1FAPB

The structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
b'RVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FK506-BINDING PROTEIN
molecule tags Complex (isomerase/kinase)
source organism Homo sapiens
publication title Structure of the FKBP12-rapamycin complex interacting with the binding domain of human FRAP.
pubmed rcsb
total genus 34
structure length 95
sequence length 95
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1996-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 1fapB00
4FAPB 3FAPB 2NPUA 4DRJB 4DRIB 1NSGB 2GAQA 2RSEB 5GPGB 4DRHB 1FAPB 1AUEA 2FAPB
chains in the Genus database with same CATH superfamily
3N24A 2IBFA 2J0XA 5DQZA 1E2XA 1V4AA 2C03A 1LE4A 2ZPAA 1I5NA 1PV3A 1JMWA 4JVSA 4P9FA 4MVQA 3T4RA 2XM0A 3RQEA 2LD6A 5T3WA 5JSLA 1XZPA 4PJNA 4CDVA 1C03A 2AVKA 1QQ3A 2C04A 1YZAA 2LFDA 1Q0KA 4MVMA 3RYLA 4LLEA 4RDAA 5L0JA 3AGUA 3U3FA 3S9OA 3ZTMA 1T6QA 3GM2A 4ZLCA 2EPKX 1RJ9B 4KI2A 3NRHA 2PFDA 3ZVRA 3C18A 4UDVA 3DXJF 1HMOA 3NDBB 3JT1A 1VTMP 3A11A 1VLTA 3DMDA 2J46A 2PNOA 4MTOA 5CIVA 4C7OA 4JE9A 3U5SA 4HFKB 2EPNA 3UR3C 4CS9C 1HW1A 2QE9A 3TK0A 4U5BE 1K05A 3K1IC 2TMVP 4CX9A 2J0WA 3ATPA 4E17A 4IWBA 1RKEA 2HUJA 4JTAB 1LM3B 1PD1A 4IB4A 1ZU5A 4BJ6A 1EI7A 1I4ZA 3N0TA 4JCHA 1VK5A 4L6RA 1F1MA 3HLZA 4W8KA 1OCOC 1VLSA 3DD7A 4A2NB 2YVKA 3U3BA 3GEEA 2CGEA 1QVXA 2BC5A 1OW6A 5JVEA 2R25A 3B29A 4YT8A 1LS4A 3ASOC 3DE9A 1NU9C 3F46A 3K33A 4O79A 3LS0A 3JZ0A 4BJ5C 1YLMA 2A0BA 3ZIBA 5KYNA 1N1CA 2WZGA 3KMIA 1RXQA 3US6A 1SYQA 5T3TA 3AOUA 1NSGB 1VMAA 256BA 3ABLC 1MMGA 1AEPA 1ZHTA 1L3PA 5T1DB 2EINC 1SR2A 2FFHA 1B68A 2XRHA 1BR4A 2G3KA 4I44A 1ZW3A 4Q7CA 4WJ0A 5IY5C 2XXAA 4F4BA 3ZTZA 1K04A 3QMKA 2YL1A 2W4MA 2IXNA 3SXZA 4EWCA 5AC4A 3KL4A 2E87A 3U0CA 2WZLA 4OD5A 3LNRA 2GFHA 4GYTA 3RIPA 1IZMA 1V74B 4JJGA 4BG0A 1M2VA 3FDQA 2WVNA 3CEXA 3H65A 1Q0DA 3L34A 4MTGA 5COMA 4YT5A 3HNKA 1OQCA 3EPVA 3HNJA 3DI5A 1OKKD 4N6CA 2P1AA 2ZXPA 5AGFA 3SYNA 2YWAA 3W4YA 1ORJA 5A6KA 2YLGA 2FAPB 4AL0A 3EGDA 3VAYA 1D0XA 2Q9CA 3EJNA 1RMVA 3X1OA 3JRTA 3QW1A 2OCCC 3JRMO 3ZG1A 4D4XA 3Q7GA 5L3QA 1QLEC 3RQGA 4G7OF 1HW2A 2LQGA 2XXAB 4KBLA 2MWQA 1LKXA 1HE9A 1YJGA 1ZVZA 3DAFA 3FOPA 4OINF 4BJ6C 3R2PA 5L3VA 3K7DA 4JCZA 1M57C 2XM4A 4PFOA 1G4WR 1R4TA 2NUTA 2Q9AA 4GEHA 2YLIA 3EZHA 3QW0A 4N4WA 3W2WA 4ZLDA 1UFBA 4MQ9F 3AG4C 1GQAA 1ZHZA 3L0IA 3NMIA 3RKOF 4IJJA 1OXBA 2AWCA 4FX5A 2L9JA 1U0BB 4NTAA 1VYKA 3FVYA 