4AX2A

New type vi-secreted toxins and self-resistance proteins in serratia marcescens
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
124
Chain Sequence
QGHMAPIQDPVAFIKQMPYHQVVKELALSRCLAQVSDSDKAFSLDAARTANAMREWMPFDIESGDEKINVLIDKYKSRINEFHSKSQGVTLNCLRLYHSPELDKLSRQLIAGNPDRTWNQDNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Secreted Toxins and Immunity Proteins Encoded within the Type Vi Secretion System Gene Cluster of Serratia Marcescens
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Toxin
molecule keywords RAP1B
total genus 43
structure length 124
sequence length 128
ec nomenclature
pdb deposition date 2012-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ax2A01
4B6IA 4J30B 3ZIBA 4AX2A 4HFFB 4JURI 4HFKB 4J32B
chains in the Genus database with same CATH superfamily
1XZPA 3DJUB 1RJ9B 5B1BC 4DVYP 1ZU5A 1ORYA 2PF4E 3HNIA 3EG9B 4XEFA 3QVZA 2WZGA 3C62A 3DM9B 4IJJA 2YWAA 4KNWA 2R03A 1YYXA 2PP4A 2PNOA 3SEOA 4OD5A 4BJ6A 1Z23A 2GAQA 1QLEC 1CGME 2DYRC 1NZEA 2E87A 3F46A 3JTLO 2A0UA 3FVYA 2EPKX 4ANJA 3S90A 1E86A 3E9VA 1OW6A 3SZRA 2H7OA 2HFIA 4Q5SF 2B0HA 2YKZA 2WB7A 4JEAA 3B71A 3HJCA 3EPVA 2I15A 3FXHA 1JAFA 1QSPA 1A7DA 1ZU4A 4MVUA 3FOOA 2Q7RA 1E85A 3W8IA 3K66A 3DXJF 3LS1A 1H7IA 3B29A 2NUTB 1B68A 3G4XA 3LAYA 1QVXA 3L8JA 4DRHB 3HLZA 4EBJA 5B3IA 3FMSA 2YLDA 2Q3TA 2XXAA 1GQAA 1CPRA 3NKDA 3KPHA 3SXMA 1Z63A 1K05A 2EIJC 3IEEA 4Q7CA 4E7SA 3V5XA 2KK1A 4C3BA 2FGYA 5KYUB 2X0CA 3U8VA 1A7VA 1Q0DA 4G78A 5KYWB 1FMWA 3ZTZA 3W2WA 3IQTA 3NRHA 3ZTMA 2RD9A 4NTAA 2XSEA 3FAJA 5L0FA 3ABKC 1ZZPA 1K04A 2J45A 2VCBA 1C03A 3CAXA 3NMJA 2RSEB 4PJLA 3M4CA 2JPUA 4JURI 1PD1A 4PFOA 2Q00A 4XEVA 2DB4A 2J7PD 5L0DA 5KYXA 4KC9A 5KYYB 2YHSA 1LM3B 1WOLA 2QY9A 1VYIA 3IQ6A 4P6IC 4PJJA 5B3SC 4U5DE 3T4RA 3WG7C 1JPJA 3AG3C 1VLSA 3ABMC 3L1MA 3LLKA 2XS8A 4LERA 4MNDA 4MVRA 5D91A 2Y69C 256BA 4YN0B 4JW1A 1IZMA 4G7HF 1QQ3A 2A69F 2ICWG 4O6YA 2MYSA 4A2NB 2KGOA 2L7AA 3K1IA 5DQTA 2QTVA 4RD9A 3S29A 3EGDB 1TR2A 2J7PA 2YVKA 4YT2A 4HEAJ 5DS6A 1I4YA 2G3VA 4CS8A 1R5ID 4C3DA 4XPWA 3M4BA 2J8WA 4YT4A 2Y3BA 3SXYA 4BEJA 2X51A 2XM4A 4MW8A 4CJOA 5F5HA 4XWJA 3NMIA 4EBBA 1TFKB 2EPMX 2Y39A 2W9YA 1RKEB 4A4AA 3KYIA 5DLJA 2OEVA 3E70C 1T9KA 3BRJA 2L6HA 5E3CA 3I4UA 1O5HA 1V55C 4CS8C 3W8HA 3V5ZA 4YL0A 3CEXA 2KYHA 3UNGC 4AL1A 2G3KA 3RIPA 3POVA 1L3PA 2R7UA 1XWJA 4DOZA 2ZD9A 4J7TA 3C63A 3OA1A 4EIYA 2Q9CA 2IYLD 1YLMA 2ZXOA 4JEBA 4W8KA 4BG0A 2R9RB 2YQYA 2IOQA 1PD0A 2A68F 4D4NA 3FDQA 1JMWA 3OEOA 4DRIB 2XLMA 4NTFA 2IXPA 3U3BA 4G0HA 4Z9IA 3FHDA 3JYYA 1WTYA 2VH3A 2ZXRA 3ITFA 1A41A 1FTSA 1S05A 2J0XA 2P7VA 3HKKA 3Q6NA 3RQGA 4RBNA 4BJ1A 5KYNA 1NLXA 1V74B 3TQOA 5IY5C 4PK4A 5A6BA 3U8PA 1KNYA 4IAOA 1VLTA 5E2QA 4F4BA 1VYKA 4JRZA 4N6HA 4ZLDA 3TOLA 3ABLC 1TKNA 3N0TA 4LDQA 1YDIA 1U89A 3U5SA 4BJ5A 3EHNA 1NSGB 2A6EF 3R2PA 4FESA 4XTKA 5DS5A 2AVKA 1BZ4A 2YL1A 5FZTA 4M63A 4K1OA 1J8MF 4J7YA 4K0DA 2UUIA 1SMYF 2FFHA 4U5HA 3C8ZA 3FOPA 4FX5A 3O39A 1AVOB 4I3MA 2J46A 5DVWA 4OIPF 3DM5A 3WAQA 1M56C 1UG7A 1E84A 2AU5A 1NU9C 2BC5A 3EH2A 3VAYA 3KH2A 1M2VA 4I44A 1HE1A 2MHRA 3G50A 5JLIA 3RF3A 1LI5A 2NUPA 1VK5A 4PR9A 3RW0A 1HW2A 2OKUA 2V3CC 3AGUA 2LFFA 1G4WR 4JJGA 2R7WA 3ZQVA 2P0NA 3LEOA 4JTAB 1W2WA 4U5CE 5D92A 1M57C 3U3FA 2V26A 4MS2A 4BPMA 2AWYA 2DI3A 1GS9A 1SR2A 3KMIA 2WVQA 4PJNA 5AC5A 2QUPA 4YL1A 5T3WA 2LP4A 2F22A 2IBFA 1NG1A 1I4ZA 4O6MA 4HFKB 3SNHA 5A6KA 3LJBA 3VRCA 3B0PA 2J9VA 1WASA 1T5OA 3JSEO 1GGQA 1LPEA 1KU2A 1T01A 3K1IC 4ONSA 3ZWIA 1QZXA 1RMVA 3GEIA 2ZXPA 3W4YA 2BL2A 3LNMB 