1FAPB

The structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
RVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FK506-BINDING PROTEIN
publication title Structure of the FKBP12-rapamycin complex interacting with the binding domain of human FRAP.
pubmed rcsb
source organism Homo sapiens
molecule tags Complex (isomerase/kinase)
total genus 34
structure length 95
sequence length 95
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1996-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 1fapB00
2NPUA 4DRHB 1NSGB 1FAPB 2FAPB 4DRJB 2GAQA 4DRIB 1AUEA 2RSEB 5GPGB 3FAPB 4FAPB
chains in the Genus database with same CATH superfamily
1OCZC 2UUHA 2VB6A 3AJMA 3C8GA 3DE9A 1ORJA 2ZXWC 5FZTA 3UGPA 4C7OB 2J45A 1T9KA 5D91A 2IYLD 1Q0MA 4LLEA 2LQGA 3C7JA 4D4XA 2F22A 2OU6A 2NPUA 2YKZA 1SMYF 2RD9A 5E33A 2GAQA 4JCZA 1FFTC 3U5SA 4CDVA 1EI7A 1QVXA 2XS8A 2QTVA 1XZQA 2R03A 2DI3A 2Y3HA 4MVRA 4DVYP 1ZW2A 3K7DA 3GODA 1G4WR 2XL6A 4U5FE 2XM0A 1DOVA 3B0VC 2L9JA 4FWVA 3LNRA 3QVZA 4MVUA 4DVZA 3HNLA 4C3EA 2EPLX 3C8GD 2L6HA 2WB7A 3O6XA 4IB4A 2EILC 4X0RA 5CIVA 1ZHXA 3K66A 2NUPA 4DRIB 2Z15A 4IJJA 1PD1A 4O6NA 3AGUA 3IQ5A 2R7OA 4U5GA 2NUTB 4U9EA 2CNWA 2EPNA 3TULA 3ZTMA 2R7SA 3VAYA 3MFNA 4ZLDA 4JE9A 2QE9A 5F28E 4E7SA 5KYWB 3DJNB 3QW0A 5B1BC 5COMA 2R7RA 4EBBA 5JUAA 3US6A 2OJED 5KYNA 4ULVA 3AG3C 3L8JA 1QLEC 3EGXA 4PJMA 2A69F 3MX3A 3RQFA 4QI0A 1CPQA 2RSEB 1YLMA 3WODF 2JD3A 3DI5A 3ZQVA 2J9WA 2Y3DA 1I5NA 1XZPA 1O3UA 1YA9A 2FGYA 1OCOC 2PF4E 3ABMC 3L0IA 4JTAB 4BG0A 2WZGA 3HKKA 1FMWA 3A11A 2CNWD 3UGOA 3NDBB 4XLPF 1WWPA 3V5YA 1IW7F 4YT5A 2L6GA 5L0CA 3RYLA 4PFPA 2HUJA 3FVYA 3R2PA 2HV6A 3GWLA 1MQVA 1NLXA 3T9OA 4XWJA 4NTFA 4YT8A 1LIHA 4CSAC 5HSWA 2Q9AA 2ETSA 2L81A 3TK0A 2XLVA 4BJ5A 2YL3A 5DLJA 4MVZA 1BR4A 3Q7GA 2R9RB 4U5CE 3U3FA 4ZLCA 3HNJA 4P9TA 2HS5A 3C18A 5EHHA 2A1DD 2LSEA 3MLGA 4JZAA 4MVMA 4NY3A 4CS9C 4BJ6A 1KNYA 1TWCA 3K6BA 1LS1A 4NC3A 4DRHB 2HFIA 2LFFA 2OQMA 3JYHA 1RKEB 1TFKB 3QVYA 3DWWA 1NSGB 5KYUA 2C03A 2XSEA 3UR3C 3SYNA 1JPNA 3SZRA 1LVKA 3EGDA 1VYKA 2GWWA 2XXAA 5AGFA 2JX0A 1E86A 1W2WA 3SXKA 2ZXOA 1Z23A 3U9JA 3ZC4A 3FHDA 2KNHA 1B68A 3VYWA 4RDAA 1RCPA 2R05A 4JRZA 4E7ZA 4HFFB 3GWNA 1VLTA 2G3KA 2AP3A 3DAGA 3X1OA 2VCCA 3EG9A 4OD5A 3T6JA 1D1CA 3TJ6A 1OXKA 2NSFA 2C04A 3IPMO 3O39A 4GYTA 4JJGA 3RIPA 3ABKC 5A6BA 1ZZPA 1EKYA 3S28A 1R4TA 2Y69C 3ASNC 4C3DA 5A6KA 4DRJB 2J9VA 4GQHA 3H2VA 3W8HA 3EZIA 