4AX2A

New type vi-secreted toxins and self-resistance proteins in serratia marcescens
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
124
Chain Sequence
QGHMAPIQDPVAFIKQMPYHQVVKELALSRCLAQVSDSDKAFSLDAARTANAMREWMPFDIESGDEKINVLIDKYKSRINEFHSKSQGVTLNCLRLYHSPELDKLSRQLIAGNPDRTWNQDNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAP1B
publication title New Secreted Toxins and Immunity Proteins Encoded within the Type Vi Secretion System Gene Cluster of Serratia Marcescens
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Toxin
total genus 43
structure length 124
sequence length 128
ec nomenclature
pdb deposition date 2012-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ax2A01
4J32B 4HFKB 3ZIBA 4B6IA 4J30B 4HFFB 4JURI 4AX2A
chains in the Genus database with same CATH superfamily
3ITFA 2HSBA 1JRAA 1NG1A 3AQCA 3C8GA 4MTGA 5EHHA 1JR8A 1TWHA 1YA7O 4OIRF 4YT2A 2DYRC 1WASA 4DJ9A 4DVYP 2PNOA 1QKRA 4E7ZA 5A6BA 2OJED 3Q6MA 4A4AA 3POVA 4K0DA 4MVOA 3MLGA 1OR3A 3B29A 4IGGA 2WZFA 2XXAB 2KQ9A 5KYUB 4U5FE 3H2UA 3HKKA 3L0IA 2RD9A 3O6XA 4O6NA 5E3AA 1E84A 2OOCA 3LNMB 4HEAJ 2FAPB 3T4RA 1WWPA 2MHRA 2HSQA 4BJTA 5L3QA 4Z9IA 3M15A 1HW1A 1DOWA 2XLHA 4E17A 1FTSA 3HTKC 2OEXA 1E2XA 3FMSA 4O6YA 5E33A 1ZZPA 4O7GA 1U0BB 3C62A 2HMQA 1CGNA 2LK4A 3IPMO 4Q7CA 1FAPB 1BR2A 4JC7A 4JKVA 3K7DA 3SXMA 2ZD9A 4EWCA 2XS1A 5COFA 4YT5A 3QVZA 5CIVA 5DQTA 3US6A 5T1DB 2P0NA 3GM2A 3EG9B 3ZQVA 3FAJA 4CIHA 5D92A 3T6GB 3KH2A 3U2LA 2Y69C 3X1OA 3E9VA 4HFFB 1B68A 3QTHA 3LJBA 4P9TA 3RW0A 3W2WA 1KNYA 1YARO 4RBNA 4DRJB 2KGOA 1NU7D 3U8PA 4QI2A 1C03A 2YZSA 3O39A 3I5PA 3DXJF 1VLSA 4XTKA 1A7VA 3KPHA 4JJGA 3SZRA 3EGDB 4XEKA 1W2WA 5EK0A 3ZTZA 1SYQA 1A0BA 4JURI 1ZW3A 3G4ZA 5A6JA 3PMRA 4EBKA 5B1AC 2CCYA 1LVKA 1Q0KA 2XL8A 3ZC4A 5COGA 5B3IA 3NDBB 3EGXB 4ONSA 2CDQA 4ZLCA 2NSFA 4U5CE 2GFHA 1T6UA 2VCBA 1L3PA 1LIHA 2J0WA 3N2ZB 3JRMO 3K33A 1J8MF 2J8WA 3RQEA 4Z9JA 2H8AA 4KC9A 4C7OB 2LIGA 3SXYA 3DWWA 1JOGA 3EHNA 3MX3A 5KYXA 4J7TA 2GWWA 2YL7A 2M4EA 2Q9CA 1OW6A 3LNRA 1S7ZA 4U9DA 1ZHZA 2VCCA 1OKKA 1FFTC 3IEEA 3N24A 2J7PA 3AG3C 3U3BA 1PD1A 3U8VA 3TJ6A 4U5GA 4R32A 2YHSA 4I1OB 2NUPA 1SZIA 5KYYB 1LE4A 3LAYA 3EZHA 3HLZA 4AL0A 5AC5A 3DE8A 1AUEA 1HW2A 1NFNA 4ZLDA 4MS2A 4DRIB 1Q0MA 4AE4B 3SEOA 4U9EA 1VLTA 2A6EF 3OA1A 3EFOA 3MBGA 3MYIA 3GEIA 4XPYA 4G7ZF 4MVRA 4JCHA 3EQLF 1YVIA 1D0ZA 2IXNA 3B71A 2R7UA 3VRCA 2OJQA 3CAXA 2EPKX 4GQHA 5KYWA 4BJ5C 3EHMA 2B0JA 2EINC 3K6BA 5T3WA 3ZWIA 2WZLA 1SMYF 4YT4A 2CGEA 2PF4E 4NCQA 1KTMA 2R7VA 4WJ0A 2HKVA 2IXMA 4XEFA 4CSAA 4CS8C 1BR4A 1XWJA 1G8XA 3OEOA 5L0HA 3GM3A 2VCAA 2Y3GA 5FCLA 3H65A 1GS9A 1G4WR 4ULVA 4AX2A 2JPUA 2O9XA 2WVQA 3B0PA 3DJUB 3FHDA 1ORYA 3LS0A 2AWYA 3V7OA 1ZHYA 5GPGB 1EQ1A 2L7AA 1GQAA 1M2VA 5BQGA 4P6IC 2WVNA 4CDAA 5JRAA 2L6FA 4OIOF 4JRZA 4LACB 4CIPA 3UGPA 2RSEB 3B0UX 4N4WA 2R05A 3JRTA 1H9GA 3GORA 3UMKA 2HJMA 2L9JA 5DLJA 2CW0F 2H7OA 2V3CC 1N1CA 3DAGA 3K66A 4CSAC 2CNWA 3KYJA 4WABA 5L0GA 3QW0A 2C04A 1YA9A 3JT1A 1E85A 2HS5A 1HE1A 4J32B 2YVKA 1UFBA 2QY9A 5JS5A 2HJ3A 3L1MA 3UR3C 1H6GA 1RCPA 3DM9B 4FX5A 2QLAA 3GANA 5D91A 1K40A 3AGUA 1S05A 3ASOC 3KL4A 3Q7LA 4XWJA 4XPWA 2UUHA 2J0XA 4XPXA 1E86A 5KYUA 4UDVA 4RD9A 1J8YF 1NBBA 3ZQYA 1YAUO 3AOUA 2Q9BA 4U5EE 3SXZA 3W2VA 4ANJA 3NYMA 2IM8A 1T6IA 1ORSC 4I44A 1U6HA 3AJMA 3TOMA 4DRHB 5B3SC 4IB4A 2J45A 1Y6DA 4JJFA 4JTDB 2DYSC 2XL4A 5IY5C 4N06A 5JVEA 1HMOA 2IYLD 4JTCB 5L0IA 2D5RB 3LEOA 2J9VA 1NU9C 3EG9A 5JUAA 2J46A 1LKXA 2ZXRA 2AVKA 3CQZA 3CEXA 1OW7A 2OU6A 5DS5A 3ECSA 2L81A 