2ASRA

The three-dimensional structure of the aspartate receptor from escherichia coli
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
142
structure length
142
Chain Sequence
b'KSFVVSNQLREQQGELTSTWDLMLQTRINLSRSAVRMMMDSSNQQSNAKVELLDSARKTLAQAATHYKKFKSMAPLPEMVATSRNIDEKYKNYYTALTELIDYLDYGNTGAYFAQPTQGMQNAMGERFAQYALSSEKLYRDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE RECEPTOR
molecule tags Chemotaxis
source organism Escherichia coli
publication title The three-dimensional structure of the aspartate receptor from Escherichia coli.
pubmed doi rcsb
total genus 71
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 1994-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 2asrA00
1JMWA 2ASRA 1LIHA 1WASA 1WATA 4Z9JA 2D4UA 2LIGA 4H54A 4Z9HA 3T9OA 4Z9IA 1VLTA 1VLSA 3ATPA
chains in the Genus database with same CATH superfamily
3ZQYA 1BZ4A 1D1AA 2J9WA 3EH1A 4DJ9A 5FCLA 4LDRA 3R7CA 2AU5A 1FMWA 3AG4C 2OJQA 1IW7F 3ATPA 1AEPA 1J8MF 4P9FA 4YL3A 3U2MA 1HMDA 3C62A 2XLDA 3C8GA 5L0JA 1GM5A 4MTFA 3QW1A 5E33A 1BDJB 3QMKA 4CJGA 5A6AA 2DYSC 3FXHA 4BJ5A 2CGEA 3HNIA 4FX5A 3KKBA 3EG9B 3DZAA 4I1OB 1RKEA 5KYXB 4MW8A 2EIJC 1A7DA 3N0TA 3FMSA 2BC5A 2M64A 3ITFA 4OD4A 2YLDA 3CZ6A 1MMAA 3EGXA 3QVZA 4JJGA 2DB4A 4PJLA 3RVYA 1NLXA 3RIPA 2DGJA 4KNWA 2C03A 2KK1A 1V4AA 2ZD9A 2P61A 2YWAA 2VC9A 3AOUA 4MVMA 1HMOA 3K1IA 4NC3A 4Z9IA 2KQ9A 3GORA 1VMAA 3K33A 4E17A 4CS9A 4U5EE 1Q0KA 1G4WR 2XS1A 3DJUB 2EPLX 2XXAA 4JTDB 4JVSA 3M15A 1JMWA 3LJBA 3MYFA 4MNDA 4DVZA 1OW8A 1Z3IX 1K05A 3AG2C 1TWHA 2M4EA 3ZSUA 1EI7A 1ZHYA 1I4ZA 2J7PA 4RBNA 1VYKA 4EIYA 2J7PD 3ZWIA 5AC5A 5BUOA 1Z63A 1TWGA 5A6JA 1A41A 1E2XA 4LERA 2ZXOA 1B68A 2A68F 2J9UA 3WHNA 1GS9A 2WVOA 1MNDA 3ZVRA 4JW1A 4ULWA 3RH3A 2X0CA 3BRJA 1R4TA 3H2VA 2LCHA 3I5QA 4IWBA 3US6A 2GA0A 3F46A 4PFOA 1W2WA 1O5HA 1OXKA 2NUPB 3JSZA 3ZTZA 3QW0A 2NUTB 1U89A 2PBEA 3KYJA 1QKRA 3UMIA 2FGYA 5DQZA 4A4AA 4KBLA 3T9OA 1D0YA 2YL3A 1ORSC 3JT1A 3UGPA 3G4ZA 1L3PA 2WZLA 2YKZA 5T1DB 1G5ZA 4OIPF 2ZPAA 1ORJA 3ZG1A 5CIVA 3JCUQ 4ZLCA 4DBQA 2P1AA 2UUHA 2DI3A 1LI5A 4EBJA 3U9JA 1O3UA 1OXBA 3OA1A 1WGWA 4A2NB 2KYHA 3TJ5A 1C02A 3DD7A 1QQ3A 3V5YA 1CGME 4NQFA 5DLJA 4IAQA 2OEXA 1T01A 1ZHWA 3FDQA 2LSEA 4XPXA 4YT4A 2YL7A 3ABLC 1FMVA 2WZFA 4MVZA 2R9RB 3DWWA 3LS0A 1VYIA 4DRJB 2O9XA 4E0IA 1M56C 5F28E 1M2OA 2XRHA 3CEXA 1Q0DA 1O87A 3TULA 2CYDA 1Y6DA 3LNMB 3AQBA 3SZRA 2Q00A 2R7RA 4O79A 3QZCA 4C3DA 2KW3C 4WABA 3S90A 2FFHA 3T6BA 