1FAPB

The structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
RVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Complex (isomerase/kinase)
molecule keywords FK506-BINDING PROTEIN
publication title Structure of the FKBP12-rapamycin complex interacting with the binding domain of human FRAP.
pubmed rcsb
source organism Homo sapiens
total genus 34
structure length 95
sequence length 95
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1996-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 1fapB00
1NSGB 3FAPB 2FAPB 1AUEA 2RSEB 5GPGB 4DRJB 1FAPB 2GAQA 4DRIB 4FAPB 2NPUA 4DRHB
chains in the Genus database with same CATH superfamily
2L9JA 4IRUA 1ST6A 1RKEA 2J9VA 3L8IA 3LNRA 4PACA 3ZTZA 3RIPA 1J8YF 4WABA 4DRIB 4CS7A 3K1IC 2HJ3A 3DXJF 2VC9A 3JSZA 4YT8A 4U5GA 5B1BC 4K7BA 2YL7A 1WWPA 2LFFA 3R2PA 1BZ4A 3LEOA 3FMSA 5L0GA 1YJGA 3O39A 5KYNA 1YVIA 2I15A 3KKBA 4CS8A 1KTMA 1LKXA 4O6NA 2GA0A 2KJGA 1V54C 3W2VA 4DBQA 3U3BA 1PV3A 3S84A 2EINC 2TMVP 1I4YA 2A0UA 1DOVA 2XL8A 2HSQA 1NSGB 1WN0A 2XM0A 3CAXA 3C8GB 2IM8A 2W4BA 3BEHA 3RYLA 1YLMA 2AWYA 4NTAA 4PJLA 4GQHA 2C04A 2JX0A 2NPUA 3TJ5A 4EIYA 4CDYA 5A6BD 1CGOA 2W9YA 2ZXWC 3S90A 4PFPA 1M57C 3DJUB 4CBEA 4G78A 1NU9C 4E7SA 4BJ1A 5IY5C 2BC5A 1FFHA 5EK0A 1EQ1A 1BR4A 3LS0A 4IB4A 3IPMO 1G5ZA 4CS9C 2R7RA 4CDAA 1GS9A 1V55C 4EBJA 2A68F 2C03A 2G3VA 2HSBA 4BPMA 2JPUA 1AEPA 3W8IA 3FOOA 1ZHWA 2FFHA 2XLMA 4IARA 3W2WA 4BJ6C 5A6KA 1E85A 1H9TA 3L34A 2LK4A 4MNDA 2NG1A 4Q7CA 3U9JA 4CJGA 4E18A 4EKWA 1MNEA 4XLNF 3B0UX 2H7VC 1YDIA 3S0XA 4LDRA 5KYWA 2EPOA 1OCOC 3I5PA 2W45A 2WZLA 1VYIA 3LLKA 5HV9A 4BJ5C 3GEIA 3K66A 2FGYA 2NUPB 1G8XA 3U9MA 2IXPA 3FVYA 3LS1A 5CI9A 3TQOA 4EBBA 1Q0DA 2DYRC 1QKRA 2QY9A 4OD4A 3X2QC 3FAJA 2XLDA 2WB7A 3N24A 3K1IA 1SZIA 3HTKC 4FX5A 2KNHA 3EFOB 2ZXOA 4YK5A 4XTKA 2XSEA 3DKAA 3NYJA 4WGYA 4JZAA 3RFYA 3EZIA 1RKCA 2OJQA 1HMDA 2OQMA 1OW7A 4JTAB 4RBNA 1A0BA 1QPUA 1S05A 3EPVA 3U8VA 1J8MF 3F46A 1PCXA 4MW8A 3J06A 4JKVA 1A7VA 5A6BA 2YKZA 2J0XA 4QI2A 1EA8A 3VRCA 5L0JA 3MBGA 3H2VA 256BA 2HV7A 1KNYA 2VCAA 4RD9A 4U9EA 5BQGA 3U3FA 3JSEO 1OKKD 2Q9BA 1ZHTA 3TJ6A 2MHRA 3HNKA 3NG1A 3N2ZB 3G50A 4PFOA 3HLZA 5AGFA 3EJNA 3GM2A 1APCA 1OCZC 4IGGA 1FMWA 2M64A 3US6A 4JCZA 3C18A 3K1HA 3T6BA 1GM5A 5JS5A 2D4UA 1OCCC 2J9UA 3U2MA 3ZDLA 4CS9A 4CIPA 3B9QA 3C8GD 2Y3GA 1AVOB 1Q0GA 4O6YA 3V5ZA 4YT2A 5KYXB 1FTSA 2FAPB 3AJMA 3DM5A 5BQIA 4U5HA 4C7OB 2IBFA 