1LE2A 4U5DE 3U0CA 3S9OA 1LS1A 3RQFA 1V74B 5DS4A 4G0HA 3R7CA 1ST6A 4E18A 1MQVA 4CS7A 2AP3A 3IQ6A 3EGDA 3GWLA 2KYHA 4IAOA 2NG1A 4IARA 1LS4A 2WZGA 1RJ9B 3NMIA 4YWQA 1G4US 4OIPF 1M6TA 4W8PA 3VAYA 1IZMA 3RVZA 3M4BA 5TJ5E 4FAPB 1QLEC 5K0IA 2QNLA 4Q4ZF 1Z63A 4G7OF 2ETSA 1FFHA 4PJNA 1VOMA 2XLWA 3O55A 1GM5A 1NSGB 3EGXA 3NYJA 4PJMA 2MYSA 2GAQA 4K1OA 2EPOA 2P61A 2ZXWC 5CI8A 3DI5A 4G7HF 4JCZA 1TWGA 5BQIA 2XLDA 2GDCA 3L8IA 2LFFA 3EPVA 3QZCA 3T9OA 2WL8A 1LI5A 2LD6A 3AG2C 5JP7A 3GEEA 4MW8A 4A2NB 4C7OA 1XZPA 1HMDA 1OCRC 1U89A 3S27A 2YQYA 5JT4A 3NG1A 1CGME 3SP1A 4NTAA 1RKEB 2EPLX 2VASA 1OCZC 4LLCA 3N0TA 3TD7A 1TWCA 4WGZA 2JD3A 4H54A 1QPUA 2R7XA 4Q5SF 4JTAB 2TMVP 5KYYA 3ASNC 4LDRA 1C17M 3GODA 3IHUA 2Q4FA 2ICWG 2LQGA 4IRUA 4D4NA 3QW1A 3S90A 3PHF2 1OR2A 3DAFA 4AE4A 3DZAA 5JSLA 1FR0A 1LI7A 3S28A 3MFNA 2BL2A 4BJ5A 2NUTB 4DBRA 1XZQA 3C7JA 1D1CA 4CBEA 4CS8A 2EILC 2R03A 1DOVA 5DVWA 2X0CA 4EBBA 3V5YA 3IQ5A 1M2OA 2F22A 2KNHA 4MTOA 2EPMX 1HY5A 2W4BA 2PFDA 4LDQA 1D1BA 3UMHA 1I4ZA 4YJWA 3JSZA 1MNEA 2A69F 2AWCA 2YEVA 4PACA 2Y3HA 3FXHA 256BA 4JEAA 4YN0B 3VYWA 2XL6A 4BPMA 5FZTA 3GEHA 4DXWA 4BJ6A 2DB4A 1JMWA 4N6CA 2GA0A 4AL1A 2R7RA 4H4KC 3JTLO 1QZXA 4BJ1A 3IQCA 4JEBA 1OCOC 5DQZA 3ZTMA 3CSKA 2BE5F 3RQGA 4GEHA 3HNJA 4WGYA 1OXKA 1M57C 1R4TA 2VH3A 1ZU5A 5KYNA 2L6GA 5L0JA 5KYXB 2P7VA 2PX0A 2DGJA 5A69A 3AGTA 2EIJC 3TOLA 4NC3A 4CS9C 4JE9A 3TQOA 3ABLC 1I4YA 1T01A 3DKAA 4BJ6C 2EIKC 2KW3C 3Q6NA 2R9RB 2LSEA 1BBHA 2QE9A 2IXPA 5AGFA 3W8HA 1O87A 1ORJA 2LFDA 3NKEA 1APCA 2Q3TA 4C3DA 4QI0A 2R02A 2YWAA 3KKBA 1EKYA 4BEJA 2L6HA 3B9QA 4ER9A 4EIYA 5BQHA 2NPUA 3NMKA 3AG1C 2WB7A 3U5SA 3K1IA 2EPNA 1Q0DA 1E83A 3M4CA 3U2MA 4L6RA 3TULA 3A11A 1JPJA 2BC5A 1D1AA 3G4XA 3L8JA 3NMJA 2R7WA 2ZXOA 2B0HA 2G3VA 4K7BA 4PFPA 2FGYA 2EIMC 2R7QA 1MMAA 2OEVA 1JPNA 3EH1A 2V26A 2XXAA 3UNGC 1FNTc 1T9KA 2A68F 3F47A 2XS8A 2MWQA 1IW7F 4XLNF 4DVZA 1GGQA 1V55C 1D0XA 1AVOB 2Y3DA 4J7YA 2Q7RA 3K1IC 3EZIA 1TKNA 1OW8A 1YJGA 1Q0GA 2P6VA 3SXKA 4W8KA 1T6QA 1TFOB 4LERA 4QDLA 4MQ9F 1EA8A 3K1HA 3RKOF 3RIPA 3F46A 3JSEO 1ZW2A 2R25A 2OKUA 3W8IA 2X51A 3ABMC 2A6HF 3FAPB 1MMGA 2NSGA 1Z3IX 3GM1A 1CPQA 1A7EA 1QVXA 2HUJA 3C8GD 1YYJA 3DD7A 1YZAA 3C8ZA 3PCVA 2XLEA 3BEHA 5A6BD 3TK0A 1L7CA 2HV6A 3I5QA 3ZG1A 2LP4A 1O5HA 4PFOA 5HV9A 2P1AA 2YKZA 3HNKA 4CDVA 1C02A 1Q0FA 3FOPA 4FWVA 4NTFA 3ZDLA 3U3FA 4MVUA 2ASRA 1WN0A 4MTFA 3HNLA 5HSWA 5DS6A 3C63A 4XQ1A 4FESA 3V5XA 4EUKB 2XLMA 1D0YA 3SYNA 4JIOA 5F5HA 1MNDA 1RKEA 2HMZA 2J9UA 3C8GB 5L3VA 4IJJA 1SF8A 1Z6AA 1BZ4A 1YDIA 4LDKA 1ZVZA 3LEVA 1FMWA 3EH2A 2OQMA 2Y3BA 3R2PA 4NQFA 5JLIA 4E0IA 2W4MA 3HJCA 2G62A 3HNIA 2XLOA 2WVOA 2DI3A 1CPRA 2YL1A 3A9CA 4CX9A 1I5NA 3ATPA 3UGOA 3NYLA 1ZU4A 5T3TA 4E7SA 2ZXPA 4KBLA 4M63A 1VYIA 5E2QA 4C3BA 5BUOA 3W4YA 2E87A 2NUTA 1WTYA 1QQ3A 4I1MA 3DMDA 1K05A 4MNDA 2YLDA 3M79A 3B0VC 2PP4A 1PCXA 4J30B 4MVSA 2I15A 1Z7Qc 2YRFA 4EBJA 1QSPA 2KSFA 1AEPA 1LM3B 2Z15A 3LLKA 5E3CA 3ZVRA 4CJOA 4JW1A 2HV7A 5CI9A 4MVQA 3OWTA 2A1DD 3X2QC 1OQCA 4EKWA 3O10A 1KU2A 1V54C 2FFHA 1BDJB 4KNWA 1LPEA 3JYHA 1ZHXA 4MVZA 1WGWA 4BG0A 4E0HA 4G78A 2IBFA 1Z5ZA 2VC9A 2LCHA 2XLVA 2XSEA 3RF3A 2CYDA 4IAQA 3ZSUA 5A6AA 3PDMP 3KMIA 5F5FA 1OKKD 1HE9A 2J7PD 4YL3A 3RFYA 2Y39A 2YLGA 3FVYA 4CS9A 2R7TA 3S84A 1UG7A 1M56C 1V4AA 4N6HA 4NY3A 3RH3A 1H7IA 5COMA 2IOQA 2Q9AA 3S29A 3CZ6A 3C18A 3VF0A 2AU5A 3NRHA 4OINF 4YL0A 5EGYA 4OIQF 4ULWA 1A7DA 2ZPAA 4KNVA 1JAFA 1TFKB 4YT8A 3FDQA 3NKDA 3IQTA 1RXQA 4XEVA 4YL1A 4B6IA 1K04A 2D4UA 3S0XA 1EI7A 3DE9A 4F4BA 2XM4A 1YLMA 1YYXA 1G5ZA 