2L6HA

Fat domain of focal adhesion kinase tethered to ld4 motif of paxillin via ggs linker
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
154
Chain Sequence
MANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPHSATRELDELMASLSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Focal adhesion kinase 1, linker, Paxillin
publication title Fat Domain of Focal Adhesion Kinase Tethered to Ld4 Motif of Paxillin via GGS Linker
rcsb
source organism Gallus gallus, unidentified
molecule tags Transferase,cell adhesion
total genus 55
structure length 154
sequence length 180
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2l6hA00
2LK4A 3B71A 3RQFA 3JZ0A 3K7DA 1KTMA 1O3UA 4XEFA 1QVXA 2JX0A 3U0CA 2HSBA 3TULA 1WWPA 3U3FA 2JPUA 1K40A 3L8JA 3C8GA 3AJMA 2L6HA 2YWAA 3GM3A 2Q00A 2L6GA 2L6FA 3RQGA 3GM2A 3JYYA 1OW8A 1WOLA 1OW7A 3RQEA 3S9OA 5F28E 1KNYA 1ZZPA 1PV3A 4EBJA 2KK1A 2PBEA 1OW6A 4XEKA 3BRJA 1JOGA 1V4AA 4NQFA 4EBKA 1WTYA 3GM1A 3MFNA 3C18A 3O10A 1UFBA 4R32A 3L8IA 1K05A 3C8GB 3C8GD 1K04A 4XEVA
chains in the Genus database with same CATH superfamily
4JVSA 3DMDA 1FMWA 1LS4A 4KNVA 4MNDA 4PK4A 3DXJF 4GEHA 2R7XA 2EPOA 1TR2A 2E87A 4G78A 4YK5A 2FAPB 5E33A 2PNOA 2LQGA 1LKXA 3EGDB 5E3AA 2Q4FA 3S84A 1HMDA 2F22A 3RH3A 1WWPA 3US6A 5JLIA 3J06A 2EPKX 3HNKA 5K0IA 4YN0B 1DOWA 3LJBA 1KU2A 4IRUA 4MTFA 1DOVA 2A68F 3AQCA 3DAGA 3DE9A 4CIPA 2PBEA 1I5NA 1Z7Qc 1V4AA 3MLGA 1ZHYA 3KPHA 4DRIB 4YT4A 1SMYF 4DBQA 1TFKB 2R05A 2XLWA 3FAJA 2XLVA 3MX3A 3SXZA 1OR3A 4P6IC 4I3MA 2J9UA 4U5GA 1MQVA 1M2VB 3EQLF 1HW1A 1SF8A 3PCVA 3QZCA 4H4KC 2XM4A 4W8KA 4C3BA 2RD9A 4NC3A 1VYIA 2ASRA 3GWNA 2HZ8A 2NUPA 5L0GA 1FNTc 3MBGA 1APCA 3LLKA 1NSGB 4HFFB 4B6IA 2DGJA 2PX0A 1RKCA 1C17M 5BQIA 3U8VA 3ZWIA 1QKRA 4MVMA 3AGTA 4XLPF 4MVRA 1AVOB 4JW1A 2AU5A 4I44A 2BL2A 1M2VA 3O55A 3QTHA 4ANJA 2P7VA 4MTOA 3K1HA 5DQZA 5CIVA 4FAPB 3M1CB 1OW6A 2KW3C 2YL7A 4LDRA 2EPLX 3NKDA 4CSAC 3ABLC 4QI0A 2R7VA 1UFBA 2H7VC 3RYLA 3TJ6A 1WN0A 3EGXA 4U9EA 1OXKA 3A9CA 5DS6A 4JRZA 4JJFA 2NG1A 1D0ZA 1IW7F 1HW2A 3ZIBA 2OOCA 1GS9A 3WAQA 2YL3A 5A69A 2Q9BA 4YWQA 1WGWA 3JCUQ 4AE4B 4D4NA 1OQCA 2VASA 4XPXA 2VC9A 2R25A 3W4YA 1LM3B 2WVQA 4JCZA 5L0DA 3TULA 2M4EA 2YHSA 2YQYA 5FCLA 1IZMA 2XXAB 1HMOA 2IYLD 3M4BA 4JTAB 2AWYA 4PR9A 1G4WR 5BUOA 3E9VA 2YVKA 3H65A 3JT1A 4WGYA 4NTAA 3Q7GA 3O10A 1RMVA 3DJNB 3RW0A 3SXYA 3MYIA 3CAXA 4M63A 3ZQYA 3GORA 1Q0MA 2W45A 2I8BA 4U5HA 4OINF 4CSAA 3ABMC 2Y3GA 5AC4A 3EG9B 3ZG1A 1OR2A 2X51A 3NKEA 1VLSA 2Q7RA 1XZQA 1YAUO 2HJMA 2UUHA 4FESA 5EGYA 1KTMA 4NTFA 1A7DA 1LVKA 1Z3IX 2V26A 4E7ZA 5JT4A 2J9WA 3OWTA 2YLDA 4CIHA 5L0HA 