1Y6DA 4H54A 3FOOA 3GEEA 3W2VA 3ZWIA 2WVQA 3GEIA 3ECSA 2XLOA 4JTDB 4DOZA 5JLIA 1NG1A 4Q5SF 2H8AA 3JCUQ 5BQIA 1SF8A 2YLIA 2J46A 4J30B 2QY9A 1U0BB 3CAXA 3CZ6A 1LI5A 2XS1A 5KYXA 4MNDA 1OR2A 4U5EE 1YYXA 2J9UA 2LFDA 2WZLA 4IAOA 3W2WA 4CS8A 1Z5ZA 3UNGC 1LE2A 1A7EA 2IOQA 2PBEA 3RKOF 3V5XA 4AE4B 2YL0A 2AU5A 3M4BA 3S84A 1M2VB 5A6BD 4KI2A 1D0ZA 1RJ9B 3GM2A 3M1CB 5L0JA 5CI8A 5L0DA 4H4KC 3RFYA 1Q0GA 4MTFA 1E83A 3UMHA 2Y3GA 4O6MA 1T6IA 4RBNA 2BL2A 1E84A 2Q7RA 3LEOA 1NFOA 3DMDA 3OA1A 4PACA 1FTSA 4AL1A 1APCA 4AX2A 3DJUB 1BZ4A 3GEHA 2XLEA 3MBGA 4LERA 4OIRF 3U3BA 4EUKB 1J8YF 3AGTA 3EH1A 1FAPB 4LLCA 2YLDA 1OQCA 4C3BA 3H65A 1O5HA 4XLNF 2DB4A 3PHF2 1Z7Qc 1NFNA 1ZHYA 5DQZA 4CX9A 2R7VA 1G8XA 4ONSA 5L0FA 4G7OF 4XEKA 3FXHA 5L0IA 2XL8A 1RXQA 2YQYA 3TJ5A 2H7VC 4E0HA 1AVOB 1ZVZA 1WN0A 3VF0A 3GM1A 2GDCA 2A6HF 3I5PA 3LEVA 3U9MA 3B29A 5DS6A 1HY5A 1FNTc 3L1MA 2W4MA 4M63A 1HE9A 2DGJA 4Q7CA 3TOLA 1VK5A 5CI9A 1KTMA 2ZD9A 2Q9CA 2FAPB 3LS1A 4Z9IA 2OEXA 3U8VA 4PR9A 3L34A 2OEVA 5L3VA 3DKAA 4MVOA 1YA7O 3DZAA 2HJ3A 3NMJA 5F5HA 1JR8A 2P6VA 2EPKX 4F4BA 2CYDA 2J0XA 2W45A 3AG4C 5A6AA 1GGQA 3B0PA 1YZCA 1SYQA 2OG2A 4W8PA 4EHPA 3KPHA 3ITFA 3SXYA 2BC5A 2H7OA 3K1IA 1LPEA 4N6HA 2YRFA 1Y4CA 2J7PA 3EPVA 3JT1A 3NMKA 4MW3A 3ZSUA 4BJ1A 4YT2A 1CGME 2EINC 4HFKB 1M56C 5D92A 4FAPB 4YK5A 2ICWG 3DM9B 5KYYB 2WVNA 3W8IA 4EWCA 1YYJA 3M4CA 2QLAA 3DAFA 3NYJA 3JSEO 1OCCC 3ATPA 3EZHA 5JP7A 5JSLA 2CCYA 4FX5A 1NU7D 1OXBA 4UDVA 1C03A 1Q0DA 1PCXA 4YL0A 2OKUA 5BUOA 1SR2A 1VYIA 3QZCA 4JW1A 4JTCB 1KU2A 4JCHA 3C8GB 1T6QA 3DXJF 3MYFA 2D5RB 3S9OA 3EJNA 2L7AA 3ZQYA 2KGOA 2J7PD 3HJCA 1ZU4A 4YN0B 1H9TA 1JRAA 1E2XA 2R7UA 3I4UA 3JTLO 3LLIA 2PP4A 3KKBA 3IQ6A 3U0CA 4O7GA 1OW8A 4WABA 1I4YA 1WTYA 3T4RA 3WG7C 2LP4A 2WL8A 3W4YA 1WASA 4BEMJ 4O6YA 2HSBA 2AWCA 2I15A 2P7VA 4JIOA 5JS5A 3KYJA 1K05A 4CIPA 1K40A 4CSAA 3B9QA 1OW7A 1M57C 3KMIA 4J7YA 2EIJC 2VC9A 4MW8A 4LACB 1MMNA 1WGWA 3AG1C 3KH2A 4XPWA 3KL4A 4RD9A 3RQGA 4AL0A 2B0JA 3HTKC 3RVYA 1HMDA 3G4XA 3NKDA 256BA 3EFOA 2YLGA 4OD4A 5F5FA 3UMIA 1EQ1A 1J8MF 1GS9A 5T3TA 2Q9BA 1PD0A 4XPXA 1TWAA 2D4UA 5B1AC 2R25A 3H2UA 3SNHA 2W4BA 4CS7A 5E3CA 2V26A 4CDYA 2J0WA 2Q4FA 1YARO 4JEAA 5L0HA 3R7CA 2Y3BA 5DS5A 1D0YA 4NQFA 1V55C 2A0BA 3B71A 4N4WA 3S29A 3V5ZA 4DJ9A 4C7OA 1XWJA 3BRJA 2VASA 1TQGA 3EGXB 4I44A 4MTGA 1D1BA 4I1OB 3L8IA 4MS2A 5BQHA 3DM5A 3CQZA 1ZU5A 2IBFA 2XRHA 2Q00A 3ZIBA 1VTMP 4OIPF 1V4AA 2HMQA 3J06A 2IM8A 