1FAPB

The structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
b'RVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FK506-BINDING PROTEIN
publication title Structure of the FKBP12-rapamycin complex interacting with the binding domain of human FRAP.
pubmed rcsb
source organism Homo sapiens
molecule tags Complex (isomerase/kinase)
total genus 34
structure length 95
sequence length 95
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1996-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 1fapB00
2NPUA 3FAPB 4DRIB 2GAQA 2FAPB 1AUEA 4DRJB 4FAPB 1NSGB 5GPGB 2RSEB 1FAPB 4DRHB
chains in the Genus database with same CATH superfamily
5L0FA 2J9VA 2EPMX 4OIRF 1VB5A 4AL0A 3RH3A 5EHHA 1I4ZA 1KU2A 2EIMC 4M63A 2J0XA 3DAFA 1KNYA 2OOCA 1TFOB 3B0PA 3JRMO 2Z15A 5B1AC 5HV9A 1ZU4A 3EPVA 5CIVA 1LVKA 1QKRA 5L3QA 3C18A 3UGOA 3IQTA 2QTVA 4LLEA 5CI9A 3S9OA 2CGEA 4Q4ZF 2M4EA 2W4BA 2XS8A 3V5YA 5JP7A 1OR2A 1Q0MA 4IRUA 1OW6A 5COFA 3RVYA 2NSGA 1RJ9B 3K1IA 3A9CA 4U9EA 2A68F 4FX5A 3FAJA 4OINF 1VK5A 3EQLF 1LS1A 1Q0KA 3NYMA 3K6BA 1JAFA 4I1MA 2TMVP 1RMVA 2LP4A 4MNDA 4MW3A 5D91A 3ZQYA 2XLEA 4QDLA 2FAPB 2YZSA 4H4KC 3UMKA 2XXAB 5A6KA 3ABMC 5A6BA 3ZC4A 3TULA 1MNDA 4C3DA 3O10A 5L0JA 4A4AA 1FFHA 3KL4A 2Q00A 3PMRA 2L7AA 1G5ZA 1NSGB 1MMNA 3RKOF 1HE1A 2ICWG 2JX0A 4DRHB 2XSEA 4J7YA 5JS5A 5EGYA 1ZZPA 4K1OA 3OWTA 1QSPA 2NSFA 2QY9A 2PFDA 2J9UA 2L9JA 3GM3A 3JSZA 1YAUO 3LESA 3N24A 2AP3A 1PD0A 3R2PA 4C7OB 5GPGB 3L8JA 2YEVA 5JVEA 3PHF2 1SMYF 2A0BA 3HJCA 1S7ZA 3UR3C 3S84A 1VTMP 1RJ9A 1U89A 4OIQF 1NZEA 3PCVA 4OD4A 1OKKD 3FOPA 4CS8C 1Q0GA 1EA8A 2DYSC 3GM1A 2XL4A 5DLJA 3NG1A 4EWCA 1T6IA 1Z5ZA 2GFHA 3W8HA 2J7PD 1JPNA 4E17A 5JUAA 1LKXA 1WTYA 3MFNA 4E0IA 3EH2A 4N06A 4A2NB 4BG0A 3DZAA 4JCZA 1M2VB 3EG9A 4MTGA 1PCXA 3MBGA 4RBNA 2J8WA 2PX3A 2XXAA 4HEAJ 1Q0DA 4YL3A 4CBEA 1VYKA 4O79A 2Q3TA 3UNGC 5BUOA 1YA9A 3DE8A 3V7OA 3ZIBA 1FFTC 1ZHWA 2VCAA 2RSEB 1C03A 4BEJA 3A11A 1A7EA 1ZHXA 3I5PA 2AVKA 2BE5F 3EHMA 1YYJA 5L0CA 1SF8A 2H7BA 4BJ1A 1GM5A 4ZLDA 1D0XA 3RFYA 1EQ1A 5KYYA 4W8PA 1CPQA 1GQAA 4LDQA 3DWWA 2VCCA 4MVQA 1WN0A 2QE9A 2LFDA 5BQHA 4ZLCA 4MW8A 3EZIA 1OQCA 3QW1A 1J8MF 2FGYA 3JYYA 3DJUB 4XQ1A 4CS9C 1TR2A 3NMJA 2BC5A 4O7GA 1YVIA 2YHSA 4GEHA 2C04A 2ETSA 4X0RA 4XPWA 5DS5A 4JTCB 1NFNA 4XLPF 2Y3BA 4DJ9A 4CJOA 4EBBA 2IM8A 2I15A 4RDAA 1FAPB 2H7VC 4R32A 3RQFA 4JIOA 4PR9A 3MX3A 4D4NA 3QTHA 3TQOA 4ER9A 2ZXWC 1OW7A 1M2VA 