1A0BA 2AP3A 4LLEA 1EQ1A 1JRAA 1T01A 2AVKA 2OU6A 1AUEA 2YLGA 1QSPA 3F47A 3QMKA 3U8PA 2D4UA 4E18A 4XEKA 5B1BC 2J0XA 4EKWA 2J9VA 1OKKD 1WTYA 1ZVZA 3QW0A 3KYJA 3DKAA 5JSLA 3SXKA 3WG7C 4CBEA 3C18A 3L1MA 4DOZA 1N1CA 1XZPA 3GEHA 4IGGA 3C8GB 3M4CA 3EH2A 4U5FE 5BQGA 2HV6A 4YL1A 5DS4A 1SR2A 4BPMA 2G62A 2YKZA 2ZD9A 4MW3A 5F5HA 2ZXOA 1LPEA 1M56C 3EHMA 3ASNC 4MTGA 5COFA 4C3DA 3EZHA 1TWGA 1S05A 2CDQA 3CEXA 2CNWD 5TJ5E 1ORSC 3UMKA 3T6JA 5A6BA 1R4TA 3R7CA 4RDAA 4PFPA 3DE8A 3U3FA 3M79A 3EFOA 3V5ZA 3AG2C 1M2OA 4Z9IA 1Q0GA 2L6FA 5EK0A 3GM2A 1WOLA 256BA 3RFYA 4DJ9A 4K0DA 3WHNA 1VK5A 2H8AA 5L3VA 1Y6DA 1D1AA 1L3PA 1EKYA 1CPRA 1EA8A 1Z6AA 3FVYA 3TQOA 3W8IA 1FFHA 1JPNA 1K04A 2QE9A 1HY5A 1NLXA 1ZHXA 2B0HA 3UMIA 4AK9A 1QLEC 4MS2A 4JTCB 3SYNA 4U5DE 3C8ZA 3U2MA 3C7JA 4AL1A 1H9TA 2XSEA 1OCZC 1FR0A 1J8YF 3U9MA 3Q6MA 2R7UA 4JC7A 2XLOA 2XS8A 2HFIA 2Y3DA 3A11A 2C03A 2J45A 2IXNA 1SYQA 5COMA 2XRHA 1NU7D 3JSEO 4ONSA 4CS7A 3NYLA 4EBJA 3AQBA 3S29A 2QTVA 3QVZA 2QLAA 2NUPB 4JURI 4E7SA 1YLMA 1YZAA 1PD0A 3EZIA 2YRFA 4KNWA 3GODA 3ZSUA 2BE5F 2QUPA 3IHUA 3SXMA 3LS1A 2A0BA 2AWCA 2YZSA 2A6HF 2XL4A 2CW0F 3PMRA 2ETSA 4CDVA 4C7OA 2EIJC 2ZXRA 3RIPA 1D0YA 2NSGA 4GQHA 2I15A 2XL8A 3WODF 2R9RB 1S7ZA 3CSKA 2BC5A 3EHNA 4IJJA 4NTBA 2YL1A 2C04A 3K7DA 5D92A 1QQ3A 2YLIA 4ZLDA 2LSEA 4OD4A 2DYSC 1HE1A 2EPNA 2W9YA 1LE2A 4H54A 3C62A 4MVSA 2LFFA 4CDAA 3EGXB 5IY5C 3G4ZA 3HNLA 4XWJA 2Y39A 1XWJA 4PJMA 4DRHB 2NUTB 4EHPA 2KGOA 2L6GA 1H7IA 2VB6A 4OIPF 5KYXB 5F28E 1ZZPA 4JEBA 2ICWG 5E3CA 2KSFA 5FZTA 3VAYA 2OJED 2WVOA 4U5EE 3T6BA 4G7ZF 5A6AA 1TWHA 3ASOC 3LNRA 3LUTB 3TOMA 3FOOA 2QY9A 3ZVRA 2WZLA 4G0HA 2J46A 5JS5A 1ZHZA 3U5SA 1YJGA 1NBBA 3IQCA 2NUTA 4AL0A 4ZLCA 3B0PA 3N24A 3RQFA 3L0IA 2RSEB 5KYXA 1OXBA 4O79A 4J7TA 2GFHA 2ZPAA 4W8PA 2XLEA 2Q3TA 4U5CE 3DZAA 1ORJA 2HSBA 4YT2A 3FDQA 2EPMX 1YA9A 3IQ6A 3ZC4A 3AJMA 1LIHA 2L6HA 3HKKA 5L3QA 3JYYA 3VM6A 1WASA 3V5YA 3IQTA 2VCAA 4A2NB 1W2WA 3UMHA 2WL8A 3HTKC 4ULWA 3KH2A 2R7OA 4OIRF 3ZDLA 3DD7A 2XS1A 1T9KA 4PACA 4DVYP 3HLZA 4XLNF 4F4BA 2LD6A 3ECSA 3C63A 3K6BA 4HE8D 2J0WA 3BEHA 3Q7LA 4N6HA 3AG3C 2MHRA 4P9FA 1BR1A 2KQ9A 1CGOA 1E2XA 1MNEA 5L0CA 1RKEA 4G7HF 2UUIA 1E86A 1VMAA 2Y3BA 5T3TA 2JPUA 4CDYA 1MMNA 1G5ZA 2KJGA 1BZ4A 5DQTA 1D0XA 2Y69C 2HSQA 4YT8A 3S90A 2R7QA 2R7RA 5JVEA 4OD5A 3I5QA 4A4AA 1KNYA 1V55C 4LDQA 2VCBA 3DAFA 3K1IC 2L9JA 2VH3A 1VTMP 2GWWA 4L6RA 3L34A 1T6UA 4K7BA 4DXWA 2QNLA 3S0XA 5HV9A 2WZFA 1OCRC 2GA0A 4IAOA 3EFOB 3T6GB 1JPJA 2Q00A 4MQ9F 3RKOF 5DS5A 1CGNA 3F46A 4GYTA 3RF3A 2Z15A 4KBLA 4X0RA 4E17A 3SEOA 4QI2A 2P0NA 2Y3HA 4YT5A 4Q7CA 2Q9AA 1ZYRF 2XL6A 1TWAA 4Q5SF 1OKKA 3AG1C 2A0UA 