H A;  3S90 A;  4CSA C;  4N6H A;  3MBG A;  3MYI A;  4FAP B;  2XLH A;  3HNL A;  1BR2 A;  4HFF B;  2Y3D A;  3ZTM A;  1Q0F A;  3WAQ A;  4GYT A;  4MTO A;  1Q0D A;  4FES A;  3EGD B;  1FFH A;  2MYS A;  4PAC A;  2JPU A;  1U6H A;  2J9V A;  3C8G D;  3X2Q C;  1HW2 A;  2M64 A;  3GWN A;  3TJ6 A;  4Q7C A;  5DS5 A;  3AG1 C;  1JR8 A;  3TD7 A;  1MND A;  1TFK B;  1BBH A;  1YZA A;  4FWV A;  4IB4 A;  4ANJ A;  5DQZ A;  5L0F A;  1E86 A;  5JSL A;  3K33 A;  1M57 C;  3SYN A;  3EHM A;  3HJC A;  2XRH A;  3Q7L A;  3I5P A;  4JC7 A;  5T3T A;  5DQT A;  4ZLD A;  2PX0 A;  4E7S A;  3I5Q A;  2EPO A;  4P9T A;  2J9B A;  2KC3 A;  1AEP A;  1J8Y F;  4QI0 A;  2XM0 A;  3B9Q A;  1EQ1 A;  4WJ0 A;  1ZHW A;  3LS1 A;  2HKV A;  4MND A;  1J8M F;  5JUA A;  2G3K A;  5L0I A;  3EQL F;  1M2O A;  3RVY A;  3NMI A;  1T6U A;  3DAG A;  2KJG A;  2ZXW C;  2GDC A;  3A11 A;  3DWW A;  3LEO A;  2CCY A;  3GM1 A;  4I3M A;  3Q7G A;  4XTK A;  2NUP B;  5TJ5 E;  1WTY A;  3DD7 A;  3SNH A;  4G7H F;  4A4A A;  2CYD A;  3W2W A;  3IQ5 A;  4B6I A;  4BG0 A;  2L6G A;  3KPH A;  5EK0 A;  3IQC A;  5KYW A;  1QKR A;  4DRJ B;  5BUO A;  4MVM A;  4EBJ A;  1HMD A;  2XL8 A;  4C3B A;  1K05 A;  2P6V A;  2Q00 A;  4U5G A;  1V4A A;  3HNI A;  1APC A;  2KNH A;  2XLW A;  3NKD A;  4GEH A;  3EGX B;  3RW0 A;  3IHU A;  1B68 A;  3L8I A;  4CDV A;  3M1C B;  1QVX A;  2YLI A;  3KL4 A;  1JAF A;  4JRZ A;  4YT5 A;  1HW1 A;  2UUH A;  2ZXP A;  3FMS A;  5FZT A;  3C7J A;  4MVZ A;  5BQG A;  2QE9 A;  1HMO A;  2DI3 A;  3EPV A;  3NDB B;  4PJN A;  4FX5 A;  3W8H A;  5DS6 A;  2IOQ A;  3LS0 A;  2CNW A;  3EG9 B;  2X51 A;  3H2U A;  3ABL C;  4IWB A;  2WZG A;  2R7O A;  2RD9 A;  3K7D A;  4KC9 A;  3A9C A;  3ZTZ A;  5L0D A;  3AQC A;  4BJ5 A;  3GOR A;  5D91 A;  2YL7 A;  1LPE A;  4YL3 A;  4CS7 A;  3BEH A;  2EIN C;  1YAR O;  4JEA A;  3DMD A;  4RD9 A;  4MQ9 F;  2YZS A;  3LES A;  2OQM A;  2WVO A;  2OCC C;  3AG2 C;  1OW7 A;  1QPU A;  4KNV A;  4MVR A;  5KYW B;  1M6T A;  4WAB A;  4NY3 A;  3ABK C;  1OXK A;  4K7B A;  2XLV A;  1MMD A;  2AU5 A;  4N6C A;  4PFP A;  1A7D A;  4E17 A;  1WN0 A;  3JYH A;  1E2X A;  2HZ8 A;  3GWL A;  3U8V A;  1D1B A;  3ZIB A;  