2ASRA

The three-dimensional structure of the aspartate receptor from escherichia coli
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
142
structure length
142
Chain Sequence
KSFVVSNQLREQQGELTSTWDLMLQTRINLSRSAVRMMMDSSNQQSNAKVELLDSARKTLAQAATHYKKFKSMAPLPEMVATSRNIDEKYKNYYTALTELIDYLDYGNTGAYFAQPTQGMQNAMGERFAQYALSSEKLYRDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of the aspartate receptor from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chemotaxis
molecule keywords ASPARTATE RECEPTOR
total genus 71
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 1994-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 2asrA00
4Z9JA 1WASA 1VLSA 1VLTA 1JMWA 1WATA 3ATPA 3T9OA 2ASRA 1LIHA 4H54A 2LIGA 4Z9IA 4Z9HA 2D4UA
chains in the Genus database with same CATH superfamily
1CGOA 3I4UA 1YYJA 3MYIA 2CDQA 3Q7LA 2DYRC 3QMKA 4LDRA 5CI8A 4AL0A 1DOWA 2GA0A 1Q0DA 4CS9C 3L1MA 1OCOC 5CIVA 2YLDA 3EPVA 256BA 3NRHA 4UDVA 4DJ9A 4G78A 2HV7A 3AOUA 2B0JA 2OCCC 2G62A 4OIRF 4NTFA 2P61A 4HE8D 1AVOB 1APCA 3QW0A 3U2LA 2BL2A 2EPOA 4RDAA 2PP4A 4GYTA 3UNGC 4C3DA 4KNWA 2ICWG 3C62A 3VM6A 2I15A 3T6GB 4I44A 1VLTA 3OEOA 4LLEA 3AGTA 3O39A 1QKRA 4NTBA 2Y39A 2I8BA 1TWAA 3GEHA 5K0IA 2YVKA 2R25A 3HKKA 1U6HA 1VOMA 2IXMA 3SXKA 1BR1A 4RD9A 5KYWB 3AG2C 3IPMO 2P6VA 2R02A 4MVRA 5CI9A 3MBGA 4F4BA 1M2VA 3Q7GA 2EIKC 3DMDA 2XS8A 3UR3C 4CDAA 4ER9A 1FFTC 5JT4A 3JT1A 4YL3A 1JMWA 5B1BC 3DE8A 3NKEA 3LEOA 3C18A 1TWGA 4B6IA 3J06A 2XSEA 1VMAA 2R7OA 3RQFA 2OU6A 4CSAA 2KQ9A 1M57C 1YA9A 3KYIA 1E85A 2C04A 3US6A 1VYKA 2OEVA 2YLIA 4E18A 3JTLO 3U8PA 2R7QA 3V5ZA 4D4NA 3LUTB 3HNIA 2Q9CA 4IAOA 4DRHB 5A6BA 1H9TA 2R7XA 4N6HA 3C7JA 3F46A 1YA7O 3KH2A 3R2PA 5F28E 2JX0A 3W8HA 4W8PA 1L3PA 2ZXOA 5A6KA 2XLWA 3LESA 2IXOA 1WTYA 3MFNA 1J8MF 4MVMA 4WABA 4MNDA 2W4BA 2WB7A 4IWBA 4JURI 4NC3A 3W8IA 2JPUA 3ZWIA 5BQHA 1C03A 4NY3A 1GM5A 1M6TA 1FTSA 3GWLA 2PNOA 2CW0F 2QE9A 3HTKC 4PJMA 3TD7A 5BQIA 1VTMP 1BR4A 2VCBA 5EHHA 2Q9BA 2RD9A 2W45A 1ZHTA 4OIQF 3DXJF 1TWCA 2YHSA 2YWAA 3RH3A 5JS5A 2LP4A 3EHNA 2GAQA 4C7OA 2O9XA 4K7BA 1OXBA 4PJLA 1TQGA 4KI2A 4MQ9F 1TWHA 4ONSA 1IW7F 1T5OA 4KNVA 1LS4A 4O6YA 3AQBA 2YL1A 4ULWA 3U3BA 1Q0FA 4CX9A 5L3QA 2NSGA 3U9MA 4OIOF 3EGDB 1Z23A 3K1HA 4JRZA 1I4ZA 5IY5C 4G7OF 3POVA 2XM4A 3K33A 4JJFA 2A6HF 1G5ZA 1WWPA 5L3VA 4PFOA 3N0TA 4NCQA 4BJ1A 4U9EA 3JCUQ 2LIGA 1Z3IX 1D1BA 1ZHWA 2EILC 1MMDA 3L34A 1VLSA 2HFIA 2KNHA 3Q6NA 2HZ8A 2BE5F 1LM3B 4U9DA 