1PV3A 1ZYRF 2R7OA 3FOOA 3G50A 4I3MA 1YZCA 4PJLA 3QVYA 1Z23A 3DJNB 5AC4A 2A0BA 1TQGA 1VMAA 2M64A 2PX3A 4HFKB 3UMIA 3WHNA 3LUTB 4IWBA 3EJNA 2NUPB 4NTBA 5L0DA 4MW3A 4X0RA 2YLIA 3WAQA 2H7VC 2PBEA 4KI2A 1MMDA 1WOLA 1RMVA 2R7SA 5L0CA 2W9YA 4XLPF 3T6JA 3RYLA 3ZIBA 2G3KA 2H7BA 3JYYA 1ZHWA 2KC3A 2OCCC 3M1CB 1ZHTA 3VM6A 3I4UA 2J9WA 3L34A 3EFOB 3QMKA 3U9MA 4CDYA 4Z9HA 1VTMP 4OD4A 1MMNA 3LS1A 4U5HA 3AQBA 3SNHA 1A41A 2QUPA 3DM5A 4BEMJ 3H2VA 2UUIA 2W45A 1OCCC 5KYWB 2JX0A 2J9BA 2XM0A 2Q00A 3T6BA 2IXOA 1FMVA 3V5ZA 2YL0A 3WG7C 1OXBA 3KYIA 1VK5A 2CNWD 3JCUQ 4JVSA 4O79A 2HFIA 2QTVA 4PR9A 5F28E 1NFOA 1R5ID 2KJGA 3GWNA 4AK9A 4CJGA 1Y4CA 2A0UA 3AG4C 3RVYA 1CGOA 1NLXA 2OG2A 1RKCA 4MVMA 3TJ5A 3U9JA 3WODF 4OD5A 4RDAA 1T5OA 3LESA 4P9FA 1TWAA 1TR2A 1VB5A 4O6MA 2I8BA 4PJJA 5B1BC 2VB6A 3BRJA 4YK5A 1F1MA 1M2VB 1NZEA 4GYTA 4HE8D 1O3UA 1SR2A 3LLIA 2HZ8A 3MYFA 2KK1A 4PK4A 4C3EA 4JZAA 2XRHA 4DBQA 3ABKC 3Q7GA 4LLEA 4DOZA 1PD0A 4EHPA 4D4XA 4U5BE 1RJ9A 3J06A 5A6KA 1WATA 2C03A 5L0FA 3E70C 1BR1A 2YL3A 1H9TA 3JZ0A 1VYKA
chains in the Genus database with same CATH topology
3ITFA 1NG1A 3AQCA 5EHHA 1TWHA 4OIRF 4YT2A 2DYRC 4DVYP 4E7ZA 3POVA 3Q6MA 4K0DA 3MLGA 2WZFA 2XXAB 2KQ9A 5KYUB 4U5FE 3L0IA 3O6XA 4O6NA 5E3AA 4HEAJ 3T4RA 5L3QA 4BJTA 1FTSA 3HTKC 4O6YA 5E33A 4O7GA 4Q7CA 4EWCA 1BR2A 3K7DA 4YT5A 5DQTA 5T1DB 3EG9B 3FAJA 4CIHA 5D92A 3KH2A 3X1OA 2Y69C 3E9VA 4HFFB 3LJBA 3W2WA 4RBNA 2KGOA 1NU7D 4QI2A 2YZSA 3O39A 3I5PA 3DXJF 4XTKA 4JJGA 3SZRA 3EGDB 1W2WA 4JURI 3PMRA 5B1AC 1LVKA 3ZC4A 3NDBB 3EGXB 2CDQA 4ZLCA 4U5CE 2GFHA 2J0WA 3N2ZB 3K33A 1J8MF 4C7OB 4KC9A 5KYXA 3EHNA 3MX3A 3ZIBA 2M4EA 2Q9CA 3LNRA 1S7ZA 1ZHZA 3N24A 3IEEA 1OKKA 1FFTC 2J7PA 3AG3C 1PD1A 4U5GA 2YHSA 4I1OB 2NUPA 1SZIA 5KYYB 3LAYA 3EZHA 3HLZA 4ZLDA 4AE4B 3SEOA 2A6EF 3OA1A 3EFOA 4G7ZF 4JCHA 3EQLF 1D0ZA 2IXNA 2R7UA 5KYWA 4BJ5C 3EHMA 2B0JA 2EINC 3K6BA 5T3WA 4YT4A 2WZLA 1SMYF 2CGEA 2PF4E 2R7VA 4WJ0A 2IXMA 4CSAA 4CS8C 1BR4A 3OEOA 1G8XA 2Y3GA 5FCLA 3H65A 4AX2A 2O9XA 2WVQA 3B0PA 3DJUB 3FHDA 3LS0A 3V7OA 1ZHYA 1M2VA 4P6IC 2WVNA 4OIOF 3B0UX 4LACB 3UGPA 3JRTA 3UMKA 2L9JA 5DLJA 2CW0F 2H7OA 2V3CC 1N1CA 3DAGA 3K66A 4CSAC 2CNWA 2C04A 3JT1A 4J32B 2QY9A 3UR3C 4FX5A 3DM9B 3GANA 5D91A 3Q7LA 3KL4A 3ASOC 4XWJA 2J0XA 5KYUA 4RD9A 1J8YF 4ANJA 2Q9BA 4U5EE 3W2VA 3NYMA 4I44A 5B3SC 2J45A 4JJFA 2DYSC 2XL4A 5IY5C 4N06A 2IYLD 2D5RB 2J9VA 1NU9C 3EG9A 2J46A 1LKXA 2ZXRA 3CQZA 5DS5A 3ECSA 2L81A 4U5DE 1LS1A 5DS4A 4G0HA 1ST6A 4CS7A 3EGDA 4IAOA 2NG1A 2WZGA 4YWQA 1RJ9B 4OIPF 3VAYA 4Q4ZF 1IZMA 1Z63A 1QLEC 4G7OF 1FFHA 4PJNA 1VOMA 3EGXA 4PJMA 3NYJA 2MYSA 5CI8A 2ZXWC 4G7HF 1TWGA 4C3BA 3QZCA 3EPVA 2WL8A 3AG2C 4A2NB 4C7OA 1OCRC 3S27A 3NG1A 3SP1A 4LLCA 2VASA 1OCZC 3TD7A 3N0TA 1TWCA 2JD3A 2R7XA 4Q5SF 5KYYA 3ASNC 3GODA 4IRUA 3PHF2 3DAFA 4AE4A 3DZAA 4BJ5A 3S28A 2NUTB 4DBRA 1D1CA 4CBEA 4CS8A 2EILC 5DVWA 4EBBA 1M2OA 2KNHA 2W4BA 2PFDA 3UMHA 1D1BA 4YJWA 3JSZA 1MNEA 2A69F 2YEVA 2Y3HA 4YN0B 3VYWA 4BJ6A 2R7RA 4H4KC 1QZXA 4BJ1A 1OCOC 5DQZA 3CSKA 2BE5F 4GEHA 1M57C 2VH3A 1ZU5A 5KYNA 5KYXB 2P7VA 2PX0A 2DGJA 2EIJC 4CS9C 3ABLC 4BJ6C 2EIKC 2KW3C 3Q6NA 2LSEA 3W8HA 2IXPA 4C3DA 1O87A 3NKEA 2Q3TA 4QI0A 3KKBA 4BEJA 3B9QA 3AG1C 2WB7A 1JPJA 1D1AA 2R7WA 2ZXOA 2G3VA 4K7BA 4PFPA 2FGYA 2EIMC 2R7QA 1MMAA 3EH1A 1JPNA 2XXAA 2V26A 3UNGC 2A68F 3F47A 2MWQA 1IW7F 4XLNF 4DVZA 1V55C 1D0XA 2Y3DA 3K1IC 3EZIA 1TKNA 2P6VA 4W8KA 4LERA 4QDLA 4MQ9F 3K1HA 3RKOF 3RIPA 3F46A 3W8IA 2X51A 3ABMC 2A6HF 1MMGA 1Z3IX 3DD7A 2HV6A 3I5QA 3ZG1A 1O5HA 4PFOA 4FWVA 5HSWA 