4AX2A

New type vi-secreted toxins and self-resistance proteins in serratia marcescens
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
124
Chain Sequence
b'QGHMAPIQDPVAFIKQMPYHQVVKELALSRCLAQVSDSDKAFSLDAARTANAMREWMPFDIESGDEKINVLIDKYKSRINEFHSKSQGVTLNCLRLYHSPELDKLSRQLIAGNPDRTWNQDNAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAP1B
publication title New Secreted Toxins and Immunity Proteins Encoded within the Type Vi Secretion System Gene Cluster of Serratia Marcescens
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Toxin
total genus 43
structure length 124
sequence length 128
ec nomenclature
pdb deposition date 2012-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ax2A01
3ZIBA 4HFFB 4J30B 4B6IA 4AX2A 4JURI 4HFKB 4J32B
chains in the Genus database with same CATH superfamily
1MMAA 3H65A 1V74B 4O6MA 4YT2A 3Q6MA 3V5XA 4ER9A 2J7PD 2FAPB 4Q5SF 4BJ5A 2R7TA 2DGJA 3RH3A 1MMDA 2V3CC 2OKUA 3U0CA 2GWWA 1A7EA 4U5HA 3SYNA 5DQZA 3ZQVA 1GS9A 5DS6A 4XLNF 1JPJA 1WASA 4AX2A 4E17A 1DOVA 2JD3A 3DE8A 5A6AA 2CGEA 2LSEA 3W2WA 2J0XA 3ZVRA 1TQGA 5EK0A 1G8XA 1ST6A 1ZHXA 2GAQA 1DOWA 5BQHA 5A6BD 1BBHA 2YQYA 1QPUA 5IY5C 2WZFA 4JW1A 1YJGA 2NUTA 1SF8A 2VCBA 1OCCC 2YVKA 1NU9C 4MW3A 2L6GA 1G5ZA 4CIHA 2WVQA 2NSFA 4G7OF 4DRIB 2A68F 1JAFA 4MTOA 2QE9A 2G62A 1YA7O 2AVKA 3RVZA 3QVYA 1QKRA 1YZAA 4WGZA 2J9UA 4CX9A 3OEOA 3EGXA 3NYMA 1NLXA 2YLDA 4KNWA 1MMGA 2OEXA 3S84A 3AG2C 3KH2A 4MVUA 2WL8A 3ZG1A 4RBNA 4YT8A 1Y4CA 3S27A 2M64A 3MBGA 3WAQA 2EPMX 2YZSA 3C18A 3LLIA 3JRMO 256BA 3LEOA 4NC3A 1IW7F 2HUJA 2J8WA 2LFDA 3FOPA 4U5GA 3QVZA 2ZXPA 3EH1A 1MNEA 1T6IA 1CGOA 1C03A 1HW2A 1LM3B 1AEPA 4J7TA 5DQTA 3NYLA 2YEVA 2VC9A 1NFOA 3G4ZA 3JTLO 1C17M 1GQAA 3I5QA 4R32A 2UUIA 2L81A 2NUPB 1WATA 3UNGC 5BUOA 1D0YA 2Q4FA 2KQ9A 5B3SC 4WABA 1SMYF 2V26A 2Y3GA 1MQVA 4CS8C 3I4UA 3FAPB 4PJLA 4PJJA 1A7VA 4OINF 2Q7RA 2R7WA 1OKKA 3I5PA 1CGME 1YDIA 2IXMA 2XSEA 4J32B 2WB7A 1YVIA 1SYQA 3JT1A 1TFOB 1OW8A 1OR2A 4P9TA 5HV9A 3B71A 5DS5A 1KTMA 4NTFA 3W2VA 1ZHTA 1R5ID 3AOUA 1ZHZA 3JCUQ 2XRHA 4NY3A 4YWQA 2A1DD 1LS1A 1NZEA 2C03A 1FTSA 2KYHA 3F46A 4K0DA 2IXOA 3IHUA 3CQZA 4JTDB 4JVSA 4BPMA 4Z9HA 2YKZA 3C8GA 3JSEO 4FESA 4ZLCA 5KYYB 2RSEB 3DAFA 4LLEA 3QW1A 3LNMB 4IJJA 2KGOA 3DAGA 4PFOA 4PFPA 1KNYA 3MLGA 5COFA 1LVKA 2DYSC 2GA0A 3HLZA 3NKDA 4HFFB 1E85A 4BJ1A 3V7OA 2CDQA 1A41A 4H54A 4IB4A 4E18A 1CGNA 3BEHA 3K1IA 3JYHA 1LS4A 3Q7GA 4U5BE 3TJ6A 4W8KA 1RKEB 2GDCA 3AQCA 2A6HF 3UMHA 2EPOA 4GEHA 2EPNA 3EG9A 3LEVA 2R7XA 2FGYA 1YYXA 2NG1A 2XLWA 4CDVA 3AGTA 3E9VA 1BR4A 4JRZA 2X0CA 5KYWA 1HMOA 1NBBA 2A6EF 3NDBB 4QI2A 1OQCA 3RW0A 1WN0A 2VCAA 4NCQA 4CDYA 2PX3A 3ECSA 4JJGA 3GEIA 1B68A 2B0HA 2MWQA 2Y3BA 4MVSA 4OD5A 1LE4A 3S28A 5KYYA 3UGOA 2A0BA 2OEVA 2BL2A 4BJ6C 4LDQA 3NKEA 4N06A 1QSPA 3TOLA 2XLMA 3EJNA 4E0HA 2YL0A 4EIYA 4AE4A 4CS9A 1VTMP 1O3UA 3WODF 3T9OA 2W4BA 1U6HA 1HMDA 3R7CA 2R25A 2EPKX 2Z15A 3DJUB 3N0TA 2Q3TA 2Q9CA 3QTHA 1D1BA 3GWLA 1Z5ZA 3GWNA 4FWVA 4XPYA 2YHSA 2J9VA 1M2VB 3HNLA 5COMA 1A0BA 2LFFA 3U5SA 3HNJA 4JKVA 4D4NA 2BC5A 5L0JA 1AUEA 1E83A 3VF0A 3FAJA 1T5OA 3LJBA 2P61A 2W4MA 1CPQA 4JIOA 2Q9BA 1GM5A 4MVZA 3EH2A 5DS4A 2PBEA 1YZCA 3U2MA 1VLTA 2XM0A 1K04A 3C8ZA 3EGDB 3K7DA 3V5ZA 1W2WA 2XLEA 2RD9A 4EBJA 2PP4A 3EFOA 4IWBA 1MMNA 3UGPA 3RQGA 3TD7A 1FAPB 4KBLA 3V5YA 3ZTZA 4XLPF 1T6UA 1S05A 1LI7A 3HKKA 5L3QA 2HJMA 4YK5A 4PJMA 5F5HA 3QW0A 4QI0A 2NSGA 3HTKC 3UMIA 1PV3A 2ETSA 3O55A 3US6A 5EHHA 2LD6A 5TJ5E 4D4XA 3MYFA 1I4YA 3RQEA 3S90A 2JX0A 4I1OB 3X1OA 3U2LA 2XLVA 