2Q9CA 1BBHA 2NSGA 2UUIA 2A1DD 1HE9A 3N24A 2OG2A 4C3BA 1HW1A 4PR9A 3B0VC 2WB7A 5L0DA 5KYYB 3K1HA 2AWCA 4YWQA 5JT4A 1KU2A 3B29A 1CGNA 4PJNA 5L3QA 3PHF2 2VB6A 3ASOC 3NMKA 4ANJA 3C7JA 2EIMC 3WG7C 4XLPF 3LAYA 1G4US 5JUAA 4CSAC 4H4KC 1WATA 5E3AA 1VOMA 3EH2A 3Q7LA 3HNLA 4G0HA 4Z9HA 3L8JA 1OW7A 2HV7A 2H7VC 3R2PA 3V5XA 1UFBA 5KYNA 3HNJA 5FZTA 4HEAJ 4XPYA 2OCCC 5EGYA 5DQTA 5HV9A 2EILC 2AP3A 4MQ9F 5K0IA 1J8YF 1QLEC 2HMQA 1JR8A 3A9CA 1OCOC 1FFHA 1SMYF 4U5BE 2XLWA 3GEIA 3NYMA 5B1AC 3V7OA 3F47A 4F4BA 2XLOA 2D5RB 3IQCA 1C03A 2XS8A 3NMJA 1SYQA 1XZPA 3W2WA 4G7HF 3E70C 1JAFA 1NU9C 3GM3A 5T3TA 2LFFA 1ZZPA 2OQMA 4MW3A 3S9OA 5L0FA 2XL8A 4J30B 2H7OA 2Q9BA 2QTVA 3CQZA 4YT2A 2HJ3A 2HSQA 1JPJA 2XLEA 1FAPB 4XLNF 4DRIB 3MYIA 2EPMX 3SP1A 2PX0A 2YQYA 2IM8A 3H65A 4JE9A 4LACB 1OKKA 1IZMA 2Y3HA 4XTKA 4DRHB 3NDBB 5CI8A 3U3BA 4NTBA 1C17M 1WASA 4C7OB 2QE9A 1TR2A 2AWYA 2I15A 4PK4A 2LP4A 4HE8D 3FAPB 4KI2A 1CPRA 1EA8A 4BEJA 2I8BA 3K1IC 4Q5SF 3ZIBA 2Y3GA 2V3CC 4E7SA 3W2VA 3M79A 3NG1A 3S28A 2J9BA 2R7TA 4JTCB 3EZHA 2KSFA 3SEOA 3T4RA 2R7WA 3C18A 4YN0B 1M2VB 1LIHA 2LD6A 4U5GA 3SXZA 1OW6A 4KNVA 1MMGA 3DE9A 4CS9C 4OINF 4JEBA 3C8GD 2GFHA 4JTAB 4QI0A 4PFPA 4NTAA 2EIKC 4YL0A 4BEMJ 4CIHA 2ZXRA 1YVIA 4YK5A 3EG9A 4N4WA 1S7ZA 3EJNA 4XEVA 4CIPA 5KYWA 3RF3A 2OU6A 3OEOA 3EGDB 4U5DE 4PACA 5L3VA 1G8XA 2IXMA 5IY5C 4CJOA 2HSBA 1WTYA 5CI9A 1KNYA 1NU7D 2W4MA 4N6HA 1YYJA 2R7OA 1ORYA 1YYXA 3H2UA 4YT5A 5BQHA 2CNWD 1VTMP 1TWAA 4OIQF 2R7VA 1ZHXA 3K7DA 4WGZA 4ER9A 4G7OF 2BE5F 2XXAB 2YL1A 4FESA 1SR2A 3FAJA 1YZCA 1PCXA 2PFDA 2Q3TA 2QLAA 2X51A 3JRTA 1RCPA 5AC4A 3HTKC 3GM2A 5DVWA 4BG0A 1BR1A 1A7VA 4CDAA 5F5HA 2D4UA 1ZW2A 2PNOA 5AGFA 3RVZA 3ASNC 4X0RA 3U3FA 1YA9A 1YAUO 1WOLA 3LS1A 2LFDA 3C8ZA 5HSWA 4W8PA 2WZGA 3EFOA 3ZTMA 3HJCA 4R32A 4W8KA 2HZ8A 2QNLA 4YL1A 1LS4A 3M4BA 3DM9B 2G3VA 4OIOF 2P0NA 4BJ6A 2HFIA 3SXMA 2JD3A 5L0CA 4IGGA 3MFNA 3FHDA 3NKEA 2J9VA 4CS8C 5B3SC 2Q9AA 1PD1A 1H9TA 4JIOA 2YLIA 3CSKA 3L34A 2J0XA 4PJJA 3U0CA 3M1CB 3MX3A 4J32B 4CS7A 1VLTA 3UR3C 3RW0A 5F5FA 3DKAA 1JRAA 3RQFA 1APCA 1V74B 3NYJA 2A6HF 2ZXPA 2VCAA 3IHUA 4U9DA 1KTMA 4PJMA 3RKOF 3DM5A 4NY3A 2OOCA 2RSEB 1T6IA 1TKNA 3ABMC 4JJFA 3ZC4A 2EINC 3GEHA 4WGYA 3B9QA 3I5PA 1DOVA 2Q4FA 2CDQA 5JP7A 4GEHA 1AUEA 2EPOA 2MHRA 5EHHA 5DS4A 2HS5A 3MBGA 3SYNA 4DVYP 4I44A 4DBRA 2LK4A 2Y39A 1M2VA 2FAPB 3O55A 3DJNB 1RKCA 4BJ6C 4E0HA 1K40A 4ULVA 1NZEA 2HJMA 2YEVA 3JSEO 2Y69C 2P7VA 1CGOA 2WL8A 4HFFB 4CS8A 4M63A 