2KC3A 3NMIA 4N6HA 5E33A 3KMIA 3W2WA 1BR1A 3ABLC 4AE4A 4WJ0A 4MVOA 3U3FA 3QVYA 4PJLA 5E2QA 1NLXA 3BEHA 3LJBA 2Q9BA 1LI7A 2L6HA 4MVMA 4O6MA 5DVWA 1MMGA 2A69F 5B1BC 5BQGA 3M15A 2D4UA 3TK0A 3R7CA 3EGXB 1CGOA 4G7ZF 2Q7RA 3UGPA 2P61A 2ZXOA 2PF4E 5E3AA 4CS9A 3FMSA 1NFOA 3M4CA 3W2VA 3ZVRA 2P6VA 1Q0FA 3CAXA 3L1MA 1V54C 3M79A 3J06A 2W9YA 3AQBA 1Z3IX 2HJ3A 3MYIA 4N4WA 1W2WA 2YL1A 3SNHA 1XZPA 3SYNA 5L0GA 4YL0A 1Z63A 4L6RA 4ANJA 4CDAA 4ONSA 2P7VA 3S28A 4BPMA 3EHNA 3KPHA 1HE9A 1K05A 1N1CA 2OJQA 3L0IA 2AWYA 4JE9A 3EGDA 3Q6MA 3ASOC 2MHRA 1HY5A 1JR8A 3C7JA 1HW2A 3FVYA 1A7DA 2EIJC 4XEVA 2HSQA 3US6A 2YVKA 4LDKA 1VOMA 3C8GD 4EIYA 2ZXPA 2C03A 1YLMA 3AOUA 2L6GA 2I8BA 2YL0A 3N0TA 2WB7A 4JTAB 1PD1A 1ZHYA 4CDYA 3EFOB 2PX0A 1OCCC 3NYJA 1E2XA 2M64A 2NUPA 2R05A 1TWGA 4MQ9F 3ZWIA 4XTKA 2EINC 2WVNA 4CSAC 1IZMA 1L7CA 1MQVA 3LLKA 4EBJA 2R7TA 1S05A 3T9OA 4O6NA 1HMOA 1MNEA 4JURI 3VM6A 1QZXA 5KYXA 4LLCA 1I5NA 2L81A 3U5SA 1BDJB 3HNIA 2DI3A 2OJED 1VYIA 3ZQVA 1H9TA 4U5BE 1HMDA 4PFOA 3QW0A 3WHNA 3HLZA 3DM5A 2LK4A 2Y39A 1UFBA 5DS4A 5AC4A 1LIHA 4MVUA 2CYDA 3SXZA 3L34A 4WGZA 4EUKB 4CIHA 4ULWA 1JMWA 5F28E 2HS5A 5K0IA 2XLDA 3AG2C 5EK0A 4JC7A 5T1DB 1LPEA 3ZTMA 1EI7A 5BQIA 3X1OA 3HTKC 1G4US 1WATA 2WVOA 2YWAA 2PBEA 2CNWD 3B0VC 3U2MA 2XLWA 5TJ5E 2ZPAA 2XLMA 3SP1A 4KBLA 3H65A 5KYUB 4CSAA 3H2VA 5B3SC 4YK5A 4XEKA 3EFOA 4WABA 3W8IA 4B6IA 2HSBA 2E87A 3Q7LA 1WOLA 3FAPB 1Y6DA 4HE8D 2UUIA 4XEFA 2JPUA 3N2ZB 1H7IA 4IAOA 3RVZA 2LD6A 1FR0A 3JSEO 1ZYRF 4P9TA 1YZAA 2OEXA 3WODF 1D1AA 3ZDLA 2OEVA 2NPUA 1LM3B 5JLIA 1VLSA 2IBFA 4DRJB 2OKUA 5FCLA 2R7VA 5DQTA 5KYWB 3RQGA 5A6BD 3ASNC 2R7WA 1QQ3A 3U9JA 1VLTA 4BJ6A 3Q6NA 1TWCA 1JPJA 3B29A 5A6AA 2XL8A 5L0HA 1K04A 3SXYA 3ZTZA 5DQZA 4F4BA 4XPXA 5COMA 2VCBA 2KSFA 3U2LA 5HSWA 2HMZA 4FAPB 1AEPA 4J30B 3ITFA 3F46A 2R7QA 1T6UA 3GORA 1EKYA 4JKVA 2QLAA 4JEBA 4YT8A 4J7TA 4Z9IA 4PK4A 4JJFA 4QI0A 1OCRC 4C3EA 2KGOA 1Z6AA 2EPKX 4ULVA 4YT4A 5B3IA 3IQ6A 3LNMB 4C7OA 2J9BA 1FTSA 3C62A 2A1DD 2R9RB 2O9XA 1ZU5A 4KC9A 2HZ8A 2IXPA 1NG1A 4BJ5C 3GODA 4IB4A 4NQFA 4U5CE 3IHUA 1ZHTA 1ZHZA 1OW8A 1J8YF 1T6QA 1RKEB 3CSKA 3E70C 3E9VA 4GQHA 2Y3HA 3GEHA 4LACB 2G62A 4BJTA 2HUJA 4JZAA 2IOQA 4CDVA 2VB6A 1AUEA 2ZXRA 2X0CA 3W4YA 5L3VA 2J0WA 1SYQA 2Q9CA 1H6GA 3RQEA 4EBKA 1U6HA 3C8GB 2VASA 3FHDA 1QLEC 2EPLX 3PDMP 1CPRA 3IPMO 1V4AA 2BL2A 3K7DA 3AG1C 3EH1A 2YKZA 2XS1A 3RIPA 3HKKA 4MTOA 4LDRA 5L0DA 3U0CA 4GYTA 2XLHA 4NTAA 