4JRZA 4PJJA 1VB5A 3DM5A 4R32A 1K40A 1ORSC 2CYDA 2HSQA 4XEFA 3NKEA 4CJGA 2LP4A 3GWNA 3SNHA 2ZXWC 3TJ5A 3ZSUA 5DS6A 2H7OA 3GORA 4Z9JA 3T6GB 2YKZA 2JD3A 5JRAA 2NUPA 2NSFA 4WABA 1ZHWA 1L7CA 2HJMA 2YRFA 1LPEA 4CSAA 4JZAA 1H9GA 3DJNB 3CQZA 1SF8A 2KYHA 2GA0A 2A6HF 4FWVA 5JT4A 2EILC 4MTFA 2QNLA 2R9RB 2ZXRA 3NMJA 2XLEA 1PD0A 4MVOA 3IEEA 3ZWIA 3EHMA 4P6IC 4JTDB 1W2WA 5CI9A 4E0IA 2R7UA 3HJCA 3M4BA 1AVOB 5F28E 2GDCA 2MHRA 3U9MA 2DB4A 3B9QA 3AQCA 2UUHA 1OKKA 2R7XA 5A6AA 4CSAC 1E83A 2HJ3A 1YARO 2XLDA 4E7SA 5E33A 2V3CC 2EIJC 4U5HA 3LNMB 3U2MA 2CNWD 2V26A 1JR8A 1ZYRF 1BBHA 3V7OA 5EHHA 5HV9A 4MVRA 4U5CE 2L7AA 2XLVA 1Z3IX 2HMZA 4ULVA 3OWTA 1U89A 1TWCA 2L6GA 4C3BA 2XLMA 2A0UA 3K1IA 4B6IA 3G50A 3O6XA 4K1OA 4O6NA 4EBJA 1LE2A 3I5PA 1WN0A 4C3DA 3CAXA 2PP4A 1AUEA 4JURI 3UMKA 4EKWA 2R7WA 2YEVA 1QPUA 3LEOA 4BJTA 4CS7A 2PX3A 2Y3DA 4IARA 1ZW2A 4DRHB 4I1MA 4E18A 3RW0A 1VYIA 1M56C 1TWHA 2Q7RA 3SXMA 4U5FE 4JJFA 3TOLA 2X51A 1E84A 1KTMA 3PHF2 2OG2A 3JTLO 2L81A 3LS1A 3NYJA 1A7EA 3B0VC 1ST6A 2PX0A 3HNLA 2I8BA 3ITFA 2WB7A 4XPYA 4U9EA 4BJ5A 4JEBA 3O10A 2HFIA 1OW7A 1FTSA 2QUPA 3ZC4A 3GANA 5L0GA 4QI2A 1J8YF 1OR2A 4EBBA 3MBGA 2VB6A 1D1BA 2B0HA 4XTKA 4DRIB 3UGOA 1YYJA 4LLCA 1YAUO 3BEHA 4YL1A 3Q6NA 2KW3C 3JYYA 4QI0A 1ORYA 4CIPA 2R7TA 1G4US 2EPLX 3IQ6A 2NPUA 3IHUA 4JTCB 5COGA 3S0XA 2QLAA 3UMIA 2XL8A 3C8GA 5KYUB 2KJGA 4MVUA 4YN0B 1OXKA 1Q0GA 1QZXA 1SZIA 2EPOA 4KC9A 3EQLF 2RSEB 1LIHA 1RCPA 1GS9A 3AG1C 3ECSA 3RVYA 4DRJB 3U8PA 3RFYA 3VRCA 3DJUB 1Q0FA 4AE4B 3VYWA 3VF0A 1YZCA 1TFOB 2IYLD 4CS8C 4XLPF 2ETSA 2AP3A 2YL7A 2DYSC 5B1BC 1Q0MA 3DAGA 4XLNF 1MNEA 5KYYA 3M79A 1YVIA 5B3IA 1T6UA 2WL8A 5L0IA 5GPGB 3L8JA 4G0HA 4LDKA 5BQGA 2LIGA 4YL3A 1NU7D 2G62A 2WZFA 2XL6A 5EK0A 4J30B 3L8IA 1CGME 1GM5A 3GM1A 3N2ZB 2R7QA 2Y3BA 3ABMC 4JEAA 4PR9A 3PMRA 4OIOF 3C8GD 4DOZA 1LVKA 3B71A 5D91A 2DYRC 1O3UA 3DE8A 1Z23A 3M1CB 1VOMA 2W4BA 1KNYA 1GGQA 5A6BA 3POVA 2R7RA 1WATA 1FFHA 2VH3A 4ANJA 2P7VA 1EKYA 3LJBA 3U8VA 2GWWA 4E0HA 4CBEA 2WVQA 4OD4A 2D5RB 2CW0F 3AQBA 5KYXA 3I4UA 3S29A 1O5HA 2KC3A 3K1HA 4Q5SF 4IAOA 3S90A 2L6HA 1FMVA 1TWGA 2Y39A 4JW1A 2J9UA 5F5HA 3KKBA 4FAPB 4XPWA 1E86A 3IQCA 1SMYF 5L0DA 4BEJA 2I15A 1FNTc 4PACA 4MW3A 1I4YA 1MMAA 3HKKA 5FZTA 4KNWA 2J8WA 2LCHA 3LUTB 4XEKA 3AGTA 5DVWA 5BQIA 2BE5F 2A1DD 1Y4CA 3RF3A 5F5FA 3L1MA 2BL2A 1Z5ZA 5A69A 2YL0A 4CDAA 4J7TA 2VC9A 3V5ZA 2HSBA 3FHDA 3W8HA 2JPUA 4C3EA 4DVYP 2R7SA 4HFFB 4CS8A 