5KYWA 5KYUB 3EPVA 2M64A 4IAQA 1ZU4A 3V7OA 1B68A 2LFDA 4BEMJ 4N6CA 2IM8A 3GWLA 1H9GA 4BEJA 4KI2A 4MVQA 1Q0DA 4YJWA 2WB7A 2PF4E 3RVZA 1RCPA 3DM9B 4NY3A 5JRAA 1ZW3A 3JRTA 2XM0A 3AGUA 1C03A 2CNWA 2J7PD 3N0TA 3MFNA 4CJOA 3U2LA 1T6IA 1YA7O 2R7SA 2WVNA 1ZW2A 2OEVA 3PHF2 2CYDA 5KYUA 1ZHWA 3B9QA 3K1IA 3C8GD 1Q0FA 1YARO 3KKBA 4O6YA 3DWWA 2CCYA 3N2ZB 2GAQA 4XEVA 4YL0A 2GDCA 4BJ6C 4CS8C 4UDVA 1Z5ZA 2EIMC 3LLIA 3X1OA 1E85A 3GEIA 1VYKA 2DI3A 4XEFA 4G7OF 4Z9HA 1MMGA 1MNDA 3OEOA 2PP4A 4U9DA 4O7GA 4ULVA 2W4BA 5BQHA 3U0CA 1GM5A 3B0UX 3DJUB 5B3IA 4C7OB 5AGFA 3SNHA 1L7CA 1R5ID 3GM3A 1LS1A 3FHDA 4P9TA 2IOQA 1OW8A 2FFHA 1FFTC 2IXMA 1U6HA 2PX3A 4OIQF 1BBHA 4JKVA 1QZXA 5L0IA 3RVYA 3I5PA 5DVWA 1MMAA 1ZHTA 3T4RA 5CI8A 1C02A 4E0HA 1U0BB 1G4US 3IEEA 3K33A 3PDMP 1YVIA 3U3BA 5B1AC 3SP1A 1AEPA 3Q6NA 3TD7A 1Z63A 4CS9C 2HMQA 1NG1A 4PFOA 3FXHA 1E83A 1OCCC 4N06A 2TMVP 3S28A 4JTDB 1U89A 2FGYA 2ZXPA 1QVXA 4BJ6A 4CS8A 3O39A 2OKUA 5KYYA 4Q4ZF 3NMJA 2YEVA 3G4XA 3OA1A 1M6TA 4PJJA 5T3WA 3AG4C 1T6QA 2HV7A 1FAPB 1YYJA 2HS5A 2J9BA 4I1OB 1M57C 3FAPB 4IWBA 3HNIA 2YWAA 3ZTMA 3CZ6A 3TJ5A 4HFKB 2A69F 2YL0A 1PV3A 4CJGA 4EUKB 2D5RB 3H2VA 1Q0KA 2PFDA 3KYIA 3EGDA 3T9OA 3VRCA 4E0IA 1NZEA 3H2UA 3M15A 5E2QA 1F1MA 1A41A 1K05A 2MWQA 4O6NA 1SZIA 4KC9A 1GQAA 3JTLO 2A6EF 2HUJA 1TKNA 2IXPA 4BG0A 1YZCA 4XPWA 4EBBA 3SZRA 2L81A 1JR8A 1V74B 2OEXA 1TQGA 3NG1A 4XPYA 1JMWA 3U9JA 3S27A 4CS9A 4RD9A 4AX2A 3ITFA 2JX0A 5F5FA 1FMVA 3VYWA 3R2PA 1ZU5A 3IQ5A 4DRJB 4QDLA 5HSWA 1V54C 2HKVA 2XLDA 3L8JA 4WJ0A 1MMDA 1NFNA 2V3CC 2R03A 2G3VA 3B0VC 4ER9A 1I4ZA 4LLCA 5CI9A 4D4XA 1O87A 2R02A 5L0FA 3BRJA 4J32B 3NMKA 1CGME 2EILC 3W8HA 1OCOC 2OQMA 1RKEB 3LAYA 1GGQA 3ABKC 3CQZA 2X0CA 1A7EA 5B3SC 2OJQA 3GANA 1TFOB 3AOUA 2WZGA 4XTKA 3V5XA 3NYMA 5COGA 4MW8A 3B71A 3JZ0A 4LACB 1CPQA 2KNHA 1O3UA 2XLHA 4Z9JA 1Z23A 3ZQVA 2NSFA 4K1OA 1J8MF 2OCCC 4LDKA 4YL3A 1K40A 4I1MA 4MVZA 1PCXA 2P1AA 3QVYA 2EIKC 4J7YA 3GEEA 3W2WA 3RQEA 4HEAJ 3FMSA 4OIOF 1QPUA 5JUAA 1LI7A 4AE4A 1JOGA 2IBFA 4WABA 4EBKA 3GM1A 2DYRC 1G8XA 2EINC 3ZTZA 3DM5A 3ATPA 5KYWB 2HMZA 1ORYA 1YDIA 2L7AA 5A6KA 2KC3A 1LE4A 1VOMA 4U5BE 5A6JA 2XXAA 1RXQA 3LEVA 2MYSA 1RJ9B 3DI5A 4PJNA 4JEAA 4BJTA 4XQ1A 1UG7A 4WGZA 1A7VA 1H6GA 3UR3C 1I4YA 2LIGA 3MYFA 4J30B 5DLJA 5L0JA 3EH1A 3LESA 2DB4A 4EIYA 2G3KA 4JCHA 1LI5A 1Y4CA 3HNJA 4JJGA 2ZXWC 2H7OA 1ST6A 2NPUA 3IPMO 4FX5A 4RBNA 1FTSA 1VLTA 1T5OA 3LEOA 1EI7A 4BJ1A 4C3EA 4JE9A 3LNMB 2Q9CA 3QW1A 4MVUA 1YYXA 5AC5A 5GPGB 3EG9A 3NYJA 3K66A 3G50A 3S9OA 4EWCA 2HJ3A 1RJ9A 4LERA 3VF0A 3UGPA 3KL4A 1BR2A 4BJ5C 4NQFA 1O5HA 1BR4A 3EJNA 3JRMO 5A6BD 3POVA 3NRHA 1JAFA 5D91A 5EHHA 