4LDQA 2X51A 5KYNA 1ZU5A 3S0XA 3EGDA 2YEVA 1E86A 1V55C 4EBBA 1R5ID 3B0UX 3DJUB 1VB5A 3ASNC 1Z5ZA 4U5DE 4EBKA 4LDKA 3RKOF 2PFDA 3SZRA 4CS8C 2MHRA 4PJJA 1D0ZA 3UGOA 3AJMA 1OW8A 1K05A 1O5HA 1RKEB 1RKCA 4N6CA 1S05A 4E0HA 5A69A 4YT8A 1SYQA 2EIJC 2XLOA 5L0DA 5EK0A 2EIMC 5TJ5E 3S29A 1SR2A 1E83A 2Y3DA 1A0BA 3HNJA 2H8AA 3KL4A 4Z9IA 1C02A 2XXAB 4BEJA 3SXYA 5JP7A 3FOOA 5L0IA 4LACB 5A6BD 1HE9A 2LD6A 3DAGA 4OD4A 3JZ0A 3RIPA 3S90A 1AEPA 3FXHA 3K66A 4ZLCA 1KTMA 5KYUB 2UUIA 3CAXA 2YQYA 2CNWA 5A6JA 3LLIA 1XZQA 1R4TA 3T4RA 5KYWA 2VASA 2Q4FA 2ZXWC 2YL3A 5E2QA 3U3FA 2J0WA 1SF8A 3EQLF 3LEVA 2QUPA 4ZLDA 4PACA 2XL8A 2QTVA 3FAPB 1JOGA 1C17M 3C8GB 5B1AC 3C63A 5DS4A 3CEXA 3EFOB 2R7RA 1W2WA 3I5PA 3JRMO 2XXAA 3B9QA 3PDMP 3MLGA 4P9FA 4JKVA 4G7HF 3IQCA 5KYXB 1D1AA 4L6RA 4J30B 3Q6MA 3RW0A 2M64A 3PCVA 1ZHYA 2R05A 3QVYA 1YAUO 5L0CA 1QZXA 3WAQA 2A69F 2P7VA 2Q7RA 1G8XA 1TKNA 3T6BA 5E3CA 4MVQA 3ZG1A 2L6GA 4DXWA 1VK5A 2PX3A 3N2ZB 4N4WA 3SXZA 3IQ6A 1T9KA 2A1DD 2G3VA 2L6FA 1NG1A 4WJ0A 3SYNA 2J9BA 1XZPA 1WASA 3OA1A 3VRCA 3JRTA 2HMQA 4YL0A 2J9UA 3X2QC 3HJCA 1CGME 2H7VC 2KSFA 3A9CA 4MTOA 4MW3A 1WN0A 3NKDA 1T6UA 3U5SA 2YL0A 4AX2A 2QLAA 4EHPA 2HS5A 3K1IC 5EGYA 1ORJA 1XWJA 1FFHA 2Q00A 1CGNA 3M4CA 1LIHA 3ECSA 1D0XA 1V4AA 1Y6DA 2ZXRA 5JSLA 1BDJB 1ZHXA 5FZTA 3U2MA 5A6AA 4HFFB 3TULA 4U5GA 3AQCA 1SMYF 3UGPA 4YN0B 1G4WR 4YT5A 3TJ5A 2E87A 3MX3A 1NU7D 1VYIA 4JE9A 2VC9A 2Y3HA 1BZ4A 3O55A 2WL8A 3RF3A 3DKAA 2J9VA 4EBJA 4CDYA 1EI7A 1G4US 1Q0MA 4BPMA 1PD1A 2OOCA 1LKXA 4PJNA 3TK0A 5JVEA 4XPWA 3B0VC 1NLXA 1MMNA 2OG2A 4BJ6A 5GPGB 1YJGA 3ZDLA 4ULVA 4CSAC 1U0BB 1M2VB 2ZXPA 3X1OA 3EH2A 3RQEA 3GANA 4KBLA 1FMVA 2J9WA 4G0HA 4XPYA 2XLHA 1WATA 1JPJA 3ZTZA 3KPHA 1H6GA 2XLDA 4XTKA 3W2VA 2ZPAA 3GEIA 1OCRC 4CS9A 2WVQA 3IHUA 3A11A 3KMIA 2R7UA 1U89A 4XEKA 1YLMA 1A41A 1ZHZA 2D5RB 2CGEA 3JYYA 3SNHA 2EPNA 2XLVA 4U5FE 3ZC4A 3L8IA 3RFYA 3T6JA 3HNLA 4GEHA 2DI3A 3NYMA 4YL1A 1ZZPA 2KJGA 3FOPA 2W9YA 4BJ5A 4Q7CA 3DI5A 4ANJA 3DJNB 2HSBA 3GM3A 3VYWA 1RCPA 4BJ6C 4EIYA 1RKEA 1UG7A 4PK4A 3EH1A 3C8GD 1LE4A 1FMWA 2HKVA 1HMOA 2ETSA 3DE9A 3SEOA 2A6EF 4MVZA 3TQOA 1HE1A 5KYYB 3EGXA 2WZLA 3OWTA 4H4KC 3EZIA 2KGOA 1JAFA 1QVXA 2WZGA 3F47A 3FDQA 1YZAA 3G4ZA 2IXPA 2VCCA 3K7DA 2QY9A 2XL4A 3M79A 3V5XA 3ABKC 3B0PA 5DLJA 4N06A 3LJBA 5DVWA 3HLZA 1YARO 3HNKA 3PHF2 1S7ZA 3ABMC 4U5EE 4YT4A 1M2OA 2ASRA 4IRUA 5KYUA 1J8YF 3TOMA 4BJ5C 4C3EA 4JCZA 4EWCA 3AG3C 1RXQA 3AG1C 3JSEO 1YZCA 1O3UA 