4FAPB 3PMRA 1PV3A 3JYYA 1BR2A 2OJED 4JCHA 3DI5A 4CSAA 3C8GB 3KL4A 3GANA 3L1MA 4AL0A 2V26A 1QPUA 4YT8A 1FFTC 1Z7Qc 2R25A 2NUTA 2AVKA 3X1OA 4AL1A 3EQLF 1MNEA 5KYXA 4MS2A 2XLVA 3BEHA 3EHMA 1D1BA 2J8WA 1H6GA 1DOWA 2B0JA 3LLIA 3G4XA 2L6FA 4LLEA 1M6TA 1ZU4A 4GYTA 4EWCA 5A6BD 3UGOA 4BPMA 3LNRA 2YHSA 2A69F 1H7IA 2G62A 3AGTA 2MWQA 3VF0A 4KC9A 1WN0A 2ZXWC 3CAXA 2JX0A 4LDQA 2R7QA 3K66A 3DE8A 2R7UA 1U0BB 3EPVA 3UMHA 1A7EA 1VLSA 1UG7A 1L7CA 1RXQA 3W8IA 2XLHA 1YDIA 4IJJA 5JS5A 2IBFA 2KC3A 2H7BA 2KNHA 1OQCA 2XM0A 1YZAA 4IB4A 4JZAA 3X2QC 3TD7A 3IQ5A 4J7YA 3M4CA 3U9MA 1V55C 1Z5ZA 5JSLA 4D4XA 4EBBA 3KYIA 3B0UX 3KMIA 3L0IA 1D0ZA 2IXNA 3U8VA 3FOOA 1I4YA 3MLGA 4MVUA 4U5CE 3Q7GA 4U9EA 4XWJA 3U2LA 4AE4A 2XL6A 3EFOB 2L81A 4AE4B 1Y4CA 1QVXA 3K6BA 3T6JA 5E2QA 1XWJA 1HE1A 2Y3DA 1T5OA 2CW0F 1Z23A 1S05A 2P6VA 3S29A 2OEVA 2W45A 3AJMA 3AQCA 1Z6AA 3C63A 3OWTA 4K1OA 4N6CA 3VRCA 4E7ZA 1FNTc 1ZHTA 4HFKB 1LVKA 3O10A 2PX3A 1SZIA 4XEFA 4DOZA 2R7SA 4LDKA 4JEAA 1EQ1A 5L0IA 1LPEA 2R03A 3SXKA 2NUPA 1NFOA 1K04A 1TWCA 3AG1C 3LUTB 4Q4ZF 4O6MA 4ZLDA 3GWLA 2EPNA 3N2ZB 2DYRC 1CPQA 2PP4A 3PCVA 5JLIA 4K0DA 1YLMA 2NPUA 3LLKA 3W8HA 1HW2A 1TFKB 3AG3C 1AVOB 4I1MA 2L7AA 3RQEA 4K7BA 4EBKA 4O7GA 1HY5A 1D0XA 2NSFA 3A11A 3QTHA 4XPWA 5D91A 3ZQVA 1NBBA 3GEEA 3U5SA 3NKDA 2HKVA 1ZW3A 2ETSA 2MYSA 3I4UA 4BJ5C 3TJ6A 2KGOA 4U5HA 3SXYA 2YLGA 1MMDA 4JKVA 2YL0A 5DS5A 1V54C 4J7TA 3TQOA 2XM4A 3JRMO 3UMKA 2VASA 5JRAA 2QUPA 2C04A 4D4NA 4QI2A 4RD9A 3FOPA 2TMVP 4CDVA 1T6UA 4P9TA 3TK0A 3ABKC 2R02A 2E87A 1PD0A 1T6QA 2A0UA 2XL4A 1JPNA 3RYLA 1OR3A 4MTOA 2VCCA 5L0GA 1E86A 1GGQA 5KYWB 1ZHZA 1OCRC 5TJ5E 2L6HA 1VB5A 3DAGA 1Q0FA 4UDVA 4WJ0A 1EKYA 4NCQA 2PF4E 4NTFA 2A6EF 5KYYA 2B0HA 4O6YA 1OR2A 2L6GA 4O6NA 1RJ9B 2R05A 1YARO 5EK0A 2CCYA 2H8AA 1F1MA 2LIGA 2JPUA 3EZIA 4EKWA 4XQ1A 1FTSA 1H9GA 1VK5A 2WVQA 4BJ1A 1OCZC 3B71A 3S84A 1LI7A 1NSGB 1LKXA 4JCZA 1M57C 4QDLA 4C3EA 1LM3B 4IRUA 1E83A 1Q0MA 1BR4A 4CX9A 3GM1A 2HMZA 3G50A 5BQIA 3HKKA 3T6GB 2YRFA 3LESA 1ZYRF 1LE2A 1A0BA 2L9JA 3L8IA 3WODF 1QSPA 2Z15A 3E9VA 4U5FE 4CBEA 4CDYA 4OIRF 5A6BA 2IYLD 3PDMP 4ONSA 1U6HA 2IOQA 2IXOA 1ZU5A 3DMDA 1OKKD 4JC7A 5JVEA 2EPKX 4H54A 5BQGA 4YJWA 2GWWA 2XLMA 2OKUA 1RKEB 4EUKB 3S27A 3WAQA 5A6KA 2VH3A 4IARA 2HUJA 3EGXB 3W4YA 4AX2A 1SF8A 2Q7RA 5DS6A 4MVRA 2W9YA 2A0BA 4XEKA 3KPHA 4JRZA 4E18A 1Q0GA 3JTLO 4P6IC 4Q7CA 4G78A 4JURI 3GWNA 4IAOA 1XZQA 1R5ID 2IXPA 3LEVA 5D92A 3U8PA 5B3IA 3VYWA 2LQGA 1MMNA 1LS1A 