3UMHA 2XLHA 3C7JA 4DVZA 1ZYRF 2NG1A 3IPMO 3LUTB 3ATPA 4IWBA 4CJGA 2XL8A 3L34A 5A6JA 2R7VA 3FAPB 3N2ZB 2J9WA 1WATA 2G62A 3CZ6A 3O6XA 3OWTA 4FAPB 3J06A 1T6QA 2YRFA 1JOGA 2L81A 5GPGB 3HTKC 4E0IA 3BEHA 3GM3A 4QI2A 4AX2A 2P6VA 3H65A 1TWCA 2CNWD 4E18A 1DOWA 2J9UA 1CGNA 1N1CA 1Y4CA 2VASA 3DI5A 3HNKA 2A0BA 4LLEA 4NY3A 4WABA 3JSZA 4CX9A 2H7BA 2EPNA 5BQHA 1JR8A 4R32A 3A9CA 2TMVP 1HE9A 2DGJA 2Z15A 3G4ZA 1L7CA 1OXBA 1BBHA 4CS7A 4N6CA 2H7VC 5KYWA 5JS5A 1Q0FA 3H2UA 1EI7A 2PX3A 2VCCA 5DQZA 1E83A 1HMDA 3NG1A 4RDAA 3IHUA 1ZW3A 4QDLA 1HMOA 3JRTA 1D1BA 3KKBA 3EGXA 3LLIA 4NQFA 2R7OA 3NMKA 2HJ3A 2YL3A 4L6RA 4JJFA 4IAQA 5AGFA 2LCHA 4C7OB 1UFBA 2GFHA 2HJMA 2I8BA 2NUTA 1SYQA 3TD7A 3B0VC 4EBKA 2A1DD 3ECSA 3US6A 1FFHA 1M2VB 4JC7A 4QI0A 1U6HA 2VB6A 3DAGA 3ZG1A 1EKYA 2L6FA 3O10A 4YJWA 5A6BD 2DYSC 2L9JA 4NC3A 1PV3A 1YA9A 4X0RA 3PHF2 1BR2A 1YYJA 1LKXA 3ZQYA 3K1HA 3T6GB 3RH3A 1OCRC 5T3TA 4JIOA 3RQFA 1MMNA 2LSEA 1LE2A 2OU6A 2QNLA 2XLOA 1ST6A 4YL3A 1J8YF 1D1AA 3LESA 4LDKA 4EWCA 2VC9A 3JZ0A 4XLNF 5A6AA 1OCOC 5JVEA 2P1AA 3B9QA 2OCCC 2R7RA 1APCA 1M2OA 1RKEA 2W4MA 3ASOC 4MVOA 5B1AC 2R7TA 1MMDA 3C18A 2J9BA 4MVZA 2QE9A 4YK5A 3CQZA 3QW0A 4PFPA 2KJGA 2PFDA 4OD4A 2EINC 1SZIA 2VCAA 3F47A 3I5PA 4MVMA 4NTBA 4ZLCA 1AEPA 2WVNA 2BE5F 3SP1A 2HMZA 2PBEA 4PACA 1D0ZA 3LEVA 4CSAA 1TWGA 4PJMA 2CGEA 4FWVA 4AE4A 3EJNA 1ORJA 2YLGA 4CDAA 2HSQA 1R4TA 5KYYA 1FMVA 3T9OA 1A7EA 1OR2A 3UGPA 2HUJA 4N4WA 3RQEA 2R7SA 3UMKA 3U9JA 1BDJB 3SXZA 2ZXWC 5CI9A 1HW1A 4E7ZA 1FFTC 4XQ1A 2MWQA 4MTOA 5BQIA 4CS9A 1T6IA 1LIHA 5AC4A 5F5FA 2IM8A 1OKKA 5COMA 3S84A 4Z9JA 3S28A 1WGWA 2YL0A 3IQCA 3NYLA 4U5FE 1YVIA 1OCZC 3RKOF 5HV9A 3R7CA 1YAUO 4WGYA 4J30B 1TWAA 1Z6AA 3GORA 2EPLX 4CDVA 2GWWA 2O9XA 1OR3A 2CDQA 3EFOA 3EZHA 3QTHA 2OOCA 4JTCB 3VF0A 1KTMA 1YZAA 1OKKD 4W8PA 1CPQA 2KSFA 2YZSA 3DKAA 3JRMO 4E17A 3K33A 4JZAA 4U5BE 2R05A 5E33A 4XPXA 4N06A 1D0XA 1IW7F 4U5GA 3JT1A 5JUAA 3O55A 2W45A 4P9FA 1DOVA 4AL0A 2NSFA 4UDVA 1QPUA 2CNWA 4O7GA 2XLEA 5F28E 4CSAC 2FAPB 4H54A 4HFFB 2HS5A 2KW3C 2OJED 2IXMA 2D4UA 2OQMA 3UR3C 4EUKB 3NYMA 3QW1A 2QLAA 3GM2A 4BEMJ 3EHMA 3HNJA 1A0BA 2HZ8A 3GANA 5CIVA 1Q0MA 3MBGA 2WL8A 1SF8A 3DJNB 4U9EA 3DZAA 3EZIA 3PCVA 3RVYA 4OIOF 3QMKA 3DMDA 2A6HF 4WJ0A 5COGA 1AUEA 4LDRA 1F1MA 1V4AA 4YT5A 3TK0A 3VYWA 1YARO 4JVSA 3KL4A 2H8AA 3GWLA 2M4EA 4J32B 3K7DA 1MMAA 4YT8A 4BJTA 4H4KC 2UUHA 3EH1A 4YWQA 3N24A 1ZHYA 4DRJB 1H9TA 1O87A 4IGGA 1MNEA 2CCYA 4DBRA 3JCUQ 4U5EE 4WGZA 3RFYA 1I5NA 3LNRA 1T6UA 1WWPA 1JPNA 2PX0A 1VMAA 2Y3HA 1E2XA 1D0YA 1VOMA 2M64A 3AG1C 1EA8A 2R02A 4OINF 3NDBB 1G8XA 3ASNC 1VB5A 1ZHWA 4CIPA 1Y6DA 3TJ6A 4GQHA 3S9OA 4C3EA 1RJ9A 3SYNA 3DAFA 1ZHZA 2LQGA 4IARA 5BQGA 4BJ6C 4ER9A 2L6GA 1WN0A 1JRAA 1TWHA 1Z3IX 2EIMC 4XPYA 4G7OF 1G5ZA 3VM6A 2KC3A 4C7OA 4CDYA 4MVSA 2XL6A 1YJGA 1OW7A 3DE9A 3EFOB 5KYUA 4JTDB 3UMIA 1ZHTA 4MVQA 4MTFA 1NFNA 2CYDA 3AJMA 5COFA 2Y3GA 1NU7D 2WVOA 3SXKA 5DS4A 1ZHXA 3AG2C 3T6JA 1MMGA 3V7OA 3W2VA 3WHNA 3ZVRA 1D1CA 5BUOA 2EILC 2GDCA 3GM1A 4DJ9A 4EHPA 2HV7A 4GYTA 5EK0A 3MX3A 3IQ5A 2P61A 3DD7A 4NCQA 5EHHA 3U9MA 4OIQF 1NFOA 2ETSA 2YEVA 2ZPAA 3NKEA 2XXAB 4G7ZF 1LS4A 4JKVA 2D5RB 2EPOA 2YL7A 1H9GA 1OCCC 1MQVA 2KQ9A 3GWNA 3EGDA 5E3AA 2WZFA 2LFDA 2B0JA 4JE9A 2NPUA 3NYJA 3M15A 3CSKA 4IRUA 4MW3A 1GM5A 1OW8A 3Q7LA 4E0HA 3PMRA 2OJQA 3M1CB 3KYJA 3B0UX 1H6GA 2AWCA 4JCZA 3ZIBA 1V54C 4IB4A 2OEXA 4Z9HA 1FR0A 1XZQA 3A11A 3EGXB 3QVYA 1RKCA 5T1DB 5L3QA 4XLPF 3V5YA 2HV6A 5L0HA 4D4XA 2WZLA 1FAPB 3AQCA 3Q7GA 4I1MA 3RYLA 2OG2A 2IXNA 2HMQA 2LK4A 2Q9BA 4HE8D 