5DS6A 4FESA 3SYNA 1D0YA 5F5HA 1MNDA 5L3VA 2J9UA 4IJJA 1SF8A 1Z6AA 3LEVA 1FMWA 3EH2A 2Y3BA 2W4MA 3HJCA 2G62A 2WVOA 3UGOA 3NYLA 1ZU4A 5T3TA 4E7SA 2ZXPA 4KBLA 4M63A 1VYIA 5E2QA 5BUOA 2E87A 2NUTA 4I1MA 3DMDA 4MNDA 3B0VC 2PP4A 1PCXA 4J30B 3ZVRA 2Z15A 3LLKA 5E3CA 4JW1A 2HV7A 5CI9A 3OWTA 2A1DD 3X2QC 1KU2A 1V54C 2FFHA 4KNWA 4BG0A 3JYHA 1ZHXA 1WGWA 1Z5ZA 2XSEA 3ZSUA 3KMIA 5F5FA 1OKKD 3RFYA 2J7PD 4CS9A 2Y39A 3FVYA 2R7TA 1M56C 4NY3A 3RH3A 2IOQA 2Q9AA 3S29A 3CZ6A 3NRHA 4OINF 4OIQF 5EGYA 4ULWA 2ZPAA 4KNVA 4YT8A 3FDQA 3NKDA 4B6IA 3S0XA 4F4BA 1ZYRF 2R7OA 4I3MA 4PJLA 1Z23A 3DJNB 1VMAA 2PX3A 4HFKB 3UMIA 4IWBA 3EJNA 2NUPB 4X0RA 2H7VC 4KI2A 1MMDA 2R7SA 4XLPF 2W9YA 3T6JA 3RYLA 2G3KA 2H7BA 1ZHWA 2OCCC 3M1CB 1ZHTA 3I4UA 2J9WA 3L34A 3EFOB 3QMKA 4OD4A 1MMNA 3LS1A 4U5HA 3AQBA 3SNHA 3DM5A 2W45A 1OCCC 5KYWB 3T6BA 2IXOA 1FMVA 3WG7C 1VK5A 2CNWD 3JCUQ 4JVSA 4O79A 2QTVA 2KJGA 4AK9A 3AG4C 2OG2A 3WODF 4OD5A 4RDAA 3LESA 1TWAA 1TR2A 4O6MA 2I8BA 4PJJA 5B1BC 2VB6A 1M2VB 1NZEA 4GYTA 4HE8D 3LLIA 4PK4A 4C3EA 4JZAA 2XRHA 4DBQA 3ABKC 3Q7GA 4LLEA 4DOZA 1PD0A 4U5BE 1RJ9A 2C03A 3E70C 1BR1A 1VYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J32 B;  4HFK B;  3ZIB A;  4B6I A;  4J30 B;  4HFF B;  4JUR I;  4AX2 A; 
#chains in the Genus database with same CATH topology
 3ITF A;  2HSB A;  1JRA A;  1NG1 A;  3AQC A;  3C8G A;  4MTG A;  5EHH A;  1JR8 A;  1TWH A;  1YA7 O;  4OIR F;  4YT2 A;  2DYR C;  1WAS A;  4DJ9 A;  4DVY P;  2PNO A;  1QKR A;  4E7Z A;  5A6B A;  2OJE D;  3Q6M A;  4A4A A;  3POV A;  4K0D A;  4MVO A;  3MLG A;  1OR3 A;  3B29 A;  4IGG A;  2WZF A;  2XXA B;  2KQ9 A;  5KYU B;  4U5F E;  3H2U A;  3HKK A;  3L0I A;  2RD9 A;  3O6X A;  4O6N A;  5E3A A;  1E84 A;  2OOC A;  3LNM B;  4HEA J;  2FAP B;  3T4R A;  1WWP A;  2MHR A;  2HSQ A;  4BJT A;  5L3Q A;  4Z9I A;  3M15 A;  1HW1 A;  1DOW A;  2XLH A;  4E17 A;  1FTS A;  3HTK C;  2OEX A;  1E2X A;  3FMS A;  4O6Y A;  5E33 A;  1ZZP A;  4O7G A;  1U0B B;  3C62 A;  2HMQ A;  1CGN A;  2LK4 A;  3IPM O;  4Q7C A;  1FAP B;  1BR2 A;  4JC7 A;  4JKV A;  3K7D A;  3SXM A;  2ZD9 A;  4EWC A;  2XS1 A;  5COF A;  4YT5 A;  3QVZ A;  5CIV A;  5DQT A;  3US6 A;  5T1D B;  2P0N A;  3GM2 A;  3EG9 B;  3ZQV A;  3FAJ A;  4CIH A;  5D92 A;  3T6G B;  3KH2 A;  3U2L A;  2Y69 C;  3X1O A;  3E9V A;  4HFF B;  1B68 A;  3QTH A;  3LJB A;  4P9T A;  3RW0 A;  3W2W A;  1KNY A;  1YAR O;  4RBN A;  4DRJ B;  2KGO A;  1NU7 D;  3U8P A;  4QI2 A;  1C03 A;  2YZS A;  3O39 A;  3I5P A;  3DXJ F;  1VLS A;  4XTK A;  1A7V A;  3KPH A;  4JJG A;  3SZR A;  3EGD B;  4XEK A;  1W2W A;  5EK0 A;  3ZTZ A;  1SYQ A;  1A0B A;  4JUR I;  1ZW3 A;  3G4Z A;  5A6J A;  3PMR A;  4EBK A;  5B1A C;  2CCY A;  1LVK A;  1Q0K A;  2XL8 A;  3ZC4 A;  5COG A;  5B3I A;  3NDB B;  3EGX B;  4ONS A;  2CDQ A;  4ZLC A;  2NSF A;  4U5C E;  2GFH A;  1T6U A;  2VCB A;  1L3P A;  1LIH A;  2J0W A;  3N2Z B;  3JRM O;  3K33 A;  1J8M F;  2J8W A;  3RQE A;  4Z9J A;  2H8A A;  4KC9 A;  4C7O B;  2LIG A;  3SXY A;  3DWW A;  1JOG A;  3EHN A;  3MX3 A;  5KYX A;  4J7T A;  2GWW A;  2YL7 A;  2M4E A;  2Q9C A;  1OW6 A;  3LNR A;  1S7Z A;  4U9D A;  1ZHZ A;  2VCC A;  1OKK A;  1FFT C;  3IEE A;  3N24 A;  2J7P A;  3AG3 C;  3U3B A;  1PD1 A;  3U8V A;  3TJ6 A;  4U5G A;  4R32 A;  2YHS A;  4I1O B;  2NUP A;  1SZI A;  5KYY B;  1LE4 A;  3LAY A;  3EZH A;  3HLZ A;  4AL0 A;  5AC5 A;  3DE8 A;  1AUE A;  1HW2 A;  1NFN A;  4ZLD A;  4MS2 A;  4DRI B;  1Q0M A;  4AE4 B;  3SEO A;  4U9E A;  1VLT A;  2A6E F;  3OA1 A;  3EFO A;  3MBG A;  3MYI