5T3WA 1TQGA 1QZXA 2HV6A 2J46A 3TOLA 3NYLA 3AGUA 1MQVA 4FWVA 5A69A 1NFNA 2Y3BA 3KH2A 1T9KA 2YVKA 4OD5A 1NG1A 3JYHA 2R7XA 1N1CA 3NRHA 3RFYA 3V5ZA 2NG1A 5GPGB 4MVSA 1D1CA 1GQAA 5COFA 1ZVZA 5B1BC 2ICWG 2F22A 5COMA 2RD9A 3SNHA 2YZSA 3O39A 5L0HA 3LEOA 3IQTA 3NMIA 3ECSA 3VM6A 3POVA 2XSEA 4I3MA 5KYUA 3J06A 4B6IA 1LE4A 3B0PA 2J0WA 5KYUB 3TOMA 3UNGC 1WWPA 3VAYA 5E3CA 3ZDLA 2QY9A 4N06A 2J45A 2KJGA 1JOGA 3HLZA 2CNWA 1I5NA 3IEEA 4MVOA 1TFOB 3O6XA 4LLCA 2GDCA 4MTGA 4BJTA 4Z9JA 1OCCC 4RDAA 1E84A 4L6RA 256BA 1YJGA 3HNKA 2VCBA 4EHPA 3Q6NA 3EGDA 4MVQA 3Q6MA 4C7OA 1RMVA 2ASRA 2GAQA 2WVNA 3IQ6A 1ST6A 2W4BA 1E85A 3JZ0A 3QVYA 1RJ9A 3FVYA 1FR0A 3GODA 3RQGA 2BL2A 4AK9A 3EHNA 3DXJF 3S0XA 2G3KA 4GQHA 3DAFA 5COGA 1YA7O 4DXWA 3IPMO 4G7ZF
chains in the Genus database with same CATH topology
1JMWA 2ASRA 1LIHA 1WASA 1WATA 4Z9JA 2D4UA 2LIGA 4H54A 4Z9HA 3T9OA 4Z9IA 1VLTA 1VLSA 3ATPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JMW A;  2ASR A;  1LIH A;  1WAS A;  1WAT A;  4Z9J A;  2D4U A;  2LIG A;  4H54 A;  4Z9H A;  3T9O A;  4Z9I A;  1VLT A;  1VLS A;  3ATP A; 
#chains in the Genus database with same CATH topology
 3ZQY A;  1BZ4 A;  1D1A A;  2J9W A;  3EH1 A;  4DJ9 A;  5FCL A;  4LDR A;  3R7C A;  2AU5 A;  1FMW A;  3AG4 C;  2OJQ A;  1IW7 F;  3ATP A;  1AEP A;  1J8M F;  4P9F A;  4YL3 A;  3U2M A;  1HMD A;  3C62 A;  2XLD A;  3C8G A;  5L0J A;  1GM5 A;  4MTF A;  3QW1 A;  5E33 A;  1BDJ B;  3QMK A;  4CJG A;  5A6A A;  2DYS C;  3FXH A;  4BJ5 A;  2CGE A;  3HNI A;  4FX5 A;  3KKB A;  3EG9 B;  3DZA A;  4I1O B;  1RKE A;  5KYX B;  4MW8 A;  2EIJ C;  1A7D A;  3N0T A;  3FMS A;  2BC5 A;  2M64 A;  3ITF A;  4OD4 A;  2YLD A;  3CZ6 A;  1MMA A;  3EGX A;  3QVZ A;  4JJG A;  2DB4 A;  4PJL A;  3RVY A;  1NLX A;  3RIP A;  2DGJ A;  4KNW A;  2C03 A;  2KK1 A;  1V4A A;  2ZD9 A;  2P61 A;  2YWA A;  2VC9 A;  3AOU A;  4MVM A;  1HMO A;  3K1I A;  4NC3 A;  4Z9I A;  2KQ9 A;  3GOR A;  1VMA A;  3K33 A;  4E17 A;  4CS9 A;  4U5E E;  1Q0K A;  1G4W R;  2XS1 A;  3DJU B;  2EPL X;  2XXA A;  4JTD B;  4JVS A;  3M15 A;  1JMW A;  3LJB A;  3MYF A;  4MND A;  4DVZ A;  1OW8 A;  1Z3I X;  1K05 A;  3AG2 C;  1TWH A;  2M4E A;  3ZSU A;  1EI7 A;  1ZHY A;  1I4Z A;  2J7P A;  4RBN A;  1VYK A;  4EIY A;  2J7P D;  3ZWI A;  5AC5 A;  5BUO A;  1Z63 A;  1TWG A;  5A6J A;  1A41 A;  1E2X A;  4LER A;  2ZXO A;  1B68 A;  2A68 F;  2J9U A;  3WHN A;  1GS9 A;  2WVO A;  1MND A;  3ZVR A;  4JW1 A;  4ULW A;  