2CW0F 5JT4A 4AE4B 1BR1A 1C17M 3S0XA 1Z7Qc 2LIGA 4P9TA 1Q0GA 2XLVA 5L0GA 5TJ5E 5JSLA 4KNVA 2YLIA 3PDMP 1M6TA 1S7ZA 1ZVZA 3RVZA 4CBEA 5JRAA 1PCXA 1CGOA 2KNHA 4KI2A 3EG9A 1ZW2A 4U9DA 4CS9C 3T6BA 2ASRA 2Q9AA 1YA7O 1ORSC 2Q4FA 2NSGA 2HKVA 3U2LA 2XL4A 3GODA 3GEHA 2R7XA 3TOMA 4O79A 3HNLA 3AOUA 1RXQA 2C04A 1K40A 2XLDA 3X2QC 2R7QA 1LI7A 2GA0A 3ZSUA 3K6BA 2J0WA 1TFOB 4ULWA 5CI8A 4OIRF 1OQCA 5JP7A 3AGTA 4AK9A 3I5QA 1BR4A 3QZCA 4DXWA 4MTGA 3ZC4A 3C8GB 4LLCA 3UGOA 4Q4ZF 3M79A 3L8IA 1YZCA 3X1OA 5L0IA 1RCPA 3MYFA 1EQ1A 1Z5ZA 4GEHA 3H2VA 2LD6A 1TQGA 4EKWA 4I1OB 1Q0KA 4JCHA 4LACB 3MFNA 3S27A 3TULA 2HSBA 3U0CA 2IXOA 1LS1A 2XRHA 2AP3A 3AG4C 5A69A 5EGYA 2NUPB 5L0JA 4ULVA 3AQBA 5K0IA 1FNTc 4CIHA 3U2MA 3ZDLA 3DE8A 4BJ5C 2XS1A 2JX0A 2C03A 4B6IA 3Q6MA 1O3UA 1OXKA 4XEKA 3GEEA 3LS0A 2XLWA 2W4BA 3C8GA 5FCLA 5KYXB 3MLGA 2R25A 2XM0A 2JD3A 1G4US 1LVKA 4DBQA 3L0IA 2EIKC 1U0BB 5L3VA 5HSWA 3JYHA 4MQ9F 5L0CA 4K7BA 3EQLF 2Y3DA 1HY5A 1QKRA 3WODF 1NBBA 1C02A 1LE4A 3DWWA 4KBLA 1VTMP 3TJ5A 3C8GD 4O6NA 1MNDA 3MYIA
chains in the Genus database with same CATH topology
3DJUB 1RJ9B 5B1BC 4DVYP 1ZU5A 2PF4E 3EG9B 2WZGA 3DM9B 4IJJA 4KNWA 2PP4A 3SEOA 4OD5A 4BJ6A 1Z23A 1QLEC 2DYRC 1NZEA 2E87A 3F46A 3FVYA 4ANJA 3E9VA 3SZRA 2H7OA 4Q5SF 2WB7A 3HJCA 3EPVA 1ZU4A 3W8IA 3K66A 3DXJF 3LS1A 2NUTB 3LAYA 3HLZA 2Q3TA 2XXAA 3NKDA 1Z63A 2EIJC 3IEEA 4Q7CA 4E7SA 4C3BA 2FGYA 5KYWB 1FMWA 3W2WA 3NRHA 2XSEA 3FAJA 3ABKC 2J45A 4PJLA 4JURI 4KI2A 1PD1A 4PFOA 2J7PD 5KYXA 4KC9A 5KYYB 2YHSA 2QY9A 1VYIA 4P6IC 5B3SC 4PJJA 4U5DE 3T4RA 3WG7C 1JPJA 3AG3C 3LLKA 3ABMC 4LERA 4MNDA 5D91A 5KYUB 4G7ZF 2Y69C 4YN0B 4JW1A 1IZMA 4G7HF 2A69F 4O6YA 5DQTA 4A2NB 2MYSA 2KGOA 2QTVA 4RD9A 3S29A 3EGDB 1TR2A 2J7PA 4YT2A 4HEAJ 5DS6A 2G3VA 4CS8A 4C3DA 4YT4A 2Y3BA 4BEJA 2X51A 5F5HA 4XWJA 4EBBA 2Y39A 2W9YA 5DLJA 3E70C 5E3CA 3I4UA 1O5HA 1V55C 4CS8C 3W8HA 3UNGC 2G3KA 3RIPA 3POVA 2R7UA 4DOZA 3OA1A 2Q9CA 2IYLD 2ZXOA 4W8KA 4BG0A 2IOQA 1PD0A 2A68F 3FDQA 3OEOA 2IXPA 4G0HA 3FHDA 2VH3A 2ZXRA 3ITFA 3Q6NA 1FTSA 2J0XA 2P7VA 5KYNA 4BJ1A 4RBNA 5IY5C 4PK4A 4IAOA 5E2QA 4F4BA 1VYKA 4ZLDA 3ABLC 1TKNA 3N0TA 4BJ5A 3EHNA 2A6EF 4FESA 4XTKA 5DS5A 4M63A 1J8MF 4K0DA 1SMYF 2FFHA 4U5HA 4FX5A 3O39A 4I3MA 2J46A 5DVWA 4OIPF 3DM5A 1M56C 1NU9C 3EH2A 3VAYA 3KH2A 1M2VA 4I44A 2NUPA 1VK5A 2V3CC 4JJGA 2R7WA 4U5CE 5D92A 1W2WA 1M57C 2V26A 3KMIA 2WVQA 4PJNA 5T3WA 1NG1A 3SNHA 4O6MA 4HFKB 3LJBA 3B0PA 2J9VA 3K1IC 1KU2A 1QZXA 2ZXPA 3UMHA 4DVZA 1ZYRF 2NG1A 2R7VA 4IWBA 3L34A 3N2ZB 2J9WA 3O6XA 2G62A 3CZ6A 3OWTA 2L81A 3HTKC 4QI2A 4AX2A 2P6VA 3H65A 1TWCA 2CNWD 2J9UA 1N1CA 2VASA 4NY3A 4LLEA 3JSZA 2H7BA 2Z15A 2DGJA 4CS7A 2H7VC 5KYWA 5DQZA 2PX3A 3NG1A 4RDAA 4QDLA 3JRTA 1D1BA 3LLIA 3EGXA 3KKBA 2R7OA 4JJFA 4C7OB 2GFHA 2I8BA 2NUTA 3TD7A 3B0VC 2A1DD 3ECSA 1FFHA 1M2VB 4QI0A 2VB6A 3DAGA 3ZG1A 4YJWA 2DYSC 2L9JA 3PHF2 4X0RA 1BR2A 1LKXA 3K1HA 3RH3A 1OCRC 5T3TA 1MMNA 2LSEA 1ST6A 1J8YF 1D1AA 3LESA 4EWCA 4XLNF 1OCOC 3B9QA 2OCCC 2R7RA 5B1AC 1M2OA 3ASOC 2W4MA 2R7TA 1MMDA 3CQZA 4PFPA 2KJGA 2PFDA 4OD4A 2EINC 1SZIA 3F47A 3I5PA 4ZLCA 2WVNA 2BE5F 3SP1A 1D0ZA 3LEVA 4CSAA 1TWGA 4PJMA 2CGEA 4FWVA 4AE4A 3EJNA 5KYYA 1FMVA 3UGPA 2R7SA 3UMKA 2ZXWC 5CI9A 4E7ZA 1FFTC 2MWQA 4CS9A 5F5FA 1OKKA 3S28A 1WGWA 3NYLA 4U5FE 1OCZC 3RKOF 4J30B 1TWAA 1Z6AA 2O9XA 3EFOA 2CDQA 3EZHA 1OKKD 2YZSA 3K33A 4JZAA 4U5BE 5E33A 4N06A 1D0XA 1IW7F 4U5GA 3JT1A 2W45A 2CNWA 4O7GA 4CSAC 4HFFB 2KW3C 2IXMA 3UR3C 3NYMA 3EHMA 3GANA 2WL8A 1SF8A 3DJNB 3DZAA 3EZIA 4OIOF 3QMKA 3DMDA 2A6HF 4WJ0A 