1D0ZA 4Z9IA 1NLXA 2J45A 2R7OA 3E70C 3IQ5A 3T6JA 4D4NA 3WAQA 2OKUA 4WGZA 2QY9A 3C63A 2A68F 4O6YA 3T9OA 3CZ6A 5E2QA 3GODA 3GEHA 2Y3HA 3B0PA 1MMDA 3K6BA 3VM6A 5JP7A 5JUAA 1RJ9A 2CNWA 3ZDLA 3MX3A 3NYLA 1JAFA 2NSGA 2B0JA 1C02A 1TR2A 3FMSA 1OR3A 3WHNA 2Y3GA 3B0UX 1CPRA 4Q4ZF 2J7PD 2HKVA 1H9TA 2NUTB 2R7VA 2FGYA 1ZHYA 3Q6MA 1DOWA 4I3MA 4FESA 3C62A 1QSPA 2PBEA 3IQTA 3LESA 4CJOA 1HMDA 4KNVA 1YDIA 4LERA 4W8PA 5BQHA 5EGYA 3NG1A 3V5XA 4PFPA 5COFA 1M2OA 3ASNC 2YZSA 4I1OB 3EGDB 2IM8A 4HE8D 1ZU4A 2EIKC 4XWJA 1LS1A 2Q9BA 1NBBA 4E7ZA 5DS5A 4J32B 1EQ1A 2M4EA 3HTKC 3EG9A 3EG9B 1TWAA 2XLOA 3JSEO 3K66A 2JX0A 3M15A 4O6MA 3RH3A 4EBKA 3GWLA 3LEVA 4BJ1A 4YL0A 1EA8A 2W9YA 4RD9A 2RD9A 2O9XA 3MLGA 1TKNA 2IOQA 4DXWA 1YA7O 4EHPA 3KH2A 1HE1A 5KYYB 4GQHA 4H54A 1A41A 2Q4FA 4XPXA 2G3VA 1BZ4A 2VCAA 5L0CA 3GEIA 5KYXB 4DVZA 4XQ1A 3SXKA 4DBRA 3F47A 4CS9A 2LK4A 3T6BA 1YA9A 1XWJA 1OCCC 3TJ6A 1QKRA 5DLJA 2R05A 3S27A 3U2LA 3EHNA 4OIPF 2KK1A 4JKVA 3NYMA 4Z9HA 4MVSA 4YWQA 2IXPA 4NTFA 1KU2A 2EIMC 2R03A 2Z15A 1D0YA 5E3CA 3AJMA 3FAPB 4P9TA 3FAJA 1H6GA 3RQFA 1NFOA 3JYHA 3ZQVA 1H7IA 4LACB 3QVYA 1Z63A 2D4UA 4YJWA 2CCYA 3H2UA 4AK9A 3E9VA 2J7PA 1C17M 1T5OA 2M64A 2P6VA 2X0CA 3NMKA 3RVZA 2KGOA 3JSZA 5FCLA 3Q7LA 2H7VC 2VCBA 2XS1A 2XSEA 4MS2A 4NY3A 1JRAA 5A6JA 1MNDA 1U6HA 3DZAA 4IRUA 1BR2A 1RKEB 2GAQA 3KPHA 4X0RA 3TOMA 2ZXOA 2XS8A 2OJED 3DM9B 3O39A 3TULA 4J7YA 4QDLA 3LLKA 2HS5A 1CGOA 2OOCA 2NUPB 4NCQA 4M63A 2OEVA 4AX2A 3ABKC 3R7CA 2QTVA 1Z6AA 4U5EE 4U9DA 1WASA 4YK5A 2HZ8A 1FFTC 1WWPA 5D92A 1A7DA 1YYXA 3QZCA 4CIHA 2P0NA 2YQYA 5B3SC 3AG3C 1WOLA 3CSKA 3LAYA 4IGGA 4YT4A 4AL1A 1APCA 1MQVA 3OA1A 1T01A 3NKDA 1BR1A 2H7BA 3AG2C 5KYWA 2Y69C 1ZHXA 2KSFA 3PCVA 4YT2A 3SZRA 2IXOA 4RBNA 5DQTA 2UUIA 2LSEA 2YHSA 3C8GB 5KYUA 1OW8A 2F22A 2OJQA 2J9BA 2DGJA 3DKAA 3EH2A 3JCUQ 4G78A 2A69F 4MW8A 3UNGC 5E3AA 3BRJA 5L0FA 4CDYA 4K7BA 4BPMA 1D1CA 4MNDA 1WTYA 2OU6A 4N06A 3DWWA 4PJLA 4EUKB 5JLIA 5BUOA 3V5YA 2R02A 1UG7A 3ZQYA 2XLWA 1OCZC 1IW7F 5HSWA 3SEOA 3EZIA 1JPNA 3QVZA 2J9VA 2ICWG 2J9WA 1Y6DA 2Q00A 5A6BD 2NG1A 2XL4A 3X2QC 2P61A 1TFKB 3S28A 1J8MF 1BDJB 4U5GA 3S84A 1XZQA 1HY5A 2HV7A 3KYIA 1O87A 5DS4A 4PK4A 5TJ5E 2PF4E 1NG1A 1M2VB 4OIQF 2KNHA 5CI8A 1G5ZA 1G8XA 2AWYA 4N6HA 4BEMJ 2EPMX 3EFOB 2XLHA 3C8ZA 3UMHA 1A7VA 1T9KA 4AE4A 5L0HA 1RKCA 3A9CA 4LDRA 3KYJA 2L6FA 2OEXA 1M6TA 1LI5A 3SXYA 1V54C 3FXHA 4DJ9A 3H2VA 1OCRC 1DOVA 3EGXA 3EH1A 4WGYA 4NQFA 