2ASRA

The three-dimensional structure of the aspartate receptor from escherichia coli
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
142
structure length
142
Chain Sequence
KSFVVSNQLREQQGELTSTWDLMLQTRINLSRSAVRMMMDSSNQQSNAKVELLDSARKTLAQAATHYKKFKSMAPLPEMVATSRNIDEKYKNYYTALTELIDYLDYGNTGAYFAQPTQGMQNAMGERFAQYALSSEKLYRDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chemotaxis
molecule keywords ASPARTATE RECEPTOR
publication title The three-dimensional structure of the aspartate receptor from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 71
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 1994-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 2asrA00
1WASA 3ATPA 2LIGA 2D4UA 1WATA 1LIHA 1VLTA 1VLSA 2ASRA 4H54A 4Z9IA 4Z9HA 3T9OA 4Z9JA 1JMWA
chains in the Genus database with same CATH superfamily
2MHRA 2L7AA 4G78A 4DXWA 3MLGA 2PFDA 4NTAA 5AGFA 3RH3A 1B68A 2J9UA 4IAOA 4JTAB 3JYHA 2CNWA 5DQTA 4CBEA 3DM9B 4CDAA 2H7VC 4AK9A 1T01A 1U6HA 1Y6DA 1OCZC 3EGXB 4JW1A 1LI7A 1TFOB 3SNHA 1YJGA 3TK0A 4ULVA 4CS9C 4MTGA 4BEJA 3SYNA 4DVZA 1TFKB 2W9YA 2IXNA 3EHNA 2PNOA 3Q7GA 5TJ5E 4OD4A 4JCHA 4IGGA 5L3VA 3EFOB 3VRCA 1SMYF 3M1CB 4E7ZA 5KYYA 1D1CA 1QQ3A 3UMKA 1LI5A 2XLVA 1BZ4A 2IBFA 4KC9A 3TJ6A 3RQEA 3SZRA 3B0PA 4E7SA 1K04A 4I3MA 2CYDA 5A6JA 1S05A 3ZIBA 5DS4A 1M56C 3G50A 2ZD9A 4R32A 4EIYA 1RKEB 2QUPA 2IOQA 3C8GB 2HSQA 3GWNA 2MWQA 5E33A 5JVEA 2GFHA 4MVSA 2Q9AA 2Q9BA 3AG2C 3IQCA 1V55C 2GDCA 2XL6A 3V7OA 4DBRA 3E70C 5A69A 3FDQA 1MMGA 4YT2A 3QZCA 4IB4A 1VK5A 1MMNA 1WN0A 4AX2A 1YLMA 1Z23A 2WL8A 4CSAC 4EBKA 2OU6A 4N6CA 5B1BC 1CGOA 1OW8A 2PP4A 4AL1A 1T6UA 4XLPF 4C7OA 2D4UA 1I4YA 1QKRA 1ZU4A 4AE4B 5L3QA 2Y39A 4NCQA 2Z15A 3RQGA 2XSEA 4LDQA 4O6NA 2LFFA 4FWVA 1JMWA 3GEEA 1QZXA 3LLIA 4E0IA 5EK0A 1IW7F 3LAYA 5BQGA 1ZW2A 3ZG1A 2E87A 3VAYA 3LNRA 3KYJA 1N1CA 2XLWA 4P9FA 4IRUA 5D92A 4A2NB 2LK4A 3JTLO 1ZVZA 2KNHA 3FMSA 2P61A 3MBGA 2B0JA 2VCBA 1ZU5A 3DM5A 4KNWA 4OIPF 2NUTB 1RJ9A 3PHF2 4RD9A 3W2WA 1Q0GA 1NSGB 1SZIA 3NKEA 1GGQA 3GANA 1ZYRF 4W8PA 3ZQYA 4RDAA 1NLXA 1O87A 2WB7A 3I5PA 3RQFA 2WZLA 3S27A 4BPMA 2YLGA 2HSBA 3NKDA 1V4AA 4PJLA 4JIOA 3N2ZB 4U9DA 3EZIA 3H2VA 4J7TA 4JKVA 3ASOC 3UGOA 2WZGA 3K33A 3KL4A 4CJOA 3JT1A 2XM4A 1D0YA 1JPNA 3DWWA 4Z9IA 3WHNA 2B0HA 5L0DA 3B0UX 2R7RA 2ZPAA 3EH2A 3QMKA 3L0IA 2CGEA 4CS9A 1ORYA 2EPOA 4ULWA 1VYKA 3LESA 3U2MA 3MX3A 1MNEA 1WASA 2DYRC 3OA1A 4CIPA 2AU5A 2FFHA 3WG7C 3RFYA 2Y3BA 