4YT5A 3VYWA 4JVSA 3KL4A 2M4EA 4J32B 3K7DA 1MMAA 4YT8A 4BJTA 4H4KC 3EH1A 4YWQA 3N24A 1ZHYA 1O87A 1MNEA 4DBRA 3JCUQ 4U5EE 3RFYA 3LNRA 2PX0A 1JPNA 2Y3HA 1VMAA 1D0YA 1VOMA 3AG1C 4OINF 3NDBB 1G8XA 3ASNC 1ZHWA 4C3EA 1RJ9A 3SYNA 3DAFA 1ZHZA 4BJ6C 1Z3IX 1TWHA 2EIMC 4G7OF 4C7OA 5DS4A 3UMIA 5KYUA 3EFOB 1ZHTA 2Y3GA 1NU7D 2WVOA 1ZHXA 3AG2C 3T6JA 1MMGA 3V7OA 3W2VA 3ZVRA 5BUOA 1D1CA 2EILC 2HV7A 4GYTA 3MX3A 3DD7A 4OIQF 5EHHA 2YEVA 2ZPAA 3NKEA 2XXAB 2D5RB 1OCCC 2KQ9A 3EGDA 5E3AA 2WZFA 2B0JA 3NYJA 3CSKA 4IRUA 3Q7LA 3PMRA 3M1CB 3B0UX 3ZIBA 1V54C 3EGXB 5T1DB 5L3QA 4XLPF 2HV6A 2WZLA 3AQCA 3RYLA 3Q7GA 4I1MA 2OG2A 2IXNA 4HE8D 2Q9BA 2CW0F 4AE4B 1BR1A 3S0XA 4KNVA 1S7ZA 4CBEA 1PCXA 2KNHA 3EG9A 4CS9C 3T6BA 2Q9AA 2XL4A 3GODA 2R7XA 4O79A 2C04A 3X2QC 2R7QA 3ZSUA 3K6BA 2J0WA 4ULWA 5CI8A 4OIRF 4AK9A 3I5QA 1BR4A 3QZCA 3ZC4A 4LLCA 3UGOA 4Q4ZF 3X1OA 1Z5ZA 4GEHA 4I1OB 4LACB 4JCHA 3S27A 2IXOA 1LS1A 2XRHA 3AG4C 5EGYA 2NUPB 3AQBA 4CIHA 4BJ5C 2C03A 4B6IA 3Q6MA 3LS0A 2W4BA 5FCLA 5KYXB 3MLGA 2JD3A 1LVKA 4DBQA 3L0IA 2EIKC 5L3VA 5HSWA 3JYHA 4MQ9F 4K7BA 3EQLF 2Y3DA 3WODF 4KBLA 4O6NA 1MNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B6I A;  4J30 B;  3ZIB A;  4AX2 A;  4HFF B;  4JUR I;  4HFK B;  4J32 B; 
#chains in the Genus database with same CATH topology
 1XZP A;  3DJU B;  1RJ9 B;  5B1B C;  4DVY P;  1ZU5 A;  1ORY A;  2PF4 E;  3HNI A;  3EG9 B;  4XEF A;  3QVZ A;  2WZG A;  3C62 A;  3DM9 B;  4IJJ A;  2YWA A;  4KNW A;  2R03 A;  1YYX A;  2PP4 A;  2PNO A;  3SEO A;  4OD5 A;  4BJ6 A;  1Z23 A;  2GAQ A;  1QLE C;  1CGM E;  2DYR C;  1NZE A;  2E87 A;  3F46 A;  3JTL O;  2A0U A;  3FVY A;  2EPK X;  4ANJ A;  3S90 A;  1E86 A;  3E9V A;  1OW6 A;  3SZR A;  2H7O A;  2HFI A;  4Q5S F;  2B0H A;  2YKZ A;  2WB7 A;  4JEA A;  3B71 A;  3HJC A;  3EPV A;  2I15 A;  3FXH A;  1JAF A;  1QSP A;  1A7D A;  1ZU4 A;  4MVU A;  3FOO A;  2Q7R A;  1E85 A;  3W8I A;  3K66 A;  3DXJ F;  3LS1 A;  1H7I A;  3B29 A;  2NUT B;  1B68 A;  3G4X A;  3LAY A;  1QVX A;  3L8J A;  4DRH B;  3HLZ A;  4EBJ A;  5B3I A;  3FMS A;  2YLD A;  2Q3T A;  2XXA A;  1GQA A;  1CPR A;  3NKD A;  3KPH A;  3SXM A;  1Z63 A;  1K05 A;  2EIJ C;  3IEE A;  4Q7C A;  4E7S A;  3V5X A;  2KK1 A;  4C3B A;  2FGY A;  5KYU B;  2X0C A;  3U8V A;  1A7V A;  1Q0D A;  4G78 A;  5KYW B;  1FMW A;  3ZTZ A;  3W2W A;  3IQT A;  3NRH A;  3ZTM A;  2RD9 A;  4NTA A;  2XSE A;  3FAJ A;  5L0F A;  3ABK C;  1ZZP A;  1K04 A;  2J45 A;  2VCB A;  1C03 A;  3CAX A;  3NMJ A;  2RSE B;  4PJL A;  3M4C A;  2JPU A;  4JUR I;  1PD1 A;  4PFO A;  2Q00 A;  4XEV A;  2DB4 A;  2J7P D;  5L0D A;  5KYX A;  4KC9 A;  5KYY B;  2YHS A;  1LM3 B;  1WOL A;  2QY9 A;  1VYI A;  3IQ6 A;  4P6I C;  4PJJ A;  5B3S C;  4U5D E;  3T4R A;  3WG7 C;  1JPJ A;  3AG3 C;  1VLS A;  3ABM C;  3L1M A;  3LLK A;  2XS8 A;  4LER A;  4MND A;  4MVR A;  5D91 A;  2Y69 C;  256B A;  4YN0 B;  4JW1 A;  1IZM A;  4G7H F;  1QQ3 A;  2A69 F;  2ICW G;  4O6Y A;  2MYS A;  4A2N B;  2KGO A;  2L7A A;  3K1I A;  5DQT A;  2QTV A;  4RD9 A;  3S29 A;  3EGD B;  1TR2 A;  2J7P A;  2YVK A;  4YT2 A;  4HEA J;  5DS6 A;  1I4Y A;  2G3V A;  4CS8 A;  1R5I D;  4C3D A;  4XPW A;  3M4B A;  2J8W A;  4YT4 A;  2Y3B A;  3SXY A;  4BEJ A;  2X51 A;  2XM4 A;  4MW8 A;  4CJO A;  5F5H A;  4XWJ A;  3NMI A;  4EBB A;  1TFK B;  2EPM X;  2Y39 A;  2W9Y A;  1RKE B;  4A4A A;  3KYI A;  5DLJ A;  2OEV A;  3E70 C;  1T9K A;  3BRJ A;  2L6H A;  5E3C A;  3I4U A;  1O5H A;  1V55 C;  4CS8 C;  3W8H A;  3V5Z A;  4YL0 A;  3CEX A;  2KYH A;  3UNG C;  4AL1 