4AX2A

New type vi-secreted toxins and self-resistance proteins in serratia marcescens
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
124
Chain Sequence
QGHMAPIQDPVAFIKQMPYHQVVKELALSRCLAQVSDSDKAFSLDAARTANAMREWMPFDIESGDEKINVLIDKYKSRINEFHSKSQGVTLNCLRLYHSPELDKLSRQLIAGNPDRTWNQDNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords RAP1B
publication title New Secreted Toxins and Immunity Proteins Encoded within the Type Vi Secretion System Gene Cluster of Serratia Marcescens
pubmed doi rcsb
source organism Serratia marcescens
total genus 43
structure length 124
sequence length 128
ec nomenclature
pdb deposition date 2012-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ax2A01
4HFKB 4B6IA 4J32B 4AX2A 4J30B 4JURI 3ZIBA 4HFFB
chains in the Genus database with same CATH superfamily
2M4EA 3QW1A 3W2WA 4XTKA 2KQ9A 3U2MA 1QSPA 2IM8A 3RH3A 4N4WA 1OCOC 1UG7A 3VRCA 5JS5A 5HSWA 2ZXPA 4G7ZF 3K6BA 4EIYA 1OKKA 2I8BA 2ICWG 3AG4C 4DXWA 1E84A 3KYJA 4W8PA 2P1AA 2KYHA 4KI2A 4XPXA 1K05A 2WL8A 2XL4A 1LS4A 4O6NA 1D0YA 2OG2A 2MYSA 4NQFA 3FAPB 5T3TA 1DOVA 3WODF 3ASNC 3BEHA 4GEHA 2KJGA 2YLIA 5B3SC 1VTMP 3ZIBA 1TWGA 2NSGA 3FXHA 1RKEA 1Z63A 1MMDA 5KYUA 1BBHA 4MVUA 5D92A 3DE8A 3QW0A 1OKKD 1Q0DA 1YA7O 3GEEA 2KGOA 1Q0MA 2ZXWC 4XEFA 2Y3DA 3SNHA 1T6UA 2GDCA 4AL0A 1Y4CA 3A11A 4LDRA 2HMQA 1EI7A 5JP7A 3X1OA 4C3DA 3H2UA 4GQHA 4JJFA 2GA0A 4CS7A 5F5FA 4C3BA 4N6CA 3F47A 3NDBB 3LLKA 1ZYRF 3U3BA 2EPLX 3DM5A 4I1MA 3EGDB 4J7TA 1M57C 5L0HA 1NG1A 2GWWA 3EGXB 4MVOA 4DVYP 3TJ5A 3MFNA 4OINF 4DJ9A 1RMVA 1ORJA 1TKNA 1T6IA 2AU5A 2Y3GA 4IB4A 3RVZA 3RFYA 3T6JA 3GM2A 3R2PA 1HW2A 4CS9C 4ZLDA 2X51A 2LK4A 2C03A 3ZWIA 1AUEA 3GEIA 4XEVA 5L0GA 1EQ1A 3GEHA 3IQ5A 2TMVP 4XPYA 4CJOA 3EJNA 2WZGA 3RQFA 2A0UA 2OU6A 3EG9B 4IARA 4AE4A 3CAXA 1D1CA 3EFOB 3HTKC 2VCAA 4GYTA 4PJMA 3JRMO 4XEKA 5L0CA 1G8XA 3W2VA 3UR3C 1Z23A 1LIHA 3ABLC 1YZAA 5T3WA 3QMKA 1UFBA 3S27A 1BR4A 4XPWA 4QI2A 3HLZA 2YL3A 2R7VA 1MNDA 2LP4A 4JEBA 2H7OA 3K66A 1G5ZA 3LNRA 1NZEA 2B0HA 2YL0A 3M4CA 3L8IA 3ZTZA 4BEMJ 4CIPA 3ABMC 2YL1A 4IJJA 2EILC 4LACB 4PR9A 2C04A 1LM3B 1XZQA 3AQBA 3C7JA 1NFOA 3NKDA 1BDJB 2L81A 4XLPF 1RJ9B 2EPNA 2LSEA 2NUPB 4JIOA 2LFFA 3NYMA 2XXAB 3EQLF 3VYWA 3PHF2 1QKRA 3T6GB 1SF8A 1QLEC 2B0JA 3IPMO 1M56C 4ULVA 4IWBA 5COMA 1RKCA 4ER9A 2Q9CA 2H7BA 4KBLA 1GQAA 3N2ZB 2XL8A 3B0VC 3KH2A 1ST6A 1FFTC 2EIMC 4H4KC 2Y69C 3PCVA 3J06A 1TWCA 4CJGA 1BZ4A 3VF0A 1OW6A 2ZXOA 4N6HA 3GODA 3R7CA 4CIHA 3EGDA 2A6HF 4E17A 5K0IA 2OOCA 3EGXA 4EBJA 4AK9A 1G4US 2PX3A 4BPMA 3CZ6A 2P0NA 2CDQA 1VYIA 3I5QA 2I15A 2WZLA 4WGZA 3ASOC 1V4AA 3LJBA 1QPUA 2L9JA 4Z9HA 2YLGA 3WG7C 2ZXRA 2KW3C 4CDAA 2YVKA 1OR3A 2IXOA 5COGA 1KTMA 4E0HA 4CSAC 4OIRF 4NCQA 3M4BA 4I1OB 4J32B 2XS1A 3EG9A 4PJJA 4U5CE 1EKYA 2J45A 3AG2C 3N24A 5DS5A 3EFOA 4G78A 5DVWA 1MNEA 1VYKA 1APCA 3O10A 5A6BA 1GS9A 3E70C 4U5HA 4CDYA 2R7UA 2CYDA 2YL7A 4FESA 3UGOA 4K1OA 2QLAA 4YT5A 3X2QC 1U6HA 2EINC 2J9UA 4U5EE 1H6GA 2CNWA 1T5OA 5CI9A 2CCYA 1LE4A 4W8KA 4Z9IA 5KYNA 3C18A 3ZTMA 2JPUA 3M79A 1JR8A 2W4BA 5L0FA 3AQCA 4A4AA 3MYIA 2EIKC 3O6XA 3Q7LA 4JZAA 3FDQA 1A7VA 4IRUA 2Q3TA 4MTGA 2R7TA 5A6BD 2PX0A 2VB6A 3JSZA 1RJ9A 2IXPA 2NUPA 5HV9A 1FMVA 2VH3A 4DOZA 4EUKB 2R7SA 4FX5A 2CNWD 4H54A 4JTAB 3UNGC 4IAOA 3H2VA 4CS8A 1YYXA 2XXAA 3SZRA 4O7GA 2R25A 1GGQA 1TQGA 3CEXA 3HNIA 3TQOA 4HE8D 5F5HA 3LLIA 3U0CA 1ZVZA 1WGWA 3DAFA 2M64A 1M2VB 3UGPA 4KNVA 3K1IA 3G4XA 2HKVA 4JC7A 4YJWA 4I3MA 2Z15A 4MVRA 2JD3A 2YEVA 2LQGA 4RBNA 4DRJB 3L1MA 1GM5A 4Z9JA 4BJ1A 3AJMA 2IOQA 