3RH3 A;  2X0C A;  3BRJ A;  1R4T A;  3H2V A;  2LCH A;  3I5Q A;  4IWB A;  3US6 A;  2GA0 A;  3F46 A;  4PFO A;  1W2W A;  1O5H A;  1OXK A;  2NUP B;  3JSZ A;  3ZTZ A;  3QW0 A;  2NUT B;  1U89 A;  2PBE A;  3KYJ A;  1QKR A;  3UMI A;  2FGY A;  5DQZ A;  4A4A A;  4KBL A;  3T9O A;  1D0Y A;  2YL3 A;  1ORS C;  3JT1 A;  3UGP A;  3G4Z A;  1L3P A;  2WZL A;  2YKZ A;  5T1D B;  1G5Z A;  4OIP F;  2ZPA A;  1ORJ A;  3ZG1 A;  5CIV A;  3JCU Q;  4ZLC A;  4DBQ A;  2P1A A;  2UUH A;  2DI3 A;  1LI5 A;  4EBJ A;  3U9J A;  1O3U A;  1OXB A;  3OA1 A;  1WGW A;  4A2N B;  2KYH A;  3TJ5 A;  1C02 A;  3DD7 A;  1QQ3 A;  3V5Y A;  1CGM E;  4NQF A;  5DLJ A;  4IAQ A;  2OEX A;  1T01 A;  1ZHW A;  3FDQ A;  2LSE A;  4XPX A;  4YT4 A;  2YL7 A;  3ABL C;  1FMV A;  2WZF A;  4MVZ A;  2R9R B;  3DWW A;  3LS0 A;  1VYI A;  4DRJ B;  2O9X A;  4E0I A;  1M56 C;  5F28 E;  1M2O A;  2XRH A;  3CEX A;  1Q0D A;  1O87 A;  3TUL A;  2CYD A;  1Y6D A;  3LNM B;  3AQB A;  3SZR A;  2Q00 A;  2R7R A;  4O79 A;  3QZC A;  4C3D A;  2KW3 C;  4WAB A;  3S90 A;  2FFH A;  3T6B A;  2Q9C A;  1BBH A;  2NSG A;  2UUI A;  2A1D D;  1HE9 A;  3N24 A;  2OG2 A;  4C3B A;  1HW1 A;  4PR9 A;  3B0V C;  2WB7 A;  5L0D A;  5KYY B;  3K1H A;  2AWC A;  4YWQ A;  5JT4 A;  1KU2 A;  3B29 A;  1CGN A;  4PJN A;  5L3Q A;  3PHF 2;  2VB6 A;  3ASO C;  3NMK A;  4ANJ A;  3C7J A;  2EIM C;  3WG7 C;  4XLP F;  3LAY A;  1G4U S;  5JUA A;  4CSA C;  4H4K C;  1WAT A;  5E3A A;  1VOM A;  3EH2 A;  3Q7L A;  3HNL A;  4G0H A;  4Z9H A;  3L8J A;  1OW7 A;  2HV7 A;  2H7V C;  3R2P A;  3V5X A;  1UFB A;  5KYN A;  3HNJ A;  5FZT A;  4HEA J;  4XPY A;  2OCC C;  5EGY A;  5DQT A;  5HV9 A;  2EIL C;  2AP3 A;  4MQ9 F;  5K0I A;  1J8Y F;  1QLE C;  2HMQ A;  1JR8 A;  3A9C A;  1OCO C;  1FFH A;  1SMY F;  4U5B E;  2XLW A;  3GEI A;  3NYM A;  5B1A C;  3V7O A;  3F47 A;  4F4B A;  2XLO A;  2D5R B;  3IQC A;  1C03 A;  2XS8 A;  3NMJ A;  1SYQ A;  1XZP A;  3W2W A;  4G7H F;  3E70 C;  1JAF A;  1NU9 C;  3GM3 A;  5T3T A;  2LFF A;  1ZZP A;  2OQM A;  4MW3 A;  3S9O A;  5L0F A;  2XL8 A;  4J30 B;  2H7O A;  2Q9B A;  2QTV A;  3CQZ A;  4YT2 A;  2HJ3 A;  2HSQ A;  1JPJ A;  2XLE A;  1FAP B;  4XLN F;  4DRI B;  3MYI A;  2EPM X;  3SP1 A;  2PX0 A;  2YQY A;  2IM8 A;  3H65 A;  4JE9 A;  4LAC B;  1OKK A;  1IZM A;  2Y3H A;  4XTK A;  4DRH B;  3NDB B;  5CI8 A;  3U3B A;  4NTB A;  1C17 M;  1WAS A;  4C7O B;  2QE9 A;  1TR2 A;  2AWY A;  2I15 A;  4PK4 A;  2LP4 A;  4HE8 D;  3FAP B;  4KI2 