2L6HA

Fat domain of focal adhesion kinase tethered to ld4 motif of paxillin via ggs linker
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
154
Chain Sequence
MANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPHSATRELDELMASLSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fat Domain of Focal Adhesion Kinase Tethered to Ld4 Motif of Paxillin via GGS Linker
rcsb
source organism Gallus gallus, unidentified
molecule tags Transferase,cell adhesion
molecule keywords Focal adhesion kinase 1, linker, Paxillin
total genus 55
structure length 154
sequence length 180
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2l6hA00
1WWPA 4XEVA 3O10A 3JYYA 1JOGA 1WTYA 1UFBA 3C8GB 3RQEA 1WOLA 3K7DA 3C8GA 3S9OA 3U0CA 2JX0A 2Q00A 1K40A 5F28E 4XEFA 4EBKA 2L6HA 2YWAA 3BRJA 4R32A 1KTMA 3MFNA 3B71A 3GM3A 3AJMA 3C18A 1ZZPA 3U3FA 1OW7A 1KNYA 1PV3A 2KK1A 1K05A 1QVXA 3L8JA 3RQFA 1O3UA 1OW8A 2JPUA 2HSBA 3GM1A 2LK4A 4EBJA 3C8GD 3TULA 3JZ0A 2PBEA 4NQFA 1K04A 4XEKA 3RQGA 2L6GA 2L6FA 1OW6A 3L8IA 1V4AA 3GM2A
chains in the Genus database with same CATH superfamily
1AEPA 3FAPB 2YEVA 3AG4C 2EINC 4DJ9A 1UFBA 1VMAA 1YJGA 3EZHA 3K7DA 5L0CA 2YLGA 2NUPB 4PFPA 2X51A 4WABA 4A2NB 4Z9JA 4BEJA 5JVEA 5KYXA 3DM9B 2A68F 4ZLDA 4U5FE 1KTMA 3V5XA 5L0FA 2X0CA 3NYMA 3ZDLA 4U5GA 1JPJA 4MW3A 3SYNA 3T6JA 4BJ1A 4D4NA 3DJUB 1K05A 4PJLA 3V5ZA 4G7ZF 3FOOA 2R25A 2R9RB 2EPOA 1BZ4A 1CGOA 3H2VA 3EH1A 4ULVA 1NLXA 2EIJC 2QTVA 3ASOC 1WATA 3HNLA 1ZHXA 3GWLA 1OXBA 2ASRA 2QE9A 3KKBA 4U9EA 4YL3A 3LLKA 4U9DA 2L7AA 5E33A 2J45A 3MYFA 5JP7A 5L0JA 1OCOC 3MFNA 3MBGA 1CGME 1H6GA 4MTOA 3NMIA 3SXKA 5T1DB 3KH2A 2EPMX 1C02A 1WN0A 1ZHYA 2Y69C 2HFIA 4YT5A 5GPGB 3VRCA 1GGQA 3EG9B 1RXQA 4BJ6A 2CDQA 4YN0B 2YKZA 3POVA 3UMHA 2GA0A 2DYSC 4JZAA 2P1AA 4G7HF 3ZC4A 4DXWA 2XSEA 3GEIA 3FHDA 1QZXA 4J30B 3LAYA 2VH3A 2R7RA 5DS6A 3EH2A 4LDRA 4C7OA 1OCRC 2HKVA 5E3AA 3RH3A 3HLZA 2WB7A 