5L0IA 5CI9A 1D1AA 3LLKA 4N6CA 4CDAA 2J7PA 2QY9A 4NTBA 3ZSUA 3T4RA 2H7VC 1L7CA 5T3WA 2YLIA 2OU6A 3GANA 3FMSA 4JTAB 4RD9A 1ZW3A 1VB5A 1FMWA 1T9KA 4O79A 4U5CE 1ORJA 3EPVA 4YT5A 2P7VA 1QLEC 2O9XA 1RMVA 2R9RB 3N24A 4NTAA 1ZHYA 4C7OB 4JEAA 2I15A 1XZPA 1ZHWA 4G78A 5JT4A 1M57C 1Q0KA 5A6BA 3X2QC 4G0HA 4G7ZF 4PR9A 3NMKA 5KYNA 5AGFA 2Q9AA 1U89A 5JLIA 4EHPA 3J06A 2EPLX 2J46A 1TWAA 4XTKA 4AL1A 3O39A 5E3CA 2PF4E 2QTVA 3HNKA 3DKAA 1Y6DA 3LESA 3NYJA 3DJNB 4U9EA 3IQ5A 1N1CA 2R7SA 2Y69C 4LERA 3TK0A 2EIMC 1PD0A 4DBRA 2R7UA 3TQOA 3QMKA 3ZDLA 3G4XA 1V54C 4JJFA 4PJNA 2D5RB 5L0GA 1SR2A 2FFHA 4M63A 2P6VA 4P9FA 1YLMA 3NMJA 5L0HA 1YYJA 3U9JA 3VRCA 1ZYRF 4U9DA 4BJ5C 1Z6AA 4PK4A 3U8PA 3M79A 3AGUA 3ASNC 1BDJB 2XS8A 2YLGA 3K66A 1E84A 3EQLF 3GM3A 5JS5A 3S9OA 1Z63A 4YN0B 1AVOB 2Y3HA 2IM8A 3EHMA 4MVOA 2XLHA 1C02A 3B9QA 4BJ6A 1HE9A 3M4BA 3U3BA 1OXBA 3DM9B 4JE9A 5CIVA 3PDMP 3CEXA 1VK5A 3LS1A 2L6FA 1E86A 1VLSA 3C63A 2HSQA 2UUHA 1RJ9B 2AP3A 5DVWA 3VM6A 4J30B 5A6KA 2CYDA 3Q6NA 3RVYA 2J45A 2NUPA 4ANJA 4IARA 5K0IA 3VAYA 1RCPA 5L3VA 1TWCA 3ABLC 3IEEA 3T6GB 5L0DA 5KYXB 2DB4A 3OWTA 3ZWIA 4RDAA 2ZXWC 5CI8A 1EA8A 1CPRA 1M6TA 2BE5F 3ASOC 2F22A 5KYUB 3E70C 2E87A 4HEAJ 4N6HA 4MVMA 5A6JA 2J9BA 1WWPA 1TKNA 2JPUA 3CSKA 3Q7LA 2LQGA 1QVXA 2HZ8A 2GFHA 4LDKA 1FMVA 1YAUO 3UMKA 3KPHA 3MYIA 1LKXA 2VB6A 4O6NA 4XEVA 5E3AA 4OIRF 1RJ9A 2EIJC 3AJMA 4MS2A 5B1AC 4DVYP 1UG7A 1O87A 4GYTA 1KU2A 3F47A 5A69A 2R7VA 1T6QA 2HSBA 2X51A 1D0XA 2I8BA 3SP1A 2AWYA 2WVOA 2A69F 1ORYA 3AG4C 5T3TA 3SZRA 4C3EA 3C7JA 1WOLA 1D1CA 4X0RA 4NQFA 4WJ0A 2XL8A 1F1MA 2YL3A 3LUTB 4ULWA 2R7QA 4MTGA 1VYKA 1TWHA 1HE1A 2P1AA 3DMDA 4U5DE 4Z9IA 4ULVA 1L3PA 2EIKC 3S29A 3TJ5A 3C62A 2HV7A 1GGQA 3H2UA 3IQTA 4CJOA 4K7BA 4C3BA 1D0ZA 2HKVA 2IXNA 3U8VA 1UFBA 4XEKA 1RKEA 2CNWD 1XWJA 2HJ3A 3FOOA 1TWGA 2P0NA 5FCLA 2DYRC 2HMQA 3TULA 1JRAA 2Q00A 3GM2A 2KW3C 2IYLD 5L0CA 3KYJA 3FHDA 3SXYA 4U5FE 3MFNA 5E2QA 1T01A 3FXHA 3M15A 3GEHA 3KYIA 3K6BA 4JCZA 5JSLA 2R05A 5JUAA 2Y3DA 5HSWA 1ZZPA 1Q0GA 1VMAA 3M1CB 1I5NA 3NMIA 4HE8D 5D92A 5F28E 4JURI 1ZU4A 1V4AA 2OQMA 3LNRA 5E33A 4DRJB 4Q7CA 3QZCA 4C3DA 2CCYA 2AWCA 1J8YF 3L8IA 3U3FA 1TFKB 1LE2A 1NG1A 2J0WA 2VCCA 3SXZA 4IAOA 3RFYA 3GM1A 4JC7A 4MQ9F 4CJGA 4XEFA 3RYLA 3SXKA 3KKBA 2M4EA 1YA9A 2KJGA 2KC3A 4YL1A 4LLCA 4Z9JA 1A7DA 2OOCA 4JTCB 4IRUA 4AL0A 1M2VA 4EKWA 1R4TA 2QLAA 1WTYA 3GEEA 1OW7A 1RXQA 4EBBA 1FR0A 3G50A 3JZ0A 2AU5A 2L9JA 3W4YA 3K1IC 2YRFA 3DI5A 3LAYA 4CS8A 3W8IA 2L7AA 2OG2A 4IGGA 2W9YA 1U0BB 4BG0A 3K1HA 1JMWA 1K40A 3EGXB 3SEOA 1J8MF 1PCXA 2PX0A 3A11A 2QUPA 3EGDA 3ZTMA 1FNTc 3WHNA 3B0UX 2HV6A 2HMZA 1QZXA 1ZW2A 2HS5A 4I1MA 2G3VA 2KSFA 4E0IA 3L1MA 2LP4A 4KI2A 2ZPAA 3ITFA 1JR8A 2CW0F 2OCCC 4CSAC 4OD4A 1M56C 1Z7Qc 3L34A 2L6HA 3JRTA 3MX3A 1MNDA 3JSZA 4E7ZA 3B0PA 2DI3A 4CS7A 2XXAB 4XPWA 4MVRA 3N2ZB 3DWWA 1LPEA 1XZQA 3O10A 2B0JA 4CIPA 1LI5A 3NG1A 3ABMC 4A2NB 4CS9C 1ZVZA 1NU7D 1G4US 1O5HA 1APCA 2EINC 1TR2A 1ZU5A 3DXJF 1H9GA 2H7BA 2J9WA 3CAXA 3HNIA 4U5EE 5BQGA 3TOMA 4DRHB 5JVEA 3WG7C 4IAQA 3RF3A 3AG1C 2NPUA 1Q0DA 3FVYA 3IPMO 4PACA 5BQIA 1H9TA 4OIPF 5AC5A 4CBEA 1RKCA 1BR1A 2MYSA 3R2PA 3JYYA 4FX5A 4H4KC 4Q4ZF 2PNOA 5B3IA 4C7OA 4EBKA 1NFNA 1M2OA 4BEJA 3L0IA 1PD1A 4YL3A 1VYIA 3U9MA 3S0XA 1OKKD 2XLDA 4ONSA 4W8PA 2XXAA 2R03A 3EHNA 3ZQYA 1QQ3A 5EGYA 1Z23A 2ZXOA 1BZ4A 4OIOF 2IXPA 4AK9A 4ZLDA 2G3KA 2PFDA 2EILC 1NSGB 3EZHA 3AG3C 2XLOA 2KNHA 4I44A 5COGA 5JP7A 1JPNA 1SZIA 3C8GB 2ZXRA 3RKOF 3UR3C 3ZIBA 4DOZA 2QNLA 5B1BC 5JRAA 1S7ZA 1LIHA 3M4CA 3GODA 1BR2A 1EI7A 2IBFA 