3UGOA 3NDBB 3FOPA 4N4WA 2JD3A 2IXOA 2J8WA 3L8IA 4IARA 3LS0A 3NMIA 1NU9C 2OG2A 3JYHA 2H7BA 2LK4A 2CGEA 3X2QC 4JZAA 2R7WA 4DVZA 2R7TA 4MVOA 2J7PA 1D1CA 3HJCA 5T1DB 1NFOA 2O9XA 3TK0A 2KYHA 1D1BA 3E70C 3O6XA 1BDJB 3C8GA 4CX9A 4DBRA 3RQGA 1HE9A 3JSZA 5KYNA 1OW7A 2B0JA 4JIOA 1PD1A 1VB5A 2KK1A 2LCHA 4PJLA 2A1DD 3KMIA 2LP4A 1E84A 5KYYB 1TWCA 2W4MA 3I4UA 3TOLA 3B29A 4NCQA 2VCCA 2XLMA 1WATA 4R32A 2P6VA 4FWVA 4IB4A 4O6MA 5JP7A 3UNGC 4BJ5A 2P61A 3W2VA
chains in the Genus database with same CATH topology
2LK4A 3B71A 3RQFA 3JZ0A 3K7DA 1KTMA 1O3UA 4XEFA 1QVXA 2JX0A 3U0CA 2HSBA 3TULA 1WWPA 3U3FA 2JPUA 1K40A 3L8JA 3C8GA 3AJMA 2L6HA 2YWAA 3GM3A 2Q00A 2L6GA 2L6FA 3RQGA 3GM2A 3JYYA 1OW8A 1WOLA 1OW7A 3RQEA 3S9OA 5F28E 1KNYA 1ZZPA 1PV3A 4EBJA 2KK1A 2PBEA 1OW6A 4XEKA 3BRJA 1JOGA 1V4AA 4NQFA 4EBKA 1WTYA 3GM1A 3MFNA 3C18A 3O10A 1UFBA 4R32A 3L8IA 1K05A 3C8GB 3C8GD 1K04A 4XEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LK4 A;  3B71 A;  3RQF A;  3JZ0 A;  3K7D A;  1KTM A;  1O3U A;  4XEF A;  1QVX A;  2JX0 A;  3U0C A;  2HSB A;  3TUL A;  1WWP A;  3U3F A;  2JPU A;  1K40 A;  3L8J A;  3C8G A;  3AJM A;  2L6H A;  2YWA A;  3GM3 A;  2Q00 A;  2L6G A;  2L6F A;  3RQG A;  3GM2 A;  3JYY A;  1OW8 A;  1WOL A;  1OW7 A;  3RQE A;  3S9O A;  5F28 E;  1KNY A;  1ZZP A;  1PV3 A;  4EBJ A;  2KK1 A;  2PBE A;  1OW6 A;  4XEK A;  3BRJ A;  1JOG A;  1V4A A;  4NQF A;  4EBK A;  1WTY A;  3GM1 A;  3MFN A;  3C18 A;  3O10 A;  1UFB A;  4R32 A;  3L8I A;  1K05 A;  3C8G B;  3C8G D;  1K04 A;  4XEV A; 
#chains in the Genus database with same CATH topology
 4JVS A;  3DMD A;  1FMW A;  1LS4 A;  4KNV A;  4MND A;  4PK4 A;  3DXJ F;  4GEH A;  2R7X A;  2EPO A;  1TR2 A;  2E87 A;  4G78 A;  4YK5 A;  2FAP B;  5E33 A;  2PNO A;  2LQG A;  1LKX A;  3EGD B;  5E3A A;  2Q4F A;  3S84 A;  1HMD A;  2F22 A;  3RH3 A;  1WWP A;  3US6 A;  5JLI A;  3J06 A;  2EPK X;  3HNK A;  5K0I A;  4YN0 B;  1DOW A;  3LJB A;  1KU2 A;  4IRU A;  4MTF A;  1DOV A;  2A68 F;  3AQC A;  3DAG A;  3DE9 A;  4CIP A;  2PBE A;  1I5N A;  1Z7Q c;  1V4A A;  3MLG A;  1ZHY A;  3KPH A;  4DRI B;  4YT4 A;  1SMY F;  4DBQ A;  1TFK B;  2R05 A;  2XLW A;  3FAJ A;  2XLV A;  3MX3 A;  3SXZ A;  1OR3 A;  4P6I C;  4I3M A;  2J9U A;  4U5G A;  1MQV A;  1M2V B;  3EQL F;  1HW1 A;  1SF8 A;  3PCV A;  3QZC A;  4H4K C;  2XM4 A;  4W8K A;  4C3B A;  2RD9 A;  4NC3 A;  1VYI A;  2ASR A;  3GWN A;  2HZ8 A;  2NUP A;  5L0G A;  1FNT c;  3MBG A;  1APC A;  3LLK A;  1NSG B;  4HFF B;  4B6I A;  2DGJ A;  2PX0 A;  1RKC A;  1C17 M;  5BQI A;  3U8V A;  3ZWI A;  1QKR A;  4MVM A;  3AGT A;  4XLP F;  4MVR A;  1AVO B;  4JW1 