A;  2G3K A;  3RIP A;  3POV A;  1L3P A;  2R7U A;  1XWJ A;  4DOZ A;  2ZD9 A;  4J7T A;  3C63 A;  3OA1 A;  4EIY A;  2Q9C A;  2IYL D;  1YLM A;  2ZXO A;  4JEB A;  4W8K A;  4BG0 A;  2R9R B;  2YQY A;  2IOQ A;  1PD0 A;  2A68 F;  4D4N A;  3FDQ A;  1JMW A;  3OEO A;  4DRI B;  2XLM A;  4NTF A;  2IXP A;  3U3B A;  4G0H A;  4Z9I A;  3FHD A;  3JYY A;  1WTY A;  2VH3 A;  2ZXR A;  3ITF A;  1A41 A;  1FTS A;  1S05 A;  2J0X A;  2P7V A;  3HKK A;  3Q6N A;  3RQG A;  4RBN A;  4BJ1 A;  5KYN A;  1NLX A;  1V74 B;  3TQO A;  5IY5 C;  4PK4 A;  5A6B A;  3U8P A;  1KNY A;  4IAO A;  1VLT A;  5E2Q A;  4F4B A;  1VYK A;  4JRZ A;  4N6H A;  4ZLD A;  3TOL A;  3ABL C;  1TKN A;  3N0T A;  4LDQ A;  1YDI A;  1U89 A;  3U5S A;  4BJ5 A;  3EHN A;  1NSG B;  2A6E F;  3R2P A;  4FES A;  4XTK A;  5DS5 A;  2AVK A;  1BZ4 A;  2YL1 A;  5FZT A;  4M63 A;  4K1O A;  1J8M F;  4J7Y A;  4K0D A;  2UUI A;  1SMY F;  2FFH A;  4U5H A;  3C8Z A;  3FOP A;  4FX5 A;  3O39 A;  1AVO B;  4I3M A;  2J46 A;  5DVW A;  4OIP F;  3DM5 A;  3WAQ A;  1M56 C;  1UG7 A;  1E84 A;  2AU5 A;  1NU9 C;  2BC5 A;  3EH2 A;  3VAY A;  3KH2 A;  1M2V A;  4I44 A;  1HE1 A;  2MHR A;  3G50 A;  5JLI A;  3RF3 A;  1LI5 A;  2NUP A;  1VK5 A;  4PR9 A;  3RW0 A;  1HW2 A;  2OKU A;  2V3C C;  3AGU A;  2LFF A;  1G4W R;  4JJG A;  2R7W A;  3ZQV A;  2P0N A;  3LEO A;  4JTA B;  1W2W A;  4U5C E;  5D92 A;  1M57 C;  3U3F A;  2V26 A;  4MS2 A;  4BPM A;  2AWY A;  2DI3 A;  1GS9 A;  1SR2 A;  3KMI A;  2WVQ A;  4PJN A;  5AC5 A;  2QUP A;  4YL1 A;  5T3W A;  2LP4 A;  2F22 A;  2IBF A;  1NG1 A;  1I4Z A;  4O6M A;  4HFK B;  3SNH A;  5A6K A;  3LJB A;  3VRC A;  3B0P A;  2J9V A;  1WAS A;  1T5O A;  3JSE O;  1GGQ A;  1LPE A;  1KU2 A;  1T01 A;  3K1I C;  4ONS A;  3ZWI A;  1QZX A;  1RMV A;  3GEI A;  2ZXP A;  3W4Y A;  2BL2 A;  3LNM B;  3UMH A;  2XLH A;  3C7J A;  4DVZ A;  1ZYR F;  2NG1 A;  3IPM O;  3LUT B;  3ATP A;  4IWB A;  4CJG A;  2XL8 A;  3L34 A;  5A6J A;  2R7V A;  3FAP B;  3N2Z B;  2J9W A;  1WAT A;  2G62 A;  3CZ6 A;  3O6X A;  3OWT A;  4FAP B;  3J06 A;  1T6Q A;  2YRF A;  1JOG A;  2L81 A;  5GPG B;  3HTK C;  4E0I A;  3BEH A;  3GM3 A;  4QI2 A;  4AX2 A;  2P6V A;  3H65 A;  1TWC A;  2CNW D;  4E18 A;  1DOW A;  2J9U A;  1CGN A;  1N1C A;  1Y4C A;  2VAS A;  3DI5 A;  3HNK A;  2A0B A;  4LLE A;  4NY3 A;  4WAB A;  3JSZ A;  4CX9 A;  2H7B A;  2EPN A;  5BQH A;  1JR8 A;  4R32 A;  3A9C A;  2TMV P;  1HE9 A;  2DGJ A;  2Z15 A;  3G4Z A;  1L7C A;  1OXB A;  1BBH A;  4CS7 A;  4N6C A;  2H7V C;  5KYW A;  5JS5 A;  1Q0F A;  3H2U A;  1EI7 A;  2PX3 A;  2VCC A;  5DQZ A;  1E83 A;  1HMD A;  3NG1 A;  4RDA A;  3IHU A;  1ZW3 A;  4QDL A;  1HMO A;  3JRT A;  1D1B A;  3KKB A;  3EGX A;  3LLI A;  4NQF A;  2R7O A;  3NMK A;  2HJ3 A;  2YL3 A;  4L6R A;  4JJF A;  4IAQ A;  5AGF A;  2LCH A;  4C7O B;  1UFB A;  2GFH A;  2HJM A;  2I8B A;  2NUT A;  1SYQ A;  3TD7 A;  3B0V C;  4EBK A;  2A1D D;  3ECS A;  3US6 A;  1FFH A;  1M2V B;  4JC7 A;  4QI0 A;  1U6H A;  2VB6 A;  3DAG A;  3ZG1 A;  1EKY A;  2L6F A;  3O10 A;  4YJW A;  5A6B D;  2DYS C;  2L9J A;  4NC3 A;  1PV3 A;  1YA9 A;  4X0R A;  3PHF 2;  1BR2 A;  1YYJ A;  1LKX A;  3ZQY A;  3K1H A;  3T6G B;  3RH3 A;  1OCR C;  5T3T A;  4JIO A;  3RQF A;  1MMN A;  2LSE A;  1LE2 A;  2OU6 A;  2QNL A;  2XLO A;  1ST6 A;  4YL3 A;  1J8Y F;  1D1A A;  3LES A;  4LDK A;  4EWC A;  2VC9 A;  3JZ0 A;  4XLN F;  5A6A A;  1OCO C;  5JVE A;  2P1A A;  3B9Q A;  2OCC C;  2R7R A;  1APC A;  1M2O A;  1RKE A;  2W4M A;  3ASO C;  4MVO A;  5B1A C;  2R7T A;  1MMD A;  3C18 A;  