A;  1CPR A;  1EA8 A;  4BEJ A;  2I8B A;  3K1I C;  4Q5S F;  3ZIB A;  2Y3G A;  2V3C C;  4E7S A;  3W2V A;  3M79 A;  3NG1 A;  3S28 A;  2J9B A;  2R7T A;  4JTC B;  3EZH A;  2KSF A;  3SEO A;  3T4R A;  2R7W A;  3C18 A;  4YN0 B;  1M2V B;  1LIH A;  2LD6 A;  4U5G A;  3SXZ A;  1OW6 A;  4KNV A;  1MMG A;  3DE9 A;  4CS9 C;  4OIN F;  4JEB A;  3C8G D;  2GFH A;  4JTA B;  4QI0 A;  4PFP A;  4NTA A;  2EIK C;  4YL0 A;  4BEM J;  4CIH A;  2ZXR A;  1YVI A;  4YK5 A;  3EG9 A;  4N4W A;  1S7Z A;  3EJN A;  4XEV A;  4CIP A;  5KYW A;  3RF3 A;  2OU6 A;  3OEO A;  3EGD B;  4U5D E;  4PAC A;  5L3V A;  1G8X A;  2IXM A;  5IY5 C;  4CJO A;  2HSB A;  1WTY A;  5CI9 A;  1KNY A;  1NU7 D;  2W4M A;  4N6H A;  1YYJ A;  2R7O A;  1ORY A;  1YYX A;  3H2U A;  4YT5 A;  5BQH A;  2CNW D;  1VTM P;  1TWA A;  4OIQ F;  2R7V A;  1ZHX A;  3K7D A;  4WGZ A;  4ER9 A;  4G7O F;  2BE5 F;  2XXA B;  2YL1 A;  4FES A;  1SR2 A;  3FAJ A;  1YZC A;  1PCX A;  2PFD A;  2Q3T A;  2QLA A;  2X51 A;  3JRT A;  1RCP A;  5AC4 A;  3HTK C;  3GM2 A;  5DVW A;  4BG0 A;  1BR1 A;  1A7V A;  4CDA A;  5F5H A;  2D4U A;  1ZW2 A;  2PNO A;  5AGF A;  3RVZ A;  3ASN C;  4X0R A;  3U3F A;  1YA9 A;  1YAU O;  1WOL A;  3LS1 A;  2LFD A;  3C8Z A;  5HSW A;  4W8P A;  2WZG A;  3EFO A;  3ZTM A;  3HJC A;  4R32 A;  4W8K A;  2HZ8 A;  2QNL A;  4YL1 A;  1LS4 A;  3M4B A;  3DM9 B;  2G3V A;  4OIO F;  2P0N A;  4BJ6 A;  2HFI A;  3SXM A;  2JD3 A;  5L0C A;  4IGG A;  3MFN A;  3FHD A;  3NKE A;  2J9V A;  4CS8 C;  5B3S C;  2Q9A A;  1PD1 A;  1H9T A;  4JIO A;  2YLI A;  3CSK A;  3L34 A;  2J0X A;  4PJJ A;  3U0C A;  3M1C B;  3MX3 A;  4J32 B;  4CS7 A;  1VLT A;  3UR3 C;  3RW0 A;  5F5F A;  3DKA A;  1JRA A;  3RQF A;  1APC A;  1V74 B;  3NYJ A;  2A6H F;  2ZXP A;  2VCA A;  3IHU A;  4U9D A;  1KTM A;  4PJM A;  3RKO F;  3DM5 A;  4NY3 A;  2OOC A;  2RSE B;  1T6I A;  1TKN A;  3ABM C;  4JJF A;  3ZC4 A;  2EIN C;  3GEH A;  4WGY A;  3B9Q A;  3I5P A;  1DOV A;  2Q4F A;  2CDQ A;  5JP7 A;  4GEH A;  1AUE A;  2EPO A;  2MHR A;  5EHH A;  5DS4 A;  2HS5 A;  3MBG A;  3SYN A;  4DVY P;  4I44 A;  4DBR A;  2LK4 A;  2Y39 A;  1M2V A;  2FAP B;  3O55 A;  3DJN B;  1RKC A;  4BJ6 C;  4E0H A;  1K40 A;  4ULV A;  1NZE A;  2HJM A;  2YEV A;  3JSE O;  2Y69 C;  2P7V A;  1CGO A;  2WL8 A;  4HFF B;  4CS8 A;  4M63 A;  4FAP B;  3PMR A;  1PV3 A;  3JYY A;  1BR2 A;  2OJE D;  4JCH A;  3DI5 A;  4CSA A;  3C8G B;  3KL4 A;  3GAN A;  3L1M A;  4AL0 A;  2V26 A;  1QPU A;  4YT8 A;  1FFT