1XWJA 2HV6A 3FXHA 1QVXA 1M57C 1G8XA 4KNWA 4YT5A 3LS0A 4NTFA 2H8AA 1GS9A 1RCPA 2OCCC 2GDCA 4P6IC 1O87A 3DM9B 4U9DA 2R7OA 1SZIA 1V55C 4XWJA 3U3BA 4EHPA 3S90A 3I5QA 3LLIA 1ST6A 4LERA 2VC9A 4OD5A 1MMAA 1U0BB 3VF0A 4MVZA 5FZTA 2KNHA 2LCHA 1KTMA 1NU7D 3CEXA 3LS1A 3V5ZA 2GWWA 3F47A 4JCHA 4JRZA 4AL1A 2B0JA 5F5FA 2YLIA 2OG2A 1DOWA 2XRHA 2VH3A 1RKEA 1OCOC 3H2UA 2B0HA 3GWLA 2DB4A 1YDIA 4YN0B 4NCQA 2ASRA 3ATPA 4RD9A 3LEOA 2KJGA 3NRHA 2WZGA 2YRFA 3HNLA 3O6XA 1M56C 1MMDA 3C8GA 4IWBA 1BR2A 4Q5SF 4D4XA 5JRAA 1T5OA 4JVSA 1YJGA 5IY5C 3K1HA 1LE2A 4YWQA 1BZ4A 4CIPA 4E7SA 2HMQA 2GA0A 4CJGA 1B68A 3EJNA 3NKEA 256BA 4YT2A 4K7BA 3TJ6A 2PNOA 2L6FA 3M1CB 2JD3A 4IGGA 3EGXA 4BJ5A 2HFIA 3GEEA 1T01A 1O3UA 1K40A 3AGTA 1APCA 2R02A 2J46A 3L8IA 1YZCA 1QPUA 1YARO 3X2QC 2X51A 3WAQA 5A6JA 4PJMA 1E86A 2FFHA 3AJMA 4JW1A 2PP4A 3T4RA 1WASA 3AQCA 4NY3A 2Y3DA 1OXKA 3LEVA 5CI8A 1HW1A 3HNJA 4HFKB 3RF3A 1E83A 4Z9JA 3TD7A 3LUTB 4J32B 1BR4A 3MLGA 4UDVA 4P9FA 4BJ6C 3G4XA 3ZSUA 2CNWA 4K0DA 1CGNA 2R25A 1JRAA 1UG7A 3QVZA 5AGFA 4JEAA 4Z9HA 3T6GB 1D0ZA 1DOVA 3S0XA 5E3CA 5DS6A 2NG1A 5F5HA 2XLVA 1JOGA 1L3PA 2YQYA 4NC3A 3T6BA 1OXBA 2QUPA 3KYIA 3NMKA 4MVRA 4DVZA 1Z23A 4H54A 2WL8A 2YL7A 2HJMA 4IJJA 3LAYA 1ORJA 1BBHA 1OKKA 1TQGA 2IXNA 2EPOA 1T9KA 1C02A 1FMVA 3IQCA 3M4BA 2LQGA 3EG9B 1XZQA 3CZ6A 3ZG1A 2AU5A 2Y3GA 5AC5A 4G7OF 5T3TA 1NU9C 1FMWA 4EKWA 4NTBA 2J7PA 4E7ZA 1LE4A 3UMHA 4DBQA 3JCUQ 3VYWA 3GWNA 1VMAA 2V26A 2XL6A 3JT1A 1LI5A 2R03A 1ZVZA 4O6YA 2CW0F 4MTFA 4MVSA 2W45A 2OU6A 4WGYA 1M2OA 4U5HA 1PV3A 1AVOB 3BRJA 4I1OB 4JTDB 5KYYB 2YLDA 3DE9A 2G3KA 2RD9A 3QZCA 3K33A 3EZHA 3JRTA 3G4ZA 1V74B 4PJNA 2J9WA 3SZRA 3UMIA 4C3BA 5D92A 4I3MA 2A6EF 2V3CC 2J45A 3HNKA 4MS2A 3IQ5A 5KYUA 1ZW2A 3QMKA 2CDQA 2EPNA 3K66A 3FDQA 4PJJA 3U8PA 5COGA 4OIPF 2XLOA 1RKCA 3OA1A 4IARA 4KNVA 1RXQA 1R4TA 4BEMJ 1M6TA 3DI5A 1E84A 3KH2A 3U9MA 2IXOA 3GM2A 5KYNA 1A41A 1SR2A 4U5EE 4G7HF 2KQ9A 3GEIA 3C63A 2P1AA 3SXMA 4AE4B 4CS7A 2R7UA 1OCZC 3AGUA 3IEEA 5KYWA 1TWHA 4Q7CA 1A7VA 3B0UX 5JT4A 2AWCA 3S29A 2OQMA 2YLGA 3B71A 1IW7F 3LNRA 3SXKA 1YYXA 4DXWA 2R7RA 1D1BA 3I4UA 4YJWA 2DGJA 1I4YA 1R5ID 3DXJF 2R7XA 1C17M 1YA7O 4CS8A 1F1MA 4U5GA 3DJNB 3AG4C 3DKAA 3CQZA 5A69A 2XM4A 4JJGA 1H9GA 2KK1A 2H7OA 4G78A 4XPYA 3NDBB 4AX2A 2EIKC 2WZFA 3O55A 3JYHA 2G3VA 2EILC 3C8ZA 2W4MA 1TFKB 2MYSA 2WZLA 2NUTB 4OIOF 4IAQA 1WGWA 2KYHA 2WVQA 2Y69C 1O5HA 3ABKC 1D0YA 3TOMA 2R7SA 4QI2A 1A0BA 