A;  2AU5 A;  4I44 A;  2BL2 A;  1M2V A;  3O55 A;  3QTH A;  4ANJ A;  2P7V A;  4MTO A;  3K1H A;  5DQZ A;  5CIV A;  4FAP B;  3M1C B;  1OW6 A;  2KW3 C;  2YL7 A;  4LDR A;  2EPL X;  3NKD A;  4CSA C;  3ABL C;  4QI0 A;  2R7V A;  1UFB A;  2H7V C;  3RYL A;  3TJ6 A;  1WN0 A;  3EGX A;  4U9E A;  1OXK A;  3A9C A;  5DS6 A;  4JRZ A;  4JJF A;  2NG1 A;  1D0Z A;  1IW7 F;  1HW2 A;  3ZIB A;  2OOC A;  1GS9 A;  3WAQ A;  2YL3 A;  5A69 A;  2Q9B A;  4YWQ A;  1WGW A;  3JCU Q;  4AE4 B;  4D4N A;  1OQC A;  2VAS A;  4XPX A;  2VC9 A;  2R25 A;  3W4Y A;  1LM3 B;  2WVQ A;  4JCZ A;  5L0D A;  3TUL A;  2M4E A;  2YHS A;  2YQY A;  5FCL A;  1IZM A;  2XXA B;  1HMO A;  2IYL D;  3M4B A;  4JTA B;  2AWY A;  4PR9 A;  1G4W R;  5BUO A;  3E9V A;  2YVK A;  3H65 A;  3JT1 A;  4WGY A;  4NTA A;  3Q7G A;  3O10 A;  1RMV A;  3DJN B;  3RW0 A;  3SXY A;  3MYI A;  3CAX A;  4M63 A;  3ZQY A;  3GOR A;  1Q0M A;  2W45 A;  2I8B A;  4U5H A;  4OIN F;  4CSA A;  3ABM C;  2Y3G A;  5AC4 A;  3EG9 B;  3ZG1 A;  1OR2 A;  2X51 A;  3NKE A;  1VLS A;  2Q7R A;  1XZQ A;  1YAU O;  2HJM A;  2UUH A;  4FES A;  5EGY A;  1KTM A;  4NTF A;  1A7D A;  1LVK A;  1Z3I X;  2V26 A;  4E7Z A;  5JT4 A;  2J9W A;  3OWT A;  2YLD A;  4CIH A;  5L0H A;  1A0B A;  2AP3 A;  4LLE A;  1EQ1 A;  1JRA A;  1T01 A;  2AVK A;  2OU6 A;  1AUE A;  2YLG A;  1QSP A;  3F47 A;  3QMK A;  3U8P A;  2D4U A;  4E18 A;  4XEK A;  5B1B C;  2J0X A;  4EKW A;  2J9V A;  1OKK D;  1WTY A;  1ZVZ A;  3QW0 A;  3KYJ A;  3DKA A;  5JSL A;  3SXK A;  3WG7 C;  4CBE A;  3C18 A;  3L1M A;  4DOZ A;  1N1C A;  1XZP A;  3GEH A;  4IGG A;  3C8G B;  3M4C A;  3EH2 A;  4U5F E;  5BQG A;  2HV6 A;  4YL1 A;  5DS4 A;  1SR2 A;  4BPM A;  2G62 A;  2YKZ A;  2ZD9 A;  4MW3 A;  5F5H A;  2ZXO A;  1LPE A;  1M56 C;  3EHM A;  3ASN C;  4MTG A;  5COF A;  4C3D A;  3EZH A;  1TWG A;  1S05 A;  2CDQ A;  3CEX A;  2CNW D;  5TJ5 E;  1ORS C;  3UMK A;  3T6J A;  5A6B A;  1R4T A;  3R7C A;  4RDA A;  4PFP A;  3DE8 A;  3U3F A;  3M79 A;  3EFO A;  3V5Z A;  3AG2 C;  1M2O A;  4Z9I A;  1Q0G A;  2L6F A;  5EK0 A;  3GM2 A;  1WOL A;  256B A;  3RFY A;  4DJ9 A;  4K0D A;  3WHN A;  1VK5 A;  2H8A A;  5L3V A;  1Y6D A;  1D1A A;  1L3P A;  1EKY A;  1CPR A;  1EA8 A;  1Z6A A;  3FVY A;  3TQO A;  3W8I A;  1FFH A;  1JPN A;  1K04 A;  2QE9 A;  1HY5 A;  1NLX A;  1ZHX A;  2B0H A;  3UMI A;  4AK9 A;  1QLE C;  4MS2 A;  4JTC B;  3SYN A;  4U5D E;  3C8Z A;  3U2M A;  3C7J A;  4AL1 A;  1H9T A;  2XSE A;  1OCZ C;  1FR0 A;  1J8Y F;  3U9M A;  3Q6M A;  2R7U A;  4JC7 A;  2XLO A;  2XS8 A;  2HFI A;  2Y3D A;  3A11 A;  2C03 A;  2J45 A;  2IXN A;  1SYQ A;  5COM A;  2XRH A;  1NU7 D;  3JSE