4MVOA 3RVZA 4G7ZF 4DOZA 4FWVA 3EGXB 1D0YA 1HY5A 2WVOA 4J7YA 3KYJA 1BBHA 3LAYA 5E33A 1OW6A 1ZYRF 2G3KA 2XLEA 2J7PA 2A68F 2PBEA 3H65A 4H54A 1OCCC 2OQMA 3FVYA 3O6XA 4MVSA 3EHMA 2Y3BA 1LS1A 3NYJA 3W4YA 5L0GA 4P9TA 5B3SC 3NMJA 4JCHA 3RVYA 4XEFA 5FCLA 4AE4A 4AK9A 2C03A 3RYLA 5T3WA 3VF0A 1NU9C 4NTAA 2GDCA 1LVKA 2D4UA 2F22A 4WGYA 2OEXA 4J7TA 4E7ZA 4IB4A 4U5CE 2HV6A 2AVKA 1H7IA 2A0UA 5F5FA 4IJJA 4QDLA 2HJMA 2M4EA 4JTAB 1DOVA 1A7DA 4CS7A 2NUPB 3TJ6A 1JRAA 2R9RB 5DQTA 4XLPF 3H2VA 2Y3GA 5HV9A 3EJNA 2Y69C 5T1DB 1GQAA 1OR3A 1K40A 2HSQA 1HMDA 2R7VA 3RQGA 2JD3A 2R03A 3TOLA 1RJ9A 5COFA 4FX5A 1Y4CA 2KW3C 4AL1A 1I5NA 1JR8A 1QSPA 3ZTMA 1FAPB 3S9OA 4I1OB 3M1CB 3GODA 1TFKB 4IAQA 4E17A 3K1IA 2L6HA 4OINF 2J0XA 1GGQA 1M56C 1F1MA 1ORSC 1OQCA 1V54C 3ZIBA 3L0IA 3L8JA 2J46A 2YLGA 3ZQVA 4DRJB 2KC3A 4FAPB 4MVUA 1ST6A 3DD7A 3QZCA 2CNWD 5DS5A 1UFBA 1MQVA 1MNDA 4O79A 4M63A 2EINC 3C8GA 4XPXA 2XRHA 4I3MA 2VH3A 2XL6A 5AC5A 5JUAA 2R7WA 2EPKX 2DB4A 4YJWA 1NSGB 3ITFA 3WODF 2FFHA 1WGWA 4JTCB 3WG7C 1E2XA 2L7AA 1LE2A 2MWQA 5D92A 3ZSUA 1T01A 3DM9B 2ZD9A 4QI0A 1NZEA 2J7PD 2FGYA 3NMKA 4BEMJ 2IBFA 4FESA 3ASOC 2J45A 4MS2A 2LSEA 5DS6A 1PV3A 2W4MA 1SZIA 1HW1A 3GM1A 2AWYA 4A2NB 1Z63A 1QQ3A 1JPNA 4GQHA 4QI2A 4DRIB 4JJGA 4P6IC 1CPQA 3IEEA 3C8ZA 4YK5A 1KU2A 3CQZA 1AUEA 2IM8A 4I1MA 5DQZA 2LK4A 3H2UA 5COMA 2YL7A 3WHNA 4Z9JA 5COGA 3GORA 2XM0A 3ATPA 3E9VA 1EKYA 5D91A 3DWWA 2AP3A 2OKUA 5HSWA 2FAPB 1MMGA 3NG1A 2Z15A 2R7TA 5BQGA 4KC9A 3UMIA 2WVNA 3M15A 5L0JA 2NUPA 4BG0A 1QPUA 1NBBA 1OKKD 4JIOA 4JTDB 4IARA 2VCAA 4C3BA 4DBQA 1ORYA 4EKWA 3IQTA 3LS1A 3AGUA 1NFNA 3E70C 4IGGA 1D1CA 3U8VA 4YT2A 1ZW3A 1N1CA 3AG4C 4EUKB 2LFDA 4JZAA 2OJED 4K0DA 3BEHA 1QLEC 5L0FA 2X0CA 4E7SA 3NYLA 4YWQA 3FAJA 2V26A 4MTGA 4OIPF 1EA8A 4MW8A 1BR2A 2P1AA 4Z9HA 2R7SA 1A7VA 5AGFA 4HFKB 3V7OA 2AU5A 1ZU4A 1OCZC 3BRJA 5JLIA 3IQ5A 4J32B 3UMKA 4JEAA 4WGZA 3SP1A 4CIPA 2Q9AA 2YRFA 3G50A 4C7OB 1Q0KA 2RSEB 4U5HA 4A4AA 4CS8A 4HEAJ 3G4XA 2NG1A 1H9GA 4NQFA 1O87A 3GWNA 1LPEA 3QTHA 3U9JA 3EZHA 1TFOB 2IOQA 2OJQA 2P0NA 4XEVA 2L9JA 4O6MA 3MYFA 2HMZA 2L81A 5E3AA 1LI7A 2KK1A 2PX0A 1LI5A 1MNEA 2LCHA 1ZVZA 2IYLD 2YZSA 3LNMB 2BC5A 3S27A 4DBRA 2NUTB 2EPMX 4O7GA 3B71A 3NMIA 5B3IA 4Q4ZF 3EG9B 2NSFA 3PMRA 1IZMA 4D4XA 2B0HA 2XLMA 3B29A 1NFOA 4X0RA 2VB6A 4DVYP 2NPUA 1HW2A 1EQ1A 1TR2A 3LS0A 5KYYA 1T6IA 3EFOA 2Q3TA 2LFFA 3ZQYA 5T3TA 4PFPA 5BUOA 1PD0A 3O10A 1E84A 4CJOA 1ZW2A 3ABLC 1YYXA 4Q5SF 2J8WA 1FNTc 