3EGDB 2P0NA 3NYLA 2DYRC 3RW0A 1Z7Qc 4HFFB 4AK9A 2Q4FA 4DOZA 3OEOA 3B9QA 1NBBA 1WWPA 2KW3C 4CX9A 3DD7A 3KYJA 3RYLA 2HV7A 5T3WA 4E0HA 2A0UA 4XLNF 1ZW3A 2XM0A 4FESA 4DBRA 5L0IA 2D5RB 4I44A 4G0HA 2CCYA 4U5DE 2HKVA 3V5XA 1ORSC 2UUHA 3Q7GA 1CGME 3SEOA 3MYFA 2IXMA 1TKNA 1D1CA 3NKDA 4U5FE 4YL1A 3S27A 3TOLA 3WG7C 4DVYP 3POVA 2GAQA 2NUPB 4FWVA 3U8VA 3JZ0A 3O39A 1ORYA 3KKBA 1FNTc 1E85A 1Y4CA 3DMDA 3G50A 4E18A 2A6HF 2LIGA 3VRCA 1LS4A 5KYXB 5JSLA 2LFFA 4W8KA 3DAGA 3JTLO 3ECSA 1TWAA 3K1IC 4DRIB 4PFPA 2QNLA 3VAYA 3TJ5A 2ZD9A 3GANA 2NUTA 2LSEA 3FOOA 4KI2A 1G4WR 2YL3A 2MWQA 3T6JA 4N6CA 2IYLD 2F22A 3AG3C 4PACA 1OR3A 2Q9AA 1GGQA
chains in the Genus database with same CATH topology
2NPUA 3FAPB 4DRIB 2GAQA 2FAPB 1AUEA 4DRJB 4FAPB 1NSGB 5GPGB 2RSEB 1FAPB 4DRHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPU A;  3FAP B;  4DRI B;  2GAQ A;  2FAP B;  1AUE A;  4DRJ B;  4FAP B;  1NSG B;  5GPG B;  2RSE B;  1FAP B;  4DRH B; 
#chains in the Genus database with same CATH topology
 5L0F A;  2J9V A;  2EPM X;  4OIR F;  1VB5 A;  4AL0 A;  3RH3 A;  5EHH A;  1I4Z A;  1KU2 A;  2EIM C;  4M63 A;  2J0X A;  3DAF A;  1KNY A;  2OOC A;  1TFO B;  3B0P A;  3JRM O;  2Z15 A;  5B1A C;  5HV9 A;  1ZU4 A;  3EPV A;  5CIV A;  1LVK A;  1QKR A;  5L3Q A;  3C18 A;  3UGO A;  3IQT A;  2QTV A;  4LLE A;  5CI9 A;  3S9O A;  2CGE A;  4Q4Z F;  2M4E A;  2W4B A;  2XS8 A;  3V5Y A;  5JP7 A;  1OR2 A;  1Q0M A;  4IRU A;  1OW6 A;  5COF A;  3RVY A;  2NSG A;  1RJ9 B;  3K1I A;  3A9C A;  4U9E A;  2A68 F;  4FX5 A;  3FAJ A;  4OIN F;  1VK5 A;  3EQL F;  1LS1 A;  1Q0K A;  3NYM A;  3K6B A;  1JAF A;  4I1M A;  2TMV P;  1RMV A;  2LP4 A;  4MND A;  4MW3 A;  5D91 A;  3ZQY A;  2XLE A;  4QDL A;  2FAP B;  2YZS A;  4H4K C;  3UMK A;  2XXA B;  5A6K A;  3ABM C;  5A6B A;  3ZC4 A;  3TUL A;  1MND A;  4C3D A;  3O10 A;  5L0J A;  4A4A A;  1FFH A;  3KL4 A;  2Q00 A;  3PMR A;  2L7A A;  1G5Z A;  1NSG B;  1MMN A;  3RKO F;  1HE1 A;  2ICW G;  2JX0 A;  4DRH B;  2XSE A;  4J7Y A;  5JS5 A;  5EGY A;  1ZZP A;  4K1O A;  3OWT A;  1QSP A;  2NSF A;  2QY9 A;  2PFD A;  2J9U A;  2L9J A;  3GM3 A;  3JSZ A;  1YAU O;  3LES A;  3N24 A;  2AP3 A;  1PD0 A;  3R2P A;  4C7O B;  5GPG B;  3L8J A;  2YEV A;  5JVE A;  3PHF 2;  1SMY F;  2A0B A;  3HJC A;  1S7Z A;  3UR3 C;  3S84 A;  1VTM P;  1RJ9 A;  1U89 A;  4OIQ F;  1NZE A;  3PCV A;  4OD4 A;  1OKK D;  3FOP A;  4CS8 C;  1Q0G A;  1EA8 A;  2DYS