3C8GD 1HY5A 2MHRA 3AQBA 4JCHA 5T1DB 4DXWA 4UDVA 3BRJA 3PCVA 3SXMA 1I4ZA 4DBQA 1IZMA 1FFTC 4QDLA 2R7RA 3O6XA 4O6YA 2H7OA 5F5FA 2TMVP 4E7SA 1OCOC 1Q0MA 2A0UA 4BJTA 3EG9B 1E2XA 2ASRA 4KC9A 1WGWA 2IOQA 1OR3A 1YARO 4DJ9A 3OA1A 5AC4A 4EWCA 4KNVA 3ABKC 5KYWB 2OJED 4BEMJ 4DVZA 1EKYA 3FDQA 1Q0FA 1G4WR 2WVNA 3PMRA 4GQHA 4XQ1A 3B0VC 4I3MA 1Z3IX 2D4UA 5DLJA 4P6IC 4XWJA 5D91A 3ATPA 3K33A 1K05A 4MW8A 3B29A 3HJCA 4HFKB 1OW6A 2XM4A 2YWAA 1H7IA 4AE4B 5L0FA 3VYWA 4OIQF 3H2VA 1ORSC 2XL6A 2VH3A 2OJQA 3KMIA 3DM5A 3POVA 1OCRC 3IQ6A 4K1OA 2XS1A 2LIGA 3IQCA 3LS0A 4WGYA 5KYXA 4F4BA 2R02A 1FFHA 3KL4A 4LDRA 3RIPA 2ICWG 2KK1A 3NRHA 4MNDA 5GPGB 3ZC4A 4XPXA 5KYUA 4N4WA 4A4AA 3PHF2 4YJWA 1VOMA 3DD7A 4J7YA 4CSAA 1EQ1A 4JEBA 3A9CA 2WZLA 3L8JA 3SNHA 2VASA 4MVQA 2LK4A 4MTFA 4YT4A 3EFOB 2YL1A 4L6RA 3T6JA 3EZIA 1H6GA 4EUKB 2XL4A 2C04A 4B6IA 4G7HF 1HW1A 3CZ6A 3W8HA 2W45A 3DE9A 4O7GA 2ZD9A 2YL7A 2WZGA 3GORA 1OXKA 4FAPB 2R7OA 1V55C 2H8AA 4JZAA 3T6BA 3DZAA 2LCHA 4LACB 3RQFA 4YL0A 1JOGA 2CNWA 2NUTB 5FZTA 2HFIA 2Y39A 1OCZC
chains in the Genus database with same CATH topology
1MMAA 3H65A 4O6MA 4YT2A 3Q6MA 2J7PD 2R7TA 4Q5SF 4BJ5A 2DGJA 3RH3A 1MMDA 2V3CC 5DQZA 4U5HA 5DS6A 4XLNF 1JPJA 4AX2A 2JD3A 2CGEA 2LSEA 3W2WA 2J0XA 3ZVRA 1G8XA 1ST6A 1ZHXA 5IY5C 2WZFA 4JW1A 2NUTA 1SF8A 1OCCC 1NU9C 2WVQA 4G7OF 2A68F 2G62A 2J9UA 3OEOA 3EGXA 3NYMA 4KNWA 1MMGA 3AG2C 3KH2A 3ZG1A 2WL8A 4YT8A 4RBNA 2YZSA 3LLIA 1IW7F 4U5GA 2ZXPA 3EH1A 1MNEA 5DQTA 3NYLA 2YEVA 3I5QA 2L81A 2NUPB 3UNGC 5BUOA 1D0YA 2KQ9A 5B3SC 1SMYF 2V26A 2Y3GA 4CS8C 3I4UA 4PJLA 4OINF 4PJJA 2R7WA 1OKKA 3I5PA 2IXMA 2XSEA 4J32B 2WB7A 3JT1A 5DS5A 3W2VA 1ZHTA 1ZHZA 3JCUQ 2XRHA 4NY3A 4YWQA 2A1DD 1LS1A 1NZEA 2C03A 1FTSA 3F46A 4K0DA 2IXOA 4JVSA 3CQZA 4ZLCA 4FESA 5KYYB 3DAFA 4LLEA 4IJJA 2KGOA 3DAGA 4PFOA 4PFPA 3MLGA 1LVKA 2DYSC 3HLZA 4HFFB 3NKDA 4BJ1A 3V7OA 2CDQA 3JYHA 3Q7GA 4U5BE 3AQCA 2A6HF 3UMHA 4GEHA 3EG9A 3LEVA 2R7XA 2FGYA 2NG1A 3E9VA 4QI2A 1BR4A 5KYWA 2A6EF 3NDBB 2PX3A 3ECSA 4JJGA 3S28A 2Y3BA 4OD5A 2MWQA 3UGOA 5KYYA 4BJ6C 3NKEA 4N06A 3EJNA 4AE4A 4CS9A 3WODF 2W4BA 3N0TA 3DJUB 2Z15A 3S27A 2Q3TA 2Q9CA 1D1BA 4FWVA 1Z5ZA 2YHSA 2J9VA 1M2VB 3FAJA 3LJBA 2W4MA 2Q9BA 3EH2A 5DS4A 3EGDB 3K7DA 1W2WA 2PP4A 3EFOA 4IWBA 1MMNA 3UGPA 3TD7A 4KBLA 4XLPF 5F5HA 4PJMA 4QI0A 3HTKC 3UMIA 5EHHA 4I1OB 3X1OA 5CI9A 1D1AA 3LLKA 2J7PA 2QY9A 3ZSUA 3T4RA 2H7VC 5T3WA 3GANA 4RD9A 1FMWA 4O79A 4U5CE 3EPVA 4YT5A 2P7VA 1QLEC 2O9XA 3N24A 1ZHYA 4C7OB 1ZHWA 1M57C 3X2QC 4G0HA 4G7ZF 5KYNA 2Q9AA 2J46A 4XTKA 1TWAA 3O39A 5E3CA 2PF4E 2QTVA 3LESA 3NYJA 3DJNB 1N1CA 2R7SA 2Y69C 4LERA 2EIMC 1PD0A 4DBRA 2R7UA 3QMKA 4JJFA 1V54C 4PJNA 2D5RB 2FFHA 4M63A 2P6VA 4BJ5C 1ZYRF 1Z6AA 4PK4A 3ASNC 3K66A 3EQLF 1Z63A 4YN0B 2Y3HA 3EHMA 4BJ6A 3B9QA 3DM9B 1VK5A 3LS1A 1RJ9B 5DVWA 4J30B 3Q6NA 2J45A 2NUPA 4ANJA 3VAYA 5L3VA 1TWCA 3ABLC 3IEEA 5KYXB 3OWTA 4RDAA 2ZXWC 5CI8A 2BE5F 3ASOC 5KYUB 3E70C 2E87A 4HEAJ 1TKNA 3CSKA 3Q7LA 2GFHA 1FMVA 3UMKA 4OIRF 1LKXA 2VB6A 4O6NA 5E3AA 4DVYP 1RJ9A 2EIJC 5B1AC 1O87A 4GYTA 1KU2A 3F47A 2R7VA 2X51A 1D0XA 2I8BA 3SP1A 2WVOA 3AG4C 2A69F 5T3TA 3SZRA 4C3EA 4X0RA 1D1CA 4WJ0A 4ULWA 2R7QA 4U5DE 1VYKA 1TWHA 3DMDA 3S29A 3SYNA 4CIHA 2EIKC 2HV7A 4K7BA 4C3BA 1D0ZA 2IXNA 2CNWD 1TWGA 5FCLA 2DYRC 2KW3C 2IYLD 3FHDA 4U5FE 5E2QA 3K6BA 5HSWA 2Y3DA 1VMAA 3M1CB 5D92A 4HE8D 4JURI 1ZU4A 3LNRA 5E33A 4Q7CA 3QZCA 4C3DA 1J8YF 1NG1A 2J0WA 4IAOA 3RFYA 4MQ9F 3RYLA 3KKBA 2M4EA 2KJGA 4LLCA 4IRUA 1M2VA 4EBBA 2L9JA 3K1IC 3LAYA 4CS8A 3W8IA 2OG2A 2W9YA 4BG0A 