4LLEA 4YK5A 1I4YA 1JPNA 1OW7A 2QNLA 3DWWA 5E3AA 1ZHTA 2GAQA 1Y6DA 3HNLA 3B29A 3HNKA 5JRAA 1FTSA 1HE1A 4U5GA 3OEOA 1PV3A 1RCPA 2R03A 3LS1A 4PJNA 1J8MF 2A1DD 3AGTA 4AL1A 3WAQA 3U3FA 2YKZA 3JTLO 2QTVA 3L0IA 2Q9BA 1OW8A 2XLOA 3SP1A 1I5NA 2OKUA 2XSEA 3LEOA 1ZU5A 4ZLCA 1HY5A 2J9BA 1IZMA 2VCCA 4R32A 1FNTc 2H8AA 4YWQA 3JZ0A 2R7XA 4X0RA 4JCHA 4XQ1A 4O79A 3QZCA 4MW3A 2P61A 3L34A 1TR2A 3RQGA 3GANA 3JT1A 1YYJA 4RD9A 1YJGA 3LUTB 4LDQA 1H9GA 2L6FA 2X0CA 4BG0A 4YL3A 1G4WR 3NMJA 3U8VA 1FMWA 1KU2A 1YARO 5TJ5E 4G7OF 1BR1A 1QZXA 1B68A 1E2XA 1OCCC 3JRTA 1SYQA 4CX9A 3AOUA 1Z3IX 3OA1A 3RIPA 4CS9A 4WJ0A 3GWNA 4BJTA 4L6RA 4BJ6A 3TD7A 3TJ6A 3F46A 2J9VA 2DB4A 3U8PA 2A69F 3LAYA 2Q7RA 3RW0A 5BQHA 4D4XA 3I4UA 1E83A 1WWPA 4E7ZA 2WVQA 4QDLA 2YRFA 2QE9A 3UMIA 1OXBA 1M2VA 3US6A 3NG1A 1VK5A 5COFA 3DI5A 1FAPB 3UMKA 4PFOA 4G7HF 5DQZA 1OXKA 1NU9C 1S7ZA 1WN0A 4O6MA 3DMDA 4J7YA 5DLJA 3GM3A 3LESA 3ECSA 5FCLA 2XL6A 3BRJA 4EBBA 5KYYB 3HNJA 3B71A 2HFIA 2R05A 4BJ5A 4MVQA 2A0BA 2J7PA 1OCRC 2LD6A 4HFKB 5KYWB 1A7DA 4E18A 3QVZA 3A9CA 1JAFA 2A6EF 1XWJA 4XLNF 4C3EA 2EPKX 1A0BA 1YZCA 2WB7A 4JVSA 4JE9A 4C7OB 2AWYA 1O3UA 1SZIA 1QQ3A 2J0WA 3C8GD 1WOLA 2Q4FA 2G3KA 3MX3A 3V5XA 4EBKA 2JX0A 1AEPA 4EKWA 3HJCA 3GWLA 1M2OA 3C63A 1YA9A 3KL4A 3KYIA 1NLXA 1T01A 2J7PD 1ZHXA 4U9EA 2J46A 1L7CA 1ZHWA 3GORA 3Q6NA 3ZC4A 4M63A 4K0DA 1R5ID 4U5DE 2HZ8A 1ZZPA 3LNMB 2XLEA 1LI7A 2KK1A 2VC9A 1OQCA 3FVYA 3JYYA 1YDIA 3EH1A 4K7BA 4KC9A 4OD4A 4P9TA 4EWCA 5D91A 3VAYA 1HMOA 1ORSC 3K7DA 1BR2A 1SMYF 3L8JA 3V5ZA 2AWCA 4YN0B 3FOPA 3JCUQ 3RF3A 3EH2A 1E86A 1CGME 3SXMA 3TOLA 2PF4E 4JJGA 2ZD9A 2EPOA 3OWTA 3SXYA 4PJLA 3DXJF 4IGGA 2Y39A 1SR2A 1MMAA 4KNWA 4OIQF 2ASRA 3KMIA 4JRZA 3ZDLA 1HMDA 3AG1C 4P9FA 1VOMA 1D1AA 2XLWA 3T6BA 4JCZA 1FFHA 4CSAA 3EPVA 5BUOA 5T1DB 2XLHA 2O9XA 1JRAA 2OEXA 1YVIA 2Q9AA 1Z6AA 4G0HA 3CQZA 2R7WA 2QY9A 3S0XA 3I5PA 4OD5A 2R9RB 3PDMP 1ZHYA 2NUTB 2DYSC 3G4ZA 3ITFA 1CGNA 1TFKB 2NG1A 3NMIA 1ORYA 2D4UA 3N0TA 3JYHA 5KYYA 1U0BB 1T6QA 2DI3A 3NYLA 4MW8A 5KYWA 2EIJC 2HUJA 3SXKA 2H7VC 2V26A 4OIPF 3ZSUA 4XWJA 3V5YA 4ULWA 2OQMA 4C7OA 4HFFB 1LKXA 4MNDA 2XM0A 2DYRC 2XS8A 3C8GB 1ZW3A 2IBFA 2J8WA 3B9QA 1RXQA 4PFPA 3O55A 3DKAA 3K1HA 4P6IC 1T9KA 1VLSA 3U9JA 3K1IC 5B3IA 3Q7GA 2IXNA 2OJQA 4PACA 5EHHA 5A69A 5AC5A 1C17M 1D0XA 1D0ZA 1WATA 2G3VA 2XLDA 2EPMX 4U5BE 4YT4A 4A2NB 3T4RA 2RD9A 1HW1A 2ETSA 4MQ9F 3IQCA 1YAUO 3RQEA 3WHNA 5F28E 2AP3A 1Z7Qc 4U5FE 2WVOA 2YLDA 3QVYA 4CBEA 4LERA 3RVYA 2L6HA 4JEAA 4J30B 3LEVA 2KSFA 4HEAJ 4RDAA 3W8IA 3M15A 3O39A 2V3CC 1MMGA 2G62A 4PK4A 1EA8A 1K04A 1PD0A 1A7EA 3DJNB 3Q6MA 5E2QA 5JSLA 3S29A 5DS6A 1M6TA 3DM9B 3W8HA 3IHUA 1CPRA 1HE9A 3CSKA 2PP4A 3QTHA 1LPEA 1JOGA 5A6AA 3FHDA 3IEEA 5A6KA 5JT4A 4Q5SF 2XLMA 2A68F 1YLMA 3EHNA 3FMSA 1WTYA 5L3QA 2QUPA 1ZU4A 4NY3A 1XZPA 4QI0A 1MMNA 4N06A 4WGYA 5B1AC 4B6IA 2OCCC 1DOWA 4MVSA 2P6VA 4I44A 2HSBA 2NUTA 4YT2A 3H65A 4FAPB 4IAQA 3GM1A 1F1MA 4MTOA 4WABA 1S05A 2PNOA 3RKOF 4YL1A 2DGJA 4OIOF 2YQYA 3DJUB 3DAGA 1WASA 3TOMA 5BQGA 2FAPB 2KC3A 4U9DA 1TWAA 4D4NA 2LIGA 2CGEA 2HSQA 1C02A 2MHRA 3B0PA 2HJ3A 3RYLA 4AX2A 5DS4A 4BJ6C 3C8ZA 4DRHB 5DQTA 5A6JA 3MYFA 2VCBA 3JSEO 4JTCB 5JLIA 3C8GA 1V54C 3NMKA 1W2WA 3AG3C 3ZQYA 1O5HA 3M1CB 2R7RA 1N1CA 5L0DA 2OJED 2RSEB 1C03A 3KPHA 1Z5ZA 3SEOA 2YZSA 4F4BA 5FZTA 4Q4ZF 1J8YF 3KKBA 5CI8A 1JMWA 3IQ6A 3NKEA 1VLTA 4NTFA 1NSGB 3DE9A 2R02A 2UUHA 2NPUA 1OR2A 2WZFA 4BJ5C 5KYXB 1KNYA 1JPJA 3HKKA 3MBGA 3B0UX 2J0XA 4MVZA 1MQVA 3SXZA 5AC4A 1I4ZA 1U89A 3U9MA 2HV6A 2L7AA 1LE2A 3AGUA 3ATPA 