C;  3GM1 A;  2XL4 A;  5DLJ A;  3NG1 A;  4EWC A;  1T6I A;  1Z5Z A;  2GFH A;  3W8H A;  2J7P D;  1JPN A;  4E17 A;  5JUA A;  1LKX A;  1WTY A;  3MFN A;  4E0I A;  3EH2 A;  4N06 A;  4A2N B;  4BG0 A;  3DZA A;  4JCZ A;  1M2V B;  3EG9 A;  4MTG A;  1PCX A;  3MBG A;  4RBN A;  2J8W A;  2PX3 A;  2XXA A;  4HEA J;  1Q0D A;  4YL3 A;  4CBE A;  1VYK A;  4O79 A;  2Q3T A;  3UNG C;  5BUO A;  1YA9 A;  3DE8 A;  3V7O A;  3ZIB A;  1FFT C;  1ZHW A;  2VCA A;  2RSE B;  1C03 A;  4BEJ A;  3A11 A;  1A7E A;  1ZHX A;  3I5P A;  2AVK A;  2BE5 F;  3EHM A;  1YYJ A;  5L0C A;  1SF8 A;  2H7B A;  4BJ1 A;  1GM5 A;  4ZLD A;  1D0X A;  3RFY A;  1EQ1 A;  5KYY A;  4W8P A;  1CPQ A;  1GQA A;  4LDQ A;  3DWW A;  2VCC A;  4MVQ A;  1WN0 A;  2QE9 A;  2LFD A;  5BQH A;  4ZLC A;  4MW8 A;  3EZI A;  1OQC A;  3QW1 A;  1J8M F;  2FGY A;  3JYY A;  3DJU B;  4XQ1 A;  4CS9 C;  1TR2 A;  3NMJ A;  2BC5 A;  4O7G A;  1YVI A;  2YHS A;  4GEH A;  2C04 A;  2ETS A;  4X0R A;  4XPW A;  5DS5 A;  4JTC B;  1NFN A;  4XLP F;  2Y3B A;  4DJ9 A;  4CJO A;  4EBB A;  2IM8 A;  2I15 A;  4RDA A;  1FAP B;  2H7V C;  4R32 A;  3RQF A;  4JIO A;  4PR9 A;  3MX3 A;  4D4N A;  3QTH A;  3TQO A;  4ER9 A;  2ZXW C;  1OW7 A;  1M2V A;  2KC3 A;  3NMI A;  4N6H A;  5E33 A;  3KMI A;  3W2W A;  1BR1 A;  3ABL C;  4AE4 A;  4WJ0 A;  4MVO A;  3U3F A;  3QVY A;  4PJL A;  5E2Q A;  1NLX A;  3BEH A;  3LJB A;  2Q9B A;  1LI7 A;  2L6H A;  4MVM A;  4O6M A;  5DVW A;  1MMG A;  2A69 F;  5B1B C;  5BQG A;  3M15 A;  2D4U A;  3TK0 A;  3R7C A;  3EGX B;  1CGO A;  4G7Z F;  2Q7R A;  3UGP A;  2P61 A;  2ZXO A;  2PF4 E;  5E3A A;  4CS9 A;  3FMS A;  1NFO A;  3M4C A;  3W2V A;  3ZVR A;  2P6V A;  1Q0F A;  3CAX A;  3L1M A;  1V54 C;  3M79 A;  3J06 A;  2W9Y A;  3AQB A;  1Z3I X;  2HJ3 A;  3MYI A;  4N4W A;  1W2W A;  2YL1 A;  3SNH A;  1XZP A;  3SYN A;  5L0G A;  4YL0 A;  1Z63 A;  4L6R A;  4ANJ A;  4CDA A;  4ONS A;  2P7V A;  3S28 A;  4BPM A;  3EHN A;  3KPH A;  1HE9 A;  1K05 A;  1N1C A;  2OJQ A;  3L0I A;  2AWY A;  4JE9 A;  3EGD A;  3Q6M A;  3ASO C;  2MHR A;  1HY5 A;  1JR8 A;  3C7J A;  1HW2 A;  3FVY A;  1A7D A;  2EIJ C;  4XEV A;  2HSQ A;  3US6 A;  2YVK A;  4LDK A;  1VOM A;  3C8G D;  4EIY A;  2ZXP A;  2C03 A;  1YLM A;  3AOU A;  2L6G A;  2I8B A;  2YL0 A;  3N0T A;  2WB7 A;  4JTA B;  1PD1 A;  1ZHY A;  4CDY A;  3EFO B;  2PX0 A;  1OCC C;  3NYJ A;  1E2X A;  2M64 A;  2NUP A;  2R05 A;  1TWG A;  4MQ9 F;  3ZWI A;  4XTK