1CGNA 4E18A 4G7ZF 4U5GA 2GAQA 2NUPA 3LJBA 2EILC 1ZZPA 2J7PD 1LKXA 2J46A 1ZW3A 2PX3A 3NRHA 3Q6NA 3RW0A 4YJWA 1YAUO 4BEMJ 1KTMA 4PR9A 3NMJA 3X1OA 2WVQA 1YARO 1OQCA 2W4BA 2ZXOA 3FAPB 4O6MA 3ZTMA 3N24A 5KYXB 5JRAA 4G7OF 3GEIA 3EGXA 2QE9A 1Q0DA 2XRHA 4YT4A 4XTKA 4NTBA 1HY5A 4YK5A 3JYYA 4OIRF 1G5ZA 2J8WA 3R2PA 2KC3A 4CSAA 2XLDA 3AG3C 4JTDB 3TQOA 1R5ID 4Q7CA 4EKWA 1YYXA 2CDQA 1D1AA 4B6IA 1H9TA 1TWAA 3RYLA 1D0XA 5K0IA 1JOGA 4JE9A 4O7GA 3U5SA 2X0CA 4D4XA 4DRIB 1C03A 5EGYA 4JRZA 5E2QA 5KYWA 2IXMA 1RKEA 3DE9A 3CAXA 1LS4A 1A0BA 1TKNA 2NUPB 3C8GA 3FAJA 2X51A 1A41A 1O3UA 4LDRA 3A9CA 2XS1A 2XM0A 1R4TA 3AQCA 1H9GA 3M4BA 2J9VA 3U9JA 1ORSC 1MQVA 3JRMO 3S29A 4BJ5C 4DOZA 1E84A 4ZLDA 3IPMO 5COFA 2XLEA 3NMIA 1FR0A 4XQ1A 2Y3GA 2QTVA 3UMIA 3AQBA 3F47A 4AE4A 1FNTc 4QI2A 3FXHA 1Z3IX 2KQ9A 1OXKA 2R9RB 2VCAA 4BJ1A 1YDIA 1VMAA 1Z63A 2WZFA 4U5BE 2WVNA 2IXOA 2P0NA 2R7VA 3W2VA 3LS0A 4M63A 4NC3A 2L81A 3F46A 1EI7A 3ZDLA 3ABMC 3C18A 5JS5A 2G62A 3DD7A 5JUAA 1FTSA 2F22A 1H6GA 1RCPA 2Y3HA 2NUTA 3O39A 2RD9A 5T1DB 1AUEA 2EPKX 5KYWB 5D91A 1OR3A 1Q0FA 5DVWA 3WODF 2FAPB 4JC7A 1D0ZA 2Y69C 2GA0A 4G0HA 5B1AC 4JVSA 2KJGA 5DS5A 1SR2A 2EIKC 3EG9B 3L1MA 2J9BA 2HFIA 5CI8A 3UGPA 1HW2A 4MW3A 256BA 1LM3B 2P7VA 4JZAA 1Z6AA 2ETSA 3CEXA 3JSEO 1GQAA 4LDKA 3GWLA 2NSFA 3C7JA 4NTFA 4XPYA 3SXZA 2EINC 4DRHB 5AC4A 5A6BD 4J32B 2R05A 1APCA 5GPGB 4C3BA 1ST6A 4XPWA 4MVQA 4YN0B 4FX5A 4BG0A 4DJ9A 1Q0KA 5EHHA 3KMIA 5KYNA 3ZVRA 1VOMA 4IARA 4J30B 4OIQF 1DOWA 3QW1A 2ZXPA 2Y3DA 3DAGA 3PDMP 1KU2A 2YL0A 3B71A 3SP1A 1NBBA 2J9WA 5CIVA 4F4BA 1Z7Qc 4LACB 5FCLA 3G4ZA 4Z9JA 4YT5A 3VYWA 4MNDA 4P6IC 4PFPA 2HV7A 1YA7O 2YKZA 3LEVA 4P9TA 2L6FA 3U9MA 4CS8C 2TMVP 4WGYA 2VC9A 1MMAA 3T9OA 2A1DD 1E2XA 4N6HA 2BL2A 1G8XA 3SXYA 1EQ1A 3QVYA 1TQGA 4YT8A 2QNLA 2YHSA 4X0RA 3O6XA 1YVIA 2HJMA 1TWHA 5KYXA 1ZHTA 1HE1A 4BJ5A 5L0GA 1YZCA 3AJMA 3O55A 4I44A 3U3FA 3AGTA 4WJ0A 3J06A 2A69F 1M57C 4WGZA 2NG1A 1T6IA 2JX0A 2OCCC 3U8VA 4KI2A 3QTHA 4U5CE 3WAQA 1V54C 4BJTA 2YLDA 1BBHA 1M6TA 4PJJA 3W4YA 1SF8A 4N06A 1M2VA 1I4ZA 3RF3A 1D1BA 2GWWA 5JSLA 1HMDA 2ICWG 2LFDA 4MVZA 2RSEB 3EH1A 1S7ZA 1FAPB 3M15A 2V3CC 1CPRA 3M4CA 2G3KA 1YA9A 2XL4A 3ABLC 4EUKB 2C03A 4CX9A 4N4WA 3HNIA 1TWGA 2BC5A 4O6YA 2R7WA 1E85A 1TWCA 2OKUA 1A7EA 3NYJA 4MW8A 3C8ZA 5A6KA 3SXKA 1W2WA 3U0CA 4UDVA 3LNMB 4JEAA 2OEVA 1WWPA 3IEEA 3K1IC 2YL3A 4D4NA 5F28E 2VB6A 3IHUA 4E17A 1LE2A 2I15A 2M4EA 1Y4CA 3L8JA 3S0XA 4OINF 3E9VA 1WGWA 2XLOA 