3M15A 2YVKA 4E18A 5FCLA 1I4ZA 5E2QA 2OCCC 2HSQA 1NBBA 4MTOA 2B0HA 4XEVA 3S90A 4E17A 2BE5F 3QMKA 3B0UX 1V54C 3N0TA 2HZ8A 3AQBA 3WHNA 4KNVA 1NZEA 2X51A 3NRHA 3PDMP 2HJMA 3RH3A 1BR1A 4Z9JA 3O10A 1K04A 3UMKA 1BDJB 3CSKA 1Z63A 2NUTA 5B3IA 2JPUA 5JVEA 3NYLA 4P6IC 3PCVA 4CBEA 2V3CC 2P0NA 2G3VA 1NU9C 1QZXA 5JRAA 4I3MA 4A2NB 4Z9HA 5KYWA 4G7HF 3Q7LA 3FDQA 3G4ZA 2J8WA 1HW1A 3CEXA 3ABLC 1CGNA 1ORSC 1VMAA 1Z6AA 1HE1A 2KYHA 1ZYRF 2R7QA 4IARA 4K7BA 1GM5A 3N2ZB 3HNKA 3IQTA 3EHMA 3SEOA 2NSGA 4MVSA 5COGA 3EGDB 3IEEA 3Q6NA 4OINF 4DBQA 2R7TA 5KYYA 2XXAB 2CW0F 4IAQA 4KBLA 4U9DA 3C63A 2GA0A 3O55A 5BQGA 1L3PA 4EIYA 2W9YA 4YT4A 4CDAA 4AK9A 3ZTZA 2YL1A 1JAFA 1MMGA 3GORA 4PFOA 4ULWA 1R5ID 1A7VA 4XPYA 4WGYA 3EQLF 4IRUA 1LKXA 2UUIA 3FOPA 3EG9B 1ORYA 1VOMA 1QSPA 1YAUO 4K0DA 4B6IA 4EBJA 4J32B 3N24A 4PJJA 5JT4A 5DS4A 4IGGA 2R7WA 2R7XA 1ZHZA 2P1AA 2WVOA 4LDRA 4N06A 2TMVP 1UG7A 2DYSC 2VCBA 3AOUA 1EA8A 1L7CA 1TKNA 4YJWA 1D1AA 2J9BA 4N6CA 4ANJA 2XLDA 5A69A 4P9FA 5DQTA 4WJ0A 1WATA 2E87A 2PX0A 3SXZA 1M6TA 3JRTA 3RW0A 1TWHA 4QDLA 3RQEA 2Y39A 1T01A 1RKEA 4G0HA 1H9GA 1SZIA 4IWBA 2M64A 3BEHA 4KNWA 5KYXB 1JOGA 2LD6A 2X0CA 4HEAJ 1MNDA 1H6GA 4JVSA 2MHRA 3TOMA 3K1HA 4K1OA 1DOWA 4L6RA 3HLZA 1U6HA 3A9CA 2HV7A 3K1IC 3Q6MA 2XM4A 4NTBA 3LAYA 2Q3TA 5K0IA 3OWTA 3E70C 1HW2A 4QI2A 2HKVA 2FFHA 3IQCA 4KC9A 4EKWA 1OR3A 5T1DB 3T6BA 3AG2C 3M79A 3K33A 3G50A 2KSFA 4YWQA 1HMOA 3IHUA 4LDKA 1T5OA 2VH3A 4XQ1A 2XL4A 3U8PA 3GM3A 4CIHA 5IY5C 1ST6A 3LJBA 5EGYA 1LI7A 2M4EA 2AVKA 2IXMA 1N1CA 5B3SC 1LM3B 1Z3IX 3DE8A 2H7BA 2QNLA 3FMSA 4W8KA 1YDIA 2PX3A 3SP1A 1FFHA 1MNEA 3SXMA 1S7ZA 3KYIA 1FR0A 4DXWA 1MMAA 3LLKA 3AQCA 4DBRA 2YL7A 2CDQA 1YVIA 4OIQF 2KC3A 2I8BA 2P61A 2AWYA 1QPUA 4FESA 4GEHA 1QQ3A 4BJ5C 3S0XA 1A41A 2YWAA 4BJTA 2EPOA 1BBHA 3POVA 3TD7A 2IXNA 3VM6A 4G7ZF 1ZW3A 2KK1A 4CS9A 4BJ6C 2NUPB 4HE8D 2MYSA 4AE4A 1GQAA 1TWGA 1Q0KA 1M2VA 4NTAA 2OOCA 4WGZA 1RJ9A 1VLSA 1C17M 1OCRC 1WOLA 2EPMX 3C8ZA 3ZDLA 4MVQA 3HNIA 1QKRA 5HV9A 1H7IA 1OW6A 3DD7A 5E3AA 4YL1A 1O87A 3VRCA 2ASRA 2XLWA 1JPJA 3GANA 3NYMA 1D0XA 3MYIA 1G5ZA 2LCHA 1YJGA 3TQOA 1LS4A 3T6GB 4EBKA 4MQ9F 2PFDA 1A7DA 2PNOA 3LUTB 3C62A 5AC4A 1TFOB 2ZXRA 4JC7A 4JURI 2QUPA 2HMZA 2GFHA 5AC5A 5T3WA 1PV3A 1MMDA 1BR2A 1TR2A 2L6FA 3PMRA 3RF3A 4J7TA 3E9VA 3NKEA 2EIMC 3LESA 1ZHWA 2XLHA 2A68F 2YZSA 3JZ0A 3QW1A 2G62A 5EK0A 4OIOF 4BEJA 1RMVA 2OJQA 4CJGA 1F1MA 2KQ9A 2YHSA 4I1MA 1A0BA 3X2QC 5L3QA 