4MVMA 4NTBA 2E87A 1ZW2A 3S9OA 2YWAA 4YT8A 1A41A 5IY5C 5GPGB 4UDVA 3MLGA 1QVXA 1CGOA 3ZVRA 2FFHA 3EZHA 4MS2A 4NTAA 1V55C 3U2LA 2Y3HA 3SYNA 3G50A 1H9TA 4DVZA 1LVKA 4DBQA 2W4MA 2GFHA 5EGYA 3TULA 1AVOB 5CIVA 3DD7A 4NC3A 3S90A 2VASA 3LS0A 3S84A 2HS5A 4O6YA 1FR0A 1IW7F 2OEVA 3C62A 1Q0GA 2IYLD 4DBRA 3W4YA 1RKEB 2W45A 1VB5A 5EK0A 3ABKC 3T9OA 5KYUB 1NBBA 2Q00A 2MWQA 2BC5A 3EHMA 3NRHA 4LLCA 5B1BC 3UMHA 1Q0FA 4E7SA 256BA 2XLVA 5L0IA 2AVKA 2J9WA 4YL0A 2R7QA 3FOOA 2CW0F 4CDVA 5L0JA 3S28A 3PMRA 4JTDB 1PD1A 4MTFA 1TFOB 4FWVA 1LI5A 2BL2A 3TK0A 4EHPA 2D5RB 3IQTA 1O87A 2F22A 2XRHA 4JKVA 3ZG1A 3FAJA 1R4TA 1NU7D 3E9VA 3POVA 2Y3BA 2P7VA 4ANJA 2XM4A 2YHSA 1Q0KA 4ONSA 2PFDA 1E85A 4BEJA 2IXMA 4Q7CA 2LFDA 2L6GA 5BQIA 5L3VA 2FGYA 3V7OA 5E3CA 1PCXA 2HMZA 5JUAA 1OCZC 2KNHA 1TWHA 2W9YA 5AGFA 3U5SA 5E33A 4E0IA 1L3PA 2UUIA 2ZPAA 2NSFA 3ZQVA 4CS8C 2HJMA 4JURI 5KYXA 3K33A 2BE5F 2PBEA 5JVEA 4JW1A 2LCHA 3VM6A 2WVNA 3EZIA 4LDKA 1LS1A 1H7IA 3DZAA 4DRIB 1D1BA 1NFNA 2HV7A 1ZHZA 3NYJA 2R7OA 4AE4B 1CPQA 1K40A 1VMAA 1V74B
chains in the Genus database with same CATH topology
2M4EA 3W2WA 4XTKA 2KQ9A 3RH3A 5HSWA 1OCOC 2ZXPA 3K6BA 1OKKA 2I8BA 3AG4C 4KI2A 2WL8A 2XL4A 4O6NA 1D0YA 2OG2A 2MYSA 3WODF 5T3TA 5B3SC 3ASNC 4GEHA 2KJGA 3ZIBA 1TWGA 1Z63A 1MMDA 5KYUA 5D92A 1OKKD 2KGOA 2ZXWC 3SNHA 2Y3DA 3X1OA 4C3DA 4JJFA 4CS7A 4C3BA 3F47A 3NDBB 3LLKA 1ZYRF 3DM5A 4I1MA 3EGDB 1M57C 1NG1A 3EGXB 4DVYP 4OINF 1TKNA 2Y3GA 3RFYA 3T6JA 4CS9C 4ZLDA 2X51A 2C03A 3EJNA 2WZGA 3EG9B 4AE4A 1D1CA 3EFOB 3HTKC 4GYTA 4PJMA 1G8XA 3W2VA 3UR3C 1Z23A 3ABLC 5T3WA 3QMKA 3S27A 1BR4A 4QI2A 3HLZA 2R7VA 1MNDA 2H7OA 3K66A 3LNRA 1NZEA 3ABMC 4IJJA 2EILC 4LACB 2C04A 3AQBA 3NKDA 2L81A 4XLPF 1RJ9B 2NUPB 2LSEA 3NYMA 2XXAB 3EQLF 3VYWA 3PHF2 1SF8A 1QLEC 2B0JA 1M56C 4IWBA 2Q9CA 2H7BA 4KBLA 3N2ZB 3B0VC 3KH2A 1ST6A 1FFTC 2EIMC 4H4KC 2Y69C 1TWCA 2ZXOA 3GODA 4CIHA 3EGDA 2A6HF 3EGXA 4AK9A 2PX3A 3CZ6A 2CDQA 1VYIA 3I5QA 2WZLA 3ASOC 3LJBA 2L9JA 3WG7C 2ZXRA 2KW3C 2IXOA 4CSAC 4OIRF 4I1OB 4J32B 3EG9A 4PJJA 4U5CE 2J45A 3AG2C 3N24A 5DS5A 3EFOA 5DVWA 1MNEA 1VYKA 3E70C 4U5HA 2R7UA 3UGOA 4FESA 4YT5A 3X2QC 2J9UA 2EINC 4U5EE 5CI9A 2CNWA 4W8KA 5KYNA 2W4BA 3AQCA 2EIKC 3O6XA 3Q7LA 4JZAA 3FDQA 2R7TA 4IRUA 2Q3TA 2PX0A 2VB6A 3JSZA 1RJ9A 2IXPA 2NUPA 1FMVA 2VH3A 4DOZA 2R7SA 4FX5A 2CNWD 3UNGC 2XXAA 4IAOA 4CS8A 3SZRA 4O7GA 4HE8D 5F5HA 3LLIA 1WGWA 3DAFA 3UGPA 1M2VB 4KNVA 4YJWA 4I3MA 2Z15A 4RBNA 2JD3A 2YEVA 4BJ1A 2IOQA 4LLEA 1JPNA 5E3AA 1ZHTA 1FTSA 4U5GA 3OEOA 4PJNA 3LS1A 1J8MF 2A1DD 2QTVA 3L0IA 2Q9BA 3SP1A 2XSEA 1ZU5A 4ZLCA 1IZMA 4YWQA 2R7XA 4X0RA 4JCHA 4O79A 3QZCA 3L34A 1TR2A 3GANA 3JT1A 4RD9A 4BG0A 1FMWA 1KU2A 4G7OF 1BR1A 1QZXA 3JRTA 1OCCC 1Z3IX 3OA1A 3RIPA 4CS9A 4WJ0A 4BJTA 4BJ6A 3TD7A 3F46A 2J9VA 2A69F 3LAYA 3I4UA 4E7ZA 2WVQA 4QDLA 3UMIA 1M2VA 3NG1A 1VK5A 4G7HF 3UMKA 4PFOA 5DQZA 1NU9C 1S7ZA 4O6MA 3DMDA 5DLJA 3LESA 3ECSA 5FCLA 4EBBA 5KYYB 4BJ5A 2J7PA 4HFKB 1OCRC 5KYWB 2A6EF 4C3EA 4XLNF 4JVSA 2WB7A 4C7OB 1SZIA 2J0WA 3MX3A 2G3KA 3HJCA 1M2OA 3KL4A 2J7PD 1ZHXA 2J46A 1ZHWA 3Q6NA 3ZC4A 4M63A 4K0DA 4U5DE 3FVYA 4K7BA 4KC9A 3EH1A 4OD4A 4EWCA 5D91A 3VAYA 3K7DA 1BR2A 1SMYF 4YN0B 3JCUQ 3EH2A 2PF4E 4JJGA 3OWTA 4PJLA 3DXJF 2Y39A 1MMAA 4KNWA 4OIQF 3KMIA 3AG1C 1VOMA 1D1AA 3T6BA 1FFHA 4CSAA 3EPVA 5BUOA 5T1DB 2O9XA 2Q9AA 1Z6AA 4G0HA 3CQZA 2R7WA 2QY9A 3S0XA 3I5PA 4OD5A 1ZHYA 2NUTB 2DYSC 3ITFA 2NG1A 3N0TA 3JYHA 5KYYA 3NYLA 5KYWA 2EIJC 2H7VC 2V26A 4OIPF 3ZSUA 4XWJA 4ULWA 4C7OA 4HFFB 1LKXA 4MNDA 2DYRC 3B9QA 4PFPA 5F5FA 