2XLHA 1MNDA 2L9JA 2H7OA 4JTCB 2XXAA 1J8MF 1YYJA 2EPNA 2YVKA 3L34A 1LS1A 4XEFA 2EIJC 2DYSC 2R7QA 1NU7D 3QVZA 3RVYA 2M64A 2HKVA 3ZQVA 1M2OA 1QVXA 5JP7A 4OIOF 1NZEA 2YZSA 2J45A 4KNVA 3IQTA 3POVA 2YL1A 3GODA 1M2VB 1Z5ZA 2IXPA 2KSFA 3OWTA 4I1MA 2R7XA 4I1OB 1OCOC 3IQ6A 4CS7A 1WTYA 4MVUA 1XZQA 2BE5F 4C3DA 1ORJA 3EJNA 2YLIA 4W8KA 2YWAA 2YQYA 4AL0A 5DQZA 1TR2A 2O9XA 3UNGC 3DI5A 3EG9A 2IM8A 4CS8A 2C04A 1U89A 3KYIA 5FZTA 2VH3A 3IQ5A 3NMKA 4JCZA 4K7BA 2J7PA 1BR4A 2YEVA 3U2LA 3HKKA 3FVYA 2AP3A 3ABKC 3GORA 3HTKC 4RBNA 3MFNA 4WABA 4IJJA 1FMVA 3TJ5A 1ZHYA 1EKYA 2QLAA 5B3IA 3GM2A 2ASRA 2XXAB 3DJNB 1NFOA 3C62A 1JR8A 5B3SC 3TULA 1AEPA 1V74B 1FFHA 2XLMA 2LIGA 4MTOA 2P1AA 3T6BA 3US6A 4JURI 3JSZA 3H2UA 1L3PA 1BR2A 2EIMC 2H8AA 3AGUA 3DAFA 1DOVA 2HV6A 1H7IA 4K0DA 4YWQA 1E83A 4MTFA 3DKAA 4BJ6C 2Q00A 1OW7A 2VASA 1O5HA 3EZHA 1FMWA 1JRAA 2UUHA 3JCUQ 2KYHA 3EGDB 1XWJA 2V26A 3HNLA 4MVRA 4MS2A 3SXMA 1T9KA 2J0WA 5DS6A 1VB5A 1VYIA 1YZAA 3DZAA 1QSPA 1RXQA 3I5QA 3EHMA 4GEHA 4GQHA 1K05A 1T5OA 2OJED 4LLCA 4MVOA 1CGME 1JAFA 2XS8A 3GEHA 4DBQA 1WATA 2OG2A 1VLTA 1UFBA 1OKKD 4PACA 3V5ZA 4HFKB 1HMOA 3UR3C 1A7VA 3K1IA 3ZC4A 4JJFA 1LIHA 1L7CA 2AVKA 3UMHA 1MMDA 1PD1A 5COGA 5JLIA 4HE8D 5L0JA 2LQGA 1T6QA 3KKBA 1PD0A 2J0XA 5F5HA 3U3BA 2XL8A 2OOCA 5BQHA 2VCCA 4K1OA 4YL3A 5T3WA 3K66A 4XWJA 4JJGA 4PJMA 2DI3A 2LP4A 3K7DA 5CI9A 5T3TA 3S90A 2R7SA 1EA8A 2A6HF 2CCYA 2PF4E 4EWCA 1Q0MA 3R7CA 4YL0A 3DMDA 3ASNC 3Q7LA 4HEAJ 4LERA 1HW1A 4XEVA 3JRTA 4XLNF 5JT4A 4FAPB 3AOUA 4EBJA 1PCXA 2YRFA 5BUOA 3GM1A 4ANJA 4Z9HA 5BQIA 2IYLD 4J7YA 5COMA 2CW0F 3M79A 5KYYB 2Q4FA 3S9OA 2A68F 1LE4A 2R7OA 3CZ6A 1UG7A 5HV9A 2DGJA 2W4MA 3B29A 1QPUA 5IY5C 2DB4A 2KW3C 2LCHA 1SYQA 4NQFA 2ZXRA 4U9EA 5E3AA 3ZWIA 4CDVA 1NG1A 1HE9A 5KYUA 2QY9A 4MQ9F 3TD7A 1NU9C 2HS5A 1AVOB 3PMRA 4ONSA 1QLEC 3T6JA 1C17M 3V5YA 4DRJB 3GM3A 3C63A 3OEOA 1XZPA 2OEXA 2P6VA 4H4KC 2KK1A 2NPUA 1OKKA 3W8IA 2PX0A 5A6BA 4YL1A 2UUIA 1RKCA 2Q9CA 2FGYA 2A6EF 2Q7RA 2PBEA 3O10A 4CJGA 1J8YF 2AWYA 3FOOA 2HUJA 1KNYA 1U0BB 4CDYA 2G3VA 2H7BA 3T6GB 2A0BA 3NDBB 3G4XA 3RVZA 2MYSA 3N0TA 4NY3A 2YL7A 5L0FA 1LPEA 1E86A 1VTMP 4U5DE 4U5FE 2ZXWC 1CPQA 3H65A 1IZMA 3A11A 4KBLA 3RKOF 3NYMA 4C7OB 4BJ6A 4MVMA 4XPXA 4E0HA 3L8IA 1NFNA 1OXBA 2OJQA 5L0CA 3DJUB 4LLEA 2HMQA 5E3CA 1F1MA 2W45A 3LLKA 2I8BA 3LUTB 4CIHA 3EPVA 3HNJA 3AG4C 3NYLA 3VM6A 1G4WR 3C8GD 4GYTA 1JPJA 4H54A 1FFTC 3CQZA 3X2QC 2A0UA 4OD5A 3ZSUA 1OCRC 1GS9A 2JD3A 1OW6A 2Q3TA 