3K1HA 3EGXB 3SEOA 1J8MF 1PCXA 2PX0A 3B0UX 3EGDA 2HV6A 1QZXA 4I1MA 2G3VA 4KI2A 2ZPAA 3ITFA 2CW0F 2OCCC 4CSAC 4OD4A 1M56C 3L34A 3JRTA 3MX3A 1MNDA 3JSZA 4E7ZA 3B0PA 4CS7A 2XXAB 3N2ZB 2B0JA 3NG1A 3ABMC 4A2NB 4CS9C 1NU7D 4W8KA 1O5HA 2EINC 3DXJF 1TR2A 1ZU5A 2H7BA 2J9WA 4U5EE 3WG7C 3AG1C 3FVYA 4OIPF 4CBEA 1BR1A 2MYSA 4FX5A 4H4KC 4Q4ZF 4C7OA 1M2OA 4BEJA 3L0IA 1PD1A 1VYIA 3S0XA 1OKKD 2XXAA 3EHNA 5EGYA 1Z23A 2ZXOA 4OIOF 2IXPA 4AK9A 4ZLDA 2G3KA 2PFDA 2EILC 3EZHA 3AG3C 4I44A 2KNHA 1JPNA 1SZIA 3RKOF 2ZXRA 3UR3C 3ZIBA 4DOZA 5B1BC 1S7ZA 3GODA 1BR2A 3AQBA 4JCHA 5T1DB 4DBQA 1IZMA 1FFTC 4QDLA 2R7RA 3O6XA 4O6YA 2H7OA 5F5FA 4E7SA 1OCOC 4BJTA 3EG9B 4KC9A 1WGWA 2IOQA 3OA1A 4EWCA 4KNVA 3ABKC 5KYWB 4DVZA 3FDQA 2WVNA 3PMRA 3B0VC 4I3MA 1Z3IX 5DLJA 4P6IC 4XWJA 5D91A 3K33A 3HJCA 4HFKB 4AE4B 3VYWA 4OIQF 2VH3A 3KMIA 3POVA 3DM5A 1OCRC 3LS0A 5KYXA 4F4BA 1FFHA 3KL4A 3RIPA 3NRHA 4MNDA 3ZC4A 5KYUA 3PHF2 4YJWA 1VOMA 3DD7A 4CSAA 3SNHA 2WZLA 2VASA 4YT4A 3EFOB 3T6JA 3EZIA 2XL4A 2C04A 4B6IA 4G7HF 3CZ6A 3W8HA 2W45A 4O7GA 2WZGA 2R7OA 1V55C 4JZAA 3T6BA 3DZAA 4LACB 2CNWA 2NUTB 5L3QA 2Y39A 1OCZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZIB A;  4HFF B;  4J30 B;  4B6I A;  4AX2 A;  4JUR I;  4HFK B;  4J32 B; 
#chains in the Genus database with same CATH topology
 1MMA A;  3H65 A;  1V74 B;  4O6M A;  4YT2 A;  3Q6M A;  3V5X A;  4ER9 A;  2J7P D;  2FAP B;  4Q5S F;  4BJ5 A;  2R7T A;  2DGJ A;  3RH3 A;  1MMD A;  2V3C C;  2OKU A;  3U0C A;  2GWW A;  1A7E A;  4U5H A;  3SYN A;  5DQZ A;  3ZQV A;  1GS9 A;  5DS6 A;  4XLN F;  1JPJ A;  1WAS A;  4AX2 A;  4E17 A;  1DOV A;  2JD3 A;  3DE8 A;  5A6A A;  2CGE A;  2LSE A;  3W2W A;  2J0X A;  3ZVR A;  1TQG A;  5EK0 A;  1G8X A;  1ST6 A;  1ZHX A;  2GAQ A;  1DOW A;  5BQH A;  5A6B D;  1BBH A;  2YQY A;  1QPU A;  5IY5 C;  2WZF A;  4JW1 A;  1YJG A;  2NUT A;  1SF8 A;  2VCB A;  1OCC C;  2YVK A;  1NU9 C;  4MW3 A;  2L6G A;  1G5Z A;  4CIH A;  2WVQ A;  2NSF A;  4G7O F;  4DRI B;  2A68 F;  1JAF A;  4MTO A;  2QE9 A;  2G62 A;  1YA7 O;  2AVK A;  3RVZ A;  3QVY A;  1QKR A;  1YZA A;  4WGZ A;  2J9U A;  4CX9 A;  3OEO A;  3EGX A;  3NYM A;  1NLX A;  2YLD A;  4KNW A;  1MMG A;  2OEX A;  3S84 A;  3AG2 C;  3KH2 A;  4MVU A;  2WL8 A;  3ZG1 A;  4RBN A;  4YT8 A;  1Y4C A;  3S27 A;  2M64 A;  3MBG A;  3WAQ A;  2EPM X;  2YZS A;  3C18 A;  3LLI A;  3JRM O;  256B A;  3LEO A;  4NC3 A;  1IW7 F;  2HUJ A;  2J8W A;  2LFD A;  3FOP A;  4U5G A;  3QVZ A;  2ZXP A;  3EH1 A;  1MNE A;  1T6I A;  1CGO A;  1C03 A;  1HW2 A;  1LM3 B;  1AEP A;  4J7T A;  5DQT A;  3NYL A;  2YEV A;  2VC9 A;  1NFO A;  3G4Z A;  3JTL O;  1C17 M;  1GQA A;  3I5Q A;  4R32 A;  2UUI A;  2L81 A;  2NUP B;  1WAT A;  3UNG C;  5BUO A;  1D0Y A;  2Q4F A;  2KQ9 A;  5B3S C;  4WAB A;  1SMY F;  2V26 A;  2Y3G A;  1MQV A;  4CS8 C;  3I4U A;  3FAP B;  4PJL A;  4PJJ A;  1A7V A;  4OIN F;  2Q7R A;  2R7W A;  1OKK A;  3I5P A;  1CGM E;  1YDI A;  2IXM A;  2XSE A;  4J32 B;  2WB7 A;  1YVI A;  1SYQ A;  3JT1 A;  1TFO B;  1OW8 A;  1OR2 A;  4P9T A;  5HV9 A;  3B71 A;  5DS5 A;  1KTM A;  4NTF A;  3W2V A;  1ZHT A;  1R5I D;  3AOU A;  1ZHZ A;  3JCU Q;  2XRH A;  4NY3 A;  4YWQ A;  2A1D D;  1LS1 A;  1NZE A;  2C03 A;  1FTS A;  2KYH A;  3F46 A;  4K0D A;  2IXO A;  3IHU A;  3CQZ A;  4JTD B;  4JVS A;  4BPM A;  4Z9H A;  2YKZ A;  3C8G A;  3JSE O;  4FES A;  4ZLC A;  5KYY B;  2RSE B;  3DAF A;  4LLE A;  3QW1 A;  3LNM B;  4IJJ A;  2KGO A;  3DAG A;  4PFO A;  4PFP A;  1KNY A;  3MLG A;  5COF A;  1LVK A;  2DYS C;  2GA0 A;  3HLZ A;  3NKD A;  4HFF B;  1E85 A;  4BJ1 A;  3V7O A;  2CDQ A;  1A41 A;  4H54 A;  4IB4 A;  4E18 A;  1CGN A;  3BEH A;  3K1I A;  3JYH A;  1LS4 A;  3Q7G A;  4U5B E;  3TJ6 A;  4W8K A;  1RKE B;  2GDC A;  3AQC A;  2A6H F;  3UMH A;  2EPO A;  4GEH A;  2EPN A;  3EG9 A;  3LEV A;  2R7X A;  2FGY A;  1YYX A;  2NG1 A;  2XLW A;  4CDV A;  3AGT A;  3E9V A;  1BR4 A;  4JRZ A;  2X0C A;  5KYW A;  1HMO A;  1NBB A;  2A6E F;  3NDB B;  4QI2 A;  1OQC A;  3RW0 A;  1WN0 A;  2VCA A;  4NCQ A;  4CDY A;  2PX3 A;  3ECS A;  4JJG A;  3GEI A;  1B68 A;  2B0H A;  2MWQ A;  2Y3B A;  4MVS A;  4OD5 A;  1LE4 A;  3S28 A;  5KYY A;  3UGO A;  2A0B A;  2OEV A;  2BL2 A;  4BJ6 C;  4LDQ A;  3NKE A;  4N06 A;  1QSP A;  3TOL A;  2XLM A;  3EJN A;  4E0H A;  2YL0 A;  4EIY A;  4AE4 A;  4CS9 A;  1VTM P;  1O3U A;  3WOD F;  3T9O A;  2W4B A;  1U6H A;  1HMD A;  3R7C A;  2R25 A;  2EPK X;  2Z15 A;  3DJU B;  3N0T A;  2Q3T A;  2Q9C A;  3QTH A;  1D1B A;  3GWL A;  1Z5Z A;  3GWN A;  4FWV A;  4XPY A;  2YHS A;  2J9V A;  1M2V B;  3HNL A;  5COM A;  1A0B A;  2LFF A;  3U5S A;  3HNJ A;  4JKV A;  4D4N A;  2BC5 A;  5L0J A;  1AUE A;  1E83 A;  3VF0 A;  3FAJ A;  1T5O A;  3LJB A;  2P61 A;  2W4M A;  1CPQ A;  4JIO A;  2Q9B A;  1GM5 A;  4MVZ A;  3EH2 A;  5DS4 A;  2PBE A;  1YZC A;  3U2M A;  1VLT A;  2XM0 A;  1K04 A;  3C8Z A;  3EGD B;  3K7D A;  3V5Z A;  1W2W A;  2XLE A;  2RD9 A;  4EBJ A;  2PP4 A;  3EFO A;  4IWB A;  1MMN A;  3UGP A;  3RQG A;  3TD7 A;  1FAP B;  4KBL A;  3V5Y A;  3ZTZ A;  4XLP F;  1T6U A;  1S05 A;  1LI7 A;  3HKK A;  5L3Q A;  2HJM A;  4YK5 A;  4PJM A;  5F5H A;  3QW0 A;  4QI0 A;  2NSG A;  3HTK C;  3UMI A;  1PV3 A;  2ETS A;  3O55 A;  3US6 A;  5EHH A;  2LD6 A;  5TJ5 E;  4D4X A;  3MYF A;  1I4Y A;  3RQE A;  3S90 A;  2JX0 A;  4I1O B;  3X1O A;  3U2L A;  2XLV A;  5L0I A;  5CI9 A;  1D1A A;  3LLK A;  4N6C A;  4CDA A;  2J7P A;  2QY9 A;  4NTB A;  3ZSU A;  3T4R A;  2H7V C;  1L7C A;  5T3W A;  2YLI A;  2OU6 A;  3GAN A;  3FMS A;  4JTA B;  4RD9 A;  1ZW3 A;  1VB5 A;  1FMW A;  1T9K A;  4O79 A;  4U5C E;  1ORJ A;  3EPV A;  4YT5 A;  2P7V A;  1QLE C;  2O9X A;  1RMV A;  2R9R B;  3N24 A;  4NTA A;  1ZHY A;  4C7O B;  4JEA A;  2I15 A;  1XZP A;  1ZHW A;  4G78 A;  5JT4 A;  1M57 C;  1Q0K A;  5A6B A;  3X2Q C;  4G0H A;  4G7Z F;  4PR9 A;  3NMK A;  5KYN A;  5AGF A;  2Q9A A;  1U89 A;  5JLI A;  4EHP A;  3J06 A;  2EPL X;  2J46 A;  1TWA A;  4XTK A;  4AL1 A;  3O39 A;  5E3C A;  2PF4 E;  2QTV A;  3HNK A;  3DKA A;  1Y6D A;  3LES A;  3NYJ A;  3DJN B;  4U9E A;  3IQ5 A;  1N1C A;  2R7S A;  2Y69 C;  4LER A;  3TK0 A;  2EIM C;  1PD0 A;  4DBR A;  2R7U A;  3TQO A;  3QMK A;  3ZDL A;  3G4X A;  1V54 C;  4JJF A;  4PJN A;  2D5R B;  5L0G A;  1SR2 A;  2FFH A;  4M63 A;  2P6V A;  4P9F A;  1YLM A;  3NMJ A;  5L0H A;  1YYJ A;  3U9J A;  3VRC A;  1ZYR F;  4U9D A;  4BJ5 C;  1Z6A A;  4PK4 A;  3U8P A;  3M79 A;  3AGU A;  3ASN C;  1BDJ B;  2XS8 A;  2YLG A;  3K66 A;  1E84 A;  3EQL F;  3GM3 A;  5JS5 A;  3S9O A;  1Z63 A;  4YN0 B;  1AVO B;  2Y3H A;  2IM8 A;  3EHM A;  4MVO A;  2XLH A;  1C02 A;  3B9Q A;  4BJ6 A;  1HE9 A;  3M4B A;  3U3B A;  1OXB A;  3DM9 B;  4JE9 A;  5CIV A;  3PDM P;  3CEX A;  1VK5 A;  3LS1 A;  2L6F A;  1E86 A;  1VLS A;  3C63 A;  2HSQ A;  2UUH A;  1RJ9 B;  2AP3 A;  5DVW A;  3VM6 A;  4J30 B;  5A6K A;  2CYD A;  3Q6N A;  3RVY A;  2J45 A;  2NUP A;  4ANJ A;  4IAR A;  5K0I A;  3VAY A;  1RCP A;  5L3V A;  1TWC A;  3ABL C;  3IEE A;  3T6G B;  5L0D A;  5KYX B;  2DB4 A;  3OWT A;  3ZWI A;  4RDA A;  2ZXW C;  5CI8 A;  1EA8 A;  