4DRJB 1D0XA 1A7EA 1HE9A 3UNGC 2HZ8A 1D0YA 1HW2A 2OOCA 5FCLA 3KMIA 5A69A 3T6JA 5HSWA 2BE5F 4NCQA 5CI8A 2L6HA 3IQ6A 3DI5A 1SYQA 1G4WR 2V3CC 1JRAA 4HE8D 2YQYA 1V4AA 4BJ5A 2J8WA 2EILC 1LS4A 4MVOA 2WVOA 1A41A 2DYSC 4JTDB 2G62A 1ZU5A 4IWBA 4H4KC 4AX2A 1K40A 3RQGA 1IW7F 2AP3A 2J0WA 2QE9A 3C62A 4I1OB 2GAQA 4LERA 3JTLO 1ZHYA 3DE9A 4FWVA 3ASOC 4HFFB 2A6HF 2OEXA 2R05A 2WZFA 3BRJA 3EGDB 4J7TA 5DVWA 5KYUB 3KPHA 2KK1A 5E3AA 2R7QA 1WATA 3UMIA 4JJGA 1NG1A 2IXOA 4XEFA 1LIHA 3ASNC 4MTGA 3EGXB 3HNIA 1Q0MA 4XPXA 4G0HA 2DI3A 3NKDA 3V5YA 2BL2A 4MW3A 4XWJA 2Y3HA 1OR2A 3AG4C 2AU5A 3FXHA 3JZ0A 3UR3C 4E17A 1RCPA 4LDQA 3EG9B 5GPGB 1D1AA 1LI7A 2WZGA 2Z15A 3Q7GA 4DVZA 2X51A 4QI0A 3U8PA 1TR2A 1YYXA 2JD3A 3W4YA 3EHNA 1YAUO 5L0HA 4EHPA 2H8AA 3PCVA 4DXWA 3L1MA 4MVMA 1GQAA 5AC4A 1NFNA 1L3PA 1UG7A 1B68A 4CSAC 1OCRC 3OA1A 3VYWA 1D0ZA 1LM3B 1O5HA 2WVQA 1BR1A 2F22A 2H7OA 3MFNA 2YZSA 3DE8A 4I44A 1K05A 1OW6A 2YVKA 5F28E 1Z63A 1RJ9A 2XLVA 2J9BA 3M4CA 4JW1A 4DBRA 1E86A 1Q0FA 1U6HA 3A9CA 1C17M 3GODA 5KYYB 1I4ZA 4JCHA 3GM3A 4LLEA 1H7IA 5F5FA 2XS8A 4ONSA 3C8ZA 3K33A 1G4US 2EPLX 2R25A 1R4TA 2QLAA 4YT5A 3CEXA 3Q7LA 1OXKA 4WJ0A 3ABLC 4MVUA 3TK0A 2R7WA 3JYHA 2P0NA 3TD7A 1JPNA 4PJJA 3T4RA 5DS5A 1RKEB 5DQZA 3POVA 3FOPA 2NSFA 3QTHA 3QVZA 2KQ9A 3EZHA 3KYJA 3L8JA 3UGPA 1IZMA 2NUTA 3W8HA 2ZPAA 2A1DD 3JT1A 4XEKA 2Q7RA 1VLTA 1C02A 1OR3A 3G4ZA 1F1MA 1W2WA 2Y39A 2YLIA 3DMDA 4OD5A 4PJNA 3TULA 4Q4ZF 4K1OA 2LFDA 2ETSA 1VLSA 2OJED 1FMVA 1A7DA 2LD6A 3VF0A 1EKYA 2ZD9A 4NTFA 2P6VA 4LLCA 1ORYA 4JE9A 4XQ1A 1SMYF 1M2OA 2YWAA 1VYKA 1TWGA 4RDAA 3S9OA 3ZIBA 2V26A 4JRZA 2WL8A 4MVSA 3IEEA 1JMWA 1XZQA 1MMAA 1SF8A 1ZW2A 2Q9AA 3G4XA 3K6BA 1NBBA 4MTOA 5E33A 5DS4A 3QVYA 4Z9HA 4O6MA 5A6JA 2W4MA 2D5RB 3GM1A 3GORA 3UMKA 3DM9B 3L0IA 4O79A 4P6IC 1BBHA 2VB6A 5CIVA 2XXAA 2GDCA 3DZAA 3SXYA 3AOUA 4ANJA 3KYIA 4G7OF 2AVKA 4ULVA 4AE4A 5JT4A 2J7PD 4YL1A 2YHSA 5D91A 4ER9A 1MQVA 2OG2A 3NMIA 3S27A 4DRHB 2XRHA 4LACB 4FESA 3DWWA 3SXZA 2GFHA 1AUEA 3SXKA 2LSEA 3MX3A 4X0RA 1TWAA 1LPEA 1Z3IX 2A0BA 1JOGA 2PFDA 3LEVA 1M2VA 5KYWB 3H65A 4OIQF 2XS1A 3M1CB 3C63A 1V74B 2R9RB 1QZXA 1KU2A 4BJ6A 4U5CE 1MNDA 3DJNB 3T6GB 5JSLA 1NFOA 2OEVA 1YA9A 3HNJA 3DAFA 3KH2A 4JTCB 3PHF2 1TKNA 1OW8A 3ABMC 1T6IA 1QQ3A 3I5QA 3CZ6A 4PK4A 4A2NB 5A6AA 2A6EF 1FFTC 3SXMA 4MQ9F 3NRHA 2L6FA 2XLOA 1LE4A 1ZZPA 2O9XA 4DOZA 1PD1A 2L81A 1TFOB 4EBKA 1U0BB 1H9GA 2Q3TA 2Y3DA 4U5FE 3K7DA 1Y6DA 3V7OA 