O;  4ONS A;  4CS7 A;  3NYL A;  4EBJ A;  3AQB A;  3S29 A;  2QTV A;  3QVZ A;  2QLA A;  2NUP B;  4JUR I;  4E7S A;  1YLM A;  1YZA A;  1PD0 A;  3EZI A;  2YRF A;  4KNW A;  3GOD A;  3ZSU A;  2BE5 F;  2QUP A;  3IHU A;  3SXM A;  3LS1 A;  2A0B A;  2AWC A;  2YZS A;  2A6H F;  2XL4 A;  2CW0 F;  3PMR A;  2ETS A;  4CDV A;  4C7O A;  2EIJ C;  2ZXR A;  3RIP A;  1D0Y A;  2NSG A;  4GQH A;  2I15 A;  2XL8 A;  3WOD F;  2R9R B;  1S7Z A;  3CSK A;  2BC5 A;  3EHN A;  4IJJ A;  4NTB A;  2YL1 A;  2C04 A;  3K7D A;  5D92 A;  1QQ3 A;  2YLI A;  4ZLD A;  2LSE A;  4OD4 A;  2DYS C;  1HE1 A;  2EPN A;  2W9Y A;  1LE2 A;  4H54 A;  3C62 A;  4MVS A;  2LFF A;  4CDA A;  3EGX B;  5IY5 C;  3G4Z A;  3HNL A;  4XWJ A;  2Y39 A;  1XWJ A;  4PJM A;  4DRH B;  2NUT B;  4EHP A;  2KGO A;  2L6G A;  1H7I A;  2VB6 A;  4OIP F;  5KYX B;  5F28 E;  1ZZP A;  4JEB A;  2ICW G;  5E3C A;  2KSF A;  5FZT A;  3VAY A;  2OJE D;  2WVO A;  4U5E E;  3T6B A;  4G7Z F;  5A6A A;  1TWH A;  3ASO C;  3LNR A;  3LUT B;  3TOM A;  3FOO A;  2QY9 A;  3ZVR A;  2WZL A;  4G0H A;  2J46 A;  5JS5 A;  1ZHZ A;  3U5S A;  1YJG A;  1NBB A;  3IQC A;  2NUT A;  4AL0 A;  4ZLC A;  3B0P A;  3N24 A;  3RQF A;  3L0I A;  2RSE B;  5KYX A;  1OXB A;  4O79 A;  4J7T A;  2GFH A;  2ZPA A;  4W8P A;  2XLE A;  2Q3T A;  4U5C E;  3DZA A;  1ORJ A;  2HSB A;  4YT2 A;  3FDQ A;  2EPM X;  1YA9 A;  3IQ6 A;  3ZC4 A;  3AJM A;  1LIH A;  2L6H A;  3HKK A;  5L3Q A;  3JYY A;  3VM6 A;  1WAS A;  3V5Y A;  3IQT A;  2VCA A;  4A2N B;  1W2W A;  3UMH A;  2WL8 A;  3HTK C;  4ULW A;  3KH2 A;  2R7O A;  4OIR F;  3ZDL A;  3DD7 A;  2XS1 A;  1T9K A;  4PAC A;  4DVY P;  3HLZ A;  4XLN F;  4F4B A;  2LD6 A;  3ECS A;  3C63 A;  3K6B A;  4HE8 D;  2J0W A;  3BEH A;  3Q7L A;  4N6H A;  3AG3 C;  2MHR A;  4P9F A;  1BR1 A;  2KQ9 A;  1CGO A;  1E2X A;  1MNE A;  5L0C A;  1RKE A;  4G7H F;  2UUI A;  1E86 A;  1VMA A;  2Y3B A;  5T3T A;  2JPU A;  4CDY A;  1MMN A;  1G5Z A;  2KJG A;  1BZ4 A;  5DQT A;  1D0X A;  2Y69 C;  2HSQ A;  4YT8 A;  3S90 A;  2R7Q A;  2R7R A;  5JVE A;  4OD5 A;  3I5Q A;  4A4A A;  1KNY A;  1V55 C;  4LDQ A;  2VCB A;  3DAF A;  3K1I C;  2L9J A;  2VH3 A;  1VTM P;  2GWW A;  4L6R A;  3L34 A;  1T6U A;  4K7B A;  4DXW A;  2QNL A;  3S0X A;  5HV9 A;  2WZF A;  1OCR C;  2GA0 A;  4IAO A;  3EFO B;  3T6G B;  1JPJ A;  2Q00 A;  4MQ9 F;  3RKO F;  5DS5 A;  1CGN A;  3F46 A;  4GYT A;  3RF3 A;  2Z15 A;  4KBL A;  4X0R A;  4E17 A;  3SEO A;  4QI2 A;  2P0N A;  2Y3H A;  4YT5 A;  4Q7C A;  2Q9A A;  1ZYR F;  2XL6 A;  1TWA A;  4Q5S F;  1OKK A;  3AG1 C;  2A0U A;  5KYW A;  5KYU B;  3EPV A;  2M64 A;  4IAQ A;  1ZU4 A;  3V7O A;  1B68 A;  2LFD