A;  3GEI A;  4XPY A;  4G7Z F;  4MVR A;  4JCH A;  3EQL F;  1YVI A;  1D0Z A;  2IXN A;  3B71 A;  2R7U A;  3VRC A;  2OJQ A;  3CAX A;  2EPK X;  4GQH A;  5KYW A;  4BJ5 C;  3EHM A;  2B0J A;  2EIN C;  3K6B A;  5T3W A;  3ZWI A;  2WZL A;  1SMY F;  4YT4 A;  2CGE A;  2PF4 E;  4NCQ A;  1KTM A;  2R7V A;  4WJ0 A;  2HKV A;  2IXM A;  4XEF A;  4CSA A;  4CS8 C;  1BR4 A;  1XWJ A;  1G8X A;  3OEO A;  5L0H A;  3GM3 A;  2VCA A;  2Y3G A;  5FCL A;  3H65 A;  1GS9 A;  1G4W R;  4ULV A;  4AX2 A;  2JPU A;  2O9X A;  2WVQ A;  3B0P A;  3DJU B;  3FHD A;  1ORY A;  3LS0 A;  2AWY A;  3V7O A;  1ZHY A;  5GPG B;  1EQ1 A;  2L7A A;  1GQA A;  1M2V A;  5BQG A;  4P6I C;  2WVN A;  4CDA A;  5JRA A;  2L6F A;  4OIO F;  4JRZ A;  4LAC B;  4CIP A;  3UGP A;  2RSE B;  3B0U X;  4N4W A;  2R05 A;  3JRT A;  1H9G A;  3GOR A;  3UMK A;  2HJM A;  2L9J A;  5DLJ A;  2CW0 F;  2H7O A;  2V3C C;  1N1C A;  3DAG A;  3K66 A;  4CSA C;  2CNW A;  3KYJ A;  4WAB A;  5L0G A;  3QW0 A;  2C04 A;  1YA9 A;  3JT1 A;  1E85 A;  2HS5 A;  1HE1 A;  4J32 B;  2YVK A;  1UFB A;  2QY9 A;  5JS5 A;  2HJ3 A;  3L1M A;  3UR3 C;  1H6G A;  1RCP A;  3DM9 B;  4FX5 A;  2QLA A;  3GAN A;  5D91 A;  1K40 A;  3AGU A;  1S05 A;  3ASO C;  3KL4 A;  3Q7L A;  4XWJ A;  4XPW A;  2UUH A;  2J0X A;  4XPX A;  1E86 A;  5KYU A;  4UDV A;  4RD9 A;  1J8Y F;  1NBB A;  3ZQY A;  1YAU O;  3AOU A;  2Q9B A;  4U5E E;  3SXZ A;  3W2V A;  4ANJ A;  3NYM A;  2IM8 A;  1T6I A;  1ORS C;  4I44 A;  1U6H A;  3AJM A;  3TOM A;  4DRH B;  5B3S C;  4IB4 A;  2J45 A;  1Y6D A;  4JJF A;  4JTD B;  2DYS C;  2XL4 A;  5IY5 C;  4N06 A;  5JVE A;  1HMO A;  2IYL D;  4JTC B;  5L0I A;  2D5R B;  3LEO A;  2J9V A;  1NU9 C;  3EG9 A;  5JUA A;  2J46 A;  1LKX A;  2ZXR A;  2AVK A;  3CQZ A;  3CEX A;  1OW7 A;  2OU6 A;  5DS5 A;  3ECS A;  2L81 A;  1LE2 A;  4U5D E;  3U0C A;  3S9O A;  1LS1 A;  3RQF A;  1V74 B;  5DS4 A;  4G0H A;  3R7C A;  1ST6 A;  4E18 A;  1MQV A;  4CS7 A;  2AP3 A;  3IQ6 A;  3EGD A;  3GWL A;  2KYH A;  4IAO A;  2NG1 A;  4IAR A;  1LS4 A;  2WZG A;  1RJ9 B;  3NMI A;  4YWQ A;  1G4U S;  4OIP F;  1M6T A;  4W8P A;  3VAY A;  1IZM A;  3RVZ A;  3M4B A;  5TJ5 E;  4FAP B;  1QLE C;  5K0I A;  2QNL A;  4Q4Z F;  1Z63 A;  4G7O F;  2ETS A;  1FFH A;  4PJN A;  1VOM A;  2XLW A;  3O55 A;  1GM5 A;  1NSG B;  3EGX A;  3NYJ A;  4PJM A;  2MYS A;  2GAQ A;  4K1O A;  2EPO A;  2P61 A;  2ZXW C;  5CI8 A;  3DI5 A;  4G7H F;  4JCZ A;  1TWG A;  5BQI A;  2XLD A;  2GDC A;  3L8I A;  2LFF A;  3EPV A;  3QZC A;  3T9O A;  2WL8 A;  1LI5 A;  2LD6 A;  3AG2 C;  5JP7 A;  3GEE A;  4MW8 A;  4A2N B;  4C7O A;  1XZP A;  1HMD A;  1OCR C;  1U89 A;  3S27 A;  2YQY A;  5JT4 A;  3NG1 A;  1CGM E;  3SP1 A;  4NTA A;  1RKE B;  2EPL X;  2VAS A;  1OCZ C;  4LLC A;  3N0T A;  3TD7 A;  1TWC A;  4WGZ A;  2JD3 A;  4H54 A;  1QPU A;  2R7X A;  4Q5S F;  4JTA B;  2TMV P;  5KYY A;  3ASN C;  4LDR A;  1C17 M;  3GOD A;  3IHU A;  2Q4F A;  2ICW G;  2LQG A;  4IRU A;  4D4N A;  3QW1 A;  3S90 A;  3PHF 2;  1OR2 A;  3DAF A;  4AE4 A;  3DZA A;  5JSL A;  1FR0 A;  1LI7 A;  3S28 A;  3MFN A;  2BL2 A;  4BJ5 A;  2NUT B;  4DBR A;  1XZQ A;  3C7J A;  1D1C A;  4CBE A;  4CS8 A;  2EIL C;  2R03 A;  1DOV A;  5DVW A;  2X0C A;  4EBB A;  3V5Y A;  3IQ5 A;  1M2O A;  2F22 A;  2KNH A;  4MTO A;  2EPM X;  1HY5 A;  2W4B A;  2PFD A;  4LDQ A;  1D1B A;  3UMH A;  1I4Z A;  4YJW A;  3JSZ A;  1MNE A;  2A69 F;  2AWC A;  2YEV A;  4PAC A;  2Y3H A;  3FXH A;  256B A;  4JEA A;  4YN0 B;  3VYW A;  2XL6 A;  4BPM A;  5FZT A;  3GEH A;  4DXW A;  4BJ6 A;  2DB4 A;  