2EPKX 2Y39A 1LI5A 3EG9A 3NKEA 2D5RB 3CAXA 2HV7A 4JTAB 4DOZA 4J7TA 2Q7RA 2Y3GA 2YLIA 3U2LA 4H4KC 1CPQA 5L3VA 1YLMA 3FVYA 1D0YA 3C62A 3KL4A 3JCUQ 5F5HA 2OKUA 5CI9A 1FTSA 1PCXA 4AX2A 4Q7CA 4G7OF 3B71A 4P9TA 4Q5SF 2A0UA 3V5YA 1L3PA 2PNOA 2XS8A 2YLDA 3FAJA 4O6NA 1Z23A 5L0IA 3Q6MA 2ZD9A 4L6RA 2Q00A 1ORSC 4ER9A 3RYLA 3H65A 1IW7F 5CI8A 2Q3TA 1V55C 2J9UA 4GYTA 2V26A 2I15A 4EBKA 1CPRA 4R32A 4YT8A 5A69A 5JS5A 5L0DA 1D0XA 2B0JA 1KNYA 3HNKA 2VC9A 4KBLA 1QVXA 2W4BA 5CIVA 3T4RA 2XRHA 2R7WA 3EPVA 4RD9A 1MMNA 2LK4A 4N4WA 5DS4A 4JEAA 5IY5C 1QQ3A 3O55A 3Q6NA 1LS4A 1ZU4A 3K1HA 2OJED 3W4YA 1AVOB 1LI7A 1NU7D 4WGYA 3M15A 1WOLA 2CCYA 2XXAB 1ZW3A 4IAQA 1F1MA 2XM0A 1SF8A 1J8MF 3R7CA 4JEBA 4MVZA 2XLEA 4CSAA 1OCZC 3N0TA 4U5DE 1LS1A 1RKCA 2A6HF 5B1BC 5T3WA 2NG1A 4U5EE 4MS2A 1RCPA 2AP3A 4NY3A 1I4ZA 2OJQA 3Q7LA 1HMDA 2PFDA 2Y3DA 3DAFA 2LP4A 3RFYA 3U8VA 3M1CB 4KI2A 2XLVA 2FFHA 3QVYA 1HW2A 1L7CA 3MYIA 1E85A 2YL0A 1D1BA 3S28A 3RKOF 1QKRA 2R05A 1S05A 4E18A 1G8XA 3O10A 3DE9A 1MMGA 4XPWA 1FNTc 3DI5A 4I1OB 1QPUA 3ECSA 1TKNA 2JX0A 1IZMA 4CX9A 3T6BA 1ST6A 4MNDA 2WZGA 1DOWA 2XL6A 3S29A 4JRZA 1OR2A 4JTCB 2XL8A 3BRJA 2GAQA 1D1CA 2Q9BA 3ATPA 5COMA 4OINF 2VCAA 1D0ZA 1VYIA 4A4AA 2NSGA 3L34A 2AVKA 3PCVA 1M2VA 3GEEA 5KYXB 4RBNA 4O6MA 4GEHA 2DYRC 2Q9CA 3ZTMA 4DVYP 2HJMA 5EK0A 3I4UA 4CSAC 4IGGA 2NUTB 2QLAA 4MVUA 2FGYA 3T9OA 3PDMP 1UG7A 2LQGA 3S84A 2JD3A 1Q0KA 5B1AC 1FFHA 2HMQA 2P7VA 5E3CA 4O6YA 5JLIA 1EKYA 2DI3A 4E7ZA 4K7BA 2QY9A 1HY5A 1N1CA 2KQ9A 1VLTA 3LUTB 4CS8A 2QNLA 3UGPA 3UNGC 1NFNA 5BQHA 3EFOA 3SP1A 3EQLF 1Q0DA 2OCCC 3MX3A 1ZHZA 1HW1A 2TMVP 2BE5F 2YWAA 4HE8D 2IOQA 2XLHA 4FESA 2L81A 3AJMA 3C18A 1BR4A 2E87A 2EPNA 4NC3A 2P6VA 4QDLA 1EQ1A 3KMIA 1YZCA 3ASNC 3C8ZA 3A11A 3WAQA 1YYJA 4PJNA 3U5SA 1A0BA 3U2MA 1GS9A 2OEXA 2R02A 1EA8A 1NBBA 2VB6A 3NKDA 3W2VA 3TULA 4K0DA 1A7DA 2LSEA 3EGXB 1G4WR 1MNDA 3EZIA 2RD9A 3K1IA 2OU6A 2Q9AA 3K6BA 4MQ9F 3VAYA 4XEVA 