4XEVA 3EGXB 5AC5A 2A6EF 3OEOA 2HV6A 4ULWA 3TD7A 5KYWB 1FAPB 2OQMA 3GM3A 3J06A 1FR0A 2KQ9A 3MFNA 2Q3TA 3WG7C 4G7HF 1ZZPA 4U5DE 1WGWA 4PJMA 1TQGA 3G4XA 3U9JA 1LI7A 1R5ID 3QTHA 3W8IA 2ZD9A 3HNIA 3C7JA 4NC3A 3I5QA 4A4AA 2HMQA 2LFFA 4HEAJ 2MYSA 3EFOA 3TQOA 3WODF 1FMWA 4C7OB 2CDQA 1S7ZA 2VASA 1JPJA 2W45A 3LLIA 4IAQA 2ASRA 2AU5A 4H4KC 4JIOA 4O7GA 1E85A 1T6IA 4DBQA 2IXMA 1PCXA 1NFNA 2WVOA 3SP1A 5K0IA 1D1AA 4LDQA 4G7ZF 3UGPA 3FOOA 4JC7A 4K0DA 2DI3A 1V55C 2VCCA 3PDMP 1NZEA 4ER9A 1CGNA 4EIYA 3M4CA 3MYIA 4MVZA 2H8AA 3O55A 3IPMO 1MMNA 4NTBA 1Z7Qc 4OIRF 3W2VA 5JS5A 1S05A 2YLDA 3G4ZA 1JOGA 1A0BA 4ONSA 5B1AC 2YL3A 1CPQA 3MYFA
chains in the Genus database with same CATH topology
4FAPB 3FAPB 2NPUA 4DRJB 4DRIB 1NSGB 2GAQA 2RSEB 5GPGB 4DRHB 1FAPB 1AUEA 2FAPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAP B;  3FAP B;  2NPU A;  4DRJ B;  4DRI B;  1NSG B;  2GAQ A;  2RSE B;  5GPG B;  4DRH B;  1FAP B;  1AUE A;  2FAP B; 
#chains in the Genus database with same CATH topology
 3N24 A;  2IBF A;  2J0X A;  5DQZ A;  1E2X A;  1V4A A;  2C03 A;  1LE4 A;  2ZPA A;  1I5N A;  1PV3 A;  1JMW A;  4JVS A;  4P9F A;  4MVQ A;  3T4R A;  2XM0 A;  3RQE A;  2LD6 A;  5T3W A;  5JSL A;  1XZP A;  4PJN A;  4CDV A;  1C03 A;  2AVK A;  1QQ3 A;  2C04 A;  1YZA A;  2LFD A;  1Q0K A;  4MVM A;  3RYL A;  4LLE A;  4RDA A;  5L0J A;  3AGU A;  3U3F A;  3S9O A;  3ZTM A;  1T6Q A;  3GM2 A;  4ZLC A;  2EPK X;  1RJ9 B;  4KI2 A;  3NRH A;  2PFD A;  3ZVR A;  3C18 A;  4UDV A;  3DXJ F;  1HMO A;  3NDB B;  3JT1 A;  1VTM P;  3A11 A;  1VLT A;  3DMD A;  2J46 A;  2PNO A;  4MTO A;  5CIV A;  4C7O A;  4JE9 A;  3U5S A;  4HFK B;  2EPN A;  3UR3 C;  4CS9 C;  1HW1 A;  2QE9 A;  3TK0 A;  4U5B E;  1K05 A;  3K1I C;  2TMV P;  4CX9 A;  2J0W A;  3ATP A;  4E17 A;  4IWB A;  1RKE A;  2HUJ A;  4JTA B;  1LM3 B;  1PD1 A;  4IB4 A;  1ZU5 A;  4BJ6 A;  1EI7 A;  1I4Z A;  3N0T A;  4JCH A;  1VK5 A;  4L6R A;  1F1M A;  3HLZ A;  4W8K A;  1OCO C;  1VLS A;  3DD7 A;  4A2N B;  2YVK A;  3U3B A;  3GEE A;  2CGE A;  1QVX A;  2BC5 A;  1OW6 A;  5JVE A;  2R25 A;  3B29 A;  4YT8 A;  1LS4 A;  3ASO C;  3DE9 A;  1NU9 C;  3F46 A;  3K33 A;  4O79 A;  3LS0 A;  3JZ0 A;  4BJ5 C;  1YLM A;  2A0B A;  3ZIB A;  5KYN A;  1N1C A;  2WZG A;  3KMI A;  1RXQ A;  3US6 A;  1SYQ A;  5T3T A;  3AOU A;  1NSG B;  1VMA A;  256B A;  3ABL C;  1MMG A;  1AEP A;  1ZHT A;  1L3P A;  5T1D B;  2EIN C;  1SR2 A;  2FFH