1T9KA 1VB5A 2YLDA 2EIJC 2CCYA 2Y69C 2L7AA 3AQCA 1RXQA 3UGOA 3EHMA 5EHHA 3ABKC 3CQZA 2Q4FA 4H54A 1OKKA 4MTFA 2HV6A 4C3BA 2MWQA 1BR2A 3E9VA 2PX3A 2J7PA 3Q6MA 3T9OA 1YA7O 4DJ9A 2R7SA 2AWCA 5K0IA 1E83A 4QDLA 1S7ZA 4MVRA 2J46A 1MMGA 4XPWA 4MVQA 4OIRF 3TOLA 3LESA 5DQTA 1TFKB 2J45A 2KSFA 3IQCA 4AL1A 4D4XA 3ZG1A 3C8GA 1T6QA 1T5OA 3RVYA 1QVXA 2DGJA 1T01A 4U5BE 3O55A 3EH1A 4J7YA 2YL0A 3AG3C 4JVSA 2IOQA 3VM6A 3ZQVA 3ECSA 4LDKA 1N1CA 1Z23A 3MYFA 4BG0A 5F5HA 1Z5ZA 2J9WA 5L3VA 4JEBA 1ORJA 2CNWD 2OU6A 4HFKB 2CYDA 1NLXA 2MYSA 3O6XA 5BUOA 4PR9A 2NSGA 3GEEA 1Q0KA 4IAOA 1HY5A 2ASRA 2GWWA 3MLGA 2EIKC 3QZCA 2B0JA 1Z7Qc 3X1OA 2XM4A 5JLIA 3B29A 3B0PA 3C7JA 3E70C 4W8KA 1TWCA 2EPMX 1D1CA 2PF4E 3OWTA 4OINF 3TOMA 1JAFA 2HJMA 2QTVA 4JEAA 3QW0A 5L0CA 2VASA 1GGQA 3R7CA 2ZXRA 2LIGA 4GEHA 1D1BA 2R02A 3IQTA 2IXMA 4CX9A 4YL3A 3RW0A 1T6UA 3DAGA 3I4UA 1XZPA 3SZRA 3SP1A 3WAQA 3ZVRA 2NUPA 4P9FA 4XLPF 1CPQA 1YZCA 3JRMO 4EUKB 1M56C 2VCBA 3A11A 4JIOA 2UUHA 4WGZA 4YT4A 2RSEB 3GANA 4HEAJ 4AL0A 5BQHA 1YZAA 3EFOA 3LLIA 3RKOF 3HKKA 4YN0B 4W8PA 4U5DE 1ZHXA 2RD9A 4J32B 4BEJA 1Z6AA 2QNLA 2EIMC 3ITFA 4OIPF 1K04A 2R7VA 1ORSC 2Y3BA 5COGA 5JP7A 5L0IA 3AGTA 2UUIA 4MVZA 2OCCC 4OIOF 1LI5A 4C3DA 2R7UA 2WVNA 1EI7A 3LJBA 2PBEA 2XL6A 1VK5A 4N6CA 1QLEC 4IAQA 3ZWIA 4CIHA 4ZLDA 2R03A 1QSPA 2L6GA 5B3IA 1O3UA 3EQLF 2CNWA 5JRAA 1PD0A 2E87A 3AQBA 2P61A 3H2UA 2YRFA 3LAYA 4NY3A 1RJ9B 5E3CA 1WASA 4G7ZF 1MMDA 1VTMP 4N06A 2ICWG 2P1AA 3OEOA 3QW1A 1LS1A 3NDBB 1E2XA 4I1MA 3FDQA 4KI2A 4CSAA 1ZW3A 2YLGA 2HUJA 4BEMJ 3NYLA 1Y4CA 3WHNA 1UFBA 2QUPA 1HW1A 4NC3A 2VCCA 4XPYA 3ZSUA 1WOLA 4BJTA 3JYYA 4KNWA 4YL0A 2DB4A 5T1DB 2XLHA 5KYXA 1NU7D 4C7OA 3M4BA 4JURI 4N4WA 2P7VA 4R32A 4KC9A 5B3SC 4UDVA 2EPKX 3ATPA 3IQ5A 1R5ID 3AG2C 3FHDA 5FZTA 3GEHA 3RF3A 4AK9A 1HMOA 2KYHA 4PJMA 3S29A 4D4NA 2EPNA 3UMHA 2NUTB 3AG1C 3CSKA 2YEVA 2Q9CA 3MYIA 3NMKA 4K0DA 1CPRA 5D92A 4NQFA 3B71A 1I5NA 3SEOA 3KL4A 4YWQA 2IXNA 3N0TA 5E2QA 1L7CA 3RQEA 3ZC4A 1MMNA 2OKUA 1JPJA 2M4EA 3HJCA 3U0CA 2G3KA 2PNOA 3FAPB 1WTYA 3SYNA 2CDQA 4IJJA 3B0VC 2A69F 5COMA 5T3TA 4A4AA 2YL1A 4Z9IA 2PP4A 2I8BA 2LP4A 3EGDA 5KYUA 1C03A 4O7GA 1E84A 1LE2A 2LCHA 2XL4A 1TQGA 2VH3A 1FAPB 1OXBA 3HNLA 4Z9JA 2KW3C 4XEVA 4E0HA 4EWCA 5B1AC 5JVEA 3V5XA 4I3MA 4C3EA 1OQCA 4E7ZA 1O87A 3LNMB 3EGXA 2IYLD 3PMRA 5DS6A 1LVKA 4JJFA 3U5SA 5AC5A 2PX0A 2CW0F 4CS8C 3PDMP 2H7BA 3IHUA 3RH3A 3GWLA 3M15A 5TJ5E 2HKVA 3EG9A 4U9DA 