5EGYA 2XXAA 4OIOF 1MMAA 4Z9HA 4G0HA 2Q4FA 3RQEA 4O79A 4P9FA 3ZQYA 3QW0A 3HKKA 2J7PD 4U5BE 2H8AA 5F28E 3RF3A 5KYUB 5KYYB 5KYUA 5DQTA 4OD5A 4MTGA 2R7QA 1APCA 3B9QA 3AQCA 3G4XA 5D91A 3SEOA 2ZXOA 3QMKA 3TOLA 2PX0A 4E0IA 1XZPA 4KC9A 3B0UX 1VLSA 1Z3IX 2GFHA 3ABMC 3ABKC 3DE8A 4N6HA 1OW8A 3JSEO 1Z63A 3EJNA 3GM1A 3IQTA 2AWCA 3MLGA 3LNRA 3G4ZA 1FFTC 5DS5A 4HFKB 1PD0A 3RQGA 2KSFA 2NUPA 3HNIA 1SYQA 2BL2A 3M79A 2L6FA 3OEOA 4YT4A 2IYLD 3NMJA 2ETSA 2UUIA 3UR3C 2RSEB 3HNJA 4JJFA 3TOMA 3UMIA 3V7OA 3RW0A 4C3EA 1O5HA 2IXNA 4AK9A 4YL0A 4OIQF 2R03A 4XLNF 2J9WA 4EHPA 1ZW2A 1LM3B 4Z9IA 2YL3A 2VASA 2W45A 4P6IC 4I44A 3LS0A 2GDCA 2ZXRA 1Y6DA 2CW0F 2V3CC 1CGNA 4ONSA 4AL0A 4BEMJ 5JUAA 5HV9A 3E70C 4IB4A 3RQFA 2ZPAA 3AQBA 2G3VA 1T6UA 2HSBA 3E9VA 3OWTA 2G62A 4JURI 1HE9A 1OKKA 1JPNA 3GORA 2NUTA 5KYNA 4KNWA 1GM5A 2LFDA 4F4BA 3DAGA 2O9XA 4MW8A 1NSGB 4YK5A 5AGFA 2ZXPA 1R5ID 4CS7A 4NTFA 1Y4CA 1KU2A 1T9KA 1I4YA 2A0BA 3EFOB 4XPYA 1FMWA 4XPXA 2CNWA 2LFFA 1NFOA 3LNMB 3RIPA 1WASA 4RDAA 1M6TA 5KYWB 2IM8A 4PFOA 4GQHA 1Q0MA 4NCQA 4ANJA 2R7VA 4AE4A 3ZWIA 3HTKC 1U6HA 2B0HA 2CYDA 5E2QA 1DOVA 4IJJA 3ZSUA 5AC5A 2XS1A 3ITFA 2KK1A 4I3MA 4N6CA 1H9TA 5BUOA 2R7TA 3FMSA 2VCBA 2PP4A 4AE4B 1PD1A 3DM5A 3ZIBA 5A6BA 4JJGA 3H2UA 1U0BB 3AGUA 2Z15A 3IEEA 4XWJA 3A9CA 1VB5A 1Z5ZA 2CNWD 1VOMA 1XZQA 3IQ5A 4DVZA 2F22A 1ZYRF 3IQ6A 3GM2A 1JR8A 1TR2A 4MTFA 1A7EA 3C8GB 1M57C 2WVQA 3NYJA 2C04A 2EILC 1MMDA 3ZVRA 1LE4A 1LKXA 2ICWG 1AUEA 2L9JA 3C63A 3GODA 3KPHA 2ZXWC 2HUJA 5A6BD 4BG0A 2C03A 3WHNA 3O6XA 4DRIB 4EBBA 2YRFA 1OR3A 2J9BA 4IARA 5F5FA 2J0XA 4JVSA 1E86A 2YL7A 4UDVA 1BR2A 3Q7GA 4N06A 1C03A 3EHNA 4E17A 2AWYA 3QVZA 4W8PA 1RMVA 2LCHA 3DXJF 3O39A 3KYIA 1TQGA 2PBEA 3QTHA 2MHRA 1B68A 3F47A 4CS9C 4E7SA 3WODF 1YA9A 1OW6A 1YAUO 1TWAA 1YDIA 3LEOA 3RVZA 4DBQA 4EWCA 1Q0FA 2WZFA 4E0HA 1JOGA 1WTYA 2EIMC 3AG1C 5DVWA 1JAFA 1ZHTA 4K1OA 3S9OA 4Q4ZF 3VM6A 2AU5A 4HFFB 3ABLC 4CJGA 