A;  1B68 A;  2XRH A;  1BR4 A;  2G3K A;  4I44 A;  1ZW3 A;  4Q7C A;  4WJ0 A;  5IY5 C;  2XXA A;  4F4B A;  3ZTZ A;  1K04 A;  3QMK A;  2YL1 A;  2W4M A;  2IXN A;  3SXZ A;  4EWC A;  5AC4 A;  3KL4 A;  2E87 A;  3U0C A;  2WZL A;  4OD5 A;  3LNR A;  2GFH A;  4GYT A;  3RIP A;  1IZM A;  1V74 B;  4JJG A;  4BG0 A;  1M2V A;  3FDQ A;  2WVN A;  3CEX A;  3H65 A;  1Q0D A;  3L34 A;  4MTG A;  5COM A;  4YT5 A;  3HNK A;  1OQC A;  3EPV A;  3HNJ A;  3DI5 A;  1OKK D;  4N6C A;  2P1A A;  2ZXP A;  5AGF A;  3SYN A;  2YWA A;  3W4Y A;  1ORJ A;  5A6K A;  2YLG A;  2FAP B;  4AL0 A;  3EGD A;  3VAY A;  1D0X A;  2Q9C A;  3EJN A;  1RMV A;  3X1O A;  3JRT A;  3QW1 A;  2OCC C;  3JRM O;  3ZG1 A;  4D4X A;  3Q7G A;  5L3Q A;  1QLE C;  3RQG A;  4G7O F;  1HW2 A;  2LQG A;  2XXA B;  4KBL A;  2MWQ A;  1LKX A;  1HE9 A;  1YJG A;  1ZVZ A;  3DAF A;  3FOP A;  4OIN F;  4BJ6 C;  3R2P A;  5L3V A;  3K7D A;  4JCZ A;  1M57 C;  2XM4 A;  4PFO A;  1G4W R;  1R4T A;  2NUT A;  2Q9A A;  4GEH A;  2YLI A;  3EZH A;  3QW0 A;  4N4W A;  3W2W A;  4ZLD A;  1UFB A;  4MQ9 F;  3AG4 C;  1GQA A;  1ZHZ A;  3L0I A;  3NMI A;  3RKO F;  4IJJ A;  1OXB A;  2AWC A;  4FX5 A;  2L9J A;  1U0B B;  4NTA A;  1VYK A;  3FVY A;  4JRZ A;  4PJJ A;  1VB5 A;  3DM5 A;  4R32 A;  1K40 A;  1ORS C;  2CYD A;  2HSQ A;  4XEF A;  3NKE A;  4CJG A;  2LP4 A;  3GWN A;  3SNH A;  2ZXW C;  3TJ5 A;  3ZSU A;  5DS6 A;  2H7O A;  3GOR A;  4Z9J A;  3T6G B;  2YKZ A;  2JD3 A;  5JRA A;  2NUP A;  2NSF A;  4WAB A;  1ZHW A;  1L7C A;  2HJM A;  2YRF A;  1LPE A;  4CSA A;  4JZA A;  1H9G A;  3DJN B;  3CQZ A;  1SF8 A;  2KYH A;  2GA0 A;  2A6H F;  4FWV A;  5JT4 A;  2EIL C;  4MTF A;  2QNL A;  2R9R B;  2ZXR A;  3NMJ A;  2XLE A;  1PD0 A;  4MVO A;  3IEE A;  3ZWI A;  3EHM A;  4P6I C;  4JTD B;  1W2W A;  5CI9 A;  4E0I A;  2R7U A;  3HJC A;  3M4B A;  1AVO B;  5F28 E;  2GDC A;  2MHR A;  3U9M A;  2DB4 A;  3B9Q A;  3AQC A;  2UUH A;  1OKK A;  2R7X A;  5A6A A;  4CSA C;  1E83 A;  2HJ3 A;  1YAR O;  2XLD A;  4E7S A;  5E33 A;  2V3C C;  2EIJ C;  4U5H A;  3LNM B;  3U2M A;  2CNW D;  2V26 A;  1JR8 A;  1ZYR F;  1BBH A;  3V7O A;  5EHH A;  5HV9 A;  4MVR A;  4U5C E;  2L7A A;  2XLV A;  1Z3I X;  2HMZ A;  4ULV A;  3OWT A;  1U89 A;  1TWC A;  2L6G A;  4C3B A;  2XLM A;  2A0U A;  3K1I A;  4B6I A;  3G50 A;  3O6X A;  4K1O A;  4O6N A;  4EBJ A;  1LE2 A;  3I5P A;  1WN0 A;  4C3D A;  3CAX A;  2PP4 A;  1AUE A;  4JUR I;  3UMK A;  4EKW