1S05A 1Q0FA 4Q4ZF 3LNMB 3ZVRA 1UFBA 3QTHA 2VCAA 2YEVA 4E0IA 2KJGA 1V74B 3ZG1A 5L0GA 4NCQA 1E85A 3S27A 1IZMA 3U2MA 3ASOC 2DYRC 2KW3C 1VB5A 4JEBA 2LK4A 2XLMA 4R32A 3I5QA 4U5DE 4D4NA 2NG1A 1U89A 3WAQA 3RVZA 2LIGA 1OKKA 4G78A 3JRMO 1AUEA 1C02A 4CS8C 3F47A 3NG1A 5A6JA 4ER9A 1LE4A 2IXOA 2IXPA 1RKCA 4JKVA 4PJNA 4YL3A 5KYUB 2ZXPA 3F46A 4XTKA 2R02A 3LS0A 1AEPA 3NMIA 3OEOA 4PK4A 4LDQA 2MWQA 1CPRA 1YZAA 2O9XA 3U2LA 4BPMA 1ZHTA 2ZPAA 5COFA 3EHNA 4U5BE 3EFOB 3V7OA 3JYYA 3FAJA 3JSZA 5DVWA 2A6EF 4U5HA 4PJLA 4O79A 1FMVA 4A4AA 1T6UA 3EH2A 1JMWA 1G4US 1M2OA 2EIKC 4JJFA 4XEFA 2A0UA 2CGEA 5TJ5E 1CGOA 2WZFA 5GPGB 3FAPB 1OKKD 4CJOA
chains in the Genus database with same CATH topology
2NPUA 4DRHB 1NSGB 1FAPB 2FAPB 4DRJB 2GAQA 4DRIB 1AUEA 2RSEB 5GPGB 3FAPB 4FAPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPU A;  4DRH B;  1NSG B;  1FAP B;  2FAP B;  4DRJ B;  2GAQ A;  4DRI B;  1AUE A;  2RSE B;  5GPG B;  3FAP B;  4FAP B; 
#chains in the Genus database with same CATH topology
 1OCZ C;  2UUH A;  2VB6 A;  3AJM A;  3C8G A;  3DE9 A;  1ORJ A;  2ZXW C;  5FZT A;  3UGP A;  4C7O B;  2J45 A;  1T9K A;  5D91 A;  2IYL D;  1Q0M A;  4LLE A;  2LQG A;  3C7J A;  4D4X A;  2F22 A;  2OU6 A;  2NPU A;  2YKZ A;  1SMY F;  2RD9 A;  5E33 A;  2GAQ A;  4JCZ A;  1FFT C;  3U5S A;  4CDV A;  1EI7 A;  1QVX A;  2XS8 A;  2QTV A;  1XZQ A;  2R03 A;  2DI3 A;  2Y3H A;  4MVR A;  4DVY P;  1ZW2 A;  3K7D A;  3GOD A;  1G4W R;  2XL6 A;  4U5F E;  2XM0 A;  1DOV A;  3B0V C;  2L9J A;  4FWV A;  3LNR A;  3QVZ A;  4MVU A;  4DVZ A;  3HNL A;  4C3E A;  2EPL X;  3C8G D;  2L6H A;  2WB7 A;  3O6X A;  4IB4 A;  2EIL C;  4X0R A;  5CIV A;  1ZHX A;  3K66 A;  2NUP A;  4DRI B;  2Z15 A;  4IJJ A;  1PD1 A;  4O6N A;  3AGU A;  3IQ5 A;  2R7O A;  4U5G A;  2NUT B;  4U9E A;  2CNW A;  2EPN A;  3TUL A;  3ZTM A;  2R7S A;  3VAY A;  3MFN A;  4ZLD A;  4JE9 A;  2QE9 A;  5F28 E;  4E7S A;  5KYW B;  3DJN B;  3QW0 A;  5B1B C;  5COM A;  2R7R A;  4EBB A;  5JUA A;  3US6 A;  2OJE D;  5KYN A;  4ULV A;  3AG3 C;  3L8J A;  1QLE C;  3EGX A;  4PJM A;  2A69 F;  3MX3 A;  3RQF A;  4QI0 A;  1CPQ A;  2RSE B;  1YLM A;  3WOD F;  2JD3 A;  3DI5 A;  3ZQV A;  2J9W A;  2Y3D A;  1I5N A;  1XZP A;  1O3U A;  1YA9 A;  2FGY A;  1OCO C;  2PF4 E;  3ABM C;  3L0I A;  4JTA B;  4BG0 A;  2WZG A;  3HKK A;  1FMW A;  3A11 A;  2CNW D;  3UGO A;  3NDB B;  4XLP F;  1WWP A;  3V5Y A;  1IW7 F;  4YT5 A;  2L6G