3N2ZB 4M63A 3TK0A 3US6A 4WJ0A 3SXMA 5KYWA 3WG7C 2M4EA 2LD6A 4KNVA 1VYKA 1VK5A 2A1DD 2IXMA 4JKVA 5AC4A 1ZVZA 4MVSA 3DMDA 1ZU5A 1PV3A 4LDQA 1TFOB 2LIGA 3L8JA 3CSKA 3AG2C 3L0IA 3DWWA 3U9JA 4ZLCA 4PJMA 2HMZA 2KGOA 2J46A 2J9VA 2PX3A 4YL1A 3EGDA 4C7OB 3F46A 2R7UA 4XQ1A 3K1IC 2L6GA 1RJ9B 4IWBA 4XTKA 3HJCA 1NU9C 1H9GA 1R4TA 3CZ6A 4BJTA 1BBHA 2DGJA 3JRTA 1WGWA 3LLIA 5B3SC 3UGOA 4HEAJ 3C8GA 2A6EF 1ORYA 3JSZA 1K40A 3AGTA 3VYWA 2IXPA 2XLDA 3LESA 5COGA 1M2VB 4YWQA 3K33A 4QI0A 3W8IA 2R7XA 2KC3A 1LPEA 3UMKA 1FMVA 4OD4A 1GQAA 3I5PA 1M2OA 2OOCA 5A6KA 4JTDB 1BDJB 4NTAA 4LLEA 5A6JA 1OW7A 1J8YF 2IBFA 4CIPA 3NMKA 3W8HA 1H7IA 1OQCA 3TJ5A 2Y3BA 1A7VA 1O3UA 4D4XA 2J7PA 2HS5A 4BJ5A 5BQGA 1V74B 3C8GD 1M56C 3TQOA 3IQCA 2YL1A 4ULWA 256BA 3T6GB 2D4UA 2I8BA 4IRUA 3GEHA 4X0RA 1HMOA 3R2PA 1V54C 4EKWA 1VTMP 3AOUA 4PK4A 3B0PA 1E2XA 2M64A 1XWJA 2IXOA 4C3DA 1T6QA 2WVOA 3M4CA 4LDKA 5COFA 5D92A 3TD7A 4CDYA 1TWGA 1TFKB 1YZAA 1S7ZA 1SR2A 1RKEB 3IPMO 2HZ8A 3DKAA 2DB4A 2VCCA 4AL1A 1ZHWA 2KJGA 4O7GA 5BQIA 1O87A 3J06A 3G50A 4CBEA 4I1MA 4J7YA 4NTBA 3TJ6A 1FR0A 1C17M 5JSLA 5T3TA 3EGXA 2HSQA 1I5NA 2NSFA 2OEVA 3EGDB 3N24A 3NRHA 3SXZA 5JT4A 2H7VC 3JZ0A 3M4BA 2H7BA 1E83A 3SXYA 3NDBB 2G3KA 1RJ9A 2XLWA 4CIHA 1V4AA 1JRAA 2A69F 4W8KA 4YJWA 3U9MA 5L0GA 1OXKA 3IHUA 2GWWA 2HJ3A 3B0VC 2R7SA 2CGEA 4JE9A 3U0CA 2EPLX 2P61A 3W2WA 2WL8A 1SMYF 3FXHA 4JCHA 4XEFA 4G78A 3AG3C 3EHMA 4U5CE 2J8WA 2NPUA 3ZG1A 5TJ5E 3OA1A 3S0XA 4QI2A 1QSPA 1G4US 3RVYA 3JTLO 4LLCA 3PHF2 4PR9A 1A41A 2YVKA 2XL4A 3K66A 1Q0GA 3B29A 3S90A 2R7OA 1NG1A 2QUPA 2W4MA 4XEKA 5L0HA 2FAPB 2WZLA 3DD7A 3LS1A 5A6AA 5HSWA 1WWPA 1ORJA 1TWHA 2XLOA 3JT1A 3X1OA 4CDAA 2J0WA 5JRAA 2YHSA 2W9YA 3JRMO 4CJOA 1OKKD 4FAPB 4PJJA 1NZEA 4MVOA 1JMWA 3GANA 4PACA 4EIYA 1D1AA 3QW1A 4IAOA 3X2QC 1RKEA 4YT2A 4J32B 3ZQVA 4MVRA 1SZIA 5B3IA 1ZZPA 1FAPB 3DZAA 4B6IA 5EHHA 3GWNA 2KW3C 3LJBA 5FZTA 1BR1A 2OQMA 1OCCC 3CQZA 3NG1A 4FWVA 