1JR8A 3VAYA 2XXAB 2LQGA 2HS5A 4P9TA 4AE4B 1ZU4A 2HFIA 4F4BA 3QMKA 4J30B 1ZYRF 3NYMA 3U2LA 1FNTc 4L6RA 4G7HF 2X0CA 5T3WA 2YL3A 1HE1A 3F47A 3JCUQ 3SNHA 3WG7C 4E0IA 2CGEA 4CJOA 1NZEA 4M63A 2R7XA 1YARO 2R7TA 1M2VB 2XLEA 2Q00A 5JUAA 5DLJA 3RVZA 3ZTMA 1ZVZA 5L3QA 4Q5SF 1CGNA 3AGUA 4MS2A 4N6HA 2KGOA 2XLWA 4JC7A 3S28A 1M6TA 1YYJA 1BDJB 4CDVA 5KYYA 3DD7A 3M79A 1U89A 1ZHZA 4GYTA 3JRTA 3Q6NA 4ZLCA 3GWNA 1VMAA 1H6GA 3O10A 5EGYA 3NKEA 1TWHA 3RQFA 3NMJA 3WODF 4B6IA 2R7OA 1FR0A 4KNVA 4KBLA 4NTBA 4FAPB 2KC3A 1VOMA 2ZXPA 3ZQYA 5L0DA 1WGWA 4DVYP 4U5EE 1SR2A 1DOWA 1RMVA 1XWJA 1CGME 2B0HA 3EH2A 4YJWA 2HMQA 4ULWA 5COFA 5L0FA 3LUTB 2HMZA
chains in the Genus database with same CATH topology
1NSGB 3FAPB 2FAPB 1AUEA 2RSEB 5GPGB 4DRJB 1FAPB 2GAQA 4DRIB 4FAPB 2NPUA 4DRHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NSG B;  3FAP B;  2FAP B;  1AUE A;  2RSE B;  5GPG B;  4DRJ B;  1FAP B;  2GAQ A;  4DRI B;  4FAP B;  2NPU A;  4DRH B; 
#chains in the Genus database with same CATH topology
 2L9J A;  4IRU A;  1ST6 A;  1RKE A;  2J9V A;  3L8I A;  3LNR A;  4PAC A;  3ZTZ A;  3RIP A;  1J8Y F;  4WAB A;  4DRI B;  4CS7 A;  3K1I C;  2HJ3 A;  3DXJ F;  2VC9 A;  3JSZ A;  4YT8 A;  4U5G A;  5B1B C;  4K7B A;  2YL7 A;  1WWP A;  2LFF A;  3R2P A;  1BZ4 A;  3LEO A;  3FMS A;  5L0G A;  1YJG A;  3O39 A;  5KYN A;  1YVI A;  2I15 A;  3KKB A;  4CS8 A;  1KTM A;  1LKX A;  4O6N A;  2GA0 A;  2KJG A;  1V54 C;  3W2V A;  4DBQ A;  3U3B A;  1PV3 A;  3S84 A;  2EIN C;  2TMV P;  1I4Y A;  2A0U A;  1DOV A;  2XL8 A;  2HSQ A;  1NSG B;  1WN0 A;  2XM0 A;  3CAX A;  3C8G B;  2IM8 A;  2W4B A;  3BEH A;  3RYL A;  1YLM A;  2AWY A;  4NTA A;  4PJL A;  4GQH A;  2C04 A;  2JX0 A;  2NPU A;  3TJ5 A;  4EIY A;  4CDY A;  5A6B D;  1CGO A;  2W9Y A;  2ZXW C;  3S90 A;  4PFP A;  1M57 C;  3DJU B;  4CBE A;  4G78 A;  1NU9 C;  4E7S A;  4BJ1 A;  5IY5 C;  2BC5 A;  1FFH A;  5EK0 A;  1EQ1 A;  1BR4 A;  3LS0 A;  4IB4 A;  3IPM O;  1G5Z A;  4CS9 C;  2R7R A;  4CDA A;  1GS9 A;  1V55 C;  4EBJ A;  2A68 F;  2C03 A;  2G3V A;  2HSB A;  4BPM A;  2JPU A;  1AEP A;  3W8I A;  3FOO A;  1ZHW A;  2FFH A;  2XLM A;  4IAR A;  3W2W A;  4BJ6 C;  5A6K A;  1E85 A;  1H9T A;  3L34 A;  2LK4 A;  4MND A;  2NG1 A;  4Q7C A;  3U9J A;  4CJG A;  4E18 A;  4EKW A;  1MNE A;  4XLN F;  3B0U X;  2H7V C;  1YDI A;  3S0X A;  4LDR A;  5KYW A;  2EPO A;  1OCO C;  3I5P A;  2W45 A;  2WZL A;  1VYI A;  3LLK A;  