1JMW A;  4N6C A;  2GA0 A;  4AL1 A;  2R7R A;  4H4K C;  3JTL O;  1QZX A;  4BJ1 A;  3IQC A;  4JEB A;  1OCO C;  5DQZ A;  3ZTM A;  3CSK A;  2BE5 F;  3RQG A;  4GEH A;  3HNJ A;  4WGY A;  1OXK A;  1M57 C;  1R4T A;  2VH3 A;  1ZU5 A;  5KYN A;  2L6G A;  5L0J A;  5KYX B;  2P7V A;  2PX0 A;  2DGJ A;  5A69 A;  3AGT A;  2EIJ C;  3TOL A;  4NC3 A;  4CS9 C;  4JE9 A;  3TQO A;  3ABL C;  1I4Y A;  1T01 A;  3DKA A;  4BJ6 C;  2EIK C;  2KW3 C;  3Q6N A;  2R9R B;  2LSE A;  1BBH A;  2QE9 A;  2IXP A;  5AGF A;  3W8H A;  1O87 A;  1ORJ A;  2LFD A;  3NKE A;  1APC A;  2Q3T A;  4C3D A;  4QI0 A;  2R02 A;  2YWA A;  3KKB A;  1EKY A;  4BEJ A;  2L6H A;  3B9Q A;  4ER9 A;  4EIY A;  5BQH A;  2NPU A;  3NMK A;  3AG1 C;  2WB7 A;  3U5S A;  3K1I A;  2EPN A;  1Q0D A;  1E83 A;  3M4C A;  3U2M A;  4L6R A;  3TUL A;  3A11 A;  1JPJ A;  2BC5 A;  1D1A A;  3G4X A;  3L8J A;  3NMJ A;  2R7W A;  2ZXO A;  2B0H A;  2G3V A;  4K7B A;  4PFP A;  2FGY A;  2EIM C;  2R7Q A;  1MMA A;  2OEV A;  1JPN A;  3EH1 A;  2V26 A;  2XXA A;  3UNG C;  1FNT c;  1T9K A;  2A68 F;  3F47 A;  2XS8 A;  2MWQ A;  1IW7 F;  4XLN F;  4DVZ A;  1GGQ A;  1V55 C;  1D0X A;  1AVO B;  2Y3D A;  4J7Y A;  2Q7R A;  3K1I C;  3EZI A;  1TKN A;  1OW8 A;  1YJG A;  1Q0G A;  2P6V A;  3SXK A;  4W8K A;  1T6Q A;  1TFO B;  4LER A;  4QDL A;  4MQ9 F;  1EA8 A;  3K1H A;  3RKO F;  3RIP A;  3F46 A;  3JSE O;  1ZW2 A;  2R25 A;  2OKU A;  3W8I A;  2X51 A;  3ABM C;  2A6H F;  3FAP B;  1MMG A;  2NSG A;  1Z3I X;  3GM1 A;  1CPQ A;  1A7E A;  1QVX A;  2HUJ A;  3C8G D;  1YYJ A;  3DD7 A;  1YZA A;  3C8Z A;  3PCV A;  2XLE A;  3BEH A;  5A6B D;  3TK0 A;  1L7C A;  2HV6 A;  3I5Q A;  3ZG1 A;  2LP4 A;  1O5H A;  4PFO A;  5HV9 A;  2P1A A;  2YKZ A;  3HNK A;  4CDV A;  1C02 A;  1Q0F A;  3FOP A;  4FWV A;  4NTF A;  3ZDL A;  3U3F A;  4MVU A;  2ASR A;  1WN0 A;  4MTF A;  3HNL A;  5HSW A;  5DS6 A;  3C63 A;  4XQ1 A;  4FES A;  3V5X A;  4EUK B;  2XLM A;  1D0Y A;  3SYN A;  4JIO A;  5F5H A;  1MND A;  1RKE A;  2HMZ A;  2J9U A;  3C8G B;  5L3V A;  4IJJ A;  1SF8 A;  1Z6A A;  1BZ4 A;  1YDI A;  4LDK A;  1ZVZ A;  3LEV A;  1FMW A;  3EH2 A;  2OQM A;  2Y3B A;  3R2P A;  4NQF A;  5JLI A;  4E0I A;  2W4M A;  3HJC A;  2G62 A;  3HNI A;  2XLO A;  2WVO A;  2DI3 A;  1CPR A;  2YL1 A;  3A9C A;  4CX9 A;  1I5N A;  3ATP A;  3UGO A;  3NYL A;  1ZU4 A;  5T3T A;  4E7S A;  2ZXP A;  4KBL A;  4M63 A;  1VYI A;  5E2Q A;  4C3B A;  5BUO A;  3W4Y A;  2E87 A;  2NUT A;  1WTY A;  1QQ3 A;  4I1M A;  3DMD A;  1K05 A;  4MND A;  2YLD A;  3M79 A;  3B0V C;  2PP4 A;  1PCX A;  4J30 B;  4MVS A;  2I15 A;  1Z7Q c;  2YRF A;  4EBJ A;  1QSP A;  2KSF A;  1AEP A;  1LM3 B;  2Z15 A;  3LLK A;  5E3C A;  3ZVR A;  4CJO A;  4JW1 A;  2HV7 A;  5CI9 A;  4MVQ A;  3OWT A;  2A1D D;  3X2Q C;  1OQC A;  4EKW A;  3O10 A;  1KU2 A;  1V54 C;  2FFH A;  1BDJ B;  4KNW A;  1LPE A;  3JYH A;  1ZHX A;  4MVZ A;  1WGW A;  4BG0 A;  4E0H A;  4G78 A;  2IBF A;  1Z5Z A;  2VC9 A;  2LCH A;  2XLV A;  2XSE A;  3RF3 A;  2CYD A;  4IAQ A;  3ZSU A;  5A6A A;  3PDM P;  3KMI A;  5F5F A;  1OKK D;  1HE9 A;  2J7P D;  4YL3 A;  3RFY A;  2Y39 A;  2YLG A;  3FVY A;  4CS9 A;  2R7T A;  3S84 A;  1UG7 A;  1M56 C;  1V4A A;  4N6H A;  4NY3 A;  3RH3 A;  1H7I A;  5COM A;  2IOQ A;  2Q9A A;  3S29 A;  3CZ6 A;  3C18 A;  3VF0 A;  2AU5 A;  3NRH A;  4OIN F;  4YL0 A;  5EGY A;  4OIQ F;  4ULW A;  1A7D A;  2ZPA A;  4KNV A;  1JAF A;  1TFK B;  4YT8 A;  3FDQ A;  3NKD A;  3IQT A;  1RXQ A;  4XEV A;  4YL1 A;  4B6I A;  1K04 A;  2D4U A;  3S0X A;  1EI7 A;  3DE9 A;  4F4B