2MWQA 2WVNA 4LERA 3SZRA 4U5HA 2YZSA 1YA7O 3U3BA 4CS8C 1YARO 4JCZA 4NQFA 1K04A 4JW1A 4MVQA 3L8IA 5FCLA 4CS9A 2XM4A 4BPMA 2Y3HA 1U89A 2KNHA 1T6IA 4DBRA 1W2WA 3JYYA 2HV6A 1YYXA 4JIOA 1Z7Qc 3C7JA 3FDQA 2BC5A 2EIKC 1MQVA 4WGZA 2UUHA 3BEHA 2XLMA 1QLEC 1HE1A 3I5QA 3JYHA 2P0NA 1MNEA 4H54A 4CDVA 1E84A 1YVIA 3ZTZA 2OG2A 2L6HA 3LEVA 4BJ5C 1LE2A 2PF4E 2YQYA 5KYYA 1TWCA 3GM3A 3U3FA 3VF0A 3CEXA 2MYSA 4DRJB 1EI7A 3L1MA 4DRHB 4XLPF 4FX5A 5L3QA 2JPUA 2H7OA 3QZCA 3FOPA 1T01A 4BJ6C 4EBJA 4MVMA 1T5OA 5DQZA 5K0IA 4OIPF 4LACB 1G5ZA 3U8PA 3PMRA 5DLJA 3DJNB 1LIHA 3NYLA 4OIRF 4EUKB 2KYHA 3KYJA 3S27A 1Z6AA 4C3BA 3SNHA 1LVKA 4JC7A
chains in the Genus database with same CATH topology
1WWPA 4XEVA 3O10A 3JYYA 1JOGA 1WTYA 1UFBA 3C8GB 3RQEA 1WOLA 3K7DA 3C8GA 3S9OA 3U0CA 2JX0A 2Q00A 1K40A 5F28E 4XEFA 4EBKA 2L6HA 2YWAA 3BRJA 4R32A 1KTMA 3MFNA 3B71A 3GM3A 3AJMA 3C18A 1ZZPA 3U3FA 1OW7A 1KNYA 1PV3A 2KK1A 1K05A 1QVXA 3L8JA 3RQFA 1O3UA 1OW8A 2JPUA 2HSBA 3GM1A 2LK4A 4EBJA 3C8GD 3TULA 3JZ0A 2PBEA 4NQFA 1K04A 4XEKA 3RQGA 2L6GA 2L6FA 1OW6A 3L8IA 1V4AA 3GM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWP A;  4XEV A;  3O10 A;  3JYY A;  1JOG A;  1WTY A;  1UFB A;  3C8G B;  3RQE A;  1WOL A;  3K7D A;  3C8G A;  3S9O A;  3U0C A;  2JX0 A;  2Q00 A;  1K40 A;  5F28 E;  4XEF A;  4EBK A;  2L6H A;  2YWA A;  3BRJ A;  4R32 A;  1KTM A;  3MFN A;  3B71 A;  3GM3 A;  3AJM A;  3C18 A;  1ZZP A;  3U3F A;  1OW7 A;  1KNY A;  1PV3 A;  2KK1 A;  1K05 A;  1QVX A;  3L8J A;  3RQF A;  1O3U A;  1OW8 A;  2JPU A;  2HSB A;  3GM1 A;  2LK4 A;  4EBJ A;  3C8G D;  3TUL A;  3JZ0 A;  2PBE A;  4NQF A;  1K04 A;  4XEK A;  3RQG A;  2L6G A;  2L6F A;  1OW6 A;  3L8I A;  1V4A A;  3GM2 A; 
#chains in the Genus database with same CATH topology