2UUHA 1L7CA 5KYXA 3DZAA 4CIHA 3KKBA 2YKZA 1RMVA 1V74B 4CJGA 1OKKA 2GWWA 4LERA 2AWCA 3LLKA 3N24A 3EG9A 4DVZA 4CDVA 1RJ9B 3FHDA 4JEBA 2XS1A 5F5HA 2IXNA 3JSZA 4JVSA 4U5BE 1GS9A 4XLNF 2CYDA 5AC4A 2EPLX 1KNYA 4W8KA 4BJTA 2TMVP 3V5YA 3SXMA 3DM5A 2LQGA 4LLCA 3FMSA 2GFHA 5L0HA 3U0CA 4JW1A 3UMHA 2H7BA 1WOLA 4K1OA 4RBNA 1OXKA 1A7EA 1Q0GA 3QVZA 4AE4B 2QNLA 3DAFA 3GM2A 4OD5A 3T9OA 5JRAA 3JYHA 3R7CA 4JC7A 3M4BA 3W2WA 1Z6AA 2HUJA 2MYSA 3QW1A 1CPRA 1MMAA 1Z7Qc 3VAYA 4R32A 2DYSC 3K6BA 1K04A 4XQ1A 1YDIA 1PCXA 1T6QA 3I5QA 1FR0A 3CZ6A 3LNRA 3S28A 1I4YA 4PR9A 4E0IA 3S84A 1OR2A 2CCYA 1YVIA 2DGJA 4O6NA 2KYHA 3GEEA 2NUTA 3ZVRA 2A0BA 4MTFA 4CBEA 1OW7A 2V3CC 2HJ3A 3CSKA 2H7OA 2PF4E 2WZFA 1B68A 3NDBB 4XWJA
chains in the Genus database with same CATH topology
4Z9JA 1WASA 1VLSA 1VLTA 1JMWA 1WATA 3ATPA 3T9OA 2ASRA 1LIHA 4H54A 2LIGA 4Z9IA 4Z9HA 2D4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z9J A;  1WAS A;  1VLS A;  1VLT A;  1JMW A;  1WAT A;  3ATP A;  3T9O A;  2ASR A;  1LIH A;  4H54 A;  2LIG A;  4Z9I A;  4Z9H A;  2D4U A; 
#chains in the Genus database with same CATH topology
 1CGO A;  3I4U A;  1YYJ A;  3MYI A;  2CDQ A;  3Q7L A;  2DYR C;  3QMK A;  4LDR A;  5CI8 A;  4AL0 A;  1DOW A;  2GA0 A;  1Q0D A;  4CS9 C;  3L1M A;  1OCO C;  5CIV A;  2YLD A;  3EPV A;  256B A;  3NRH A;  4UDV A;  4DJ9 A;  4G78 A;  2HV7 A;  3AOU A;  2B0J A;  2OCC C;  2G62 A;  4OIR F;  4NTF A;  2P61 A;  4HE8 D;  1AVO B;  1APC A;  3QW0 A;  3U2L A;  2BL2 A;  2EPO A;  4RDA A;  2PP4 A;  4GYT A;  3UNG C;  4C3D A;  4KNW A;  2ICW G;  3C62 A;  3VM6 A;  2I15 A;  3T6G B;  4I44 A;  1VLT A;  3OEO A;  4LLE A;  3AGT A;  3O39 A;  1QKR A;  4NTB A;  2Y39 A;  2I8B A;  1TWA A;  3GEH A;  5K0I A;  2YVK A;  2R25 A;  3HKK A;  1U6H A;  1VOM A;  2IXM A;  3SXK A;  1BR1 A;  4RD9 A;  5KYW B;  3AG2 C;  3IPM O;  2P6V A;  2R02 A;  4MVR A;  5CI9 A;  3MBG A;  4F4B A;  1M2V A;  3Q7G A;  2EIK C;  3DMD A;  2XS8 A;  3UR3 C;  4CDA A;  4ER9 A;  1FFT C;  5JT4 A;  3JT1 A;  4YL3 A;  1JMW A;  5B1B C;  3DE8 A;  3NKE A;  3LEO A;  3C18 A;  1TWG A;  4B6I A;  3J06 A;  2XSE A;  1VMA A;  2R7O A;  3RQF A;  2OU6 A;  4CSA A;  2KQ9 A;  1M57 C;  1YA9 A;  3KYI A;  1E85 A;  2C04 A;  3US6 A;  1VYK A;  2OEV A;  2YLI A;  4E18 A;  3JTL O;  3U8P A;  2R7Q A;  3V5Z A;  4D4N A;  3LUT B;  3HNI A;  2Q9C A;  4IAO A;  4DRH B;  5A6B A;  1H9T A;  2R7X A;  4N6H A;  3C7J A;  3F46 A;  1YA7 O;  3KH2 A;  3R2P A;  