A;  2R7W A;  2YEV A;  1QPU A;  3LEO A;  4BJT A;  4CS7 A;  2PX3 A;  2Y3D A;  4IAR A;  1ZW2 A;  4DRH B;  4I1M A;  4E18 A;  3RW0 A;  1VYI A;  1M56 C;  1TWH A;  2Q7R A;  3SXM A;  4U5F E;  4JJF A;  3TOL A;  2X51 A;  1E84 A;  1KTM A;  3PHF 2;  2OG2 A;  3JTL O;  2L81 A;  3LS1 A;  3NYJ A;  1A7E A;  3B0V C;  1ST6 A;  2PX0 A;  3HNL A;  2I8B A;  3ITF A;  2WB7 A;  4XPY A;  4U9E A;  4BJ5 A;  4JEB A;  3O10 A;  2HFI A;  1OW7 A;  1FTS A;  2QUP A;  3ZC4 A;  3GAN A;  5L0G A;  4QI2 A;  1J8Y F;  1OR2 A;  4EBB A;  3MBG A;  2VB6 A;  1D1B A;  2B0H A;  4XTK A;  4DRI B;  3UGO A;  1YYJ A;  4LLC A;  1YAU O;  3BEH A;  4YL1 A;  3Q6N A;  2KW3 C;  3JYY A;  4QI0 A;  1ORY A;  4CIP A;  2R7T A;  1G4U S;  2EPL X;  3IQ6 A;  2NPU A;  3IHU A;  4JTC B;  5COG A;  3S0X A;  2QLA A;  3UMI A;  2XL8 A;  3C8G A;  5KYU B;  2KJG A;  4MVU A;  4YN0 B;  1OXK A;  1Q0G A;  1QZX A;  1SZI A;  2EPO A;  4KC9 A;  3EQL F;  2RSE B;  1LIH A;  1RCP A;  1GS9 A;  3AG1 C;  3ECS A;  3RVY A;  4DRJ B;  3U8P A;  3RFY A;  3VRC A;  3DJU B;  1Q0F A;  4AE4 B;  3VYW A;  3VF0 A;  1YZC A;  1TFO B;  2IYL D;  4CS8 C;  4XLP F;  2ETS A;  2AP3 A;  2YL7 A;  2DYS C;  5B1B C;  1Q0M A;  3DAG A;  4XLN F;  1MNE A;  5KYY A;  3M79 A;  1YVI A;  5B3I A;  1T6U A;  2WL8 A;  5L0I A;  5GPG B;  3L8J A;  4G0H A;  4LDK A;  5BQG A;  2LIG A;  4YL3 A;  1NU7 D;  2G62 A;  2WZF A;  2XL6 A;  5EK0 A;  4J30 B;  3L8I A;  1CGM E;  1GM5 A;  3GM1 A;  3N2Z B;  2R7Q A;  2Y3B A;  3ABM C;  4JEA A;  4PR9 A;  3PMR A;  4OIO F;  3C8G D;  4DOZ A;  1LVK A;  3B71 A;  5D91 A;  2DYR C;  1O3U A;  3DE8 A;  1Z23 A;  3M1C B;  1VOM A;  2W4B A;  1KNY A;  1GGQ A;  5A6B A;  3POV A;  2R7R A;  1WAT A;  1FFH A;  2VH3 A;  4ANJ A;  2P7V A;  1EKY A;  3LJB A;  3U8V A;  2GWW A;  4E0H A;  4CBE A;  2WVQ A;  4OD4 A;  2D5R B;  2CW0 F;  3AQB A;  5KYX A;  3I4U A;  3S29 A;  1O5H A;  2KC3 A;  3K1H A;  4Q5S F;  4IAO A;  3S90 A;  2L6H A;  1FMV A;  1TWG A;  2Y39 A;  4JW1 A;  2J9U A;  5F5H A;  3KKB A;  4FAP B;  4XPW A;  1E86 A;  3IQC A;  1SMY F;  5L0D A;  4BEJ A;  2I15 A;  1FNT c;  4PAC A;  4MW3 A;  1I4Y A;  1MMA A;  3HKK A;  5FZT A;  4KNW A;  2J8W A;  2LCH A;  3LUT B;  4XEK A;  3AGT A;  5DVW A;  5BQI A;  2BE5 F;  2A1D D;  1Y4C A;  3RF3 A;  5F5F A;  3L1M A;  2BL2 A;  1Z5Z A;  5A69 A;  2YL0 A;  4CDA A;  4J7T A;  2VC9 A;  3V5Z A;  2HSB A;  3FHD A;  3W8H A;  2JPU A;  4C3E A;  4DVY P;  2R7S A;  4HFF B;  4CS8 A;  