C;  1Z7Q c;  2R25 A;  2NUT A;  2AVK A;  3X1O A;  4AL1 A;  3EQL F;  1MNE A;  5KYX A;  4MS2 A;  2XLV A;  3BEH A;  3EHM A;  1D1B A;  2J8W A;  1H6G A;  1DOW A;  2B0J A;  3LLI A;  3G4X A;  2L6F A;  4LLE A;  1M6T A;  1ZU4 A;  4GYT A;  4EWC A;  5A6B D;  3UGO A;  4BPM A;  3LNR A;  2YHS A;  2A69 F;  1H7I A;  2G62 A;  3AGT A;  2MWQ A;  3VF0 A;  4KC9 A;  1WN0 A;  2ZXW C;  3CAX A;  2JX0 A;  4LDQ A;  2R7Q A;  3K66 A;  3DE8 A;  2R7U A;  1U0B B;  3EPV A;  3UMH A;  1A7E A;  1VLS A;  1UG7 A;  1L7C A;  1RXQ A;  3W8I A;  2XLH A;  1YDI A;  4IJJ A;  5JS5 A;  2IBF A;  2KC3 A;  2H7B A;  2KNH A;  1OQC A;  2XM0 A;  1YZA A;  4IB4 A;  4JZA A;  3X2Q C;  3TD7 A;  3IQ5 A;  4J7Y A;  3M4C A;  3U9M A;  1V55 C;  1Z5Z A;  5JSL A;  4D4X A;  4EBB A;  3KYI A;  3B0U X;  3KMI A;  3L0I A;  1D0Z A;  2IXN A;  3U8V A;  3FOO A;  1I4Y A;  3MLG A;  4MVU A;  4U5C E;  3Q7G A;  4U9E A;  4XWJ A;  3U2L A;  4AE4 A;  2XL6 A;  3EFO B;  2L81 A;  4AE4 B;  1Y4C A;  1QVX A;  3K6B A;  3T6J A;  5E2Q A;  1XWJ A;  1HE1 A;  2Y3D A;  1T5O A;  2CW0 F;  1Z23 A;  1S05 A;  2P6V A;  3S29 A;  2OEV A;  2W45 A;  3AJM A;  3AQC A;  1Z6A A;  3C63 A;  3OWT A;  4K1O A;  4N6C A;  3VRC A;  4E7Z A;  1FNT c;  1ZHT A;  4HFK B;  1LVK A;  3O10 A;  2PX3 A;  1SZI A;  4XEF A;  4DOZ A;  2R7S A;  4LDK A;  4JEA A;  1EQ1 A;  5L0I A;  1LPE A;  2R03 A;  3SXK A;  2NUP A;  1NFO A;  1K04 A;  1TWC A;  3AG1 C;  3LUT B;  4Q4Z F;  4O6M A;  4ZLD A;  3GWL A;  2EPN A;  3N2Z B;  2DYR C;  1CPQ A;  2PP4 A;  3PCV A;  5JLI A;  4K0D A;  1YLM A;  2NPU A;  3LLK A;  3W8H A;  1HW2 A;  1TFK B;  3AG3 C;  1AVO B;  4I1M A;  2L7A A;  3RQE A;  4K7B A;  4EBK A;  4O7G A;  1HY5 A;  1D0X A;  2NSF A;  3A11 A;  3QTH A;  4XPW A;  5D91 A;  3ZQV A;  1NBB A;  3GEE A;  3U5S A;  3NKD A;  2HKV A;  1ZW3 A;  2ETS A;  2MYS A;  3I4U A;  4BJ5 C;  3TJ6 A;  2KGO A;  4U5H A;  3SXY A;  2YLG A;  1MMD A;  4JKV A;  2YL0 A;  5DS5 A;  1V54 C;  4J7T A;  3TQO A;  2XM4 A;  3JRM O;  3UMK A;  2VAS A;  5JRA A;  2QUP A;  2C04 A;  4D4N A;  4QI2 A;  4RD9 A;  3FOP A;  2TMV P;  4CDV A;  1T6U A;  4P9T A;  3TK0 A;  3ABK C;  2R02 A;  2E87 A;  1PD0 A;  1T6Q A;  2A0U A;  2XL4 A;  1JPN A;  3RYL A;  1OR3 A;  4MTO A;  2VCC A;  5L0G A;  1E86 A;  1GGQ A;  5KYW B;  1ZHZ A;  1OCR C;  5TJ5 E;  2L6H A;  1VB5 A;  3DAG A;  1Q0F A;  4UDV A;  4WJ0 A;  1EKY A;  4NCQ A;  2PF4 E;  4NTF A;  2A6E F;  5KYY A;  2B0H A;  4O6Y A;  1OR2 A;  2L6G A;  4O6N A;  1RJ9 B;  