5HV9 A;  4BJ5 C;  3GEI A;  3K66 A;  2FGY A;  2NUP B;  1G8X A;  3U9M A;  2IXP A;  3FVY A;  3LS1 A;  5CI9 A;  3TQO A;  4EBB A;  1Q0D A;  2DYR C;  1QKR A;  2QY9 A;  4OD4 A;  3X2Q C;  3FAJ A;  2XLD A;  2WB7 A;  3N24 A;  3K1I A;  1SZI A;  3HTK C;  4FX5 A;  2KNH A;  3EFO B;  2ZXO A;  4YK5 A;  4XTK A;  2XSE A;  3DKA A;  3NYJ A;  4WGY A;  4JZA A;  3RFY A;  3EZI A;  1RKC A;  2OJQ A;  1HMD A;  2OQM A;  1OW7 A;  4JTA B;  4RBN A;  1A0B A;  1QPU A;  1S05 A;  3EPV A;  3U8V A;  1J8M F;  3F46 A;  1PCX A;  4MW8 A;  3J06 A;  4JKV A;  1A7V A;  5A6B A;  2YKZ A;  2J0X A;  4QI2 A;  1EA8 A;  3VRC A;  5L0J A;  3MBG A;  3H2V A;  256B A;  2HV7 A;  1KNY A;  2VCA A;  4RD9 A;  4U9E A;  5BQG A;  3U3F A;  3JSE O;  1OKK D;  2Q9B A;  1ZHT A;  3TJ6 A;  2MHR A;  3HNK A;  3NG1 A;  3N2Z B;  3G50 A;  4PFO A;  3HLZ A;  5AGF A;  3EJN A;  3GM2 A;  1APC A;  1OCZ C;  4IGG A;  1FMW A;  2M64 A;  3US6 A;  4JCZ A;  3C18 A;  3K1H A;  3T6B A;  1GM5 A;  5JS5 A;  2D4U A;  1OCC C;  2J9U A;  3U2M A;  3ZDL A;  4CS9 A;  4CIP A;  3B9Q A;  3C8G D;  2Y3G A;  1AVO B;  1Q0G A;  4O6Y A;  3V5Z A;  4YT2 A;  5KYX B;  1FTS A;  2FAP B;  3AJM A;  3DM5 A;  5BQI A;  4U5H A;  4C7O B;  2IBF A;  4DRJ B;  1D0X A;  1A7E A;  1HE9 A;  3UNG C;  2HZ8 A;  1D0Y A;  1HW2 A;  2OOC A;  5FCL A;  3KMI A;  5A69 A;  3T6J A;  5HSW A;  2BE5 F;  4NCQ A;  5CI8 A;  2L6H A;  3IQ6 A;  3DI5 A;  1SYQ A;  1G4W R;  2V3C C;  1JRA A;  4HE8 D;  2YQY A;  1V4A A;  4BJ5 A;  2J8W A;  2EIL C;  1LS4 A;  4MVO A;  2WVO A;  1A41 A;  2DYS C;  4JTD B;  2G62 A;  1ZU5 A;  4IWB A;  4H4K C;  4AX2 A;  1K40 A;  3RQG A;  1IW7 F;  2AP3 A;  2J0W A;  2QE9 A;  3C62 A;  4I1O B;  2GAQ A;  4LER A;  3JTL O;  1ZHY A;  3DE9 A;  4FWV A;  3ASO C;  4HFF B;  2A6H F;  2OEX A;  2R05 A;  2WZF A;  3BRJ A;  3EGD B;  4J7T A;  5DVW A;  5KYU B;  3KPH A;  2KK1 A;  5E3A A;  2R7Q A;  1WAT A;  3UMI A;  4JJG A;  1NG1 A;  2IXO A;  4XEF A;  1LIH A;  3ASN C;  4MTG A;  3EGX B;  3HNI A;  1Q0M A;  4XPX A;  4G0H A;  2DI3 A;  3NKD A;  3V5Y A;  2BL2 A;  4MW3 A;  4XWJ A;  2Y3H A;  1OR2 A;  3AG4 C;  2AU5 A;  3FXH A;  3JZ0 A;  3UR3 C;  4E17 A;  1RCP A;  4LDQ A;  3EG9 B;  5GPG B;  1D1A A;  1LI7 A;  2WZG A;  2Z15 A;  3Q7G A;  4DVZ A;  2X51 A;  4QI0 A;  3U8P A;  1TR2 A;  1YYX A;  2JD3 A;  3W4Y A;  3EHN A;  1YAU O;  5L0H A;  4EHP A;  2H8A A;  3PCV A;  4DXW A;  3L1M A;  4MVM A;  1GQA A;  5AC4 A;  1NFN A;  1L3P A;  1UG7 A;  1B68 A;  4CSA C;  1OCR C;  3OA1 A;  3VYW A;  1D0Z A;  1LM3 B;  1O5H A;  2WVQ A;  1BR1 A;  2F22 A;  2H7O A;  3MFN A;  2YZS A;  3DE8 A;  4I44 A;  1K05 A;  1OW6 A;  2YVK A;  5F28 E;  1Z63 A;  1RJ9 A;  2XLV A;  2J9B A;  3M4C A;  4JW1 A;  4DBR A;  1E86 A;  1Q0F A;  1U6H A;  3A9C A;  1C17 M;  3GOD A;  5KYY B;  1I4Z A;  4JCH A;  3GM3 A;  4LLE A;  1H7I A;  5F5F A;  2XS8 A;  4ONS A;  3C8Z A;  3K33 A;  1G4U S;  2EPL X;  2R25 A;  1R4T A;  2QLA A;  4YT5 A;  3CEX A;  3Q7L A;  1OXK A;  4WJ0 A;  3ABL C;  4MVU A;  3TK0 A;  2R7W A;  3JYH A;  2P0N A;  3TD7 A;  1JPN A;  4PJJ A;  3T4R A;  5DS5 A;  1RKE B;  5DQZ A;  3POV A;  3FOP A;  2NSF A;  3QTH A;  3QVZ A;  2KQ9 A;  3EZH A;  3KYJ A;  3L8J A;  3UGP A;  1IZM A;  2NUT A;  3W8H A;  2ZPA A;  2A1D D;  3JT1 A;  4XEK A;  2Q7R A;  1VLT A;  1C02 A;  1OR3 A;  3G4Z A;  1F1M A;  1W2W A;  2Y39 A;  2YLI A;  3DMD A;  4OD5 A;  4PJN A;  3TUL A;  4Q4Z F;  4K1O A;  2LFD A;  2ETS A;  1VLS A;  2OJE D;  1FMV A;  1A7D A;  2LD6 A;  3VF0 A;  1EKY A;  2ZD9 A;  4NTF A;  2P6V A;  4LLC A;  1ORY A;  4JE9 A;  4XQ1 A;  1SMY F;  1M2O A;  2YWA A;  1VYK A;  1TWG A;  4RDA A;  3S9O A;  3ZIB A;  2V26 A;  4JRZ A;  2WL8 A;  4MVS A;  3IEE A;  1JMW A;  1XZQ A;  1MMA A;  1SF8 A;  1ZW2 A;  2Q9A A;  3G4X A;  3K6B A;  1NBB A;  4MTO A;  5E33 A;  5DS4 A;  3QVY A;  4Z9H A;  4O6M A;  5A6J A;  2W4M A;  2D5R B;  3GM1 A;  3GOR A;  3UMK A;  3DM9 B;  3L0I A;  4O79 A;  4P6I C;  1BBH A;  2VB6 A;  5CIV A;  2XXA A;  2GDC A;  3DZA A;  3SXY A;  3AOU A;  4ANJ A;  3KYI A;  4G7O F;  2AVK A;  4ULV A;  4AE4 A;  5JT4 A;  2J7P D;  4YL1 A;  2YHS A;  5D91 A;  4ER9 A;  1MQV A;  2OG2 A;  3NMI A;  3S27 A;  4DRH B;  2XRH A;  4LAC B;  4FES A;  3DWW A;  3SXZ A;  2GFH A;  1AUE A;  3SXK A;  2LSE A;  3MX3 A;  4X0R A;  1TWA A;  1LPE A;  1Z3I X;  2A0B A;  1JOG A;  2PFD A;  3LEV A;  1M2V A;  5KYW B;  3H65 A;  4OIQ F;  2XS1 A;  3M1C B;  3C63 A;  1V74 B;  2R9R B;  1QZX A;  1KU2 A;  4BJ6 A;  4U5C E;  1MND A;  3DJN B;  3T6G B;  5JSL A;  1NFO A;  2OEV A;  1YA9 A;  3HNJ A;  3DAF A;  3KH2 A;  4JTC B;  3PHF 2;  1TKN A;  1OW8 A;  3ABM C;  1T6I A;  1QQ3 A;  3I5Q A;  3CZ6 A;  4PK4 A;  4A2N B;  5A6A A;  2A6E F;  1FFT C;  3SXM A;  4MQ9 F;  3NRH A;  2L6F A;  2XLO A;  1LE4 A;  1ZZP A;  2O9X A;  4DOZ A;  1PD1 A;  2L81 A;  1TFO B;  4EBK A;  1U0B B;  1H9G A;  2Q3T A;  2Y3D A;  4U5F E;  3K7D A;  1Y6D A;  3V7O A;  1T9K A;  