1OCR C;  3R7C A;  4J30 B;  1D1C A;  2FGY A;  3POV A;  4LER A;  2Y69 C;  2ZPA A;  2QY9 A;  3K1I A;  4G7Z F;  3EH1 A;  1CGO A;  2NPU A;  2WZF A;  2HMQ A;  3UMK A;  2IYL D;  2A69 F;  4BJ6 A;  3JT1 A;  1O5H A;  2EIJ C;  4EHP A;  3ASO C;  1RMV A;  4E7Z A;  4K1O A;  3F47 A;  4J32 B;  5DVW A;  1FFT C;  3JCU Q;  4EUK B;  3MYF A;  1V74 B;  4JW1 A;  1R5I D;  2KGO A;  3DJU B;  1DOV A;  1M56 C;  5T1D B;  3AG4 C;  4P6I C;  2Q9B A;  3ZC4 A;  5A6B D;  2ICW G;  1JPJ A;  4A2N B;  3ABM C;  2VCC A;  1BZ4 A;  3NRH A;  2YWA A;  1NBB A;  3QW0 A;  3U3B A;  4DVZ A;  1PV3 A;  3G4Z A;  2W4B A;  1HE1 A;  2V3C C;  3TJ5 A;  1LVK A;  2RSE B;  3LEV A;  1WAS A;  3CSK A;  2ASR A;  3NYJ A;  1EA8 A;  3SXK A;  1OR2 A;  2R7X A;  1VLS A;  2BC5 A;  4BJ6 C;  3TQO A;  4CS8 A;  2L9J A;  5AGF A;  4OIQ F;  4JCH A;  3B0U X;  2HUJ A;  1E85 A;  3PDM P;  2BL2 A;  3GEE A;  2EIL C;  1WWP A;  5B1A C;  2IM8 A;  2L6H A;  2QTV A;  3BRJ A;  1YDI A;  2R03 A;  1G4U S;  1NFN A;  2LFD A;  5E3C A;  1H7I A;  1PD1 A;  5B3S C;  4YJW A;  3GEI A;  2WVN A;  2NUP A;  1LS1 A;  2HS5 A;  1I5N A;  4YWQ A;  1LE4 A;  1OCC C;  3K6B A;  4CDA A;  2OJQ A;  3E70 C;  4MVS A;  4Z9J A;  3GM3 A;  1CGM E;  2PX3 A;  2P61 A;  1UG7 A;  5JP7 A;  1V55 C;  4GQH A;  2DGJ A;  4XPX A;  5L0C A;  5CIV A;  2H8A A;  2WZL A;  3H65 A;  1TWA A;  3NMJ A;  1RXQ A;  3EGX A;  3FAJ A;  2J0X A;  3KYJ A;  1T9K A;  4D4N A;  3M4B A;  1SMY F;  2Q3T A;  2AVK A;  4NTF A;  3UR3 C;  1FAP B;  1I4Z A;  3NG1 A;  4K0D A;  1L3P A;  2R7T A;  1PCX A;  4JJG A;  5JVE A;  1C03 A;  3RQG A;  1ZW3 A;  2NG1 A;  3S0X A;  1KU2 A;  3NYL A;  4IJJ A;  4O6N A;  4G7O F;  1U0B B;  4JUR I;  1E84 A;  5L3Q A;  1T5O A;  3AQB A;  4PFO A;  4J7Y A;  4YT4 A;  2LSE A;  3EG9 A;  1JOG A;  3C18 A;  4MW3 A;  1Z7Q c;  3S29 A;  2LCH A;  4R32 A;  4ULV A;  2EPK X;  2GAQ A;  2A6H F;  3FVY A;  3KH2 A;  2OEX A;  4I1O B;  4OD5 A;  3Q6M A;  3SP1 A;  1NZE A;  1QQ3 A;  2I15 A;  2LIG A;  2R9R B;  2R7S A;  2CNW D;  2R7Q A;  1CGN A;  3I4U A;  3RQE A;  3EZH A;  3SXZ A;  3RFY A;  3U8P A;  1Z3I X;  1TFO B;  2KSF A;  1LIH A;  1MQV A;  1Z23 A;  3DJN B;  3SEO A;  3L34 A;  1XZP