A;  5L0C A;  3RYL A;  4PFP A;  2HUJ A;  3FVY A;  3R2P A;  2HV6 A;  3GWL A;  1MQV A;  1NLX A;  3T9O A;  4XWJ A;  4NTF A;  4YT8 A;  1LIH A;  4CSA C;  5HSW A;  2Q9A A;  2ETS A;  2L81 A;  3TK0 A;  2XLV A;  4BJ5 A;  2YL3 A;  5DLJ A;  4MVZ A;  1BR4 A;  3Q7G A;  2R9R B;  4U5C E;  3U3F A;  4ZLC A;  3HNJ A;  4P9T A;  2HS5 A;  3C18 A;  5EHH A;  2A1D D;  2LSE A;  3MLG A;  4JZA A;  4MVM A;  4NY3 A;  4CS9 C;  4BJ6 A;  1KNY A;  1TWC A;  3K6B A;  1LS1 A;  4NC3 A;  4DRH B;  2HFI A;  2LFF A;  2OQM A;  3JYH A;  1RKE B;  1TFK B;  3QVY A;  3DWW A;  1NSG B;  5KYU A;  2C03 A;  2XSE A;  3UR3 C;  3SYN A;  1JPN A;  3SZR A;  1LVK A;  3EGD A;  1VYK A;  2GWW A;  2XXA A;  5AGF A;  2JX0 A;  1E86 A;  1W2W A;  3SXK A;  2ZXO A;  1Z23 A;  3U9J A;  3ZC4 A;  3FHD A;  2KNH A;  1B68 A;  3VYW A;  4RDA A;  1RCP A;  2R05 A;  4JRZ A;  4E7Z A;  4HFF B;  3GWN A;  1VLT A;  2G3K A;  2AP3 A;  3DAG A;  3X1O A;  2VCC A;  3EG9 A;  4OD5 A;  3T6J A;  1D1C A;  3TJ6 A;  1OXK A;  2NSF A;  2C04 A;  3IPM O;  3O39 A;  4GYT A;  4JJG A;  3RIP A;  3ABK C;  5A6B A;  1ZZP A;  1EKY A;  3S28 A;  1R4T A;  2Y69 C;  3ASN C;  4C3D A;  5A6K A;  4DRJ B;  2J9V A;  4GQH A;  3H2V A;  3W8H A;  3EZI A;  1Y6D A;  4H54 A;  3FOO A;  3GEE A;  3W2V A;  3ZWI A;  2WVQ A;  3GEI A;  3ECS A;  2XLO A;  4JTD B;  4DOZ A;  5JLI A;  1NG1 A;  4Q5S F;  2H8A A;  3JCU Q;  5BQI A;  1SF8 A;  2YLI A;  2J46 A;  4J30 B;  2QY9 A;  1U0B B;  3CAX A;  3CZ6 A;  1LI5 A;  2XS1 A;  5KYX A;  4MND A;  1OR2 A;  4U5E E;  1YYX A;  2J9U A;  2LFD A;  2WZL A;  4IAO A;  3W2W A;  4CS8 A;  1Z5Z A;  3UNG C;  1LE2 A;  1A7E A;  2IOQ A;  2PBE A;  3RKO F;  3V5X A;  4AE4 B;  2YL0 A;  2AU5 A;  3M4B A;  3S84 A;  1M2V B;  5A6B D;  4KI2 A;  1D0Z A;  1RJ9 B;  3GM2 A;  3M1C B;  5L0J A;  5CI8 A;  5L0D A;  4H4K C;  3RFY A;  1Q0G A;  4MTF A;  1E83 A;  3UMH A;  2Y3G A;  4O6M A;  1T6I A;  4RBN A;  2BL2 A;  1E84 A;  2Q7R A;  3LEO A;  1NFO A;  3DMD A;  3OA1 A;  4PAC A;  1FTS A;  4AL1 A;  1APC A;  4AX2 A;  3DJU B;  1BZ4 A;  3GEH A;  2XLE A;  3MBG A;  4LER A;  4OIR F;  3U3B A;  4EUK B;  1J8Y F;  3AGT A;  3EH1 A;  1FAP B;  4LLC A;  2YLD A;  1OQC A;  4C3B A;  3H65 A;  1O5H A;  4XLN F;  2DB4 A;  3PHF 2;  1Z7Q c;  1NFN A;  1ZHY A;  5DQZ A;  4CX9 A;  2R7V A;  1G8X A;  4ONS A;  5L0F A;  4G7O F;  4XEK A;  3FXH A;  5L0I A;  2XL8 A;  1RXQ A;  2YQY A;  3TJ5 A;  2H7V C;  4E0H A;  1AVO B;  1ZVZ A;  1WN0 