3HNKA 3V5XA 3ATPA 4IWBA 4FESA 4U5HA 4QI0A 5A6AA 1BDJB 5KYUB 4XEKA 1RJ9B 1G4US 3HJCA 5DLJA 4QDLA 1PV3A 1GM5A 2R7TA 2CNWD 5F5FA 2EPMX 3K1HA 4L6RA 3Q6MA 1RMVA 4Q5SF 3FOPA 1LVKA 2R7UA 3ECSA 3B0VC 3AG1C 2KGOA 2HMZA 1OR2A 3I4UA 1WOLA 3QW0A 3NG1A 1I5NA 2OQMA 2R25A 3MYIA 3CSKA 4A4AA 3TOMA 4G7HF 3ZTZA 2JPUA 2LSEA 3RIPA 3ITFA 3U8PA 3JZ0A 4ZLCA 4PK4A 3EGDA 5L0IA 2L6GA 1C02A 2D5RB 4O79A 3FHDA 3EFOA 3KH2A 4JEBA 2NSGA 3LS1A 3VF0A 3S28A 3HLZA 2LD6A 1ZHWA 2R02A 4PFOA 3DXJF 1VLSA 3KPHA 1OCCC 2HZ8A 1BR1A 4HFFB 3LEOA 4IAQA 4U5EE 2WVOA 4EBBA 5L0HA 3MYFA 2L6HA 4PJNA 3S84A 3SEOA 3PCVA 2R03A 3BEHA 1ZHXA 2EPLX 2HJ3A 3EQLF 3TOLA 4C3EA 1A7DA 1ZHZA 3B9QA 3T4RA 3W8HA 4DVYP 4Q4ZF 1K40A 3DE8A 4EHPA 5AC5A 4ER9A 2AWCA 3K6BA 5HSWA 3BRJA
chains in the Genus database with same CATH topology
1WASA 3ATPA 2LIGA 2D4UA 1WATA 1LIHA 1VLTA 1VLSA 2ASRA 4H54A 4Z9IA 4Z9HA 3T9OA 4Z9JA 1JMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAS A;  3ATP A;  2LIG A;  2D4U A;  1WAT A;  1LIH A;  1VLT A;  1VLS A;  2ASR A;  4H54 A;  4Z9I A;  4Z9H A;  3T9O A;  4Z9J A;  1JMW A; 
#chains in the Genus database with same CATH topology
 2MHR A;  2L7A A;  4G78 A;  4DXW A;  3MLG A;  2PFD A;  4NTA A;  5AGF A;  3RH3 A;  1B68 A;  2J9U A;  4IAO A;  4JTA B;  3JYH A;  2CNW A;  5DQT A;  4CBE A;  3DM9 B;  4CDA A;  2H7V C;  4AK9 A;  1T01 A;  1U6H A;  1Y6D A;  1OCZ C;  3EGX B;  4JW1 A;  1LI7 A;  1TFO B;  3SNH A;  1YJG A;  3TK0 A;  4ULV A;  4CS9 C;  4MTG A;  4BEJ A;  3SYN A;  4DVZ A;  1TFK B;  2W9Y A;  2IXN A;  3EHN A;  2PNO A;  3Q7G A;  5TJ5 E;  4OD4 A;  4JCH A;  4IGG A;  5L3V A;  3EFO B;  3VRC A;  1SMY F;  3M1C B;  4E7Z A;  5KYY A;  1D1C A;  1QQ3 A;  3UMK A;  1LI5 A;  2XLV A;  1BZ4 A;  2IBF A;  4KC9 A;  3TJ6 A;  3RQE A;  3SZR A;  3B0P A;  4E7S A;  1K04 A;  4I3M A;  2CYD A;  5A6J A;  1S05 A;  3ZIB A;  5DS4 A;  1M56 C;  3G50 A;  2ZD9 A;  4R32 A;  4EIY A;  1RKE B;  2QUP A;  2IOQ A;  3C8G B;  2HSQ A;  3GWN A;  2MWQ A;  5E33 A;  5JVE A;  2GFH A;  4MVS A;  2Q9A A;  2Q9B A;  3AG2 C;  3IQC A;  1V55 C;  2GDC A;  2XL6 A;  3V7O A;  4DBR A;  3E70 C;  5A69 A;  3FDQ A;  1MMG A;  4YT2 A;  3QZC A;  4IB4 A;  1VK5 A;  1MMN A;  1WN0 A;  4AX2 A;  1YLM A;  1Z23 A;  2WL8 A;  4CSA C;  4EBK A;  2OU6 A;  4N6C A;  5B1B C;  1CGO A;  1OW8 A;  2PP4 A;  4AL1 A;  1T6U A;  4XLP F;  4C7O A;  2D4U A;  1I4Y A;  1QKR A;  1ZU4 A;  4AE4 B;  5L3Q A;  2Y39 A;  4NCQ A;  2Z15 A;  3RQG A;  2XSE A;  4LDQ A;  4O6N A;  2LFF A;  4FWV A;  1JMW A;  3GEE A;  1QZX A;  3LLI A;  4E0I A;  5EK0 A;  1IW7 F;  3LAY A;  5BQG A;  1ZW2 A;  3ZG1 A;  2E87 A;  3VAY A;  3LNR A;  3KYJ A;  1N1C A;  2XLW A;  4P9F A;  4IRU A;  5D92 A;  4A2N B;  2LK4 A;  3JTL O;  1ZVZ A;  2KNH A;  3FMS A;  2P61 A;  3MBG A;  2B0J A;  2VCB A;  1ZU5 A;  3DM5 A;  4KNW A;  4OIP F;  2NUT B;  1RJ9 A;  3PHF 2;  4RD9 A;  3W2W A;  1Q0G A;  1NSG B;  1SZI A;  3NKE A;  1GGQ A;  3GAN A;  1ZYR F;  4W8P A;  3ZQY A;  4RDA A;  1NLX A;  1O87 A;  2WB7 A;  3I5P A;  3RQF A;  2WZL A;  3S27 A;  4BPM A;  2YLG A;  2HSB A;  3NKD A;  1V4A A;  4PJL A;  4JIO A;  3N2Z B;  4U9D A;  3EZI A;  3H2V A;  4J7T A;  4JKV A;  3ASO C;  3UGO A;  2WZG A;  3K33 A;  3KL4 A;  4CJO A;  3JT1 A;  2XM4 A;  1D0Y A;  1JPN A;  3DWW A;  4Z9I A;  3WHN A;  2B0H A;  5L0D A;  3B0U X;  2R7R A;  2ZPA A;  3EH2 A;  3QMK A;  3L0I A;  2CGE A;  4CS9 A;  1ORY A;  2EPO A;  4ULW A;  1VYK A;  3LES A;  3U2M A;  3MX3 A;  1MNE A;  1WAS A;  2DYR C;  3OA1 A;  4CIP A;  2AU5 A;  2FFH A;  3WG7 C;  3RFY A;  2Y3B A;  1CGN A;  4E18 A;  4G7Z F;  4U5G A;  2GAQ A;  2NUP A;  3LJB A;  2EIL C;  1ZZP A;  2J7P D;  1LKX A;  2J46 A;  1ZW3 A;  2PX3 A;  3NRH A;  3Q6N A;  3RW0 A;  4YJW A;  1YAU O;  4BEM J;  1KTM A;  4PR9 A;  3NMJ A;  3X1O A;  2WVQ A;  1YAR O;  1OQC A;  2W4B A;  2ZXO A;  3FAP B;  4O6M A;  3ZTM A;  3N24 A;  5KYX B;  5JRA A;  4G7O F;  3GEI A;  3EGX A;  2QE9 A;  1Q0D A;  2XRH A;  4YT4 A;  4XTK A;  4NTB A;  1HY5 A;  4YK5 A;  3JYY A;  4OIR F;  1G5Z A;  2J8W A;  3R2P A;  2KC3 A;  4CSA A;  2XLD A;  3AG3 C;  4JTD B;  3TQO A;  1R5I D;  4Q7C A;  4EKW A;  1YYX A;  2CDQ A;  1D1A A;  4B6I A;  1H9T A;  1TWA A;  3RYL A;  1D0X A;  5K0I A;  1JOG A;  4JE9 A;  4O7G A;  3U5S A;  2X0C A;  4D4X A;  4DRI B;  1C03 A;  5EGY A;  4JRZ A;  5E2Q A;  5KYW A;  2IXM A;  1RKE A;  3DE9 A;  3CAX A;  1LS4 A;  1A0B A;  1TKN A;  2NUP B;  3C8G A;  3FAJ A;  2X51 A;  1A41 A;  1O3U A;  4LDR A;  3A9C A;  2XS1 A;  2XM0 A;  1R4T A;  3AQC A;  1H9G A;  3M4B A;  2J9V A;  3U9J A;  1ORS C;  1MQV A;  3JRM O;  3S29 A;  4BJ5 C;  4DOZ A;  1E84 A;  4ZLD A;  3IPM O;  5COF A;  2XLE A;  3NMI A;  1FR0 A;  4XQ1 A;  2Y3G A;  2QTV A;  3UMI A;  3AQB A;  3F47 A;  4AE4 A;  1FNT c;  4QI2 A;  3FXH A;  1Z3I X;  2KQ9 A;  1OXK A;  2R9R B;  2VCA A;  4BJ1 A;  1YDI A;  1VMA A;  1Z63 A;  2WZF A;  4U5B E;  2WVN A;  2IXO A;  2P0N A;  2R7V A;  3W2V A;  3LS0 A;  4M63 A;  4NC3 