A;  4BEM J;  4N6C A;  2IM8 A;  3GWL A;  1H9G A;  4BEJ A;  4KI2 A;  4MVQ A;  1Q0D A;  4YJW A;  2WB7 A;  2PF4 E;  3RVZ A;  1RCP A;  3DM9 B;  4NY3 A;  5JRA A;  1ZW3 A;  3JRT A;  2XM0 A;  3AGU A;  1C03 A;  2CNW A;  2J7P D;  3N0T A;  3MFN A;  4CJO A;  3U2L A;  1T6I A;  1YA7 O;  2R7S A;  2WVN A;  1ZW2 A;  2OEV A;  3PHF 2;  2CYD A;  5KYU A;  1ZHW A;  3B9Q A;  3K1I A;  3C8G D;  1Q0F A;  1YAR O;  3KKB A;  4O6Y A;  3DWW A;  2CCY A;  3N2Z B;  2GAQ A;  4XEV A;  4YL0 A;  2GDC A;  4BJ6 C;  4CS8 C;  4UDV A;  1Z5Z A;  2EIM C;  3LLI A;  3X1O A;  1E85 A;  3GEI A;  1VYK A;  2DI3 A;  4XEF A;  4G7O F;  4Z9H A;  1MMG A;  1MND A;  3OEO A;  2PP4 A;  4U9D A;  4O7G A;  4ULV A;  2W4B A;  5BQH A;  3U0C A;  1GM5 A;  3B0U X;  3DJU B;  5B3I A;  4C7O B;  5AGF A;  3SNH A;  1L7C A;  1R5I D;  3GM3 A;  1LS1 A;  3FHD A;  4P9T A;  2IOQ A;  1OW8 A;  2FFH A;  1FFT C;  2IXM A;  1U6H A;  2PX3 A;  4OIQ F;  1BBH A;  4JKV A;  1QZX A;  5L0I A;  3RVY A;  3I5P A;  5DVW A;  1MMA A;  1ZHT A;  3T4R A;  5CI8 A;  1C02 A;  4E0H A;  1U0B B;  1G4U S;  3IEE A;  3K33 A;  3PDM P;  1YVI A;  3U3B A;  5B1A C;  3SP1 A;  1AEP A;  3Q6N A;  3TD7 A;  1Z63 A;  4CS9 C;  2HMQ A;  1NG1 A;  4PFO A;  3FXH A;  1E83 A;  1OCC C;  4N06 A;  2TMV P;  3S28 A;  4JTD B;  1U89 A;  2FGY A;  2ZXP A;  1QVX A;  4BJ6 A;  4CS8 A;  3O39 A;  2OKU A;  5KYY A;  4Q4Z F;  3NMJ A;  2YEV A;  3G4X A;  3OA1 A;  1M6T A;  4PJJ A;  5T3W A;  3AG4 C;  1T6Q A;  2HV7 A;  1FAP B;  1YYJ A;  2HS5 A;  2J9B A;  4I1O B;  1M57 C;  3FAP B;  4IWB A;  3HNI A;  2YWA A;  3ZTM A;  3CZ6 A;  3TJ5 A;  4HFK B;  2A69 F;  2YL0 A;  1PV3 A;  4CJG A;  4EUK B;  2D5R B;  3H2V A;  1Q0K A;  2PFD A;  3KYI A;  3EGD A;  3T9O A;  3VRC A;  4E0I A;  1NZE A;  3H2U A;  3M15 A;  5E2Q A;  1F1M A;  1A41 A;  1K05 A;  2MWQ A;  4O6N A;  1SZI A;  4KC9 A;  1GQA A;  3JTL O;  2A6E F;  2HUJ A;  1TKN A;  2IXP A;  4BG0 A;  1YZC A;  4XPW A;  4EBB A;  3SZR A;  2L81 A;  1JR8 A;  1V74 B;  2OEX A;  1TQG A;  3NG1 A;  4XPY A;  1JMW A;  3U9J A;  3S27 A;  4CS9 A;  4RD9 A;  4AX2 A;  3ITF A;  2JX0 A;  5F5F A;  1FMV A;  3VYW A;  3R2P A;  1ZU5 A;  3IQ5 A;  4DRJ B;  4QDL A;  5HSW A;  1V54 C;  2HKV A;  2XLD A;  3L8J A;  4WJ0 A;  1MMD A;  1NFN A;  2V3C C;  2R03 A;  2G3V A;  3B0V C;  4ER9 A;  1I4Z A;  4LLC A;  5CI9 A;  4D4X A;  1O87 A;  2R02 A;  5L0F A;  3BRJ A;  4J32 B;  3NMK A;  1CGM E;  2EIL C;  3W8H A;  1OCO C;  2OQM A;  1RKE B;  3LAY A;  1GGQ A;  3ABK C;  3CQZ A;  2X0C A;  1A7E A;  5B3S C;  2OJQ A;  3GAN A;  1TFO B;  3AOU A;  2WZG A;  4XTK A;  3V5X A;  3NYM A;  5COG A;  4MW8 A;  3B71 A;  3JZ0 A;  4LAC B;  1CPQ A;  2KNH A;  1O3U A;  2XLH A;  4Z9J A;  1Z23 A;  3ZQV A;  2NSF A;  4K1O A;  1J8M F;  2OCC C;  4LDK A;  4YL3 A;  1K40 A;  4I1M A;  4MVZ A;  1PCX A;  2P1A A;  3QVY A;  2EIK C;  4J7Y A;  3GEE A;  3W2W A;  3RQE A;  4HEA J;  3FMS A;  4OIO F;  1QPU A;  5JUA A;  1LI7 A;  4AE4 A;  1JOG A;  2IBF A;  4WAB A;  4EBK A;  3GM1 A;  2DYR C;  1G8X A;  2EIN C;  3ZTZ A;  3DM5 A;  3ATP A;  5KYW B;  2HMZ A;  1ORY A;  1YDI A;  2L7A A;  5A6K A;  2KC3 A;  1LE4 A;  1VOM A;  4U5B E;  5A6J A;  2XXA A;  1RXQ A;  3LEV A;  2MYS A;  1RJ9 B;  3DI5 A;  4PJN A;  4JEA A;  4BJT A;  4XQ1 A;  1UG7 A;  4WGZ A;  1A7V A;  1H6G A;  3UR3 C;  1I4Y A;  2LIG A;  3MYF A;  4J30 B;  5DLJ A;  5L0J A;  3EH1 A;  3LES A;  2DB4 A;  4EIY A;  2G3K A;  4JCH A;  1LI5 A;  1Y4C A;  3HNJ A;  4JJG A;  2ZXW C;  2H7O A;  1ST6 A;  2NPU A;  3IPM O;  4FX5 A;  4RBN A;  1FTS A;  1VLT A;  1T5O A;  3LEO A;  1EI7 A;  4BJ1 A;  4C3E A;  4JE9 A;  3LNM B;  2Q9C A;  3QW1 A;  4MVU A;  1YYX A;  5AC5 A;  5GPG B;  3EG9 A;  3NYJ A;  3K66 A;  3G50 A;  3S9O A;  4EWC A;  2HJ3 A;  1RJ9 A;  4LER A;  3VF0 A;  3UGP A;  3KL4 A;  1BR2 A;  4BJ5 C;  4NQF A;  1O5H A;  1BR4 A;  3EJN A;  3JRM O;  5A6B D;  3POV A;  3NRH A;  1JAF A;  5D91 A;  5EHH A;  3UGO A;  3NDB B;  3FOP A;  4N4W A;  2JD3 A;  2IXO A;  2J8W A;  3L8I A;  4IAR A;  3LS0 A;  3NMI A;  1NU9 C;  2OG2 A;  3JYH A;  2H7B A;  2LK4 A;  2CGE A;  3X2Q C;  4JZA A;  2R7W A;  4DVZ A;  2R7T A;  4MVO A;  2J7P A;  1D1C A;  3HJC A;  5T1D B;  1NFO A;  2O9X A;  3TK0 A;  2KYH A;  1D1B A;  3E70 C;  3O6X A;  1BDJ B;  3C8G A;  4CX9 A;  4DBR A;  3RQG A;  1HE9 A;  3JSZ A;  5KYN A;  1OW7 A;  2B0J A;  4JIO A;  1PD1 A;  1VB5 A;  2KK1 A;  2LCH A;  4PJL A;  2A1D D;  3KMI A;  2LP4 A;  1E84 A;  5KYY B;  1TWC A;  2W4M A;  3I4U A;  3TOL A;  3B29 A;  4NCQ A;  2VCC A;  2XLM A;  1WAT A;  4R32 A;  2P6V A;  4FWV A;  4IB4 A;  4O6M A;  5JP7 A;  3UNG C;  4BJ5 A;  2P61 A;  3W2V A; 
#chains in the Genus database with same CATH homology
 2LK4 A;  3B71 A;  3RQF A;  3JZ0 A;  3K7D A;  1KTM A;  1O3U A;  4XEF A;  1QVX A;  2JX0 A;  3U0C A;  2HSB A;  3TUL A;  1WWP A;  3U3F A;  2JPU A;  1K40 A;  3L8J A;  3C8G A;  3AJM A;  2L6H A;  2YWA A;  3GM3 A;  2Q00 A;  2L6G A;  2L6F A;  3RQG A;  3GM2 A;  3JYY A;  1OW8 A;  1WOL A;  1OW7 A;  3RQE A;  3S9O A;  5F28 E;  1KNY A;  1ZZP A;  1PV3 A;  4EBJ A;  2KK1 A;  2PBE A;  1OW6 A;  4XEK A;  3BRJ A;  1JOG A;  1V4A A;  4NQF A;  4EBK A;  1WTY A;  3GM1 A;  3MFN A;  3C18 A;  3O10 A;  1UFB A;  4R32 A;  3L8I A;  1K05 A;  3C8G B;  3C8G D;  1K04 A;  4XEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...