1CPR A;  1M6T A;  2BE5 F;  3ASO C;  2F22 A;  5KYU B;  3E70 C;  2E87 A;  4HEA J;  4N6H A;  4MVM A;  5A6J A;  2J9B A;  1WWP A;  1TKN A;  2JPU A;  3CSK A;  3Q7L A;  2LQG A;  1QVX A;  2HZ8 A;  2GFH A;  4LDK A;  1FMV A;  1YAU O;  3UMK A;  3KPH A;  3MYI A;  1LKX A;  2VB6 A;  4O6N A;  4XEV A;  5E3A A;  4OIR F;  1RJ9 A;  2EIJ C;  3AJM A;  4MS2 A;  5B1A C;  4DVY P;  1UG7 A;  1O87 A;  4GYT A;  1KU2 A;  3F47 A;  5A69 A;  2R7V A;  1T6Q A;  2HSB A;  2X51 A;  1D0X A;  2I8B A;  3SP1 A;  2AWY A;  2WVO A;  2A69 F;  1ORY A;  3AG4 C;  5T3T A;  3SZR A;  4C3E A;  3C7J A;  1WOL A;  1D1C A;  4X0R A;  4NQF A;  4WJ0 A;  2XL8 A;  1F1M A;  2YL3 A;  3LUT B;  4ULW A;  2R7Q A;  4MTG A;  1VYK A;  1TWH A;  1HE1 A;  2P1A A;  3DMD A;  4U5D E;  4Z9I A;  4ULV A;  1L3P A;  2EIK C;  3S29 A;  3TJ5 A;  3C62 A;  2HV7 A;  1GGQ A;  3H2U A;  3IQT A;  4CJO A;  4K7B A;  4C3B A;  1D0Z A;  2HKV A;  2IXN A;  3U8V A;  1UFB A;  4XEK A;  1RKE A;  2CNW D;  1XWJ A;  2HJ3 A;  3FOO A;  1TWG A;  2P0N A;  5FCL A;  2DYR C;  2HMQ A;  3TUL A;  1JRA A;  2Q00 A;  3GM2 A;  2KW3 C;  2IYL D;  5L0C A;  3KYJ A;  3FHD A;  3SXY A;  4U5F E;  3MFN A;  5E2Q A;  1T01 A;  3FXH A;  3M15 A;  3GEH A;  3KYI A;  3K6B A;  4JCZ A;  5JSL A;  2R05 A;  5JUA A;  2Y3D A;  5HSW A;  1ZZP A;  1Q0G A;  1VMA A;  3M1C B;  1I5N A;  3NMI A;  4HE8 D;  5D92 A;  5F28 E;  4JUR I;  1ZU4 A;  1V4A A;  2OQM A;  3LNR A;  5E33 A;  4DRJ B;  4Q7C A;  3QZC A;  4C3D A;  2CCY A;  2AWC A;  1J8Y F;  3L8I A;  3U3F A;  1TFK B;  1LE2 A;  1NG1 A;  2J0W A;  2VCC A;  3SXZ A;  4IAO A;  3RFY A;  3GM1 A;  4JC7 A;  4MQ9 F;  4CJG A;  4XEF A;  3RYL A;  3SXK A;  3KKB A;  2M4E A;  1YA9 A;  2KJG A;  2KC3 A;  4YL1 A;  4LLC A;  4Z9J A;  1A7D A;  2OOC A;  4JTC B;  4IRU A;  4AL0 A;  1M2V A;  4EKW A;  1R4T A;  2QLA A;  1WTY A;  3GEE A;  1OW7 A;  1RXQ A;  4EBB A;  1FR0 A;  3G50 A;  3JZ0 A;  2AU5 A;  2L9J A;  3W4Y A;  3K1I C;  2YRF A;  3DI5 A;  3LAY A;  4CS8 A;  3W8I A;  2L7A A;  2OG2 A;  4IGG A;  2W9Y A;  1U0B B;  4BG0 A;  3K1H A;  1JMW A;  1K40 A;  3EGX B;  3SEO A;  1J8M F;  1PCX A;  2PX0 A;  3A11 A;  2QUP A;  3EGD A;  3ZTM A;  1FNT c;  3WHN A;  3B0U X;  2HV6 A;  2HMZ A;  1QZX A;  1ZW2 A;  2HS5 A;  4I1M A;  2G3V A;  2KSF A;  4E0I A;  3L1M A;  2LP4 A;  4KI2 A;  2ZPA A;  3ITF A;  1JR8 A;  2CW0 F;  2OCC C;  4CSA C;  4OD4 A;  1M56 C;  1Z7Q c;  3L34 A;  2L6H A;  3JRT A;  3MX3 A;  1MND A;  3JSZ A;  4E7Z A;  3B0P A;  2DI3 A;  4CS7 A;  2XXA B;  4XPW A;  4MVR A;  3N2Z B;  3DWW A;  1LPE A;  1XZQ A;  3O10 A;  2B0J A;  4CIP A;  1LI5 A;  3NG1 A;  3ABM C;  4A2N B;  4CS9 C;  1ZVZ A;  1NU7 D;  1G4U S;  1O5H A;  1APC A;  2EIN C;  1TR2 A;  1ZU5 A;  3DXJ F;  1H9G A;  2H7B A;  2J9W A;  3CAX A;  3HNI A;  4U5E E;  5BQG A;  3TOM A;  4DRH B;  5JVE A;  3WG7 C;  4IAQ A;  3RF3 A;  3AG1 C;  2NPU A;  1Q0D A;  3FVY A;  3IPM O;  4PAC A;  5BQI A;  1H9T A;  4OIP F;  5AC5 A;  4CBE A;  1RKC A;  1BR1 A;  2MYS A;  3R2P A;  3JYY A;  4FX5 A;  4H4K C;  4Q4Z F;  2PNO A;  5B3I A;  4C7O A;  4EBK A;  1NFN A;  1M2O A;  4BEJ A;  3L0I A;  1PD1 A;  4YL3 A;  1VYI A;  3U9M A;  3S0X A;  1OKK D;  2XLD A;  4ONS A;  4W8P A;  2XXA A;  2R03 A;  3EHN A;  3ZQY A;  1QQ3 A;  5EGY A;  1Z23 A;  2ZXO A;  1BZ4 A;  4OIO F;  2IXP A;  4AK9 A;  4ZLD A;  2G3K A;  2PFD A;  2EIL C;  1NSG B;  3EZH A;  3AG3 C;  2XLO A;  2KNH A;  4I44 A;  5COG A;  5JP7 A;  1JPN A;  1SZI A;  3C8G B;  2ZXR A;  3RKO F;  3UR3 C;  3ZIB A;  4DOZ A;  2QNL A;  5B1B C;  5JRA A;  1S7Z A;  1LIH A;  3M4C