A;  2L81 A;  3F46 A;  1EI7 A;  3ZDL A;  3ABM C;  3C18 A;  5JS5 A;  2G62 A;  3DD7 A;  5JUA A;  1FTS A;  2F22 A;  1H6G A;  1RCP A;  2Y3H A;  2NUT A;  3O39 A;  2RD9 A;  5T1D B;  1AUE A;  2EPK X;  5KYW B;  5D91 A;  1OR3 A;  1Q0F A;  5DVW A;  3WOD F;  2FAP B;  4JC7 A;  1D0Z A;  2Y69 C;  2GA0 A;  4G0H A;  5B1A C;  4JVS A;  2KJG A;  5DS5 A;  1SR2 A;  2EIK C;  3EG9 B;  3L1M A;  2J9B A;  2HFI A;  5CI8 A;  3UGP A;  1HW2 A;  4MW3 A;  256B A;  1LM3 B;  2P7V A;  4JZA A;  1Z6A A;  2ETS A;  3CEX A;  3JSE O;  1GQA A;  4LDK A;  3GWL A;  2NSF A;  3C7J A;  4NTF A;  4XPY A;  3SXZ A;  2EIN C;  4DRH B;  5AC4 A;  5A6B D;  4J32 B;  2R05 A;  1APC A;  5GPG B;  4C3B A;  1ST6 A;  4XPW A;  4MVQ A;  4YN0 B;  4FX5 A;  4BG0 A;  4DJ9 A;  1Q0K A;  5EHH A;  3KMI A;  5KYN A;  3ZVR A;  1VOM A;  4IAR A;  4J30 B;  4OIQ F;  1DOW A;  3QW1 A;  2ZXP A;  2Y3D A;  3DAG A;  3PDM P;  1KU2 A;  2YL0 A;  3B71 A;  3SP1 A;  1NBB A;  2J9W A;  5CIV A;  4F4B A;  1Z7Q c;  4LAC B;  5FCL A;  3G4Z A;  4Z9J A;  4YT5 A;  3VYW A;  4MND A;  4P6I C;  4PFP A;  2HV7 A;  1YA7 O;  2YKZ A;  3LEV A;  4P9T A;  2L6F A;  3U9M A;  4CS8 C;  2TMV P;  4WGY A;  2VC9 A;  1MMA A;  3T9O A;  2A1D D;  1E2X A;  4N6H A;  2BL2 A;  1G8X A;  3SXY A;  1EQ1 A;  3QVY A;  1TQG A;  4YT8 A;  2QNL A;  2YHS A;  4X0R A;  3O6X A;  1YVI A;  2HJM A;  1TWH A;  5KYX A;  1ZHT A;  1HE1 A;  4BJ5 A;  5L0G A;  1YZC A;  3AJM A;  3O55 A;  4I44 A;  3U3F A;  3AGT A;  4WJ0 A;  3J06 A;  2A69 F;  1M57 C;  4WGZ A;  2NG1 A;  1T6I A;  2JX0 A;  2OCC C;  3U8V A;  4KI2 A;  3QTH A;  4U5C E;  3WAQ A;  1V54 C;  4BJT A;  2YLD A;  1BBH A;  1M6T A;  4PJJ A;  3W4Y A;  1SF8 A;  4N06 A;  1M2V A;  1I4Z A;  3RF3 A;  1D1B A;  2GWW A;  5JSL A;  1HMD A;  2ICW G;  2LFD A;  4MVZ A;  2RSE B;  3EH1 A;  1S7Z A;  1FAP B;  3M15 A;  2V3C C;  1CPR A;  3M4C A;  2G3K A;  1YA9 A;  2XL4 A;  3ABL C;  4EUK B;  2C03 A;  4CX9 A;  4N4W A;  3HNI A;  1TWG A;  2BC5 A;  4O6Y A;  2R7W A;  1E85 A;  1TWC A;  2OKU A;  1A7E A;  3NYJ A;  4MW8 A;  3C8Z A;  5A6K A;  3SXK A;  1W2W A;  3U0C A;  4UDV A;  3LNM B;  4JEA A;  2OEV A;  1WWP A;  3IEE A;  3K1I C;  2YL3 A;  4D4N A;  5F28 E;  2VB6 A;  3IHU A;  4E17 A;  1LE2 A;  2I15 A;  2M4E A;  1Y4C A;  3L8J A;  3S0X A;  4OIN F;  3E9V A;  1WGW A;  2XLO A;  2XLH A;  1MND A;  2L9J A;  2H7O A;  4JTC B;  2XXA A;  1J8M F;  1YYJ A;  2EPN A;  2YVK A;  3L34 A;  1LS1 A;  4XEF A;  2EIJ C;  2DYS C;  2R7Q A;  1NU7 