A;  3VF0 A;  3GM1 A;  2GDC A;  2A6H F;  3I5P A;  3LEV A;  3U9M A;  3B29 A;  5DS6 A;  1HY5 A;  1FNT c;  3L1M A;  2W4M A;  4M63 A;  1HE9 A;  2DGJ A;  4Q7C A;  3TOL A;  1VK5 A;  5CI9 A;  1KTM A;  2ZD9 A;  2Q9C A;  2FAP B;  3LS1 A;  4Z9I A;  2OEX A;  3U8V A;  4PR9 A;  3L34 A;  2OEV A;  5L3V A;  3DKA A;  4MVO A;  1YA7 O;  3DZA A;  2HJ3 A;  3NMJ A;  5F5H A;  1JR8 A;  2P6V A;  2EPK X;  4F4B A;  2CYD A;  2J0X A;  2W45 A;  3AG4 C;  5A6A A;  1GGQ A;  3B0P A;  1YZC A;  1SYQ A;  2OG2 A;  4W8P A;  4EHP A;  3KPH A;  3ITF A;  3SXY A;  2BC5 A;  2H7O A;  3K1I A;  1LPE A;  4N6H A;  2YRF A;  1Y4C A;  2J7P A;  3EPV A;  3JT1 A;  3NMK A;  4MW3 A;  3ZSU A;  4BJ1 A;  4YT2 A;  1CGM E;  2EIN C;  4HFK B;  1M56 C;  5D92 A;  4FAP B;  4YK5 A;  2ICW G;  3DM9 B;  5KYY B;  2WVN A;  3W8I A;  4EWC A;  1YYJ A;  3M4C A;  2QLA A;  3DAF A;  3NYJ A;  3JSE O;  1OCC C;  3ATP A;  3EZH A;  5JP7 A;  5JSL A;  2CCY A;  4FX5 A;  1NU7 D;  1OXB A;  4UDV A;  1C03 A;  1Q0D A;  1PCX A;  4YL0 A;  2OKU A;  5BUO A;  1SR2 A;  1VYI A;  3QZC A;  4JW1 A;  4JTC B;  1KU2 A;  4JCH A;  3C8G B;  1T6Q A;  3DXJ F;  3MYF A;  2D5R B;  3S9O A;  3EJN A;  2L7A A;  3ZQY A;  2KGO A;  2J7P D;  3HJC A;  1ZU4 A;  4YN0 B;  1H9T A;  1JRA A;  1E2X A;  2R7U A;  3I4U A;  3JTL O;  3LLI A;  2PP4 A;  3KKB A;  3IQ6 A;  3U0C A;  4O7G A;  1OW8 A;  4WAB A;  1I4Y A;  1WTY A;  3T4R A;  3WG7 C;  2LP4 A;  2WL8 A;  3W4Y A;  1WAS A;  4BEM J;  4O6Y A;  2HSB A;  2AWC A;  2I15 A;  2P7V A;  4JIO A;  5JS5 A;  3KYJ A;  1K05 A;  4CIP A;  1K40 A;  4CSA A;  3B9Q A;  1OW7 A;  1M57 C;  3KMI A;  4J7Y A;  2EIJ C;  2VC9 A;  4MW8 A;  4LAC B;  1MMN A;  1WGW A;  3AG1 C;  3KH2 A;  4XPW A;  3KL4 A;  4RD9 A;  3RQG A;  4AL0 A;  2B0J A;  3HTK C;  3RVY A;  1HMD A;  3G4X A;  3NKD A;  256B A;  3EFO A;  2YLG A;  4OD4 A;  5F5F A;  3UMI A;  1EQ1 A;  1J8M F;  1GS9 A;  5T3T A;  2Q9B A;  1PD0 A;  4XPX A;  1TWA A;  2D4U A;  5B1A C;  2R25 A;  3H2U A;  3SNH A;  2W4B A;  4CS7 A;  5E3C A;  2V26 A;  4CDY A;  2J0W A;  2Q4F A;  1YAR O;  4JEA A;  5L0H A;  3R7C A;  2Y3B A;  5DS5 A;  1D0Y A;  4NQF A;  1V55 C;  2A0B A;  3B71 A;  4N4W A;  3S29 A;  3V5Z A;  4DJ9 A;  4C7O A;  1XWJ A;  3BRJ A;  2VAS A;  1TQG A;  3EGX B;  4I44 A;  4MTG A;  1D1B A;  4I1O B;  3L8I A;  4MS2 A;  5BQH A;  3DM5 A;  3CQZ A;  1ZU5 A;  2IBF A;  2XRH A;  2Q00 A;  3ZIB A;  1VTM P;  4OIP F;  1V4A A;  2HMQ A;  3J06 A;  2IM8 A;  