3K1HA 4P6IC 3K1IC 3Q7GA 2IXNA 5EHHA 1D0XA 1D0ZA 4U5BE 2G3VA 4YT4A 4A2NB 3T4RA 4MQ9F 4U5FE 2WVOA 4CBEA 4LERA 4J30B 3LEVA 4HEAJ 4RDAA 3W8IA 2V3CC 3O39A 1MMGA 2G62A 4PK4A 1PD0A 3S29A 3DJNB 3Q6MA 5E2QA 5DS6A 3DM9B 3W8HA 3CSKA 2PP4A 3FHDA 3IEEA 4Q5SF 2A68F 3EHNA 5L3QA 1ZU4A 4NY3A 4QI0A 5B1AC 1MMNA 4N06A 4B6IA 2OCCC 2P6VA 4I44A 2NUTA 4YT2A 3H65A 4OIOF 3RKOF 2DGJA 3DJUB 3DAGA 1TWAA 2CGEA 3B0PA 4AX2A 3RYLA 5DS4A 4BJ6C 5DQTA 1V54C 1W2WA 3AG3C 1O5HA 3M1CB 2R7RA 1N1CA 4F4BA 3SEOA 1Z5ZA 2YZSA 4Q4ZF 1J8YF 3KKBA 5CI8A 3NKEA 5KYXB 2WZFA 4BJ5C 1JPJA 3B0UX 2J0XA 2HV6A 2E87A 4YT8A 5IY5C 3MLGA 3ZVRA 2FFHA 3EZHA 1V55C 2Y3HA 3SYNA 4DVZA 1LVKA 4DBQA 2W4MA 2GFHA 5EGYA 3DD7A 2VASA 3LS0A 4O6YA 1IW7F 2IYLD 4DBRA 2W45A 3ABKC 5KYUB 3NRHA 2MWQA 3EHMA 4LLCA 5B1BC 3UMHA 4E7SA 2J9WA 2R7QA 2CW0F 3S28A 3PMRA 1PD1A 4FWVA 2D5RB 3ZG1A 1O87A 2XRHA 3FAJA 1NU7D 3E9VA 3POVA 2Y3BA 2P7VA 4ANJA 2YHSA 4G7ZF 2PFDA 4BEJA 2IXMA 4Q7CA 5L3VA 2FGYA 3V7OA 5E3CA 1PCXA 1OCZC 2KNHA 1TWHA 2W9YA 5E33A 2ZPAA 4CS8C 4JURI 5KYXA 3K33A 2BE5F 4JW1A 2WVNA 3EZIA 1LS1A 3DZAA 1D1BA 2HV7A 1ZHZA 3NYJA 2R7OA 4AE4B 1VMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFK B;  4B6I A;  4J32 B;  4AX2 A;  4J30 B;  4JUR I;  3ZIB A;  4HFF B; 
#chains in the Genus database with same CATH topology
 2M4E A;  3QW1 A;  3W2W A;  4XTK A;  2KQ9 A;  3U2M A;  1QSP A;  2IM8 A;  3RH3 A;  4N4W A;  1OCO C;  1UG7 A;  3VRC A;  5JS5 A;  5HSW A;  2ZXP A;  4G7Z F;  3K6B A;  4EIY A;  1OKK A;  2I8B A;  2ICW G;  3AG4 C;  4DXW A;  1E84 A;  3KYJ A;  4W8P A;  2P1A A;  2KYH A;  4KI2 A;  4XPX A;  1K05 A;  2WL8 A;  2XL4 A;  1LS4 A;  4O6N A;  1D0Y A;  2OG2 A;  2MYS A;  4NQF A;  3FAP B;  5T3T A;  1DOV A;  3WOD F;  3ASN C;  3BEH A;  4GEH A;  2KJG A;  2YLI A;  5B3S C;  1VTM P;  3ZIB A;  1TWG A;  2NSG A;  3FXH A;  1RKE A;  1Z63 A;  1MMD A;  5KYU A;  1BBH A;  4MVU A;  5D92 A;  3DE8 A;  3QW0 A;  1OKK D;  1Q0D A;  1YA7 O;  3GEE A;  2KGO A;  1Q0M A;  2ZXW C;  4XEF A;  2Y3D A;  3SNH A;  1T6U A;  2GDC A;  4AL0 A;  1Y4C A;  3A11 A;  4LDR A;  2HMQ A;  1EI7 A;  5JP7 A;  3X1O A;  4C3D A;  3H2U A;  4GQH A;  4JJF A;  2GA0 A;  4CS7 A;  5F5F A;  4C3B A;  4N6C A;  3F47 A;  3NDB B;  3LLK A;  1ZYR F;  3U3B A;  2EPL X;  3DM5 A;  4I1M A;  3EGD B;  4J7T A;  1M57 C;  5L0H A;  1NG1 A;  2GWW A;  3EGX B;  4MVO A;  4DVY P;  3TJ5 A;  3MFN A;  4OIN F;  4DJ9 A;  1RMV A;  1ORJ A;  1TKN A;  1T6I A;  2AU5 A;  2Y3G A;  4IB4 A;  3RVZ A;  3RFY A;  3T6J A;  3GM2 A;  3R2P A;  1HW2 A;  4CS9 C;  4ZLD A;  2X51 A;  2LK4 A;  2C03 A;  3ZWI A;  1AUE A;  3GEI A;  4XEV A;  5L0G A;  1EQ1 A;  3GEH A;  3IQ5 A;  2TMV P;  4XPY A;  4CJO A;  3EJN A;  2WZG A;  3RQF A;  2A0U A;  2OU6 A;  3EG9 B;  4IAR A;  4AE4 A;  3CAX A;  1D1C A;  3EFO B;  3HTK C;  2VCA A;  4GYT A;  4PJM A;  3JRM O;  4XEK A;  5L0C A;  1G8X A;  3W2V A;  3UR3 C;  1Z23 A;  1LIH A;  3ABL C;  1YZA A;  5T3W A;  3QMK A;  1UFB A;  3S27 A;  1BR4 A;  4XPW A;  4QI2 A;  3HLZ A;  2YL3 A;  2R7V A;  1MND A;  2LP4 A;  4JEB A;  2H7O A;  3K66 A;  1G5Z A;  3LNR A;  1NZE A;  2B0H A;  2YL0 A;  3M4C A;  3L8I A;  3ZTZ A;  4BEM J;  4CIP A;  3ABM C;  2YL1 A;  4IJJ A;  2EIL C;  4LAC B;  4PR9 A;  2C04 A;  1LM3 B;  1XZQ A;  3AQB A;  3C7J A;  1NFO A;  3NKD A;  1BDJ B;  2L81 A;  4XLP F;  1RJ9 B;  2EPN A;  2LSE A;  2NUP B;  4JIO A;  2LFF A;  3NYM A;  2XXA B;  3EQL F;  3VYW A;  3PHF 2;  1QKR A;  3T6G B;  1SF8 A;  1QLE C;  2B0J A;  3IPM O;  1M56 C;  4ULV A;  4IWB A;  5COM A;  1RKC A;  4ER9 A;  2Q9C