1D0Z A;  4Z9I A;  1NLX A;  2J45 A;  2R7O A;  3E70 C;  3IQ5 A;  3T6J A;  4D4N A;  3WAQ A;  2OKU A;  4WGZ A;  2QY9 A;  3C63 A;  2A68 F;  4O6Y A;  3T9O A;  3CZ6 A;  5E2Q A;  3GOD A;  3GEH A;  2Y3H A;  3B0P A;  1MMD A;  3K6B A;  3VM6 A;  5JP7 A;  5JUA A;  1RJ9 A;  2CNW A;  3ZDL A;  3MX3 A;  3NYL A;  1JAF A;  2NSG A;  2B0J A;  1C02 A;  1TR2 A;  3FMS A;  1OR3 A;  3WHN A;  2Y3G A;  3B0U X;  1CPR A;  4Q4Z F;  2J7P D;  2HKV A;  1H9T A;  2NUT B;  2R7V A;  2FGY A;  1ZHY A;  3Q6M A;  1DOW A;  4I3M A;  4FES A;  3C62 A;  1QSP A;  2PBE A;  3IQT A;  3LES A;  4CJO A;  1HMD A;  4KNV A;  1YDI A;  4LER A;  4W8P A;  5BQH A;  5EGY A;  3NG1 A;  3V5X A;  4PFP A;  5COF A;  1M2O A;  3ASN C;  2YZS A;  4I1O B;  3EGD B;  2IM8 A;  4HE8 D;  1ZU4 A;  2EIK C;  4XWJ A;  1LS1 A;  2Q9B A;  1NBB A;  4E7Z A;  5DS5 A;  4J32 B;  1EQ1 A;  2M4E A;  3HTK C;  3EG9 A;  3EG9 B;  1TWA A;  2XLO A;  3JSE O;  3K66 A;  2JX0 A;  3M15 A;  4O6M A;  3RH3 A;  4EBK A;  3GWL A;  3LEV A;  4BJ1 A;  4YL0 A;  1EA8 A;  2W9Y A;  4RD9 A;  2RD9 A;  2O9X A;  3MLG A;  1TKN A;  2IOQ A;  4DXW A;  1YA7 O;  4EHP A;  3KH2 A;  1HE1 A;  5KYY B;  4GQH A;  4H54 A;  1A41 A;  2Q4F A;  4XPX A;  2G3V A;  1BZ4 A;  2VCA A;  5L0C A;  3GEI A;  5KYX B;  4DVZ A;  4XQ1 A;  3SXK A;  4DBR A;  3F47 A;  4CS9 A;  2LK4 A;  3T6B A;  1YA9 A;  1XWJ A;  1OCC C;  3TJ6 A;  1QKR A;  5DLJ A;  2R05 A;  3S27 A;  3U2L A;  3EHN A;  4OIP F;  2KK1 A;  4JKV A;  3NYM A;  4Z9H A;  4MVS A;  4YWQ A;  2IXP A;  4NTF A;  1KU2 A;  2EIM C;  2R03 A;  2Z15 A;  1D0Y A;  5E3C A;  3AJM A;  3FAP B;  4P9T A;  3FAJ A;  1H6G A;  3RQF A;  1NFO A;  3JYH A;  3ZQV A;  1H7I A;  4LAC B;  3QVY A;  1Z63 A;  2D4U A;  4YJW A;  2CCY A;  3H2U A;  4AK9 A;  3E9V A;  2J7P A;  1C17 M;  1T5O A;  2M64 A;  2P6V A;  2X0C A;  3NMK A;  3RVZ A;  2KGO A;  3JSZ A;  5FCL A;  3Q7L A;  2H7V C;  2VCB A;  2XS1 A;  2XSE A;  4MS2 A;  4NY3 A;  1JRA A;  5A6J A;  1MND A;  1U6H A;  3DZA A;  4IRU A;  1BR2 A;  1RKE B;  2GAQ A;  3KPH A;  4X0R A;  3TOM A;  2ZXO A;  2XS8 A;  2OJE D;  3DM9 B;  3O39 A;  3TUL A;  4J7Y A;  4QDL A;  3LLK A;  2HS5 A;  1CGO A;  2OOC A;  2NUP B;  4NCQ A;  4M63 A;  2OEV A;  4AX2 A;  3ABK C;  3R7C A;  2QTV A;  1Z6A A;  4U5E E;  4U9D A;  1WAS A;  4YK5 A;  2HZ8 A;  1FFT C;  1WWP A;  5D92 A;  1A7D A;  1YYX A;  3QZC A;  4CIH A;  2P0N A;  2YQY A;  5B3S C;  3AG3 C;  1WOL A;  3CSK A;  3LAY A;  4IGG A;  4YT4 