5F28 E;  2JX0 A;  3W8H A;  4W8P A;  1L3P A;  2ZXO A;  5A6K A;  2XLW A;  3LES A;  2IXO A;  1WTY A;  3MFN A;  1J8M F;  4MVM A;  4WAB A;  4MND A;  2W4B A;  2WB7 A;  4IWB A;  4JUR I;  4NC3 A;  3W8I A;  2JPU A;  3ZWI A;  5BQH A;  1C03 A;  4NY3 A;  1GM5 A;  1M6T A;  1FTS A;  3GWL A;  2PNO A;  2CW0 F;  2QE9 A;  3HTK C;  4PJM A;  3TD7 A;  5BQI A;  1VTM P;  1BR4 A;  2VCB A;  5EHH A;  2Q9B A;  2RD9 A;  2W45 A;  1ZHT A;  4OIQ F;  3DXJ F;  1TWC A;  2YHS A;  2YWA A;  3RH3 A;  5JS5 A;  2LP4 A;  3EHN A;  2GAQ A;  4C7O A;  2O9X A;  4K7B A;  1OXB A;  4PJL A;  1TQG A;  4KI2 A;  4MQ9 F;  1TWH A;  4ONS A;  1IW7 F;  1T5O A;  4KNV A;  1LS4 A;  4O6Y A;  3AQB A;  2YL1 A;  4ULW A;  3U3B A;  1Q0F A;  4CX9 A;  5L3Q A;  2NSG A;  3U9M A;  4OIO F;  3EGD B;  1Z23 A;  3K1H A;  4JRZ A;  1I4Z A;  5IY5 C;  4G7O F;  3POV A;  2XM4 A;  3K33 A;  4JJF A;  2A6H F;  1G5Z A;  1WWP A;  5L3V A;  4PFO A;  3N0T A;  4NCQ A;  4BJ1 A;  4U9E A;  3JCU Q;  2LIG A;  1Z3I X;  1D1B A;  1ZHW A;  2EIL C;  1MMD A;  3L34 A;  1VLS A;  2HFI A;  2KNH A;  3Q6N A;  2HZ8 A;  2BE5 F;  1LM3 B;  4U9D A;  4LDQ A;  2X51 A;  5KYN A;  1ZU5 A;  3S0X A;  3EGD A;  2YEV A;  1E86 A;  1V55 C;  4EBB A;  1R5I D;  3B0U X;  3DJU B;  1VB5 A;  3ASN C;  1Z5Z A;  4U5D E;  4EBK A;  4LDK A;  3RKO F;  2PFD A;  3SZR A;  4CS8 C;  2MHR A;  4PJJ A;  1D0Z A;  3UGO A;  3AJM A;  1OW8 A;  1K05 A;  1O5H A;  1RKE B;  1RKC A;  4N6C A;  1S05 A;  4E0H A;  5A69 A;  4YT8 A;  1SYQ A;  2EIJ C;  2XLO A;  5L0D A;  5EK0 A;  2EIM C;  5TJ5 E;  3S29 A;  1SR2 A;  1E83 A;  2Y3D A;  1A0B A;  3HNJ A;  2H8A A;  3KL4 A;  4Z9I A;  1C02 A;  2XXA B;  4BEJ A;  3SXY A;  5JP7 A;  3FOO A;  5L0I A;  4LAC B;  5A6B D;  1HE9 A;  2LD6 A;  3DAG A;  4OD4 A;  3JZ0 A;  3RIP A;  3S90 A;  1AEP A;  3FXH A;  3K66 A;  4ZLC A;  1KTM A;  5KYU B;  2UUI A;  3CAX A;  2YQY A;  2CNW A;  5A6J A;  3LLI A;  1XZQ A;  1R4T A;  3T4R A;  5KYW A;  2VAS A;  2Q4F A;  2ZXW C;  2YL3 A;  5E2Q A;  3U3F A;  2J0W A;  1SF8 A;  3EQL F;  3LEV A;  2QUP A;  4ZLD A;  4PAC A;  2XL8 A;  2QTV A;  3FAP B;  1JOG A;  1C17 M;  3C8G B;  5B1A C;  3C63 A;  5DS4 A;  3CEX A;  3EFO B;  2R7R A;  1W2W A;  3I5P A;  3JRM O;  2XXA A;  3B9Q A;  3PDM P;  3MLG A;  4P9F A;  4JKV A;  4G7H F;  3IQC A;  5KYX B;  1D1A A;  4L6R A;  4J30 B;  3Q6M A;  3RW0 A;  2M64 A;  3PCV A;  1ZHY A;  2R05 A;  3QVY A;  1YAU O;  5L0C A;  1QZX A;  3WAQ A;  2A69 F;  2P7V A;  2Q7R A;  1G8X A;  