3M15 A;  2YVK A;  4E18 A;  5FCL A;  1I4Z A;  5E2Q A;  2OCC C;  2HSQ A;  1NBB A;  4MTO A;  2B0H A;  4XEV A;  3S90 A;  4E17 A;  2BE5 F;  3QMK A;  3B0U X;  1V54 C;  3N0T A;  2HZ8 A;  3AQB A;  3WHN A;  4KNV A;  1NZE A;  2X51 A;  3NRH A;  3PDM P;  2HJM A;  3RH3 A;  1BR1 A;  4Z9J A;  3O10 A;  1K04 A;  3UMK A;  1BDJ B;  3CSK A;  1Z63 A;  2NUT A;  5B3I A;  2JPU A;  5JVE A;  3NYL A;  4P6I C;  3PCV A;  4CBE A;  2V3C C;  2P0N A;  2G3V A;  1NU9 C;  1QZX A;  5JRA A;  4I3M A;  4A2N B;  4Z9H A;  5KYW A;  4G7H F;  3Q7L A;  3FDQ A;  3G4Z A;  2J8W A;  1HW1 A;  3CEX A;  3ABL C;  1CGN A;  1ORS C;  1VMA A;  1Z6A A;  1HE1 A;  2KYH A;  1ZYR F;  2R7Q A;  4IAR A;  4K7B A;  1GM5 A;  3N2Z B;  3HNK A;  3IQT A;  3EHM A;  3SEO A;  2NSG A;  4MVS A;  5COG A;  3EGD B;  3IEE A;  3Q6N A;  4OIN F;  4DBQ A;  2R7T A;  5KYY A;  2XXA B;  2CW0 F;  4IAQ A;  4KBL A;  4U9D A;  3C63 A;  2GA0 A;  3O55 A;  5BQG A;  1L3P A;  4EIY A;  2W9Y A;  4YT4 A;  4CDA A;  4AK9 A;  3ZTZ A;  2YL1 A;  1JAF A;  1MMG A;  3GOR A;  4PFO A;  4ULW A;  1R5I D;  1A7V A;  4XPY A;  4WGY A;  3EQL F;  4IRU A;  1LKX A;  2UUI A;  3FOP A;  3EG9 B;  1ORY A;  1VOM A;  1QSP A;  1YAU O;  4K0D A;  4B6I A;  4EBJ A;  4J32 B;  3N24 A;  4PJJ A;  5JT4 A;  5DS4 A;  4IGG A;  2R7W A;  2R7X A;  1ZHZ A;  2P1A A;  2WVO A;  4LDR A;  4N06 A;  2TMV P;  1UG7 A;  2DYS C;  2VCB A;  3AOU A;  1EA8 A;  1L7C A;  1TKN A;  4YJW A;  1D1A A;  2J9B A;  4N6C A;  4ANJ A;  2XLD A;  5A69 A;  4P9F A;  5DQT A;  4WJ0 A;  1WAT A;  2E87 A;  2PX0 A;  3SXZ A;  1M6T A;  3JRT A;  3RW0 A;  1TWH A;  4QDL A;  3RQE A;  2Y39 A;  1T01 A;  1RKE A;  4G0H A;  1H9G A;  1SZI A;  4IWB A;  2M64 A;  3BEH A;  4KNW A;  5KYX B;  1JOG A;  2LD6 A;  2X0C A;  4HEA J;  1MND A;  1H6G A;  4JVS A;  2MHR A;  3TOM A;  3K1H A;  4K1O A;  1DOW A;  4L6R A;  3HLZ A;  1U6H A;  3A9C A;  2HV7 A;  3K1I C;  3Q6M A;  2XM4 A;  4NTB A;  3LAY A;  2Q3T A;  5K0I A;  3OWT A;  3E70 C;  1HW2 A;  4QI2 A;  2HKV A;  2FFH A;  3IQC A;  4KC9 A;  4EKW A;  1OR3 A;  5T1D B;  3T6B A;  3AG2 C;  3M79 A;  3K33 A;  3G50 A;  2KSF A;  4YWQ A;  1HMO A;  3IHU A;  4LDK A;  1T5O A;  2VH3 A;  4XQ1 A;  2XL4 A;  3U8P A;  3GM3 A;  4CIH A;  5IY5 C;  1ST6 A;  3LJB A;  5EGY A;  1LI7 A;  2M4E A;  2AVK A;  2IXM A;  1N1C A;  5B3S C;  1LM3 B;  1Z3I X;  3DE8 A;  2H7B A;  2QNL A;  3FMS A;  4W8K A;  1YDI A;  2PX3 A;  3SP1 A;  1FFH A;  1MNE A;  3SXM A;  1S7Z