1VB5 A;  2YLD A;  2EIJ C;  2CCY A;  2Y69 C;  2L7A A;  3AQC A;  1RXQ A;  3UGO A;  3EHM A;  5EHH A;  3ABK C;  3CQZ A;  2Q4F A;  4H54 A;  1OKK A;  4MTF A;  2HV6 A;  4C3B A;  2MWQ A;  1BR2 A;  3E9V A;  2PX3 A;  2J7P A;  3Q6M A;  3T9O A;  1YA7 O;  4DJ9 A;  2R7S A;  2AWC A;  5K0I A;  1E83 A;  4QDL A;  1S7Z A;  4MVR A;  2J46 A;  1MMG A;  4XPW A;  4MVQ A;  4OIR F;  3TOL A;  3LES A;  5DQT A;  1TFK B;  2J45 A;  2KSF A;  3IQC A;  4AL1 A;  4D4X A;  3ZG1 A;  3C8G A;  1T6Q A;  1T5O A;  3RVY A;  1QVX A;  2DGJ A;  1T01 A;  4U5B E;  3O55 A;  3EH1 A;  4J7Y A;  2YL0 A;  3AG3 C;  4JVS A;  2IOQ A;  3VM6 A;  3ZQV A;  3ECS A;  4LDK A;  1N1C A;  1Z23 A;  3MYF A;  4BG0 A;  5F5H A;  1Z5Z A;  2J9W A;  5L3V A;  4JEB A;  1ORJ A;  2CNW D;  2OU6 A;  4HFK B;  2CYD A;  1NLX A;  2MYS A;  3O6X A;  5BUO A;  4PR9 A;  2NSG A;  3GEE A;  1Q0K A;  4IAO A;  1HY5 A;  2ASR A;  2GWW A;  3MLG A;  2EIK C;  3QZC A;  2B0J A;  1Z7Q c;  3X1O A;  2XM4 A;  5JLI A;  3B29 A;  3B0P A;  3C7J A;  3E70 C;  4W8K A;  1TWC A;  2EPM X;  1D1C A;  2PF4 E;  3OWT A;  4OIN F;  3TOM A;  1JAF A;  2HJM A;  2QTV A;  4JEA A;  3QW0 A;  5L0C A;  2VAS A;  1GGQ A;  3R7C A;  2ZXR A;  2LIG A;  4GEH A;  1D1B A;  2R02 A;  3IQT A;  2IXM A;  4CX9 A;  4YL3 A;  3RW0 A;  1T6U A;  3DAG A;  3I4U A;  1XZP A;  3SZR A;  3SP1 A;  3WAQ A;  3ZVR A;  2NUP A;  4P9F A;  4XLP F;  1CPQ A;  1YZC A;  3JRM O;  4EUK B;  1M56 C;  2VCB A;  3A11 A;  4JIO A;  2UUH A;  4WGZ A;  4YT4 A;  2RSE B;  3GAN A;  4HEA J;  4AL0 A;  5BQH A;  1YZA A;  3EFO A;  3LLI A;  3RKO F;  3HKK A;  4YN0 B;  4W8P A;  4U5D E;  1ZHX A;  2RD9 A;  4J32 B;  4BEJ A;  1Z6A A;  2QNL A;  2EIM C;  3ITF A;  4OIP F;  1K04 A;  2R7V A;  1ORS C;  2Y3B A;  5COG A;  5JP7 A;  5L0I A;  3AGT A;  2UUI A;  4MVZ A;  2OCC C;  4OIO F;  1LI5 A;  4C3D A;  2R7U A;  2WVN A;  1EI7 A;  3LJB A;  2PBE A;  2XL6 A;  1VK5 A;  4N6C A;  1QLE C;  4IAQ A;  3ZWI A;  4CIH A;  4ZLD A;  2R03 A;  1QSP A;  2L6G A;  5B3I A;  1O3U A;  3EQL F;  2CNW A;  5JRA A;  1PD0 A;  2E87 A;  3AQB A;  2P61 A;  3H2U A;  2YRF A;  3LAY A;  4NY3 A;  1RJ9 B;  5E3C A;  1WAS A;  4G7Z F;  1MMD A;  1VTM P;  4N06 A;  2ICW G;  2P1A A;  3OEO A;  3QW1 A;  1LS1 A;  3NDB B;  1E2X A;  4I1M A;  3FDQ A;  4KI2 A;  4CSA A;  1ZW3 A;  2YLG A;  2HUJ A;  4BEM J;  3NYL A;  1Y4C A;  3WHN A;  1UFB A;  2QUP A;  1HW1 A;  4NC3 A;  2VCC A;  4XPY A;  3ZSU A;  1WOL A;  4BJT A;  3JYY