A;  3LUT B;  3U5S A;  3WG7 C;  2L6F A;  1D1A A;  1VOM A;  2ZXR A;  4ULW A;  3IQT A;  2WVQ A;  5IY5 C;  3R2P A;  4CJO A;  1ORJ A;  3AGU A;  1Y4C A;  3VAY A;  2NSG A;  1JPN A;  2XM4 A;  3DM9 B;  3JSZ A;  1TKN A;  2W4M A;  3NYM A;  2GWW A;  3ZG1 A;  2HJM A;  1R4T A;  3CAX A;  1QLE C;  4E0H A;  4LDQ A;  3JTL O;  3M79 A;  2R02 A;  1BDJ B;  1G5Z A;  2AWY A;  4XPW A;  4Z9I A;  3EH2 A;  1IZM A;  2QNL A;  3ASN C;  3DAF A;  4JVS A;  3UNG C;  5L0G A;  3L8J A;  1A0B A;  5A6J A;  3DXJ F;  1CPR A;  4YN0 B;  4D4X A;  3W2V A;  4U5B E;  1NSG B;  3VRC A;  1D0Z A;  2KQ9 A;  2J7P D;  3JYY A;  4PJM A;  1NG1 A;  5D92 A;  1OQC A;  4O6M A;  4CS9 A;  2LQG A;  1WAT A;  4CS8 C;  1Q0G A;  1V54 C;  1OKK D;  4G78 A;  4BEM J;  1GM5 A;  3C8Z A;  4I1M A;  4XLN F;  3TUL A;  2YLD A;  4M63 A;  2L81 A;  2WL8 A;  3EJN A;  1I4Y A;  3JRT A;  4XWJ A;  4MVU A;  4U9D A;  4YL0 A;  1EI7 A;  1FMV A;  2YLG A;  3RQF A;  3NMK A;  2QLA A;  2YL3 A;  4NCQ A;  3O55 A;  4CSA A;  4JTC B;  4XEV A;  2G62 A;  3SZR A;  2ZD9 A;  5COG A;  2IXP A;  1YVI A;  3B71 A;  2W45 A;  4O79 A;  3U9J A;  4JJF A;  1JRA A;  3L0I A;  2R7R A;  1TWH A;  1O3U A;  3RKO F;  2DYS C;  4PR9 A;  1OW6 A;  2OOC A;  4JE9 A;  1N1C A;  2C04 A;  2L7A A;  2UUI A;  3FHD A;  2XS1 A;  3JZ0 A;  3K66 A;  4P9F A;  4X0R A;  1ZHT A;  2Y3B A;  1VMA A;  1LM3 B;  1WGW A;  4OIN F;  5A6K A;  3MX3 A;  4C3E A;  3O10 A;  3OWT A;  2ETS A;  3N2Z B;  3DI5 A;  2NUT B;  2YEV A;  3DZA A;  2B0J A;  4JZA A;  2EPM X;  2J46 A;  2VAS A;  4NTA A;  3NKE A;  2XLD A;  3AOU A;  1G4W R;  4HEA J;  1MNE A;  4U5H A;  4U5D E;  5A6A A;  5A69 A;  2XL6 A;  4JEB A;  4DRH B;  3ZQY A;  3G50 A;  3U0C A;  4CBE A;  2BE5 F;  4PJL A;  1GQA A;  4DOZ A;  3FAP B;  2B0H A;  2YQY A;  4IAR A;  1Y6D A;  3KKB A;  1G8X A;  2E87 A;  2YL1 A;  4G0H A;  4N4W A;  2A1D D;  4OD4 A;  2R7U A;  2Y39 A;  3K1H A;  3S9O A;  1BR4 A;  4AL0 A;  2VH3 A;  4IGG A;  2YKZ A;  2YRF A;  3PHF 2;  3ZWI A;  4ER9 A;  4CIH A;  3HTK C;  4O7G A;  1C02 A;  5AC5 A;  1YYX A;  3QVY A;  3V7O A;  2HMZ A;  3PCV A;  2R05 A;  2PFD A;  3LNR A;  3O6X A;  3S27 A;  3VM6 A;  3QVZ A;  4UDV A;  5AC4 A;  