A;  2H7B A;  4KBL A;  1GQA A;  3N2Z B;  2XL8 A;  3B0V C;  3KH2 A;  1ST6 A;  1FFT C;  2EIM C;  4H4K C;  2Y69 C;  3PCV A;  3J06 A;  1TWC A;  4CJG A;  1BZ4 A;  3VF0 A;  1OW6 A;  2ZXO A;  4N6H A;  3GOD A;  3R7C A;  4CIH A;  3EGD A;  2A6H F;  4E17 A;  5K0I A;  2OOC A;  3EGX A;  4EBJ A;  4AK9 A;  1G4U S;  2PX3 A;  4BPM A;  3CZ6 A;  2P0N A;  2CDQ A;  1VYI A;  3I5Q A;  2I15 A;  2WZL A;  4WGZ A;  3ASO C;  1V4A A;  3LJB A;  1QPU A;  2L9J A;  4Z9H A;  2YLG A;  3WG7 C;  2ZXR A;  2KW3 C;  4CDA A;  2YVK A;  1OR3 A;  2IXO A;  5COG A;  1KTM A;  4E0H A;  4CSA C;  4OIR F;  4NCQ A;  3M4B A;  4I1O B;  4J32 B;  2XS1 A;  3EG9 A;  4PJJ A;  4U5C E;  1EKY A;  2J45 A;  3AG2 C;  3N24 A;  5DS5 A;  3EFO A;  4G78 A;  5DVW A;  1MNE A;  1VYK A;  1APC A;  3O10 A;  5A6B A;  1GS9 A;  3E70 C;  4U5H A;  4CDY A;  2R7U A;  2CYD A;  2YL7 A;  4FES A;  3UGO A;  4K1O A;  2QLA A;  4YT5 A;  3X2Q C;  1U6H A;  2EIN C;  2J9U A;  4U5E E;  1H6G A;  2CNW A;  1T5O A;  5CI9 A;  2CCY A;  1LE4 A;  4W8K A;  4Z9I A;  5KYN A;  3C18 A;  3ZTM A;  2JPU A;  3M79 A;  1JR8 A;  2W4B A;  5L0F A;  3AQC A;  4A4A A;  3MYI A;  2EIK C;  3O6X A;  3Q7L A;  4JZA A;  3FDQ A;  1A7V A;  4IRU A;  2Q3T A;  4MTG A;  2R7T A;  5A6B D;  2PX0 A;  2VB6 A;  3JSZ A;  1RJ9 A;  2IXP A;  2NUP A;  5HV9 A;  1FMV A;  2VH3 A;  4DOZ A;  4EUK B;  2R7S A;  4FX5 A;  2CNW D;  4H54 A;  4JTA B;  3UNG C;  4IAO A;  3H2V A;  4CS8 A;  1YYX A;  2XXA A;  3SZR A;  4O7G A;  2R25 A;  1GGQ A;  1TQG A;  3CEX A;  3HNI A;  3TQO A;  4HE8 D;  5F5H A;  3LLI A;  3U0C A;  1ZVZ A;  1WGW A;  3DAF A;  2M64 A;  1M2V B;  3UGP A;  4KNV A;  3K1I A;  3G4X A;  2HKV A;  4JC7 A;  4YJW A;  4I3M A;  2Z15 A;  4MVR A;  2JD3 A;  2YEV A;  2LQG A;  4RBN A;  4DRJ B;  3L1M A;  1GM5 A;  4Z9J A;  4BJ1 A;  3AJM A;  2IOQ A;  4LLE A;  4YK5 A;  1I4Y A;  1JPN A;  1OW7 A;  2QNL A;  3DWW A;  5E3A A;  1ZHT A;  2GAQ A;  1Y6D A;  3HNL A;  3B29 A;  3HNK A;  5JRA A;  1FTS A;  1HE1 A;  4U5G A;  3OEO A;  1PV3 A;  1RCP A;  2R03 A;  3LS1 A;  4PJN A;  1J8M F;  2A1D D;  3AGT A;  4AL1 A;  3WAQ A;  3U3F A;  2YKZ A;  3JTL O;  2QTV A;  3L0I A;  2Q9B A;  1OW8 A;  2XLO A;  3SP1 A;  1I5N A;  2OKU A;  2XSE A;  3LEO A;  1ZU5 A;  4ZLC A;  1HY5 A;  2J9B A;  1IZM A;  2VCC A;  4R32 A;  1FNT c;  2H8A A;  4YWQ A;  3JZ0 A;  2R7X A;  4X0R A;  4JCH A;  4XQ1 A;  4O79 A;  3QZC A;  4MW3 A;  2P61 A;  3L34 A;  1TR2 A;  3RQG A;  3GAN A;  3JT1 A;  1YYJ A;  4RD9 A;  1YJG A;  3LUT B;  4LDQ A;  1H9G A;  2L6F A;  2X0C A;  4BG0 A;  4YL3 A;  1G4W R;  3NMJ A;  3U8V A;  1FMW A;  1KU2 A;  1YAR O;  5TJ5 E;  4G7O F;  1BR1 A;  1QZX A;  1B68 A;  1E2X A;  1OCC C;  3JRT A;  1SYQ A;  4CX9 A;  3AOU A;  1Z3I X;  3OA1 A;  3RIP A;  4CS9 A;  4WJ0 A;  3GWN A;  4BJT A;  4L6R A;  4BJ6 A;  3TD7 A;  3TJ6 A;  3F46 A;  2J9V A;  2DB4 A;  3U8P A;  2A69 F;  3LAY A;  2Q7R A;  3RW0 A;  5BQH A;  4D4X A;  3I4U A;  1E83 A;  1WWP A;  4E7Z A;  2WVQ A;  4QDL A;  2YRF A;  2QE9 A;  3UMI A;  1OXB A;  1M2V A;  3US6 A;  3NG1 A;  1VK5 A;  5COF A;  3DI5 A;  1FAP B;  3UMK A;  4PFO A;  4G7H F;  5DQZ A;  1OXK A;  1NU9 C;  1S7Z A;  1WN0 A;  4O6M A;  3DMD A;  4J7Y A;  5DLJ A;  3GM3 A;  3LES A;  3ECS A;  5FCL A;  2XL6 A;  3BRJ A;  4EBB A;  5KYY B;  3HNJ A;  3B71 A;  2HFI A;  2R05 A;  4BJ5 A;  4MVQ A;  2A0B A;  2J7P A;  1OCR C;  2LD6 A;  4HFK B;  5KYW B;  1A7D A;  4E18 A;  3QVZ A;  3A9C A;  1JAF A;  2A6E F;  1XWJ A;  4XLN F;  4C3E A;  2EPK X;  1A0B A;  1YZC A;  2WB7 A;  4JVS A;  4JE9 A;  4C7O B;  2AWY A;  