A;  3GOD A;  1BR2 A;  1EI7 A;  2IBF A;  3C8G D;  1HY5 A;  2MHR A;  3AQB A;  4JCH A;  5T1D B;  4DXW A;  4UDV A;  3BRJ A;  3PCV A;  3SXM A;  1I4Z A;  4DBQ A;  1IZM A;  1FFT C;  4QDL A;  2R7R A;  3O6X A;  4O6Y A;  2H7O A;  5F5F A;  2TMV P;  4E7S A;  1OCO C;  1Q0M A;  2A0U A;  4BJT A;  3EG9 B;  1E2X A;  2ASR A;  4KC9 A;  1WGW A;  2IOQ A;  1OR3 A;  1YAR O;  4DJ9 A;  3OA1 A;  5AC4 A;  4EWC A;  4KNV A;  3ABK C;  5KYW B;  2OJE D;  4BEM J;  4DVZ A;  1EKY A;  3FDQ A;  1Q0F A;  1G4W R;  2WVN A;  3PMR A;  4GQH A;  4XQ1 A;  3B0V C;  4I3M A;  1Z3I X;  2D4U A;  5DLJ A;  4P6I C;  4XWJ A;  5D91 A;  3ATP A;  3K33 A;  1K05 A;  4MW8 A;  3B29 A;  3HJC A;  4HFK B;  1OW6 A;  2XM4 A;  2YWA A;  1H7I A;  4AE4 B;  5L0F A;  3VYW A;  4OIQ F;  3H2V A;  1ORS C;  2XL6 A;  2VH3 A;  2OJQ A;  3KMI A;  3DM5 A;  3POV A;  1OCR C;  3IQ6 A;  4K1O A;  2XS1 A;  2LIG A;  3IQC A;  3LS0 A;  4WGY A;  5KYX A;  4F4B A;  2R02 A;  1FFH A;  3KL4 A;  4LDR A;  3RIP A;  2ICW G;  2KK1 A;  3NRH A;  4MND A;  5GPG B;  3ZC4 A;  4XPX A;  5KYU A;  4N4W A;  4A4A A;  3PHF 2;  4YJW A;  1VOM A;  3DD7 A;  4J7Y A;  4CSA A;  1EQ1 A;  4JEB A;  3A9C A;  2WZL A;  3L8J A;  3SNH A;  2VAS A;  4MVQ A;  2LK4 A;  4MTF A;  4YT4 A;  3EFO B;  2YL1 A;  4L6R A;  3T6J A;  3EZI A;  1H6G A;  4EUK B;  2XL4 A;  2C04 A;  4B6I A;  4G7H F;  1HW1 A;  3CZ6 A;  3W8H A;  2W45 A;  3DE9 A;  4O7G A;  2ZD9 A;  2YL7 A;  2WZG A;  3GOR A;  1OXK A;  4FAP B;  2R7O A;  1V55 C;  2H8A A;  4JZA A;  3T6B A;  3DZA A;  2LCH A;  4LAC B;  3RQF A;  4YL0 A;  1JOG A;  2CNW A;  2NUT B;  5FZT A;  2HFI A;  2Y39 A;  1OCZ C; 
#chains in the Genus database with same CATH homology
 1MMA A;  3H65 A;  4O6M A;  4YT2 A;  3Q6M A;  2J7P D;  2R7T A;  4Q5S F;  4BJ5 A;  2DGJ A;  3RH3 A;  1MMD A;  2V3C C;  5DQZ A;  4U5H A;  5DS6 A;  4XLN F;  1JPJ A;  4AX2 A;  2JD3 A;  2CGE A;  2LSE A;  3W2W A;  2J0X A;  3ZVR A;  1G8X A;  1ST6 A;  1ZHX A;  5IY5 C;  2WZF A;  4JW1 A;  2NUT A;  1SF8 A;  1OCC C;  1NU9 C;  2WVQ A;  4G7O F;  2A68 F;  2G62 A;  2J9U A;  3OEO A;  3EGX A;  3NYM A;  4KNW A;  1MMG A;  3AG2 C;  3KH2 A;  3ZG1 A;  2WL8 A;  4YT8 A;  4RBN A;  2YZS A;  3LLI A;  1IW7 F;  4U5G A;  2ZXP A;  3EH1 A;  1MNE A;  5DQT A;  3NYL A;  2YEV A;  3I5Q A;  2L81 A;  2NUP B;  3UNG C;  5BUO A;  1D0Y A;  2KQ9 A;  5B3S C;  1SMY F;  2V26 A;  2Y3G A;  4CS8 C;  3I4U A;  4PJL A;  4OIN F;  4PJJ A;  2R7W A;  1OKK A;  3I5P A;  2IXM A;  2XSE A;  4J32 B;  2WB7 A;  3JT1 A;  5DS5 A;  3W2V A;  1ZHT A;  1ZHZ A;  3JCU Q;  2XRH A;  4NY3 A;  4YWQ A;  2A1D D;  1LS1 A;  1NZE A;  2C03 A;  1FTS A;  3F46 A;  4K0D A;  2IXO A;  4JVS A;  3CQZ A;  4ZLC A;  4FES A;  5KYY B;  3DAF A;  4LLE A;  4IJJ A;  2KGO A;  3DAG A;  4PFO A;  4PFP A;  3MLG A;  1LVK A;  2DYS C;  3HLZ A;  4HFF B;  3NKD A;  4BJ1 A;  3V7O A;  2CDQ A;  3JYH A;  3Q7G A;  4U5B E;  3AQC A;  2A6H F;  3UMH A;  4GEH A;  3EG9 A;  3LEV A;  2R7X A;  2FGY A;  2NG1 A;  3E9V A;  4QI2 A;  1BR4 A;  5KYW A;  2A6E F;  3NDB B;  2PX3 A;  3ECS A;  4JJG A;  3S28 A;  2Y3B A;  4OD5 A;  2MWQ A;  3UGO A;  5KYY A;  4BJ6 C;  3NKE A;  4N06 A;  3EJN A;  4AE4 A;  4CS9 A;  3WOD F;  2W4B A;  3N0T A;  3DJU B;  2Z15 A;  3S27 A;  2Q3T A;  2Q9C A;  1D1B A;  4FWV A;  1Z5Z A;  2YHS A;  2J9V A;  1M2V B;  3FAJ A;  3LJB A;  2W4M A;  2Q9B A;  3EH2 A;  5DS4 A;  3EGD B;  3K7D A;  1W2W A;  2PP4 A;  3EFO A;  4IWB A;  1MMN A;  3UGP A;  3TD7 A;  4KBL A;  4XLP F;  5F5H A;  4PJM A;  4QI0 A;  3HTK C;  3UMI A;  5EHH A;  4I1O B;  3X1O A;  