A;  4KNW A;  4YL0 A;  2DB4 A;  5T1D B;  2XLH A;  5KYX A;  1NU7 D;  4C7O A;  3M4B A;  4JUR I;  4N4W A;  2P7V A;  4R32 A;  4KC9 A;  5B3S C;  4UDV A;  2EPK X;  3ATP A;  3IQ5 A;  1R5I D;  3AG2 C;  3FHD A;  5FZT A;  3GEH A;  3RF3 A;  4AK9 A;  1HMO A;  2KYH A;  4PJM A;  3S29 A;  4D4N A;  2EPN A;  3UMH A;  2NUT B;  3AG1 C;  3CSK A;  2YEV A;  2Q9C A;  3MYI A;  3NMK A;  4K0D A;  1CPR A;  5D92 A;  4NQF A;  3B71 A;  1I5N A;  3SEO A;  3KL4 A;  4YWQ A;  2IXN A;  3N0T A;  5E2Q A;  1L7C A;  3RQE A;  3ZC4 A;  1MMN A;  2OKU A;  1JPJ A;  2M4E A;  3HJC A;  3U0C A;  2G3K A;  2PNO A;  3FAP B;  1WTY A;  3SYN A;  2CDQ A;  4IJJ A;  3B0V C;  2A69 F;  5COM A;  5T3T A;  4A4A A;  2YL1 A;  4Z9I A;  2PP4 A;  2I8B A;  2LP4 A;  3EGD A;  5KYU A;  1C03 A;  4O7G A;  1E84 A;  1LE2 A;  2LCH A;  2XL4 A;  1TQG A;  2VH3 A;  1FAP B;  1OXB A;  3HNL A;  4Z9J A;  2KW3 C;  4XEV A;  4E0H A;  4EWC A;  5B1A C;  5JVE A;  3V5X A;  4I3M A;  4C3E A;  1OQC A;  4E7Z A;  1O87 A;  3LNM B;  3EGX A;  2IYL D;  3PMR A;  5DS6 A;  1LVK A;  4JJF A;  3U5S A;  5AC5 A;  2PX0 A;  2CW0 F;  4CS8 C;  3PDM P;  2H7B A;  3IHU A;  3RH3 A;  3GWL A;  3M15 A;  5TJ5 E;  2HKV A;  3EG9 A;  4U9D A;  1JR8 A;  3VAY A;  2XXA B;  2LQG A;  2HS5 A;  4P9T A;  4AE4 B;  1ZU4 A;  2HFI A;  4F4B A;  3QMK A;  4J30 B;  1ZYR F;  3NYM A;  3U2L A;  1FNT c;  4L6R A;  4G7H F;  2X0C A;  5T3W A;  2YL3 A;  1HE1 A;  3F47 A;  3JCU Q;  3SNH A;  3WG7 C;  4E0I A;  2CGE A;  4CJO A;  1NZE A;  4M63 A;  2R7X A;  1YAR O;  2R7T A;  1M2V B;  2XLE A;  2Q00 A;  5JUA A;  5DLJ A;  3RVZ A;  3ZTM A;  1ZVZ A;  5L3Q A;  4Q5S F;  1CGN A;  3AGU A;  4MS2 A;  4N6H A;  2KGO A;  2XLW A;  4JC7 A;  3S28 A;  1M6T A;  1YYJ A;  1BDJ B;  4CDV A;  5KYY A;  3DD7 A;  3M79 A;  1U89 A;  1ZHZ A;  4GYT A;  3JRT A;  3Q6N A;  4ZLC A;  3GWN A;  1VMA A;  1H6G A;  3O10 A;  5EGY A;  3NKE A;  1TWH A;  3RQF A;  3NMJ A;  3WOD F;  4B6I A;  2R7O A;  1FR0 A;  4KNV A;  4KBL A;  4NTB A;  4FAP B;  2KC3 A;  1VOM A;  2ZXP A;  3ZQY A;  5L0D A;  1WGW A;  4DVY P;  4U5E E;  1SR2 A;  1DOW A;  1RMV A;  1XWJ A;  1CGM E;  2B0H A;  3EH2 A;  4YJW A;  2HMQ A;  4ULW A;  5COF A;  5L0F A;  3LUT B;  2HMZ A; 
#chains in the Genus database with same CATH homology
 1NSG B;  3FAP B;  2FAP B;  1AUE A;  2RSE B;  5GPG B;  4DRJ B;  1FAP B;  2GAQ A;  4DRI B;  4FAP B;  2NPU A;  4DRH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...