A;  2XM4 A;  1YLM A;  1YYX A;  1G5Z A;  1PV3 A;  1ZYR F;  2R7O A;  3FOO A;  3G50 A;  4I3M A;  1YZC A;  4PJL A;  3QVY A;  1Z23 A;  3DJN B;  5AC4 A;  2A0B A;  1TQG A;  1VMA A;  2M64 A;  2PX3 A;  4HFK B;  3UMI A;  3WHN A;  3LUT B;  4IWB A;  3EJN A;  2NUP B;  4NTB A;  5L0D A;  4MW3 A;  4X0R A;  2YLI A;  3WAQ A;  2H7V C;  2PBE A;  4KI2 A;  1MMD A;  1WOL A;  1RMV A;  2R7S A;  5L0C A;  2W9Y A;  4XLP F;  3T6J A;  3RYL A;  3ZIB A;  2G3K A;  2H7B A;  3JYY A;  1ZHW A;  2KC3 A;  2OCC C;  3M1C B;  1ZHT A;  3VM6 A;  3I4U A;  2J9W A;  3L34 A;  3EFO B;  3QMK A;  3U9M A;  4CDY A;  4Z9H A;  1VTM P;  4OD4 A;  1MMN A;  3LS1 A;  4U5H A;  3AQB A;  3SNH A;  1A41 A;  2QUP A;  3DM5 A;  4BEM J;  3H2V A;  2UUI A;  2W45 A;  1OCC C;  5KYW B;  2JX0 A;  2J9B A;  2XM0 A;  2Q00 A;  3T6B A;  2IXO A;  1FMV A;  3V5Z A;  2YL0 A;  3WG7 C;  1OXB A;  3KYI A;  1VK5 A;  2CNW D;  3JCU Q;  4JVS A;  4O79 A;  2HFI A;  2QTV A;  4PR9 A;  5F28 E;  1NFO A;  1R5I D;  2KJG A;  3GWN A;  4AK9 A;  4CJG A;  1Y4C A;  2A0U A;  3AG4 C;  3RVY A;  1CGO A;  1NLX A;  2OG2 A;  1RKC A;  4MVM A;  3TJ5 A;  3U9J A;  3WOD F;  4OD5 A;  4RDA A;  1T5O A;  3LES A;  4P9F A;  1TWA A;  1TR2 A;  1VB5 A;  4O6M A;  2I8B A;  4PJJ A;  5B1B C;  2VB6 A;  3BRJ A;  4YK5 A;  1F1M A;  1M2V B;  1NZE A;  4GYT A;  4HE8 D;  1O3U A;  1SR2 A;  3LLI A;  2HZ8 A;  3MYF A;  2KK1 A;  4PK4 A;  4C3E A;  4JZA A;  2XRH A;  4DBQ A;  3ABK C;  3Q7G A;  4LLE A;  4DOZ A;  1PD0 A;  4EHP A;  4D4X A;  4U5B E;  1RJ9 A;  3J06 A;  5A6K A;  1WAT A;  2C03 A;  5L0F A;  3E70 C;  1BR1 A;  2YL3 A;  1H9T A;  3JZ0 A;  1VYK A; 
#chains in the Genus database with same CATH homology
 3ITF A;  1NG1 A;  3AQC A;  5EHH A;  1TWH A;  4OIR F;  4YT2 A;  2DYR C;  4DVY P;  4E7Z A;  3POV A;  3Q6M A;  4K0D A;  3MLG A;  2WZF A;  2XXA B;  2KQ9 A;  5KYU B;  4U5F E;  3L0I A;  3O6X A;  4O6N A;  5E3A A;  4HEA J;  3T4R A;  5L3Q A;  4BJT A;  1FTS A;  3HTK C;  4O6Y A;  5E33 A;  4O7G A;  4Q7C A;  4EWC A;  1BR2 A;  3K7D A;  4YT5 A;  5DQT A;  5T1D B;  3EG9 B;  3FAJ A;  4CIH A;  5D92 A;  3KH2 A;  3X1O A;  2Y69 C;  3E9V A;  4HFF B;  3LJB A;  3W2W A;  4RBN A;  2KGO A;  1NU7 D;  4QI2 A;  2YZS A;  3O39 A;  3I5P A;  3DXJ F;  4XTK A;  4JJG A;  3SZR A;  3EGD B;  1W2W A;  4JUR I;  3PMR A;  5B1A C;  1LVK A;  3ZC4 A;  3NDB B;  3EGX B;  2CDQ A;  4ZLC A;  4U5C E;  2GFH A;  2J0W A;  3N2Z B;  3K33 A;  1J8M F;  4C7O B;  4KC9 A;  5KYX A;  3EHN A;  3MX3 A;  3ZIB A;  2M4E A;  2Q9C A;  3LNR A;  1S7Z A;  1ZHZ A;  3N24 A;  3IEE A;  1OKK A;  1FFT C;  2J7P A;  3AG3 C;  1PD1 A;  4U5G A;  2YHS A;  4I1O B;  2NUP A;  1SZI A;  5KYY B;  3LAY A;  3EZH A;  3HLZ A;  4ZLD A;  4AE4 B;  3SEO A;  2A6E F;  3OA1 A;  3EFO A;  4G7Z F;  4JCH A;  3EQL F;  1D0Z A;  2IXN A;  2R7U A;  5KYW A;  4BJ5 C;  3EHM A;  2B0J A;  2EIN C;  3K6B A;  5T3W A;  4YT4 A;  2WZL A;  1SMY F;  2CGE A;  2PF4 E;  2R7V A;  4WJ0 A;  2IXM A;  4CSA A;  4CS8 C;  1BR4 A;  3OEO A;  1G8X A;  2Y3G A;  5FCL A;  3H65 A;  4AX2 A;  2O9X A;  2WVQ A;  3B0P A;  3DJU B;  3FHD A;  3LS0 A;  3V7O A;  1ZHY A;  1M2V A;  4P6I C;  2WVN A;  4OIO F;  3B0U X;  4LAC B;  3UGP A;  3JRT A;  3UMK A;  2L9J A;  5DLJ A;  2CW0 F;  2H7O A;  2V3C C;  1N1C A;  3DAG A;  3K66 A;  4CSA C;  2CNW A;  2C04 A;  3JT1 A;  4J32 B;  2QY9 A;  3UR3 C;  4FX5 A;  3DM9 B;  3GAN A;  5D91 A;  3Q7L A;  3KL4 A;  3ASO C;  4XWJ A;  2J0X A;  5KYU A;  4RD9 A;  1J8Y F;  4ANJ A;  2Q9B A;  4U5E E;  3W2V A;  3NYM A;  4I44 A;  5B3S C;  2J45 A;  4JJF A;  