2R05 A;  1YAR O;  5EK0 A;  2CCY A;  2H8A A;  1F1M A;  2LIG A;  2JPU A;  3EZI A;  4EKW A;  4XQ1 A;  1FTS A;  1H9G A;  1VK5 A;  2WVQ A;  4BJ1 A;  1OCZ C;  3B71 A;  3S84 A;  1LI7 A;  1NSG B;  1LKX A;  4JCZ A;  1M57 C;  4QDL A;  4C3E A;  1LM3 B;  4IRU A;  1E83 A;  1Q0M A;  1BR4 A;  4CX9 A;  3GM1 A;  2HMZ A;  3G50 A;  5BQI A;  3HKK A;  3T6G B;  2YRF A;  3LES A;  1ZYR F;  1LE2 A;  1A0B A;  2L9J A;  3L8I A;  3WOD F;  1QSP A;  2Z15 A;  3E9V A;  4U5F E;  4CBE A;  4CDY A;  4OIR F;  5A6B A;  2IYL D;  3PDM P;  4ONS A;  1U6H A;  2IOQ A;  2IXO A;  1ZU5 A;  3DMD A;  1OKK D;  4JC7 A;  5JVE A;  2EPK X;  4H54 A;  5BQG A;  4YJW A;  2GWW A;  2XLM A;  2OKU A;  1RKE B;  4EUK B;  3S27 A;  3WAQ A;  5A6K A;  2VH3 A;  4IAR A;  2HUJ A;  3EGX B;  3W4Y A;  4AX2 A;  1SF8 A;  2Q7R A;  5DS6 A;  4MVR A;  2W9Y A;  2A0B A;  4XEK A;  3KPH A;  4JRZ A;  4E18 A;  1Q0G A;  3JTL O;  4P6I C;  4Q7C A;  4G78 A;  4JUR I;  3GWN A;  4IAO A;  1XZQ A;  1R5I D;  2IXP A;  3LEV A;  5D92 A;  3U8P A;  5B3I A;  3VYW A;  2LQG A;  1MMN A;  1LS1 A;  5T3W A;  1TQG A;  1QZX A;  2HV6 A;  2J46 A;  3TOL A;  3NYL A;  3AGU A;  1MQV A;  4FWV A;  5A69 A;  1NFN A;  2Y3B A;  3KH2 A;  1T9K A;  2YVK A;  4OD5 A;  1NG1 A;  3JYH A;  2R7X A;  1N1C A;  3NRH A;  3RFY A;  3V5Z A;  2NG1 A;  5GPG B;  4MVS A;  1D1C A;  1GQA A;  5COF A;  1ZVZ A;  5B1B C;  2ICW G;  2F22 A;  5COM A;  2RD9 A;  3SNH A;  2YZS A;  3O39 A;  5L0H A;  3LEO A;  3IQT A;  3NMI A;  3ECS A;  3VM6 A;  3POV A;  2XSE A;  4I3M A;  5KYU A;  3J06 A;  4B6I A;  1LE4 A;  3B0P A;  2J0W A;  5KYU B;  3TOM A;  3UNG C;  1WWP A;  3VAY A;  5E3C A;  3ZDL A;  2QY9 A;  4N06 A;  2J45 A;  2KJG A;  1JOG A;  3HLZ A;  2CNW A;  1I5N A;  3IEE A;  4MVO A;  1TFO B;  3O6X A;  4LLC A;  2GDC A;  4MTG A;  4BJT A;  4Z9J A;  1OCC C;  4RDA A;  1E84 A;  4L6R A;  256B A;  1YJG A;  3HNK A;  2VCB A;  4EHP A;  3Q6N A;  3EGD A;  4MVQ A;  3Q6M A;  4C7O A;  1RMV A;  2ASR A;  2GAQ A;  2WVN A;  3IQ6 A;  1ST6 A;  2W4B A;  1E85 A;  3JZ0 A;  3QVY A;  1RJ9 A;  3FVY A;  1FR0 A;  3GOD A;  3RQG A;  2BL2 A;  4AK9 A;  3EHN A;  3DXJ F;  3S0X A;  2G3K A;  4GQH A;  3DAF A;  5COG A;  1YA7 O;  4DXW A;  3IPM O;  4G7Z F; 
#chains in the Genus database with same CATH homology
 1JMW A;  2ASR A;  1LIH A;  1WAS A;  1WAT A;  4Z9J A;  2D4U A;  2LIG A;  4H54 A;  4Z9H A;  3T9O A;  4Z9I A;  1VLT A;  1VLS A;  3ATP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...