D;  3QVZ A;  3RVY A;  2M64 A;  2HKV A;  3ZQV A;  1M2O A;  1QVX A;  5JP7 A;  4OIO F;  1NZE A;  2YZS A;  2J45 A;  4KNV A;  3IQT A;  3POV A;  2YL1 A;  3GOD A;  1M2V B;  1Z5Z A;  2IXP A;  2KSF A;  3OWT A;  4I1M A;  2R7X A;  4I1O B;  1OCO C;  3IQ6 A;  4CS7 A;  1WTY A;  4MVU A;  1XZQ A;  2BE5 F;  4C3D A;  1ORJ A;  3EJN A;  2YLI A;  4W8K A;  2YWA A;  2YQY A;  4AL0 A;  5DQZ A;  1TR2 A;  2O9X A;  3UNG C;  3DI5 A;  3EG9 A;  2IM8 A;  4CS8 A;  2C04 A;  1U89 A;  3KYI A;  5FZT A;  2VH3 A;  3IQ5 A;  3NMK A;  4JCZ A;  4K7B A;  2J7P A;  1BR4 A;  2YEV A;  3U2L A;  3HKK A;  3FVY A;  2AP3 A;  3ABK C;  3GOR A;  3HTK C;  4RBN A;  3MFN A;  4WAB A;  4IJJ A;  1FMV A;  3TJ5 A;  1ZHY A;  1EKY A;  2QLA A;  5B3I A;  3GM2 A;  2ASR A;  2XXA B;  3DJN B;  1NFO A;  3C62 A;  1JR8 A;  5B3S C;  3TUL A;  1AEP A;  1V74 B;  1FFH A;  2XLM A;  2LIG A;  4MTO A;  2P1A A;  3T6B A;  3US6 A;  4JUR I;  3JSZ A;  3H2U A;  1L3P A;  1BR2 A;  2EIM C;  2H8A A;  3AGU A;  3DAF A;  1DOV A;  2HV6 A;  1H7I A;  4K0D A;  4YWQ A;  1E83 A;  4MTF A;  3DKA A;  4BJ6 C;  2Q00 A;  1OW7 A;  2VAS A;  1O5H A;  3EZH A;  1FMW A;  1JRA A;  2UUH A;  3JCU Q;  2KYH A;  3EGD B;  1XWJ A;  2V26 A;  3HNL A;  4MVR A;  4MS2 A;  3SXM A;  1T9K A;  2J0W A;  5DS6 A;  1VB5 A;  1VYI A;  1YZA A;  3DZA A;  1QSP A;  1RXQ A;  3I5Q A;  3EHM A;  4GEH A;  4GQH A;  1K05 A;  1T5O A;  2OJE D;  4LLC A;  4MVO A;  1CGM E;  1JAF A;  2XS8 A;  3GEH A;  4DBQ A;  1WAT A;  2OG2 A;  1VLT A;  1UFB A;  1OKK D;  4PAC A;  3V5Z A;  4HFK B;  1HMO A;  3UR3 C;  1A7V A;  3K1I A;  3ZC4 A;  4JJF A;  1LIH A;  1L7C A;  2AVK A;  3UMH A;  1MMD A;  1PD1 A;  5COG A;  5JLI A;  4HE8 D;  5L0J A;  2LQG A;  1T6Q A;  3KKB A;  1PD0 A;  2J0X A;  5F5H A;  3U3B A;  2XL8 A;  2OOC A;  5BQH A;  2VCC A;  4K1O A;  4YL3 A;  5T3W A;  3K66 A;  4XWJ A;  4JJG A;  4PJM A;  2DI3 A;  2LP4 A;  3K7D A;  5CI9 A;  5T3T A;  3S90 A;  2R7S A;  1EA8 A;  2A6H F;  2CCY A;  2PF4 E;  4EWC A;  1Q0M A;  3R7C A;  4YL0 A;  3DMD A;  3ASN C;  3Q7L A;  4HEA J;  4LER A;  1HW1 A;  4XEV A;  3JRT A;  4XLN F;  5JT4 A;  4FAP B;  3AOU A;  4EBJ A;  1PCX A;  2YRF A;  5BUO A;  3GM1 A;  4ANJ A;  4Z9H A;  5BQI A;  2IYL D;  4J7Y A;  5COM A;  2CW0 F;  3M79 A;  5KYY B;  2Q4F A;  3S9O A;  2A68 F;  1LE4 A;  2R7O A;  3CZ6 A;  1UG7 A;  5HV9 A;  2DGJ A;  2W4M A;  3B29 A;  1QPU A;  5IY5 C;  2DB4 A;  2KW3 C;  2LCH A;  1SYQ A;  4NQF A;  2ZXR A;  4U9E A;  5E3A A;  3ZWI A;  