A;  2EIN C;  2WVN A;  4CSA C;  1IZM A;  1L7C A;  1MQV A;  3LLK A;  4EBJ A;  2R7T A;  1S05 A;  3T9O A;  4O6N A;  1HMO A;  1MNE A;  4JUR I;  3VM6 A;  1QZX A;  5KYX A;  4LLC A;  1I5N A;  2L81 A;  3U5S A;  1BDJ B;  3HNI A;  2DI3 A;  2OJE D;  1VYI A;  3ZQV A;  1H9T A;  4U5B E;  1HMD A;  4PFO A;  3QW0 A;  3WHN A;  3HLZ A;  3DM5 A;  2LK4 A;  2Y39 A;  1UFB A;  5DS4 A;  5AC4 A;  1LIH A;  4MVU A;  2CYD A;  3SXZ A;  3L34 A;  4WGZ A;  4EUK B;  4CIH A;  4ULW A;  1JMW A;  5F28 E;  2HS5 A;  5K0I A;  2XLD A;  3AG2 C;  5EK0 A;  4JC7 A;  5T1D B;  1LPE A;  3ZTM A;  1EI7 A;  5BQI A;  3X1O A;  3HTK C;  1G4U S;  1WAT A;  2WVO A;  2YWA A;  2PBE A;  2CNW D;  3B0V C;  3U2M A;  2XLW A;  5TJ5 E;  2ZPA A;  2XLM A;  3SP1 A;  4KBL A;  3H65 A;  5KYU B;  4CSA A;  3H2V A;  5B3S C;  4YK5 A;  4XEK A;  3EFO A;  4WAB A;  3W8I A;  4B6I A;  2HSB A;  2E87 A;  3Q7L A;  1WOL A;  3FAP B;  1Y6D A;  4HE8 D;  2UUI A;  4XEF A;  2JPU A;  3N2Z B;  1H7I A;  4IAO A;  3RVZ A;  2LD6 A;  1FR0 A;  3JSE O;  1ZYR F;  4P9T A;  1YZA A;  2OEX A;  3WOD F;  1D1A A;  3ZDL A;  2OEV A;  2NPU A;  1LM3 B;  5JLI A;  1VLS A;  2IBF A;  4DRJ B;  2OKU A;  5FCL A;  2R7V A;  5DQT A;  5KYW B;  3RQG A;  5A6B D;  3ASN C;  2R7W A;  1QQ3 A;  3U9J A;  1VLT A;  4BJ6 A;  3Q6N A;  1TWC A;  1JPJ A;  3B29 A;  5A6A A;  2XL8 A;  5L0H A;  1K04 A;  3SXY A;  3ZTZ A;  5DQZ A;  4F4B A;  4XPX A;  5COM A;  2VCB A;  2KSF A;  3U2L A;  5HSW A;  2HMZ A;  4FAP B;  1AEP A;  4J30 B;  3ITF A;  3F46 A;  2R7Q A;  1T6U A;  3GOR A;  1EKY A;  4JKV A;  2QLA A;  4JEB A;  4YT8 A;  4J7T A;  4Z9I A;  4PK4 A;  4JJF A;  4QI0 A;  1OCR C;  4C3E A;  2KGO A;  1Z6A A;  2EPK X;  4ULV A;  4YT4 A;  5B3I A;  3IQ6 A;  3LNM B;  4C7O A;  2J9B A;  1FTS A;  3C62 A;  2A1D D;  2R9R B;  2O9X A;  1ZU5 A;  4KC9 A;  2HZ8 A;  2IXP A;  1NG1 A;  4BJ5 C;  3GOD A;  4IB4 A;  4NQF A;  4U5C E;  3IHU A;  1ZHT A;  1ZHZ A;  1OW8 A;  1J8Y F;  1T6Q A;  1RKE B;  3CSK A;  3E70 C;  3E9V A;  4GQH A;  2Y3H A;  3GEH A;  4LAC B;  2G62 A;  4BJT A;  2HUJ A;  4JZA A;  2IOQ A;  4CDV A;  2VB6 A;  1AUE A;  2ZXR A;  2X0C A;  3W4Y A;  5L3V A;  2J0W A;  1SYQ A;  2Q9C A;  1H6G A;  3RQE A;  4EBK A;  1U6H A;  3C8G B;  2VAS A;  3FHD A;  1QLE C;  2EPL X;  3PDM P;  1CPR A;  3IPM O;  1V4A A;  2BL2 A;  3K7D A;  3AG1 C;  3EH1 A;  2YKZ A;  2XS1 A;  3RIP A;  3HKK A;  4MTO A;  4LDR A;  5L0D A;  3U0C A;  4GYT A;  2XLH A;  4NTA A;  