1O3U A;  1SZI A;  1QQ3 A;  2J0W A;  3C8G D;  1WOL A;  2Q4F A;  2G3K A;  3MX3 A;  3V5X A;  4EBK A;  2JX0 A;  1AEP A;  4EKW A;  3HJC A;  3GWL A;  1M2O A;  3C63 A;  1YA9 A;  3KL4 A;  3KYI A;  1NLX A;  1T01 A;  2J7P D;  1ZHX A;  4U9E A;  2J46 A;  1L7C A;  1ZHW A;  3GOR A;  3Q6N A;  3ZC4 A;  4M63 A;  4K0D A;  1R5I D;  4U5D E;  2HZ8 A;  1ZZP A;  3LNM B;  2XLE A;  1LI7 A;  2KK1 A;  2VC9 A;  1OQC A;  3FVY A;  3JYY A;  1YDI A;  3EH1 A;  4K7B A;  4KC9 A;  4OD4 A;  4P9T A;  4EWC A;  5D91 A;  3VAY A;  1HMO A;  1ORS C;  3K7D A;  1BR2 A;  1SMY F;  3L8J A;  3V5Z A;  2AWC A;  4YN0 B;  3FOP A;  3JCU Q;  3RF3 A;  3EH2 A;  1E86 A;  1CGM E;  3SXM A;  3TOL A;  2PF4 E;  4JJG A;  2ZD9 A;  2EPO A;  3OWT A;  3SXY A;  4PJL A;  3DXJ F;  4IGG A;  2Y39 A;  1SR2 A;  1MMA A;  4KNW A;  4OIQ F;  2ASR A;  3KMI A;  4JRZ A;  3ZDL A;  1HMD A;  3AG1 C;  4P9F A;  1VOM A;  1D1A A;  2XLW A;  3T6B A;  4JCZ A;  1FFH A;  4CSA A;  3EPV A;  5BUO A;  5T1D B;  2XLH A;  2O9X A;  1JRA A;  2OEX A;  1YVI A;  2Q9A A;  1Z6A A;  4G0H A;  3CQZ A;  2R7W A;  2QY9 A;  3S0X A;  3I5P A;  4OD5 A;  2R9R B;  3PDM P;  1ZHY A;  2NUT B;  2DYS C;  3G4Z A;  3ITF A;  1CGN A;  1TFK B;  2NG1 A;  3NMI A;  1ORY A;  2D4U A;  3N0T A;  3JYH A;  5KYY A;  1U0B B;  1T6Q A;  2DI3 A;  3NYL A;  4MW8 A;  5KYW A;  2EIJ C;  2HUJ A;  3SXK A;  2H7V C;  2V26 A;  4OIP F;  3ZSU A;  4XWJ A;  3V5Y A;  4ULW A;  2OQM A;  4C7O A;  4HFF B;  1LKX A;  4MND A;  2XM0 A;  2DYR C;  2XS8 A;  3C8G B;  1ZW3 A;  2IBF A;  2J8W A;  3B9Q A;  1RXQ A;  4PFP A;  3O55 A;  3DKA A;  3K1H A;  4P6I C;  1T9K A;  1VLS A;  3U9J A;  3K1I C;  5B3I A;  3Q7G A;  2IXN A;  2OJQ A;  4PAC A;  5EHH A;  5A69 A;  5AC5 A;  1C17 M;  1D0X A;  1D0Z A;  1WAT A;  2G3V A;  2XLD A;  2EPM X;  4U5B E;  4YT4 A;  4A2N B;  3T4R A;  2RD9 A;  1HW1 A;  2ETS A;  4MQ9 F;  3IQC A;  1YAU O;  3RQE A;  3WHN A;  5F28 E;  2AP3 A;  1Z7Q c;  4U5F E;  2WVO A;  2YLD A;  3QVY A;  4CBE A;  4LER A;  3RVY A;  2L6H A;  4JEA A;  4J30 B;  3LEV A;  2KSF A;  4HEA J;  4RDA A;  3W8I A;  3M15 A;  3O39 A;  2V3C C;  1MMG A;  2G62 A;  4PK4 A;  1EA8 A;  1K04 A;  1PD0 A;  1A7E A;  3DJN B;  3Q6M A;  5E2Q A;  5JSL A;  3S29 A;  5DS6 A;  1M6T A;  3DM9 B;  3W8H A;  3IHU A;  1CPR A;  1HE9 A;  3CSK A;  2PP4 A;  3QTH A;  1LPE A;  1JOG A;  5A6A A;  3FHD A;  3IEE A;  5A6K A;  5JT4 A;  4Q5S F;  2XLM A;  2A68 F;  1YLM A;  3EHN A;  3FMS A;  1WTY A;  5L3Q A;  2QUP A;  1ZU4 A;  4NY3 A;  1XZP A;  4QI0 A;  1MMN A;  4N06 A;  4WGY A;  5B1A C;  4B6I A;  2OCC C;  1DOW A;  4MVS A;  2P6V A;  4I44 A;  2HSB A;  2NUT A;  4YT2 A;  3H65 A;  4FAP B;  4IAQ A;  3GM1 A;  1F1M A;  4MTO A;  4WAB A;  1S05 A;  2PNO A;  3RKO F;  4YL1 A;  2DGJ A;  4OIO F;  2YQY A;  3DJU B;  3DAG A;  1WAS A;  3TOM A;  5BQG A;  2FAP B;  2KC3 A;  4U9D A;  1TWA A;  4D4N A;  2LIG A;  2CGE A;  2HSQ A;  1C02 A;  2MHR A;  3B0P A;  2HJ3 A;  3RYL A;  4AX2 A;  5DS4 A;  4BJ6 C;  3C8Z A;  4DRH B;  5DQT A;  5A6J A;  3MYF A;  2VCB A;  3JSE O;  4JTC B;  5JLI A;  3C8G A;  1V54 C;  3NMK A;  1W2W A;  3AG3 C;  3ZQY A;  1O5H A;  3M1C B;  2R7R A;  1N1C A;  5L0D A;  2OJE D;  2RSE B;  1C03 A;  3KPH A;  1Z5Z A;  3SEO A;  2YZS A;  4F4B A;  5FZT A;  4Q4Z F;  1J8Y F;  3KKB A;  5CI8 A;  1JMW A;  3IQ6 A;  3NKE A;  1VLT A;  4NTF A;  1NSG B;  3DE9 A;  2R02 A;  2UUH A;  2NPU A;  1OR2 A;  2WZF A;  4BJ5 C;  5KYX B;  1KNY A;  1JPJ A;  3HKK A;  3MBG A;  3B0U X;  2J0X A;  4MVZ A;  1MQV A;  3SXZ A;  5AC4 A;  1I4Z A;  1U89 A;  3U9M A;  2HV6 