A;  4AL1 A;  1APC A;  1MQV A;  3OA1 A;  1T01 A;  3NKD A;  1BR1 A;  2H7B A;  3AG2 C;  5KYW A;  2Y69 C;  1ZHX A;  2KSF A;  3PCV A;  4YT2 A;  3SZR A;  2IXO A;  4RBN A;  5DQT A;  2UUI A;  2LSE A;  2YHS A;  3C8G B;  5KYU A;  1OW8 A;  2F22 A;  2OJQ A;  2J9B A;  2DGJ A;  3DKA A;  3EH2 A;  3JCU Q;  4G78 A;  2A69 F;  4MW8 A;  3UNG C;  5E3A A;  3BRJ A;  5L0F A;  4CDY A;  4K7B A;  4BPM A;  1D1C A;  4MND A;  1WTY A;  2OU6 A;  4N06 A;  3DWW A;  4PJL A;  4EUK B;  5JLI A;  5BUO A;  3V5Y A;  2R02 A;  1UG7 A;  3ZQY A;  2XLW A;  1OCZ C;  1IW7 F;  5HSW A;  3SEO A;  3EZI A;  1JPN A;  3QVZ A;  2J9V A;  2ICW G;  2J9W A;  1Y6D A;  2Q00 A;  5A6B D;  2NG1 A;  2XL4 A;  3X2Q C;  2P61 A;  1TFK B;  3S28 A;  1J8M F;  1BDJ B;  4U5G A;  3S84 A;  1XZQ A;  1HY5 A;  2HV7 A;  3KYI A;  1O87 A;  5DS4 A;  4PK4 A;  5TJ5 E;  2PF4 E;  1NG1 A;  1M2V B;  4OIQ F;  2KNH A;  5CI8 A;  1G5Z A;  1G8X A;  2AWY A;  4N6H A;  4BEM J;  2EPM X;  3EFO B;  2XLH A;  3C8Z A;  3UMH A;  1A7V A;  1T9K A;  4AE4 A;  5L0H A;  1RKC A;  3A9C A;  4LDR A;  3KYJ A;  2L6F A;  2OEX A;  1M6T A;  1LI5 A;  3SXY A;  1V54 C;  3FXH A;  4DJ9 A;  3H2V A;  1OCR C;  1DOV A;  3EGX A;  3EH1 A;  4WGY A;  4NQF A;  4XEV A;  3EGX B;  5AC5 A;  2A6E F;  3OEO A;  2HV6 A;  4ULW A;  3TD7 A;  5KYW B;  1FAP B;  2OQM A;  3GM3 A;  3J06 A;  1FR0 A;  2KQ9 A;  3MFN A;  2Q3T A;  3WG7 C;  4G7H F;  1ZZP A;  4U5D E;  1WGW A;  4PJM A;  1TQG A;  3G4X A;  3U9J A;  1LI7 A;  1R5I D;  3QTH A;  3W8I A;  2ZD9 A;  3HNI A;  3C7J A;  4NC3 A;  3I5Q A;  4A4A A;  2HMQ A;  2LFF A;  4HEA J;  2MYS A;  3EFO A;  3TQO A;  3WOD F;  1FMW A;  4C7O B;  2CDQ A;  1S7Z A;  2VAS A;  1JPJ A;  2W45 A;  3LLI A;  4IAQ A;  2ASR A;  2AU5 A;  4H4K C;  4JIO A;  4O7G A;  1E85 A;  1T6I A;  4DBQ A;  2IXM A;  1PCX A;  1NFN A;  2WVO A;  3SP1 A;  5K0I A;  1D1A A;  4LDQ A;  4G7Z F;  3UGP A;  3FOO A;  4JC7 A;  4K0D A;  2DI3 A;  1V55 C;  2VCC A;  3PDM P;  1NZE A;  4ER9 A;  1CGN A;  4EIY A;  3M4C A;  3MYI A;  4MVZ A;  2H8A A;  3O55 A;  3IPM O;  1MMN A;  4NTB A;  1Z7Q c;  4OIR F;  3W2V A;  5JS5 A;  1S05 A;  2YLD A;  3G4Z A;  1JOG A;  1A0B A;  4ONS A;  5B1A C;  2YL3 A;  1CPQ A;  3MYF A; 
#chains in the Genus database with same CATH homology
 4FAP B;  3FAP B;  2NPU A;  4DRJ B;  4DRI B;  1NSG B;  2GAQ A;  2RSE B;  5GPG B;  4DRH B;  1FAP B;  1AUE A;  2FAP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...