5K0I A;  4MW8 A;  3MLG A;  3B29 A;  1S05 A;  3JRM O;  4LDR A;  2EIM C;  5JS5 A;  2LD6 A;  5BQH A;  1K04 A;  2C03 A;  3IEE A;  1YLM A;  1XZQ A;  1Q0M A;  1A7V A;  4F4B A;  1M2V A;  4EBK A;  1Q0K A;  2OU6 A;  2VCB A;  3RVZ A;  4U9E A;  3X1O A;  5FCL A;  1NFO A;  4XEF A;  2HFI A;  3TOM A;  5JT4 A;  1ZVZ A;  2HSQ A;  1K40 A;  1YJG A;  3DM5 A;  5L3V A;  4C7O A;  3DE8 A;  4BJ5 C;  5CI9 A;  2J0W A;  3CEX A;  3V5Y A;  2QUP A;  4AL1 A;  2AP3 A;  2TMV P;  2A6E F;  3B0P A;  2AWC A;  4MTG A;  4U5C E;  5EGY A;  2XXA B;  1RKE A;  4LLE A;  4YT2 A;  4U5F E;  1ZYR F;  1OCO C;  4CIP A;  2O9X A;  1FR0 A;  4NQF A;  5E2Q A;  1H9T A;  1LS4 A;  4ZLC A;  4E18 A;  1LI7 A;  1RJ9 A;  3F46 A;  2VCA A;  3CZ6 A;  4W8P A;  2R7V A;  5KYU B;  1WOL A;  2FFH A;  3RH3 A;  4OIR F;  3DE9 A;  1UFB A;  3UGO A;  2P1A A;  3LAY A;  1QSP A;  1H9G A;  3U2L A;  5F5F A;  1D0X A;  2IXO A;  1ZZP A;  4I44 A;  2OJE D;  4EBB A;  5BQI A;  1JMW A;  2D4U A;  3VYW A;  4OIP F;  3U9M A;  3T6G B;  1VB5 A;  5CI8 A;  3TK0 A;  3QTH A;  3UGP A;  3MFN A;  2EPL X;  3Q6N A;  1M2V B;  4PJJ A;  4AX2 A;  3FDQ A;  2J8W A;  1QZX A;  1GGQ A;  3DKA A;  3AJM A;  1D0Y A;  5KYX A;  3K1I C;  2CW0 F;  3ECS A;  1NU7 D;  1LKX A;  4XQ1 A;  4BPM A;  4C7O B;  1ZHY A;  1NU9 C;  2Q9C A;  4IRU A;  1AVO B;  1GS9 A;  1T6Q A;  4QDL A;  1W2W A;  2M4E A;  2V26 A;  2XSE A;  1H6G A;  3IQ6 A;  1S7Z A;  1EKY A;  2LK4 A;  3GOD A;  3CQZ A;  2KYH A;  2HSB A;  1RCP A;  4XPY A;  3RIP A;  2GFH A;  3V5Z A;  5DS4 A;  5EHH A;  2Y3H A;  4HFK B;  5HV9 A;  3M15 A;  5T3W A;  1CPQ A;  1TWC A;  3T6B A;  1RKE B;  1T01 A;  4MS2 A;  4JTA B;  1VYK A;  3C8G A;  4XLP F;  1TQG A;  1T6I A;  1A41 A;  2PBE A;  3J06 A;  2DB4 A;  2NUT A;  1VK5 A;  1BR1 A;  1RJ9 B;  3LJB A;  4CDY A;  2KK1 A;  1ZHZ A;  4BEJ A;  2VC9 A;  3ZQV A;  3EZI A;  1KNY A;  4H4K C;  1MMN A;  2X0C A;  2Q4F A;  3QW1 A;  3U3F A;  2WB7 A;  1TR2 A;  3HKK A;  3JSE O;  1RKC A;  3RF3 A;  3WHN A;  5JLI A;  3B0V C;  1HE9 A;  5KYY A;  1MMG A;  5F5H A;  4MTF A;  1PD0 A;  3LNM B;  3LLI A;  4N06 A;  4XEK A;  2EPN A;  5F28 E;  2J9W A;  4DJ9 A;  2LP4 A;  3W8I A;  4NC3 A;  5KYX