5CI9 A;  1D1A A;  3LLK A;  2J7P A;  2QY9 A;  3ZSU A;  3T4R A;  2H7V C;  5T3W A;  3GAN A;  4RD9 A;  1FMW A;  4O79 A;  4U5C E;  3EPV A;  4YT5 A;  2P7V A;  1QLE C;  2O9X A;  3N24 A;  1ZHY A;  4C7O B;  1ZHW A;  1M57 C;  3X2Q C;  4G0H A;  4G7Z F;  5KYN A;  2Q9A A;  2J46 A;  4XTK A;  1TWA A;  3O39 A;  5E3C A;  2PF4 E;  2QTV A;  3LES A;  3NYJ A;  3DJN B;  1N1C A;  2R7S A;  2Y69 C;  4LER A;  2EIM C;  1PD0 A;  4DBR A;  2R7U A;  3QMK A;  4JJF A;  1V54 C;  4PJN A;  2D5R B;  2FFH A;  4M63 A;  2P6V A;  4BJ5 C;  1ZYR F;  1Z6A A;  4PK4 A;  3ASN C;  3K66 A;  3EQL F;  1Z63 A;  4YN0 B;  2Y3H A;  3EHM A;  4BJ6 A;  3B9Q A;  3DM9 B;  1VK5 A;  3LS1 A;  1RJ9 B;  5DVW A;  4J30 B;  3Q6N A;  2J45 A;  2NUP A;  4ANJ A;  3VAY A;  5L3V A;  1TWC A;  3ABL C;  3IEE A;  5KYX B;  3OWT A;  4RDA A;  2ZXW C;  5CI8 A;  2BE5 F;  3ASO C;  5KYU B;  3E70 C;  2E87 A;  4HEA J;  1TKN A;  3CSK A;  3Q7L A;  2GFH A;  1FMV A;  3UMK A;  4OIR F;  1LKX A;  2VB6 A;  4O6N A;  5E3A A;  4DVY P;  1RJ9 A;  2EIJ C;  5B1A C;  1O87 A;  4GYT A;  1KU2 A;  3F47 A;  2R7V A;  2X51 A;  1D0X A;  2I8B A;  3SP1 A;  2WVO A;  3AG4 C;  2A69 F;  5T3T A;  3SZR A;  4C3E A;  4X0R A;  1D1C A;  4WJ0 A;  4ULW A;  2R7Q A;  4U5D E;  1VYK A;  1TWH A;  3DMD A;  3S29 A;  3SYN A;  4CIH A;  2EIK C;  2HV7 A;  4K7B A;  4C3B A;  1D0Z A;  2IXN A;  2CNW D;  1TWG A;  5FCL A;  2DYR C;  2KW3 C;  2IYL D;  3FHD A;  4U5F E;  5E2Q A;  3K6B A;  5HSW A;  2Y3D A;  1VMA A;  3M1C B;  5D92 A;  4HE8 D;  4JUR I;  1ZU4 A;  3LNR A;  5E33 A;  4Q7C A;  3QZC A;  4C3D A;  1J8Y F;  1NG1 A;  2J0W A;  4IAO A;  3RFY A;  4MQ9 F;  3RYL A;  3KKB A;  2M4E A;  2KJG A;  4LLC A;  4IRU A;  1M2V A;  4EBB A;  2L9J A;  3K1I C;  3LAY A;  4CS8 A;  3W8I A;  2OG2 A;  2W9Y A;  4BG0 A;  3K1H A;  3EGX B;  3SEO A;  1J8M F;  1PCX A;  2PX0 A;  3B0U X;  3EGD A;  2HV6 A;  1QZX A;  4I1M A;  2G3V A;  4KI2 A;  2ZPA A;  3ITF A;  2CW0 F;  2OCC C;  4CSA C;  4OD4 A;  1M56 C;  3L34 A;  3JRT A;  3MX3 A;  1MND A;  3JSZ A;  4E7Z A;  3B0P A;  4CS7 A;  2XXA B;  3N2Z B;  2B0J A;  3NG1 A;  3ABM C;  4A2N B;  4CS9 C;  1NU7 D;  4W8K A;  1O5H A;  2EIN C;  3DXJ F;  1TR2 A;  1ZU5 A;  2H7B A;  2J9W A;  4U5E E;  3WG7 C;  3AG1 C;  3FVY A;  4OIP F;  4CBE A;  1BR1 A;  2MYS A;  4FX5 A;  4H4K C;  4Q4Z F;  4C7O A;  1M2O A;  4BEJ A;  3L0I A;  1PD1 A;  1VYI A;  3S0X A;  1OKK D;  2XXA A;  3EHN A;  5EGY A;  1Z23 A;  2ZXO A;  4OIO F;  2IXP A;  4AK9 A;  4ZLD A;  2G3K A;  2PFD A;  2EIL C;  3EZH A;  3AG3 C;  4I44 A;  2KNH A;  1JPN A;  1SZI A;  3RKO F;  2ZXR A;  3UR3 C;  3ZIB A;  4DOZ A;  5B1B C;  1S7Z A;  3GOD A;  1BR2 A;  3AQB A;  4JCH A;  5T1D B;  4DBQ A;  1IZM A;  1FFT C;  4QDL A;  2R7R A;  3O6X A;  4O6Y A;  2H7O A;  5F5F A;  4E7S A;  1OCO C;  4BJT A;  3EG9 B;  4KC9 A;  1WGW A;  2IOQ A;  3OA1 A;  4EWC A;  4KNV A;  3ABK C;  5KYW B;  4DVZ A;  3FDQ A;  2WVN A;  3PMR A;  3B0V C;  4I3M A;  1Z3I X;  5DLJ A;  4P6I C;  4XWJ A;  5D91 A;  3K33 A;  3HJC A;  4HFK B;  4AE4 B;  3VYW A;  4OIQ F;  2VH3 A;  3KMI A;  3POV A;  3DM5 A;  1OCR C;  3LS0 A;  5KYX A;  4F4B A;  1FFH A;  3KL4 A;  3RIP A;  3NRH A;  4MND A;  3ZC4 A;  5KYU A;  3PHF 2;  4YJW A;  1VOM A;  3DD7 A;  4CSA A;  3SNH A;  2WZL A;  2VAS A;  4YT4 A;  3EFO B;  3T6J A;  3EZI A;  2XL4 A;  2C04 A;  4B6I A;  4G7H F;  3CZ6 A;  3W8H A;  2W45 A;  4O7G A;  2WZG A;  2R7O A;  1V55 C;  4JZA A;  3T6B A;  3DZA A;  4LAC B;  2CNW A;  2NUT B;  5L3Q A;  2Y39 A;  1OCZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...