2J9B A;  4MVZ A;  2QE9 A;  4YK5 A;  3CQZ A;  3QW0 A;  4PFP A;  2KJG A;  2PFD A;  4OD4 A;  2EIN C;  1SZI A;  2VCA A;  3F47 A;  3I5P A;  4MVM A;  4NTB A;  4ZLC A;  1AEP A;  2WVN A;  2BE5 F;  3SP1 A;  2HMZ A;  2PBE A;  4PAC A;  1D0Z A;  3LEV A;  4CSA A;  1TWG A;  4PJM A;  2CGE A;  4FWV A;  4AE4 A;  3EJN A;  1ORJ A;  2YLG A;  4CDA A;  2HSQ A;  1R4T A;  5KYY A;  1FMV A;  3T9O A;  1A7E A;  1OR2 A;  3UGP A;  2HUJ A;  4N4W A;  3RQE A;  2R7S A;  3UMK A;  3U9J A;  1BDJ B;  3SXZ A;  2ZXW C;  5CI9 A;  1HW1 A;  4E7Z A;  1FFT C;  4XQ1 A;  2MWQ A;  4MTO A;  5BQI A;  4CS9 A;  1T6I A;  1LIH A;  5AC4 A;  5F5F A;  2IM8 A;  1OKK A;  5COM A;  3S84 A;  4Z9J A;  3S28 A;  1WGW A;  2YL0 A;  3IQC A;  3NYL A;  4U5F E;  1YVI A;  1OCZ C;  3RKO F;  5HV9 A;  3R7C A;  1YAU O;  4WGY A;  4J30 B;  1TWA A;  1Z6A A;  3GOR A;  2EPL X;  4CDV A;  2GWW A;  2O9X A;  1OR3 A;  2CDQ A;  3EFO A;  3EZH A;  3QTH A;  2OOC A;  4JTC B;  3VF0 A;  1KTM A;  1YZA A;  1OKK D;  4W8P A;  1CPQ A;  2KSF A;  2YZS A;  3DKA A;  3JRM O;  4E17 A;  3K33 A;  4JZA A;  4U5B E;  2R05 A;  5E33 A;  4XPX A;  4N06 A;  1D0X A;  1IW7 F;  4U5G A;  3JT1 A;  5JUA A;  3O55 A;  2W45 A;  4P9F A;  1DOV A;  4AL0 A;  2NSF A;  4UDV A;  1QPU A;  2CNW A;  4O7G A;  2XLE A;  5F28 E;  4CSA C;  2FAP B;  4H54 A;  4HFF B;  2HS5 A;  2KW3 C;  2OJE D;  2IXM A;  2D4U A;  2OQM A;  3UR3 C;  4EUK B;  3NYM A;  3QW1 A;  2QLA A;  3GM2 A;  4BEM J;  3EHM A;  3HNJ A;  1A0B A;  2HZ8 A;  3GAN A;  5CIV A;  1Q0M A;  3MBG A;  2WL8 A;  1SF8 A;  3DJN B;  4U9E A;  3DZA A;  3EZI A;  3PCV A;  3RVY A;  4OIO F;  3QMK A;  3DMD A;  2A6H F;  4WJ0 A;  5COG A;  1AUE A;  4LDR A;  1F1M A;  1V4A A;  4YT5 A;  3TK0 A;  3VYW A;  1YAR O;  4JVS A;  3KL4 A;  2H8A A;  3GWL A;  2M4E A;  4J32 B;  3K7D A;  1MMA A;  4YT8 A;  4BJT A;  4H4K C;  2UUH A;  3EH1 A;  4YWQ A;  3N24 A;  1ZHY A;  4DRJ B;  1H9T A;  1O87 A;  4IGG A;  1MNE A;  2CCY A;  4DBR A;  3JCU Q;  4U5E E;  4WGZ A;  3RFY A;  1I5N A;  3LNR A;  1T6U A;  1WWP A;  1JPN A;  2PX0 A;  1VMA A;  2Y3H A;  1E2X A;  1D0Y A;  1VOM A;  2M64 A;  3AG1 C;  1EA8 A;  2R02 A;  4OIN F;  3NDB B;  1G8X A;  3ASN C;  1VB5 A;  1ZHW A;  4CIP A;  1Y6D A;  3TJ6 A;  4GQH A;  3S9O A;  4C3E A;  1RJ9 A;  3SYN A;  3DAF A;  1ZHZ A;  2LQG A;  4IAR A;  5BQG A;  4BJ6 C;  4ER9 A;  2L6G A;  1WN0 A;  1JRA A;  1TWH A;  1Z3I X;  2EIM C;  4XPY A;  4G7O F;  1G5Z A;  3VM6 A;  2KC3 A;  4C7O A;  4CDY A;  4MVS A;  2XL6 A;  1YJG A;  1OW7 A;  3DE9 A;  3EFO B;  5KYU A;  4JTD B;  3UMI A;  1ZHT A;  4MVQ A;  4MTF A;  1NFN A;  2CYD A;  3AJM A;  5COF A;  2Y3G A;  1NU7 D;  2WVO A;  3SXK A;  5DS4 A;  1ZHX A;  3AG2 C;  3T6J A;  1MMG A;  3V7O A;  3W2V A;  3WHN A;  3ZVR A;  1D1C A;  5BUO A;  2EIL C;  2GDC A;  3GM1 A;  4DJ9 A;  4EHP A;  2HV7 A;  4GYT A;  5EK0 A;  3MX3 A;  3IQ5 A;  2P61 A;  3DD7 A;  4NCQ A;  5EHH A;  3U9M A;  4OIQ F;  1NFO A;  2ETS A;  2YEV A;  2ZPA A;  3NKE A;  2XXA B;  4G7Z F;  1LS4 A;  4JKV A;  2D5R B;  2EPO A;  2YL7 A;  1H9G A;  1OCC C;  1MQV A;  2KQ9 A;  3GWN A;  3EGD A;  5E3A A;  2WZF A;  2LFD A;  2B0J A;  4JE9 A;  2NPU A;  3NYJ A;  3M15 A;  3CSK A;  4IRU A;  4MW3 A;  1GM5 A;  1OW8 A;  3Q7L A;  4E0H A;  3PMR A;  2OJQ A;  3M1C B;  3KYJ A;  3B0U X;  1H6G A;  2AWC A;  4JCZ A;  3ZIB A;  1V54 C;  4IB4 A;  2OEX A;  4Z9H A;  1FR0 A;  1XZQ A;  3A11 A;  3EGX B;  3QVY A;  1RKC A;  5T1D B;  5L3Q A;  4XLP F;  3V5Y A;  2HV6 A;  5L0H A;  4D4X A;  2WZL A;  1FAP B;  3AQC A;  3Q7G A;  4I1M A;  3RYL A;  2OG2 