2DYS C;  2XL4 A;  5IY5 C;  4N06 A;  2IYL D;  2D5R B;  2J9V A;  1NU9 C;  3EG9 A;  2J46 A;  1LKX A;  2ZXR A;  3CQZ A;  5DS5 A;  3ECS A;  2L81 A;  4U5D E;  1LS1 A;  5DS4 A;  4G0H A;  1ST6 A;  4CS7 A;  3EGD A;  4IAO A;  2NG1 A;  2WZG A;  4YWQ A;  1RJ9 B;  4OIP F;  3VAY A;  4Q4Z F;  1IZM A;  1Z63 A;  1QLE C;  4G7O F;  1FFH A;  4PJN A;  1VOM A;  3EGX A;  4PJM A;  3NYJ A;  2MYS A;  5CI8 A;  2ZXW C;  4G7H F;  1TWG A;  4C3B A;  3QZC A;  3EPV A;  2WL8 A;  3AG2 C;  4A2N B;  4C7O A;  1OCR C;  3S27 A;  3NG1 A;  3SP1 A;  4LLC A;  2VAS A;  1OCZ C;  3TD7 A;  3N0T A;  1TWC A;  2JD3 A;  2R7X A;  4Q5S F;  5KYY A;  3ASN C;  3GOD A;  4IRU A;  3PHF 2;  3DAF A;  4AE4 A;  3DZA A;  4BJ5 A;  3S28 A;  2NUT B;  4DBR A;  1D1C A;  4CBE A;  4CS8 A;  2EIL C;  5DVW A;  4EBB A;  1M2O A;  2KNH A;  2W4B A;  2PFD A;  3UMH A;  1D1B A;  4YJW A;  3JSZ A;  1MNE A;  2A69 F;  2YEV A;  2Y3H A;  4YN0 B;  3VYW A;  4BJ6 A;  2R7R A;  4H4K C;  1QZX A;  4BJ1 A;  1OCO C;  5DQZ A;  3CSK A;  2BE5 F;  4GEH A;  1M57 C;  2VH3 A;  1ZU5 A;  5KYN A;  5KYX B;  2P7V A;  2PX0 A;  2DGJ A;  2EIJ C;  4CS9 C;  3ABL C;  4BJ6 C;  2EIK C;  2KW3 C;  3Q6N A;  2LSE A;  3W8H A;  2IXP A;  4C3D A;  1O87 A;  3NKE A;  2Q3T A;  4QI0 A;  3KKB A;  4BEJ A;  3B9Q A;  3AG1 C;  2WB7 A;  1JPJ A;  1D1A A;  2R7W A;  2ZXO A;  2G3V A;  4K7B A;  4PFP A;  2FGY A;  2EIM C;  2R7Q A;  1MMA A;  3EH1 A;  1JPN A;  2XXA A;  2V26 A;  3UNG C;  2A68 F;  3F47 A;  2MWQ A;  1IW7 F;  4XLN F;  4DVZ A;  1V55 C;  1D0X A;  2Y3D A;  3K1I C;  3EZI A;  1TKN A;  2P6V A;  4W8K A;  4LER A;  4QDL A;  4MQ9 F;  3K1H A;  3RKO F;  3RIP A;  3F46 A;  3W8I A;  2X51 A;  3ABM C;  2A6H F;  1MMG A;  1Z3I X;  3DD7 A;  2HV6 A;  3I5Q A;  3ZG1 A;  1O5H A;  4PFO A;  4FWV A;  5HSW A;  5DS6 A;  4FES A;  3SYN A;  1D0Y A;  5F5H A;  1MND A;  5L3V A;  2J9U A;  4IJJ A;  1SF8 A;  1Z6A A;  3LEV A;  1FMW A;  3EH2 A;  2Y3B A;  2W4M A;  3HJC A;  2G62 A;  2WVO A;  3UGO A;  3NYL A;  1ZU4 A;  5T3T A;  4E7S A;  2ZXP A;  4KBL A;  4M63 A;  1VYI A;  5E2Q A;  5BUO A;  2E87 A;  2NUT A;  4I1M A;  3DMD A;  4MND A;  3B0V C;  2PP4 A;  1PCX A;  4J30 B;  3ZVR A;  2Z15 A;  3LLK A;  5E3C A;  4JW1 A;  2HV7 A;  5CI9 A;  3OWT A;  2A1D D;  3X2Q C;  1KU2 A;  1V54 C;  2FFH A;  4KNW A;  4BG0 A;  3JYH A;  1ZHX A;  1WGW A;  1Z5Z A;  2XSE A;  3ZSU A;  3KMI A;  5F5F A;  1OKK D;  3RFY A;  2J7P D;  4CS9 A;  2Y39 A;  3FVY A;  2R7T A;  1M56 C;  4NY3 A;  3RH3 A;  2IOQ A;  2Q9A A;  3S29 A;  3CZ6 A;  3NRH A;  4OIN F;  4OIQ F;  5EGY A;  4ULW A;  2ZPA A;  4KNV A;  4YT8 A;  3FDQ A;  3NKD A;  4B6I A;  3S0X A;  4F4B A;  1ZYR F;  2R7O A;  4I3M A;  4PJL A;  1Z23 A;  3DJN B;  1VMA A;  2PX3 A;  4HFK B;  3UMI A;  4IWB A;  3EJN A;  2NUP B;  4X0R A;  2H7V C;  4KI2 A;  1MMD A;  2R7S A;  4XLP F;  2W9Y A;  3T6J A;  3RYL A;  2G3K A;  2H7B A;  1ZHW A;  2OCC C;  3M1C B;  1ZHT A;  3I4U A;  2J9W A;  3L34 A;  3EFO B;  3QMK A;  4OD4 A;  1MMN A;  3LS1 A;  4U5H A;  3AQB A;  3SNH A;  3DM5 A;  2W45 A;  1OCC C;  5KYW B;  3T6B A;  2IXO A;  1FMV A;  3WG7 C;  1VK5 A;  2CNW D;  3JCU Q;  4JVS A;  4O79 A;  2QTV A;  2KJG A;  4AK9 A;  3AG4 C;  2OG2 A;  3WOD F;  4OD5 A;  4RDA A;  3LES A;  1TWA A;  1TR2 A;  4O6M A;  2I8B A;  4PJJ A;  5B1B C;  2VB6 A;  1M2V B;  1NZE A;  4GYT A;  4HE8 D;  3LLI A;  4PK4 A;  4C3E A;  4JZA A;  2XRH A;  4DBQ A;  3ABK C;  3Q7G A;  4LLE A;  4DOZ A;  1PD0 A;  4U5B E;  1RJ9 A;  2C03 A;  3E70 C;  1BR1 A;  1VYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...