A;  3KYI A;  1FR0 A;  4DXW A;  1MMA A;  3LLK A;  3AQC A;  4DBR A;  2YL7 A;  2CDQ A;  1YVI A;  4OIQ F;  2KC3 A;  2I8B A;  2P61 A;  2AWY A;  1QPU A;  4FES A;  4GEH A;  1QQ3 A;  4BJ5 C;  3S0X A;  1A41 A;  2YWA A;  4BJT A;  2EPO A;  1BBH A;  3POV A;  3TD7 A;  2IXN A;  3VM6 A;  4G7Z F;  1ZW3 A;  2KK1 A;  4CS9 A;  4BJ6 C;  2NUP B;  4HE8 D;  2MYS A;  4AE4 A;  1GQA A;  1TWG A;  1Q0K A;  1M2V A;  4NTA A;  2OOC A;  4WGZ A;  1RJ9 A;  1VLS A;  1C17 M;  1OCR C;  1WOL A;  2EPM X;  3C8Z A;  3ZDL A;  4MVQ A;  3HNI A;  1QKR A;  5HV9 A;  1H7I A;  1OW6 A;  3DD7 A;  5E3A A;  4YL1 A;  1O87 A;  3VRC A;  2ASR A;  2XLW A;  1JPJ A;  3GAN A;  3NYM A;  1D0X A;  3MYI A;  1G5Z A;  2LCH A;  1YJG A;  3TQO A;  1LS4 A;  3T6G B;  4EBK A;  4MQ9 F;  2PFD A;  1A7D A;  2PNO A;  3LUT B;  3C62 A;  5AC4 A;  1TFO B;  2ZXR A;  4JC7 A;  4JUR I;  2QUP A;  2HMZ A;  2GFH A;  5AC5 A;  5T3W A;  1PV3 A;  1MMD A;  1BR2 A;  1TR2 A;  2L6F A;  3PMR A;  3RF3 A;  4J7T A;  3E9V A;  3NKE A;  2EIM C;  3LES A;  1ZHW A;  2XLH A;  2A68 F;  2YZS A;  3JZ0 A;  3QW1 A;  2G62 A;  5EK0 A;  4OIO F;  4BEJ A;  1RMV A;  2OJQ A;  4CJG A;  1F1M A;  2KQ9 A;  2YHS A;  4I1M A;  1A0B A;  3X2Q C;  5L3Q A;  1S05 A;  1Q0F A;  4Q4Z F;  3LNM B;  3ZVR A;  1UFB A;  3QTH A;  2VCA A;  2YEV A;  4E0I A;  2KJG A;  1V74 B;  3ZG1 A;  5L0G A;  4NCQ A;  1E85 A;  3S27 A;  1IZM A;  3U2M A;  3ASO C;  2DYR C;  2KW3 C;  1VB5 A;  4JEB A;  2LK4 A;  2XLM A;  4R32 A;  3I5Q A;  4U5D E;  4D4N A;  2NG1 A;  1U89 A;  3WAQ A;  3RVZ A;  2LIG A;  1OKK A;  4G78 A;  3JRM O;  1AUE A;  1C02 A;  4CS8 C;  3F47 A;  3NG1 A;  5A6J A;  4ER9 A;  1LE4 A;  2IXO A;  2IXP A;  1RKC A;  4JKV A;  4PJN A;  4YL3 A;  5KYU B;  2ZXP A;  3F46 A;  4XTK A;  2R02 A;  3LS0 A;  1AEP A;  3NMI A;  3OEO A;  4PK4 A;  4LDQ A;  2MWQ A;  1CPR A;  1YZA A;  2O9X A;  3U2L A;  4BPM A;  1ZHT A;  2ZPA A;  5COF A;  3EHN A;  4U5B E;  3EFO B;  3V7O A;  3JYY A;  3FAJ A;  3JSZ A;  5DVW A;  2A6E F;  4U5H A;  4PJL A;  4O79 A;  1FMV A;  4A4A A;  1T6U A;  3EH2 A;  1JMW A;  1G4U S;  1M2O A;  2EIK C;  4JJF A;  4XEF A;  2A0U A;  2CGE A;  5TJ5 E;  1CGO A;  2WZF A;  5GPG B;  3FAP B;  1OKK D;  4CJO A; 
#chains in the Genus database with same CATH homology
 2NPU A;  4DRH B;  1NSG B;  1FAP B;  2FAP B;  4DRJ B;  2GAQ A;  4DRI B;  1AUE A;  2RSE B;  5GPG B;  3FAP B;  4FAP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...