B;  4DVY P;  2VB6 A;  1U89 A;  4C3D A;  2Z15 A;  1YZC A;  1O87 A;  4DBQ A;  1YA7 O;  3PMR A;  3ITF A;  4IAQ A;  4KNW A;  3UMH A;  3HLZ A;  1Z6A A;  1KTM A;  3SXY A;  2OKU A;  1C17 M;  2EIK C;  1LE2 A;  4KI2 A;  1ZHX A;  1ZU4 A;  3U2M A;  3S84 A;  2YL0 A;  3OA1 A;  4BJ1 A;  1ZU5 A;  4J7T A;  4EKW A;  1YAU O;  4JTD B;  2YHS A;  3C8G B;  4LLC A;  3V5X A;  1SZI A;  2A0U A;  3N24 A;  2JD3 A;  1FNT c;  2MWQ A;  1YA9 A;  1OR3 A;  2JX0 A;  2ZXO A;  3SXM A;  3T4R A;  2PF4 E;  4O6Y A;  1Z5Z A;  3KMI A;  2Y3G A;  1VTM P;  4KBL A;  1F1M A;  3M4C A;  5L0J A;  4DRI B;  4QI2 A;  2P7V A;  1ORY A;  4AK9 A;  3TOL A;  3W4Y A;  2MHR A;  5COF A;  4CJG A;  1SR2 A;  2XS8 A;  2Q9A A;  3O39 A;  4JIO A;  3RYL A;  4AE4 A;  5HSW A;  2CDQ A;  4OIO F;  1ORS C;  5KYY B;  2IXN A;  1OCZ C;  3S28 A;  4Q4Z F;  1HY5 A;  1YYJ A;  4W8K A;  1ZW2 A;  2R25 A;  5GPG B;  3HNJ A;  1A7E A;  2J7P A;  1LI5 A;  3FOO A;  4PK4 A;  3ATP A;  4JKV A;  1MMA A;  1Z63 A;  1DOW A;  2OEV A;  3H2V A;  3ZSU A;  3FOP A;  2HV7 A;  2XXA A;  2D5R B;  1OKK A;  3GM2 A;  4DXW A;  1XWJ A;  2IXM A;  3GEH A;  1VYI A;  4L6R A;  2A68 F;  2CGE A;  3EFO A;  3T6J A;  2KW3 C;  1IW7 F;  4NTB A;  3UMI A;  4CX9 A;  4LDK A;  5B1B C;  4EIY A;  3L1M A;  2HJ3 A;  1FMW A;  256B A;  3LLK A;  4HE8 D;  3US6 A;  1TWG A;  2FAP B;  2I8B A;  2H7O A;  3GAN A;  3N0T A;  1FTS A;  5KYU A;  2XLE A;  3QMK A;  4LAC B;  5E33 A;  4E0I A;  4EWC A;  3G4X A;  3WOD F;  3EHN A;  2PP4 A;  3EGD A;  1SF8 A;  3C63 A;  4MVQ A;  2YVK A;  4WGY A;  4YL1 A;  3ZVR A;  1L7C A;  2H7V C;  5DLJ A;  5KYN A;  1E83 A;  2XL4 A;  4YT8 A;  4Q5S F;  1VLT A;  2OG2 A;  5E3A A;  3KYI A;  2J9U A;  1OXB A;  5JRA A;  4IAO A;  2HV6 A;  2XLO A;  3AGT A;  2GA0 A;  1OW8 A;  1SYQ A;  2A0B A;  2Q7R A;  4Z9H A;  2R7W A;  2F22 A;  4BJT A;  2J45 A;  2LFF A;  1AUE A;  2XLM A;  4H54 A;  2PNO A;  4AE4 B;  1NLX A; 
#chains in the Genus database with same CATH homology
 1VLS A;  3T9O A;  4Z9H A;  4Z9I A;  4Z9J A;  1WAT A;  1VLT A;  1LIH A;  2LIG A;  1JMW A;  2D4U A;  3ATP A;  4H54 A;  1WAS A;  2ASR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...