1XWJ A;  2HV6 A;  3FXH A;  1QVX A;  1M57 C;  1G8X A;  4KNW A;  4YT5 A;  3LS0 A;  4NTF A;  2H8A A;  1GS9 A;  1RCP A;  2OCC C;  2GDC A;  4P6I C;  1O87 A;  3DM9 B;  4U9D A;  2R7O A;  1SZI A;  1V55 C;  4XWJ A;  3U3B A;  4EHP A;  3S90 A;  3I5Q A;  3LLI A;  1ST6 A;  4LER A;  2VC9 A;  4OD5 A;  1MMA A;  1U0B B;  3VF0 A;  4MVZ A;  5FZT A;  2KNH A;  2LCH A;  1KTM A;  1NU7 D;  3CEX A;  3LS1 A;  3V5Z A;  2GWW A;  3F47 A;  4JCH A;  4JRZ A;  4AL1 A;  2B0J A;  5F5F A;  2YLI A;  2OG2 A;  1DOW A;  2XRH A;  2VH3 A;  1RKE A;  1OCO C;  3H2U A;  2B0H A;  3GWL A;  2DB4 A;  1YDI A;  4YN0 B;  4NCQ A;  2ASR A;  3ATP A;  4RD9 A;  3LEO A;  2KJG A;  3NRH A;  2WZG A;  2YRF A;  3HNL A;  3O6X A;  1M56 C;  1MMD A;  3C8G A;  4IWB A;  1BR2 A;  4Q5S F;  4D4X A;  5JRA A;  1T5O A;  4JVS A;  1YJG A;  5IY5 C;  3K1H A;  1LE2 A;  4YWQ A;  1BZ4 A;  4CIP A;  4E7S A;  2HMQ A;  2GA0 A;  4CJG A;  1B68 A;  3EJN A;  3NKE A;  256B A;  4YT2 A;  4K7B A;  3TJ6 A;  2PNO A;  2L6F A;  3M1C B;  2JD3 A;  4IGG A;  3EGX A;  4BJ5 A;  2HFI A;  3GEE A;  1T01 A;  1O3U A;  1K40 A;  3AGT A;  1APC A;  2R02 A;  2J46 A;  3L8I A;  1YZC A;  1QPU A;  1YAR O;  3X2Q C;  2X51 A;  3WAQ A;  5A6J A;  4PJM A;  1E86 A;  2FFH A;  3AJM A;  4JW1 A;  2PP4 A;  3T4R A;  1WAS A;  3AQC A;  4NY3 A;  2Y3D A;  1OXK A;  3LEV A;  5CI8 A;  1HW1 A;  3HNJ A;  4HFK B;  3RF3 A;  1E83 A;  4Z9J A;  3TD7 A;  3LUT B;  4J32 B;  1BR4 A;  3MLG A;  4UDV A;  4P9F A;  4BJ6 C;  3G4X A;  3ZSU A;  2CNW A;  4K0D A;  1CGN A;  2R25 A;  1JRA A;  1UG7 A;  3QVZ A;  5AGF A;  4JEA A;  4Z9H A;  3T6G B;  1D0Z A;  1DOV A;  3S0X A;  5E3C A;  5DS6 A;  2NG1 A;  5F5H A;  2XLV A;  1JOG A;  1L3P A;  2YQY A;  4NC3 A;  3T6B A;  1OXB A;  2QUP A;  3KYI A;  3NMK A;  4MVR A;  4DVZ A;  1Z23 A;  4H54 A;  2WL8 A;  2YL7 A;  2HJM A;  4IJJ A;  3LAY A;  1ORJ A;  1BBH A;  1OKK A;  1TQG A;  2IXN A;  2EPO A;  1T9K A;  1C02 A;  1FMV A;  3IQC A;  3M4B A;  2LQG A;  3EG9 B;  1XZQ A;  3CZ6 A;  3ZG1 A;  2AU5 A;  2Y3G A;  5AC5 A;  4G7O F;  5T3T A;  1NU9 C;  1FMW A;  4EKW A;  4NTB A;  2J7P A;  4E7Z A;  1LE4 A;  3UMH A;  4DBQ A;  3JCU Q;  3VYW A;  3GWN A;  1VMA A;  2V26 A;  2XL6 A;  3JT1 A;  1LI5 A;  2R03 A;  1ZVZ A;  4O6Y A;  2CW0 F;  4MTF A;  4MVS A;  2W45 A;  2OU6 A;  4WGY A;  1M2O A;  4U5H A;  1PV3 A;  1AVO B;  3BRJ A;  4I1O B;  4JTD B;  5KYY B;  2YLD A;  3DE9 A;  2G3K A;  2RD9 A;  3QZC A;  3K33 A;  3EZH