A;  2IXN A;  2HMQ A;  2LK4 A;  2Q9B A;  4HE8 D;  2CW0 F;  5JT4 A;  4AE4 B;  1BR1 A;  1C17 M;  3S0X A;  1Z7Q c;  2LIG A;  4P9T A;  1Q0G A;  2XLV A;  5L0G A;  5TJ5 E;  5JSL A;  4KNV A;  2YLI A;  3PDM P;  1M6T A;  1S7Z A;  1ZVZ A;  3RVZ A;  4CBE A;  5JRA A;  1PCX A;  1CGO A;  2KNH A;  4KI2 A;  3EG9 A;  1ZW2 A;  4U9D A;  4CS9 C;  3T6B A;  2ASR A;  2Q9A A;  1YA7 O;  1ORS C;  2Q4F A;  2NSG A;  2HKV A;  3U2L A;  2XL4 A;  3GOD A;  3GEH A;  2R7X A;  3TOM A;  4O79 A;  3HNL A;  3AOU A;  1RXQ A;  2C04 A;  1K40 A;  2XLD A;  3X2Q C;  2R7Q A;  1LI7 A;  2GA0 A;  3ZSU A;  3K6B A;  2J0W A;  1TFO B;  4ULW A;  5CI8 A;  4OIR F;  1OQC A;  5JP7 A;  3AGT A;  4AK9 A;  3I5Q A;  1BR4 A;  3QZC A;  4DXW A;  4MTG A;  3ZC4 A;  3C8G B;  4LLC A;  3UGO A;  4Q4Z F;  3M79 A;  3L8I A;  1YZC A;  3X1O A;  5L0I A;  1RCP A;  3MYF A;  1EQ1 A;  1Z5Z A;  4GEH A;  3H2V A;  2LD6 A;  1TQG A;  4EKW A;  4I1O B;  1Q0K A;  4JCH A;  4LAC B;  3MFN A;  3S27 A;  3TUL A;  2HSB A;  3U0C A;  2IXO A;  1LS1 A;  2XRH A;  2AP3 A;  3AG4 C;  5A69 A;  5EGY A;  2NUP B;  5L0J A;  4ULV A;  3AQB A;  5K0I A;  1FNT c;  4CIH A;  3U2M A;  3ZDL A;  3DE8 A;  4BJ5 C;  2XS1 A;  2JX0 A;  2C03 A;  4B6I A;  3Q6M A;  1O3U A;  1OXK A;  4XEK A;  3GEE A;  3LS0 A;  2XLW A;  2W4B A;  3C8G A;  5FCL A;  5KYX B;  3MLG A;  2R25 A;  2XM0 A;  2JD3 A;  1G4U S;  1LVK A;  4DBQ A;  3L0I A;  2EIK C;  1U0B B;  5L3V A;  5HSW A;  3JYH A;  4MQ9 F;  5L0C A;  4K7B A;  3EQL F;  2Y3D A;  1HY5 A;  1QKR A;  3WOD F;  1NBB A;  1C02 A;  1LE4 A;  3DWW A;  4KBL A;  1VTM P;  3TJ5 A;  3C8G D;  4O6N A;  1MND A;  3MYI A; 
#chains in the Genus database with same CATH homology
 3DJU B;  1RJ9 B;  5B1B C;  4DVY P;  1ZU5 A;  2PF4 E;  3EG9 B;  2WZG A;  3DM9 B;  4IJJ A;  4KNW A;  2PP4 A;  3SEO A;  4OD5 A;  4BJ6 A;  1Z23 A;  1QLE C;  2DYR C;  1NZE A;  2E87 A;  3F46 A;  3FVY A;  4ANJ A;  3E9V A;  3SZR A;  2H7O A;  4Q5S F;  2WB7 A;  3HJC A;  3EPV A;  1ZU4 A;  3W8I A;  3K66 A;  3DXJ F;  3LS1 A;  2NUT B;  3LAY A;  3HLZ A;  2Q3T A;  2XXA A;  3NKD A;  1Z63 A;  2EIJ C;  3IEE A;  4Q7C A;  4E7S A;  4C3B A;  2FGY A;  5KYW B;  1FMW A;  3W2W A;  3NRH A;  2XSE A;  3FAJ A;  3ABK C;  2J45 A;  4PJL A;  4JUR I;  4KI2 A;  1PD1 A;  4PFO A;  2J7P D;  5KYX A;  4KC9 A;  5KYY B;  2YHS A;  2QY9 A;  1VYI A;  4P6I C;  5B3S C;  4PJJ A;  4U5D E;  3T4R A;  3WG7 C;  1JPJ A;  3AG3 C;  3LLK A;  3ABM C;  4LER A;  4MND A;  5D91 A;  5KYU B;  4G7Z F;  2Y69 C;  4YN0 B;  4JW1 A;  1IZM A;  4G7H F;  2A69 F;  4O6Y A;  5DQT A;  4A2N B;  2MYS A;  2KGO A;  2QTV A;  4RD9 A;  3S29 A;  3EGD B;  1TR2 A;  2J7P A;  4YT2 A;  4HEA J;  5DS6 A;  2G3V A;  4CS8 A;  4C3D A;  4YT4 A;  2Y3B A;  4BEJ A;  2X51 A;  5F5H A;  4XWJ A;  4EBB A;  2Y39 A;  2W9Y A;  5DLJ A;  3E70 C;  5E3C A;  3I4U A;  1O5H A;  1V55 C;  4CS8 C;  3W8H A;  3UNG C;  2G3K A;  3RIP A;  3POV A;  2R7U A;  4DOZ A;  3OA1 A;  2Q9C A;  2IYL D;  2ZXO A;  4W8K A;  4BG0 A;  2IOQ A;  1PD0 A;  2A68 F;  3FDQ A;  3OEO A;  2IXP A;  4G0H A;  3FHD A;  2VH3 A;  2ZXR A;  3ITF A;  3Q6N A;  1FTS A;  2J0X A;  2P7V A;  5KYN A;  4BJ1 A;  4RBN A;  5IY5 C;  4PK4 A;  4IAO A;  5E2Q A;  4F4B A;  1VYK A;  4ZLD A;  3ABL C;  1TKN A;  3N0T A;  4BJ5 A;  3EHN A;  2A6E F;  4FES A;  4XTK A;  5DS5 A;  4M63 A;  1J8M F;  4K0D A;  1SMY F;  2FFH A;  4U5H A;  4FX5 A;  3O39 A;  4I3M A;  2J46 A;  5DVW A;  4OIP F;  3DM5 A;  1M56 C;  1NU9 C;  3EH2 A;  3VAY A;  3KH2 A;  1M2V A;  4I44 A;  2NUP A;  1VK5 A;  2V3C C;  4JJG A;  2R7W A;  