1TKN A;  3T6B A;  5E3C A;  4MVQ A;  3ZG1 A;  2L6G A;  4DXW A;  1VK5 A;  2PX3 A;  3N2Z B;  4N4W A;  3SXZ A;  3IQ6 A;  1T9K A;  2A1D D;  2G3V A;  2L6F A;  1NG1 A;  4WJ0 A;  3SYN A;  2J9B A;  1XZP A;  1WAS A;  3OA1 A;  3VRC A;  3JRT A;  2HMQ A;  4YL0 A;  2J9U A;  3X2Q C;  3HJC A;  1CGM E;  2H7V C;  2KSF A;  3A9C A;  4MTO A;  4MW3 A;  1WN0 A;  3NKD A;  1T6U A;  3U5S A;  2YL0 A;  4AX2 A;  2QLA A;  4EHP A;  2HS5 A;  3K1I C;  5EGY A;  1ORJ A;  1XWJ A;  1FFH A;  2Q00 A;  1CGN A;  3M4C A;  1LIH A;  3ECS A;  1D0X A;  1V4A A;  1Y6D A;  2ZXR A;  5JSL A;  1BDJ B;  1ZHX A;  5FZT A;  3U2M A;  5A6A A;  4HFF B;  3TUL A;  4U5G A;  3AQC A;  1SMY F;  3UGP A;  4YN0 B;  1G4W R;  4YT5 A;  3TJ5 A;  2E87 A;  3MX3 A;  1NU7 D;  1VYI A;  4JE9 A;  2VC9 A;  2Y3H A;  1BZ4 A;  3O55 A;  2WL8 A;  3RF3 A;  3DKA A;  2J9V A;  4EBJ A;  4CDY A;  1EI7 A;  1G4U S;  1Q0M A;  4BPM A;  1PD1 A;  2OOC A;  1LKX A;  4PJN A;  3TK0 A;  5JVE A;  4XPW A;  3B0V C;  1NLX A;  1MMN A;  2OG2 A;  4BJ6 A;  5GPG B;  1YJG A;  3ZDL A;  4ULV A;  4CSA C;  1U0B B;  1M2V B;  2ZXP A;  3X1O A;  3EH2 A;  3RQE A;  3GAN A;  4KBL A;  1FMV A;  2J9W A;  4G0H A;  4XPY A;  2XLH A;  1WAT A;  1JPJ A;  3ZTZ A;  3KPH A;  1H6G A;  2XLD A;  4XTK A;  3W2V A;  2ZPA A;  3GEI A;  1OCR C;  4CS9 A;  2WVQ A;  3IHU A;  3A11 A;  3KMI A;  2R7U A;  1U89 A;  4XEK A;  1YLM A;  1A41 A;  1ZHZ A;  2D5R B;  2CGE A;  3JYY A;  3SNH A;  2EPN A;  2XLV A;  4U5F E;  3ZC4 A;  3L8I A;  3RFY A;  3T6J A;  3HNL A;  4GEH A;  2DI3 A;  3NYM A;  4YL1 A;  1ZZP A;  2KJG A;  3FOP A;  2W9Y A;  4BJ5 A;  4Q7C A;  3DI5 A;  4ANJ A;  3DJN B;  2HSB A;  3GM3 A;  3VYW A;  1RCP A;  4BJ6 C;  4EIY A;  1RKE A;  1UG7 A;  4PK4 A;  3EH1 A;  3C8G D;  1LE4 A;  1FMW A;  2HKV A;  1HMO A;  2ETS A;  3DE9 A;  3SEO A;  2A6E F;  4MVZ A;  3TQO A;  1HE1 A;  5KYY B;  3EGX A;  2WZL A;  3OWT A;  4H4K C;  3EZI A;  2KGO A;  1JAF A;  1QVX A;  2WZG A;  3F47 A;  3FDQ A;  1YZA A;  3G4Z A;  2IXP A;  2VCC A;  3K7D A;  2QY9 A;  2XL4 A;  3M79 A;  3V5X A;  3ABK C;  3B0P A;  5DLJ A;  4N06 A;  3LJB A;  5DVW A;  3HLZ A;  1YAR O;  3HNK A;  3PHF 2;  1S7Z A;  3ABM C;  4U5E E;  4YT4 A;  1M2O A;  2ASR A;  4IRU A;  5KYU A;  1J8Y F;  3TOM A;  4BJ5 C;  4C3E A;  4JCZ A;  4EWC A;  3AG3 C;  1RXQ A;  3AG1 C;  3JSE O;  1YZC A;  1O3U A;  4MVO A;  3RVZ A;  4G7Z F;  4DOZ A;  4FWV A;  3EGX B;  1D0Y A;  1HY5 A;  2WVO A;  4J7Y A;  3KYJ A;  1BBH A;  3LAY A;  