4CDV A;  1NG1 A;  1HE9 A;  5KYU A;  2QY9 A;  4MQ9 F;  3TD7 A;  1NU9 C;  2HS5 A;  1AVO B;  3PMR A;  4ONS A;  1QLE C;  3T6J A;  1C17 M;  3V5Y A;  4DRJ B;  3GM3 A;  3C63 A;  3OEO A;  1XZP A;  2OEX A;  2P6V A;  4H4K C;  2KK1 A;  2NPU A;  1OKK A;  3W8I A;  2PX0 A;  5A6B A;  4YL1 A;  2UUI A;  1RKC A;  2Q9C A;  2FGY A;  2A6E F;  2Q7R A;  2PBE A;  3O10 A;  4CJG A;  1J8Y F;  2AWY A;  3FOO A;  2HUJ A;  1KNY A;  1U0B B;  4CDY A;  2G3V A;  2H7B A;  3T6G B;  2A0B A;  3NDB B;  3G4X A;  3RVZ A;  2MYS A;  3N0T A;  4NY3 A;  2YL7 A;  5L0F A;  1LPE A;  1E86 A;  1VTM P;  4U5D E;  4U5F E;  2ZXW C;  1CPQ A;  3H65 A;  1IZM A;  3A11 A;  4KBL A;  3RKO F;  3NYM A;  4C7O B;  4BJ6 A;  4MVM A;  4XPX A;  4E0H A;  3L8I A;  1NFN A;  1OXB A;  2OJQ A;  5L0C A;  3DJU B;  4LLE A;  2HMQ A;  5E3C A;  1F1M A;  2W45 A;  3LLK A;  2I8B A;  3LUT B;  4CIH A;  3EPV A;  3HNJ A;  3AG4 C;  3NYL A;  3VM6 A;  1G4W R;  3C8G D;  4GYT A;  1JPJ A;  4H54 A;  1FFT C;  3CQZ A;  3X2Q C;  2A0U A;  4OD5 A;  3ZSU A;  1OCR C;  1GS9 A;  2JD3 A;  1OW6 A;  2Q3T A;  3HNK A;  3V5X A;  3ATP A;  4IWB A;  4FES A;  4U5H A;  4QI0 A;  5A6A A;  1BDJ B;  5KYU B;  4XEK A;  1RJ9 B;  1G4U S;  3HJC A;  5DLJ A;  4QDL A;  1PV3 A;  1GM5 A;  2R7T A;  2CNW D;  5F5F A;  2EPM X;  3K1H A;  4L6R A;  3Q6M A;  1RMV A;  4Q5S F;  3FOP A;  1LVK A;  2R7U A;  3ECS A;  3B0V C;  3AG1 C;  2KGO A;  2HMZ A;  1OR2 A;  3I4U A;  1WOL A;  3QW0 A;  3NG1 A;  1I5N A;  2OQM A;  2R25 A;  3MYI A;  3CSK A;  4A4A A;  3TOM A;  4G7H F;  3ZTZ A;  2JPU A;  2LSE A;  3RIP A;  3ITF A;  3U8P A;  3JZ0 A;  4ZLC A;  4PK4 A;  3EGD A;  5L0I A;  2L6G A;  1C02 A;  2D5R B;  4O79 A;  3FHD A;  3EFO A;  3KH2 A;  4JEB A;  2NSG A;  3LS1 A;  3VF0 A;  3S28 A;  3HLZ A;  2LD6 A;  1ZHW A;  2R02 A;  4PFO A;  3DXJ F;  1VLS A;  3KPH A;  1OCC C;  2HZ8 A;  1BR1 A;  4HFF B;  3LEO A;  4IAQ A;  4U5E E;  2WVO A;  4EBB A;  5L0H A;  3MYF A;  2L6H A;  4PJN A;  3S84 A;  3SEO A;  3PCV A;  2R03 A;  3BEH A;  1ZHX A;  2EPL X;  2HJ3 A;  3EQL F;  3TOL A;  4C3E A;  1A7D A;  1ZHZ A;  3B9Q A;  3T4R A;  3W8H A;  4DVY P;  4Q4Z F;  1K40 A;  3DE8 A;  4EHP A;  5AC5 A;  4ER9 A;  2AWC A;  3K6B A;  5HSW A;  3BRJ A; 
#chains in the Genus database with same CATH homology
 1WAS A;  3ATP A;  2LIG A;  2D4U A;  1WAT A;  1LIH A;  1VLT A;  1VLS A;  2ASR A;  4H54 A;  4Z9I A;  4Z9H A;  3T9O A;  4Z9J A;  1JMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...