4U5C E;  5D92 A;  1W2W A;  1M57 C;  2V26 A;  3KMI A;  2WVQ A;  4PJN A;  5T3W A;  1NG1 A;  3SNH A;  4O6M A;  4HFK B;  3LJB A;  3B0P A;  2J9V A;  3K1I C;  1KU2 A;  1QZX A;  2ZXP A;  3UMH A;  4DVZ A;  1ZYR F;  2NG1 A;  2R7V A;  4IWB A;  3L34 A;  3N2Z B;  2J9W A;  3O6X A;  2G62 A;  3CZ6 A;  3OWT A;  2L81 A;  3HTK C;  4QI2 A;  4AX2 A;  2P6V A;  3H65 A;  1TWC A;  2CNW D;  2J9U A;  1N1C A;  2VAS A;  4NY3 A;  4LLE A;  3JSZ A;  2H7B A;  2Z15 A;  2DGJ A;  4CS7 A;  2H7V C;  5KYW A;  5DQZ A;  2PX3 A;  3NG1 A;  4RDA A;  4QDL A;  3JRT A;  1D1B A;  3LLI A;  3EGX A;  3KKB A;  2R7O A;  4JJF A;  4C7O B;  2GFH A;  2I8B A;  2NUT A;  3TD7 A;  3B0V C;  2A1D D;  3ECS A;  1FFH A;  1M2V B;  4QI0 A;  2VB6 A;  3DAG A;  3ZG1 A;  4YJW A;  2DYS C;  2L9J A;  3PHF 2;  4X0R A;  1BR2 A;  1LKX A;  3K1H A;  3RH3 A;  1OCR C;  5T3T A;  1MMN A;  2LSE A;  1ST6 A;  1J8Y F;  1D1A A;  3LES A;  4EWC A;  4XLN F;  1OCO C;  3B9Q A;  2OCC C;  2R7R A;  5B1A C;  1M2O A;  3ASO C;  2W4M A;  2R7T A;  1MMD A;  3CQZ A;  4PFP A;  2KJG A;  2PFD A;  4OD4 A;  2EIN C;  1SZI A;  3F47 A;  3I5P A;  4ZLC A;  2WVN A;  2BE5 F;  3SP1 A;  1D0Z A;  3LEV A;  4CSA A;  1TWG A;  4PJM A;  2CGE A;  4FWV A;  4AE4 A;  3EJN A;  5KYY A;  1FMV A;  3UGP A;  2R7S A;  3UMK A;  2ZXW C;  5CI9 A;  4E7Z A;  1FFT C;  2MWQ A;  4CS9 A;  5F5F A;  1OKK A;  3S28 A;  1WGW A;  3NYL A;  4U5F E;  1OCZ C;  3RKO F;  4J30 B;  1TWA A;  1Z6A A;  2O9X A;  3EFO A;  2CDQ A;  3EZH A;  1OKK D;  2YZS A;  3K33 A;  4JZA A;  4U5B E;  5E33 A;  4N06 A;  1D0X A;  1IW7 F;  4U5G A;  3JT1 A;  2W45 A;  2CNW A;  4O7G A;  4CSA C;  4HFF B;  2KW3 C;  2IXM A;  3UR3 C;  3NYM A;  3EHM A;  3GAN A;  2WL8 A;  1SF8 A;  3DJN B;  3DZA A;  3EZI A;  4OIO F;  3QMK A;  3DMD A;  2A6H F;  4WJ0 A;  4YT5 A;  3VYW A;  4JVS A;  3KL4 A;  2M4E A;  4J32 B;  3K7D A;  1MMA A;  4YT8 A;  4BJT A;  4H4K C;  3EH1 A;  4YWQ A;  3N24 A;  1ZHY A;  1O87 A;  1MNE A;  4DBR A;  3JCU Q;  4U5E E;  3RFY A;  3LNR A;  2PX0 A;  1JPN A;  2Y3H A;  1VMA A;  1D0Y A;  1VOM A;  3AG1 C;  4OIN F;  3NDB B;  1G8X A;  3ASN C;  1ZHW A;  4C3E A;  1RJ9 A;  3SYN A;  3DAF A;  1ZHZ A;  4BJ6 C;  1Z3I X;  1TWH A;  2EIM C;  4G7O F;  4C7O A;  5DS4 A;  3UMI A;  5KYU A;  3EFO B;  1ZHT A;  2Y3G A;  1NU7 D;  2WVO A;  1ZHX A;  3AG2 C;  3T6J A;  1MMG A;  3V7O A;  3W2V A;  3ZVR A;  5BUO A;  1D1C A;  2EIL C;  2HV7 A;  4GYT A;  3MX3 A;  3DD7 A;  4OIQ F;  5EHH A;  2YEV A;  2ZPA A;  3NKE A;  2XXA B;  2D5R B;  1OCC C;  2KQ9 A;  3EGD A;  5E3A A;  2WZF A;  2B0J A;  3NYJ A;  3CSK A;  4IRU A;  3Q7L A;  3PMR A;  3M1C B;  3B0U X;  3ZIB A;  1V54 C;  3EGX B;  5T1D B;  5L3Q A;  4XLP F;  2HV6 A;  2WZL A;  3AQC A;  3RYL A;  3Q7G A;  4I1M A;  2OG2 A;  2IXN A;  4HE8 D;  2Q9B A;  2CW0 F;  4AE4 B;  1BR1 A;  3S0X A;  4KNV A;  1S7Z A;  4CBE A;  1PCX A;  2KNH A;  3EG9 A;  4CS9 C;  3T6B A;  2Q9A A;  2XL4 A;  3GOD A;  2R7X A;  4O79 A;  2C04 A;  3X2Q C;  2R7Q A;  3ZSU A;  3K6B A;  2J0W A;  4ULW A;  5CI8 A;  4OIR F;  4AK9 A;  3I5Q A;  1BR4 A;  3QZC A;  3ZC4 A;  4LLC A;  3UGO A;  4Q4Z F;  3X1O A;  1Z5Z A;  4GEH A;  4I1O B;  4LAC B;  4JCH A;  3S27 A;  2IXO A;  1LS1 A;  2XRH A;  3AG4 C;  5EGY A;  2NUP B;  3AQB A;  4CIH A;  4BJ5 C;  2C03 A;  4B6I A;  3Q6M A;  3LS0 A;  2W4B A;  5FCL A;  5KYX B;  3MLG A;  2JD3 A;  1LVK A;  4DBQ A;  3L0I A;  2EIK C;  5L3V A;  5HSW A;  3JYH A;  4MQ9 F;  4K7B A;  3EQL F;  2Y3D A;  3WOD F;  4KBL A;  4O6N A;  1MND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...