5E33 A;  1OW6 A;  1ZYR F;  2G3K A;  2XLE A;  2J7P A;  2A68 F;  2PBE A;  3H65 A;  4H54 A;  1OCC C;  2OQM A;  3FVY A;  3O6X A;  4MVS A;  3EHM A;  2Y3B A;  1LS1 A;  3NYJ A;  3W4Y A;  5L0G A;  4P9T A;  5B3S C;  3NMJ A;  4JCH A;  3RVY A;  4XEF A;  5FCL A;  4AE4 A;  4AK9 A;  2C03 A;  3RYL A;  5T3W A;  3VF0 A;  1NU9 C;  4NTA A;  2GDC A;  1LVK A;  2D4U A;  2F22 A;  4WGY A;  2OEX A;  4J7T A;  4E7Z A;  4IB4 A;  4U5C E;  2HV6 A;  2AVK A;  1H7I A;  2A0U A;  5F5F A;  4IJJ A;  4QDL A;  2HJM A;  2M4E A;  4JTA B;  1DOV A;  1A7D A;  4CS7 A;  2NUP B;  3TJ6 A;  1JRA A;  2R9R B;  5DQT A;  4XLP F;  3H2V A;  2Y3G A;  5HV9 A;  3EJN A;  2Y69 C;  5T1D B;  1GQA A;  1OR3 A;  1K40 A;  2HSQ A;  1HMD A;  2R7V A;  3RQG A;  2JD3 A;  2R03 A;  3TOL A;  1RJ9 A;  5COF A;  4FX5 A;  1Y4C A;  2KW3 C;  4AL1 A;  1I5N A;  1JR8 A;  1QSP A;  3ZTM A;  1FAP B;  3S9O A;  4I1O B;  3M1C B;  3GOD A;  1TFK B;  4IAQ A;  4E17 A;  3K1I A;  2L6H A;  4OIN F;  2J0X A;  1GGQ A;  1M56 C;  1F1M A;  1ORS C;  1OQC A;  1V54 C;  3ZIB A;  3L0I A;  3L8J A;  2J46 A;  2YLG A;  3ZQV A;  4DRJ B;  2KC3 A;  4FAP B;  4MVU A;  1ST6 A;  3DD7 A;  3QZC A;  2CNW D;  5DS5 A;  1UFB A;  1MQV A;  1MND A;  4O79 A;  4M63 A;  2EIN C;  3C8G A;  4XPX A;  2XRH A;  4I3M A;  2VH3 A;  2XL6 A;  5AC5 A;  5JUA A;  2R7W A;  2EPK X;  2DB4 A;  4YJW A;  1NSG B;  3ITF A;  3WOD F;  2FFH A;  1WGW A;  4JTC B;  3WG7 C;  1E2X A;  2L7A A;  1LE2 A;  2MWQ A;  5D92 A;  3ZSU A;  1T01 A;  3DM9 B;  2ZD9 A;  4QI0 A;  1NZE A;  2J7P D;  2FGY A;  3NMK A;  4BEM J;  2IBF A;  4FES A;  3ASO C;  2J45 A;  4MS2 A;  2LSE A;  5DS6 A;  1PV3 A;  2W4M A;  1SZI A;  1HW1 A;  3GM1 A;  2AWY A;  4A2N B;  1Z63 A;  1QQ3 A;  1JPN A;  4GQH A;  4QI2 A;  4DRI B;  4JJG A;  4P6I C;  1CPQ A;  3IEE A;  3C8Z A;  4YK5 A;  1KU2 A;  3CQZ A;  1AUE A;  2IM8 A;  4I1M A;  5DQZ A;  2LK4 A;  3H2U A;  5COM A;  2YL7 A;  3WHN A;  4Z9J A;  5COG A;  3GOR A;  2XM0 A;  3ATP A;  3E9V A;  1EKY A;  5D91 A;  3DWW A;  2AP3 A;  2OKU A;  5HSW A;  2FAP B;  1MMG A;  3NG1 A;  2Z15 A;  2R7T A;  5BQG A;  4KC9 A;  3UMI A;  2WVN A;  3M15 A;  5L0J A;  2NUP A;  4BG0 A;  1QPU A;  1NBB A;  1OKK D;  4JIO A;  4JTD B;  4IAR A;  2VCA A;  4C3B A;  4DBQ A;  1ORY A;  4EKW A;  3IQT A;  3LS1 A;  3AGU A;  1NFN A;  3E70 C;  4IGG A;  1D1C A;  3U8V A;  4YT2 A;  1ZW3 A;  1N1C A;  3AG4 C;  4EUK B;  2LFD A;  4JZA A;  2OJE D;  4K0D A;  3BEH A;  1QLE C;  5L0F A;  2X0C