A;  2L7A A;  1LE2 A;  3AGU A;  3ATP A;  4MVM A;  4NTB A;  2E87 A;  1ZW2 A;  3S9O A;  2YWA A;  4YT8 A;  1A41 A;  5IY5 C;  5GPG B;  4UDV A;  3MLG A;  1QVX A;  1CGO A;  3ZVR A;  2FFH A;  3EZH A;  4MS2 A;  4NTA A;  1V55 C;  3U2L A;  2Y3H A;  3SYN A;  3G50 A;  1H9T A;  4DVZ A;  1LVK A;  4DBQ A;  2W4M A;  2GFH A;  5EGY A;  3TUL A;  1AVO B;  5CIV A;  3DD7 A;  4NC3 A;  3S90 A;  2VAS A;  3LS0 A;  3S84 A;  2HS5 A;  4O6Y A;  1FR0 A;  1IW7 F;  2OEV A;  3C62 A;  1Q0G A;  2IYL D;  4DBR A;  3W4Y A;  1RKE B;  2W45 A;  1VB5 A;  5EK0 A;  3ABK C;  3T9O A;  5KYU B;  1NBB A;  2Q00 A;  2MWQ A;  2BC5 A;  3EHM A;  3NRH A;  4LLC A;  5B1B C;  3UMH A;  1Q0F A;  4E7S A;  256B A;  2XLV A;  5L0I A;  2AVK A;  2J9W A;  4YL0 A;  2R7Q A;  3FOO A;  2CW0 F;  4CDV A;  5L0J A;  3S28 A;  3PMR A;  4JTD B;  1PD1 A;  4MTF A;  1TFO B;  4FWV A;  1LI5 A;  2BL2 A;  3TK0 A;  4EHP A;  2D5R B;  3IQT A;  1O87 A;  2F22 A;  2XRH A;  4JKV A;  3ZG1 A;  3FAJ A;  1R4T A;  1NU7 D;  3E9V A;  3POV A;  2Y3B A;  2P7V A;  4ANJ A;  2XM4 A;  2YHS A;  1Q0K A;  4ONS A;  2PFD A;  1E85 A;  4BEJ A;  2IXM A;  4Q7C A;  2LFD A;  2L6G A;  5BQI A;  5L3V A;  2FGY A;  3V7O A;  5E3C A;  1PCX A;  2HMZ A;  5JUA A;  1OCZ C;  2KNH A;  1TWH A;  2W9Y A;  5AGF A;  3U5S A;  5E33 A;  4E0I A;  1L3P A;  2UUI A;  2ZPA A;  2NSF A;  3ZQV A;  4CS8 C;  2HJM A;  4JUR I;  5KYX A;  3K33 A;  2BE5 F;  2PBE A;  5JVE A;  4JW1 A;  2LCH A;  3VM6 A;  2WVN A;  3EZI A;  4LDK A;  1LS1 A;  1H7I A;  3DZA A;  4DRI B;  1D1B A;  1NFN A;  2HV7 A;  1ZHZ A;  3NYJ A;  2R7O A;  4AE4 B;  1CPQ A;  1K40 A;  1VMA A;  1V74 B; 
#chains in the Genus database with same CATH homology
 2M4E A;  3W2W A;  4XTK A;  2KQ9 A;  3RH3 A;  5HSW A;  1OCO C;  2ZXP A;  3K6B A;  1OKK A;  2I8B A;  3AG4 C;  4KI2 A;  2WL8 A;  2XL4 A;  4O6N A;  1D0Y A;  2OG2 A;  2MYS A;  3WOD F;  5T3T A;  5B3S C;  3ASN C;  4GEH A;  2KJG A;  3ZIB A;  1TWG A;  1Z63 A;  1MMD A;  5KYU A;  5D92 A;  1OKK D;  2KGO A;  2ZXW C;  3SNH A;  2Y3D A;  3X1O A;  4C3D A;  4JJF A;  4CS7 A;  4C3B A;  3F47 A;  3NDB B;  3LLK A;  1ZYR F;  3DM5 A;  4I1M A;  3EGD B;  1M57 C;  1NG1 A;  3EGX B;  4DVY P;  4OIN F;  1TKN A;  2Y3G A;  3RFY A;  3T6J A;  4CS9 C;  4ZLD A;  2X51 A;  2C03 A;  3EJN A;  2WZG A;  3EG9 B;  4AE4 A;  1D1C A;  3EFO B;  3HTK C;  4GYT A;  4PJM A;  1G8X A;  3W2V A;  3UR3 C;  1Z23 A;  3ABL C;  5T3W A;  3QMK A;  3S27 A;  1BR4 A;  4QI2 A;  3HLZ A;  2R7V A;  1MND A;  2H7O A;  3K66 A;  3LNR A;  1NZE A;  3ABM C;  4IJJ A;  2EIL C;  4LAC B;  2C04 A;  3AQB A;  3NKD A;  2L81 A;  4XLP F;  1RJ9 B;  2NUP B;  2LSE A;  3NYM A;  2XXA B;  3EQL F;  3VYW A;  3PHF 2;  1SF8 A;  1QLE C;  2B0J A;  1M56 C;  4IWB A;  2Q9C A;  2H7B A;  4KBL A;  3N2Z B;  3B0V C;  3KH2 A;  1ST6 A;  1FFT C;  2EIM C;  4H4K C;  2Y69 C;  1TWC A;  2ZXO A;  3GOD A;  4CIH A;  3EGD A;  2A6H F;  3EGX A;  4AK9 A;  2PX3 A;  3CZ6 A;  2CDQ A;  1VYI A;  3I5Q A;  2WZL A;  3ASO C;  3LJB A;  2L9J A;  3WG7 C;  2ZXR A;  2KW3 C;  2IXO A;  4CSA C;  4OIR F;  4I1O B;  4J32 B;  3EG9 A;  4PJJ A;  4U5C E;  2J45 A;  3AG2 C;  3N24 A;  5DS5 A;  3EFO A;  5DVW A;  1MNE A;  1VYK A;  3E70 C;  4U5H A;  2R7U A;  3UGO A;  4FES A;  4YT5 A;  3X2Q C;  2J9U A;  2EIN C;  4U5E E;  5CI9 A;  2CNW A;  4W8K A;  5KYN A;  2W4B A;  3AQC A;  2EIK C;  3O6X A;  3Q7L A;  4JZA A;  3FDQ A;  2R7T A;  4IRU A;  2Q3T A;  2PX0 A;  2VB6 A;  3JSZ A;  1RJ9 A;  2IXP A;  2NUP A;  1FMV A;  2VH3 A;  4DOZ A;  2R7S A;  4FX5 A;  2CNW D;  3UNG C;  2XXA A;  