A;  3JRT A;  3G4Z A;  1V74 B;  4PJN A;  2J9W A;  3SZR A;  3UMI A;  4C3B A;  5D92 A;  4I3M A;  2A6E F;  2V3C C;  2J45 A;  3HNK A;  4MS2 A;  3IQ5 A;  5KYU A;  1ZW2 A;  3QMK A;  2CDQ A;  2EPN A;  3K66 A;  3FDQ A;  4PJJ A;  3U8P A;  5COG A;  4OIP F;  2XLO A;  1RKC A;  3OA1 A;  4IAR A;  4KNV A;  1RXQ A;  1R4T A;  4BEM J;  1M6T A;  3DI5 A;  1E84 A;  3KH2 A;  3U9M A;  2IXO A;  3GM2 A;  5KYN A;  1A41 A;  1SR2 A;  4U5E E;  4G7H F;  2KQ9 A;  3GEI A;  3C63 A;  2P1A A;  3SXM A;  4AE4 B;  4CS7 A;  2R7U A;  1OCZ C;  3AGU A;  3IEE A;  5KYW A;  1TWH A;  4Q7C A;  1A7V A;  3B0U X;  5JT4 A;  2AWC A;  3S29 A;  2OQM A;  2YLG A;  3B71 A;  1IW7 F;  3LNR A;  3SXK A;  1YYX A;  4DXW A;  2R7R A;  1D1B A;  3I4U A;  4YJW A;  2DGJ A;  1I4Y A;  1R5I D;  3DXJ F;  2R7X A;  1C17 M;  1YA7 O;  4CS8 A;  1F1M A;  4U5G A;  3DJN B;  3AG4 C;  3DKA A;  3CQZ A;  5A69 A;  2XM4 A;  4JJG A;  1H9G A;  2KK1 A;  2H7O A;  4G78 A;  4XPY A;  3NDB B;  4AX2 A;  2EIK C;  2WZF A;  3O55 A;  3JYH A;  2G3V A;  2EIL C;  3C8Z A;  2W4M A;  1TFK B;  2MYS A;  2WZL A;  2NUT B;  4OIO F;  4IAQ A;  1WGW A;  2KYH A;  2WVQ A;  2Y69 C;  1O5H A;  3ABK C;  1D0Y A;  3TOM A;  2R7S A;  4QI2 A;  1A0B A;  3EGD B;  2P0N A;  3NYL A;  2DYR C;  3RW0 A;  1Z7Q c;  4HFF B;  4AK9 A;  2Q4F A;  4DOZ A;  3OEO A;  3B9Q A;  1NBB A;  1WWP A;  2KW3 C;  4CX9 A;  3DD7 A;  3KYJ A;  3RYL A;  2HV7 A;  5T3W A;  4E0H A;  2A0U A;  4XLN F;  1ZW3 A;  2XM0 A;  4FES A;  4DBR A;  5L0I A;  2D5R B;  4I44 A;  4G0H A;  2CCY A;  4U5D E;  2HKV A;  3V5X A;  1ORS C;  2UUH A;  3Q7G A;  1CGM E;  3SEO A;  3MYF A;  2IXM A;  1TKN A;  1D1C A;  3NKD A;  4U5F E;  4YL1 A;  3S27 A;  3TOL A;  3WG7 C;  4DVY P;  3POV A;  2GAQ A;  2NUP B;  4FWV A;  3U8V A;  3JZ0 A;  3O39 A;  1ORY A;  3KKB A;  1FNT c;  1E85 A;  1Y4C A;  3DMD A;  3G50 A;  4E18 A;  2A6H F;  2LIG A;  3VRC A;  1LS4 A;  5KYX B;  5JSL A;  2LFF A;  4W8K A;  3DAG A;  3JTL O;  3ECS A;  1TWA A;  3K1I C;  4DRI B;  4PFP A;  2QNL A;  3VAY A;  3TJ5 A;  2ZD9 A;  3GAN A;  2NUT A;  2LSE A;  3FOO A;  4KI2 A;  1G4W R;  2YL3 A;  2MWQ A;  3T6J A;  4N6C A;  2IYL D;  2F22 A;  3AG3 C;  4PAC A;  1OR3 A;  2Q9A A;  1GGQ A; 
#chains in the Genus database with same CATH homology
 2NPU A;  3FAP B;  4DRI B;  2GAQ A;  2FAP B;  1AUE A;  4DRJ B;  4FAP B;  1NSG B;  5GPG B;  2RSE B;  1FAP B;  4DRH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...