A;  4E7S A;  3NYL A;  4YWQ A;  3FAJ A;  2V26 A;  4MTG A;  4OIP F;  1EA8 A;  4MW8 A;  1BR2 A;  2P1A A;  4Z9H A;  2R7S A;  1A7V A;  5AGF A;  4HFK B;  3V7O A;  2AU5 A;  1ZU4 A;  1OCZ C;  3BRJ A;  5JLI A;  3IQ5 A;  4J32 B;  3UMK A;  4JEA A;  4WGZ A;  3SP1 A;  4CIP A;  2Q9A A;  2YRF A;  3G50 A;  4C7O B;  1Q0K A;  2RSE B;  4U5H A;  4A4A A;  4CS8 A;  4HEA J;  3G4X A;  2NG1 A;  1H9G A;  4NQF A;  1O87 A;  3GWN A;  1LPE A;  3QTH A;  3U9J A;  3EZH A;  1TFO B;  2IOQ A;  2OJQ A;  2P0N A;  4XEV A;  2L9J A;  4O6M A;  3MYF A;  2HMZ A;  2L81 A;  5E3A A;  1LI7 A;  2KK1 A;  2PX0 A;  1LI5 A;  1MNE A;  2LCH A;  1ZVZ A;  2IYL D;  2YZS A;  3LNM B;  2BC5 A;  3S27 A;  4DBR A;  2NUT B;  2EPM X;  4O7G A;  3B71 A;  3NMI A;  5B3I A;  4Q4Z F;  3EG9 B;  2NSF A;  3PMR A;  1IZM A;  4D4X A;  2B0H A;  2XLM A;  3B29 A;  1NFO A;  4X0R A;  2VB6 A;  4DVY P;  2NPU A;  1HW2 A;  1EQ1 A;  1TR2 A;  3LS0 A;  5KYY A;  1T6I A;  3EFO A;  2Q3T A;  2LFF A;  3ZQY A;  5T3T A;  4PFP A;  5BUO A;  1PD0 A;  3O10 A;  1E84 A;  4CJO A;  1ZW2 A;  3ABL C;  1YYX A;  4Q5S F;  2J8W A;  1FNT c;  2UUH A;  1L7C A;  5KYX A;  3DZA A;  4CIH A;  3KKB A;  2YKZ A;  1RMV A;  1V74 B;  4CJG A;  1OKK A;  2GWW A;  4LER A;  2AWC A;  3LLK A;  3N24 A;  3EG9 A;  4DVZ A;  4CDV A;  1RJ9 B;  3FHD A;  4JEB A;  2XS1 A;  5F5H A;  2IXN A;  3JSZ A;  4JVS A;  4U5B E;  1GS9 A;  4XLN F;  2CYD A;  5AC4 A;  2EPL X;  1KNY A;  4W8K A;  4BJT A;  2TMV P;  3V5Y A;  3SXM A;  3DM5 A;  2LQG A;  4LLC A;  3FMS A;  2GFH A;  5L0H A;  3U0C A;  4JW1 A;  3UMH A;  2H7B A;  1WOL A;  4K1O A;  4RBN A;  1OXK A;  1A7E A;  1Q0G A;  3QVZ A;  4AE4 B;  2QNL A;  3DAF A;  3GM2 A;  4OD5 A;  3T9O A;  5JRA A;  3JYH A;  3R7C A;  4JC7 A;  3M4B A;  3W2W A;  1Z6A A;  2HUJ A;  2MYS A;  3QW1 A;  1CPR A;  1MMA A;  1Z7Q c;  3VAY A;  4R32 A;  2DYS C;  3K6B A;  1K04 A;  4XQ1 A;  1YDI A;  1PCX A;  1T6Q A;  3I5Q A;  1FR0 A;  3CZ6 A;  3LNR A;  3S28 A;  1I4Y A;  4PR9 A;  4E0I A;  3S84 A;  1OR2 A;  2CCY A;  1YVI A;  2DGJ A;  4O6N A;  2KYH A;  3GEE A;  2NUT A;  3ZVR A;  2A0B A;  4MTF A;  4CBE A;  1OW7 A;  2V3C C;  2HJ3 A;  3CSK A;  2H7O A;  2PF4 E;  2WZF A;  1B68 A;  3NDB B;  4XWJ A; 
#chains in the Genus database with same CATH homology
 4Z9J A;  1WAS A;  1VLS A;  1VLT A;  1JMW A;  1WAT A;  3ATP A;  3T9O A;  2ASR A;  1LIH A;  4H54 A;  2LIG A;  4Z9I A;  4Z9H A;  2D4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...