4IAO A;  4CS8 A;  3SZR A;  4O7G A;  4HE8 D;  5F5H A;  3LLI A;  1WGW A;  3DAF A;  3UGP A;  1M2V B;  4KNV A;  4YJW A;  4I3M A;  2Z15 A;  4RBN A;  2JD3 A;  2YEV A;  4BJ1 A;  2IOQ A;  4LLE A;  1JPN A;  5E3A A;  1ZHT A;  1FTS A;  4U5G A;  3OEO A;  4PJN A;  3LS1 A;  1J8M F;  2A1D D;  2QTV A;  3L0I A;  2Q9B A;  3SP1 A;  2XSE A;  1ZU5 A;  4ZLC A;  1IZM A;  4YWQ A;  2R7X A;  4X0R A;  4JCH A;  4O79 A;  3QZC A;  3L34 A;  1TR2 A;  3GAN A;  3JT1 A;  4RD9 A;  4BG0 A;  1FMW A;  1KU2 A;  4G7O F;  1BR1 A;  1QZX A;  3JRT A;  1OCC C;  1Z3I X;  3OA1 A;  3RIP A;  4CS9 A;  4WJ0 A;  4BJT A;  4BJ6 A;  3TD7 A;  3F46 A;  2J9V A;  2A69 F;  3LAY A;  3I4U A;  4E7Z A;  2WVQ A;  4QDL A;  3UMI A;  1M2V A;  3NG1 A;  1VK5 A;  4G7H F;  3UMK A;  4PFO A;  5DQZ A;  1NU9 C;  1S7Z A;  4O6M A;  3DMD A;  5DLJ A;  3LES A;  3ECS A;  5FCL A;  4EBB A;  5KYY B;  4BJ5 A;  2J7P A;  4HFK B;  1OCR C;  5KYW B;  2A6E F;  4C3E A;  4XLN F;  4JVS A;  2WB7 A;  4C7O B;  1SZI A;  2J0W A;  3MX3 A;  2G3K A;  3HJC A;  1M2O A;  3KL4 A;  2J7P D;  1ZHX A;  2J46 A;  1ZHW A;  3Q6N A;  3ZC4 A;  4M63 A;  4K0D A;  4U5D E;  3FVY A;  4K7B A;  4KC9 A;  3EH1 A;  4OD4 A;  4EWC A;  5D91 A;  3VAY A;  3K7D A;  1BR2 A;  1SMY F;  4YN0 B;  3JCU Q;  3EH2 A;  2PF4 E;  4JJG A;  3OWT A;  4PJL A;  3DXJ F;  2Y39 A;  1MMA A;  4KNW A;  4OIQ F;  3KMI A;  3AG1 C;  1VOM A;  1D1A A;  3T6B A;  1FFH A;  4CSA A;  3EPV A;  5BUO A;  5T1D B;  2O9X A;  2Q9A A;  1Z6A A;  4G0H A;  3CQZ A;  2R7W A;  2QY9 A;  3S0X A;  3I5P A;  4OD5 A;  1ZHY A;  2NUT B;  2DYS C;  3ITF A;  2NG1 A;  3N0T A;  3JYH A;  5KYY A;  3NYL A;  5KYW A;  2EIJ C;  2H7V C;  2V26 A;  4OIP F;  3ZSU A;  4XWJ A;  4ULW A;  4C7O A;  4HFF B;  1LKX A;  4MND A;  2DYR C;  3B9Q A;  4PFP A;  5F5F A;  3K1H A;  4P6I C;  3K1I C;  3Q7G A;  2IXN A;  5EHH A;  1D0X A;  1D0Z A;  4U5B E;  2G3V A;  4YT4 A;  4A2N B;  3T4R A;  4MQ9 F;  4U5F E;  2WVO A;  4CBE A;  4LER A;  4J30 B;  3LEV A;  4HEA J;  4RDA A;  3W8I A;  2V3C C;  3O39 A;  1MMG A;  2G62 A;  4PK4 A;  1PD0 A;  3S29 A;  3DJN B;  3Q6M A;  5E2Q A;  5DS6 A;  3DM9 B;  3W8H A;  3CSK A;  2PP4 A;  3FHD A;  3IEE A;  4Q5S F;  2A68 F;  3EHN A;  5L3Q A;  1ZU4 A;  4NY3 A;  4QI0 A;  5B1A C;  1MMN A;  4N06 A;  4B6I A;  2OCC C;  2P6V A;  4I44 A;  2NUT A;  4YT2 A;  3H65 A;  4OIO F;  3RKO F;  2DGJ A;  3DJU B;  3DAG A;  1TWA A;  2CGE A;  3B0P A;  4AX2 A;  3RYL A;  5DS4 A;  4BJ6 C;  5DQT A;  1V54 C;  1W2W A;  3AG3 C;  1O5H A;  3M1C B;  2R7R A;  1N1C A;  4F4B A;  3SEO A;  1Z5Z A;  2YZS A;  4Q4Z F;  1J8Y F;  3KKB A;  5CI8 A;  3NKE A;  5KYX B;  2WZF A;  4BJ5 C;  1JPJ A;  3B0U X;  2J0X A;  2HV6 A;  2E87 A;  4YT8 A;  5IY5 C;  3MLG A;  3ZVR A;  2FFH A;  3EZH A;  1V55 C;  2Y3H A;  3SYN A;  4DVZ A;  1LVK A;  4DBQ A;  2W4M A;  2GFH A;  5EGY A;  3DD7 A;  2VAS A;  3LS0 A;  4O6Y A;  1IW7 F;  2IYL D;  4DBR A;  2W45 A;  3ABK C;  5KYU B;  3NRH A;  2MWQ A;  3EHM A;  4LLC A;  5B1B C;  3UMH A;  4E7S A;  2J9W A;  2R7Q A;  2CW0 F;  3S28 A;  3PMR A;  1PD1 A;  4FWV A;  2D5R B;  3ZG1 A;  1O87 A;  2XRH A;  3FAJ A;  1NU7 D;  3E9V A;  3POV A;  2Y3B A;  2P7V A;  4ANJ A;  2YHS A;  4G7Z F;  2PFD A;  4BEJ A;  2IXM A;  4Q7C A;  5L3V A;  2FGY A;  3V7O A;  5E3C A;  1PCX A;  1OCZ C;  2KNH A;  1TWH A;  2W9Y A;  5E33 A;  2ZPA A;  4CS8 C;  4JUR I;  5KYX A;  3K33 A;  2BE5 F;  4JW1 A;  2WVN A;  3EZI A;  1LS1 A;  3DZA A;  1D1B A;  2HV7 A;  1ZHZ A;  3NYJ A;  2R7O A;  4AE4 B;  1VMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...