 1AEP A;  3FAP B;  2YEV A;  3AG4 C;  2EIN C;  4DJ9 A;  1UFB A;  1VMA A;  1YJG A;  3EZH A;  3K7D A;  5L0C A;  2YLG A;  2NUP B;  4PFP A;  2X51 A;  4WAB A;  4A2N B;  4Z9J A;  4BEJ A;  5JVE A;  5KYX A;  3DM9 B;  2A68 F;  4ZLD A;  4U5F E;  1KTM A;  3V5X A;  5L0F A;  2X0C A;  3NYM A;  3ZDL A;  4U5G A;  1JPJ A;  4MW3 A;  3SYN A;  3T6J A;  4BJ1 A;  4D4N A;  3DJU B;  1K05 A;  4PJL A;  3V5Z A;  4G7Z F;  3FOO A;  2R25 A;  2R9R B;  2EPO A;  1BZ4 A;  1CGO A;  3H2V A;  3EH1 A;  4ULV A;  1NLX A;  2EIJ C;  2QTV A;  3ASO C;  1WAT A;  3HNL A;  1ZHX A;  3GWL A;  1OXB A;  2ASR A;  2QE9 A;  3KKB A;  4U9E A;  4YL3 A;  3LLK A;  4U9D A;  2L7A A;  5E33 A;  2J45 A;  3MYF A;  5JP7 A;  5L0J A;  1OCO C;  3MFN A;  3MBG A;  1CGM E;  1H6G A;  4MTO A;  3NMI A;  3SXK A;  5T1D B;  3KH2 A;  2EPM X;  1C02 A;  1WN0 A;  1ZHY A;  2Y69 C;  2HFI A;  4YT5 A;  5GPG B;  3VRC A;  1GGQ A;  3EG9 B;  1RXQ A;  4BJ6 A;  2CDQ A;  4YN0 B;  2YKZ A;  3POV A;  3UMH A;  2GA0 A;  2DYS C;  4JZA A;  2P1A A;  4G7H F;  3ZC4 A;  4DXW A;  2XSE A;  3GEI A;  3FHD A;  1QZX A;  4J30 B;  3LAY A;  2VH3 A;  2R7R A;  5DS6 A;  3EH2 A;  4LDR A;  4C7O A;  1OCR C;  2HKV A;  5E3A A;  3RH3 A;  3HLZ A;  2WB7 A;  2EPK X;  2Y39 A;  1LI5 A;  3EG9 A;  3NKE A;  2D5R B;  3CAX A;  2HV7 A;  4JTA B;  4DOZ A;  4J7T A;  2Q7R A;  2Y3G A;  2YLI A;  3U2L A;  4H4K C;  1CPQ A;  5L3V A;  1YLM A;  3FVY A;  1D0Y A;  3C62 A;  3KL4 A;  3JCU Q;  5F5H A;  2OKU A;  5CI9 A;  1FTS A;  1PCX A;  4AX2 A;  4Q7C A;  4G7O F;  3B71 A;  4P9T A;  4Q5S F;  2A0U A;  3V5Y A;  1L3P A;  2PNO A;  2XS8 A;  2YLD A;  3FAJ A;  4O6N A;  1Z23 A;  5L0I A;  3Q6M A;  2ZD9 A;  4L6R A;  2Q00 A;  1ORS C;  4ER9 A;  3RYL A;  3H65 A;  1IW7 F;  5CI8 A;  2Q3T A;  1V55 C;  2J9U A;  4GYT A;  2V26 A;  2I15 A;  4EBK A;  1CPR A;  4R32 A;  4YT8 A;  5A69 A;  5JS5 A;  5L0D A;  1D0X A;  2B0J A;  1KNY A;  3HNK A;  2VC9 A;  4KBL A;  1QVX A;  2W4B A;  5CIV A;  3T4R A;  2XRH A;  2R7W A;  3EPV A;  4RD9 A;  1MMN A;  2LK4 A;  4N4W A;  5DS4 A;  4JEA A;  5IY5 C;  1QQ3 A;  3O55 A;  3Q6N A;  1LS4 A;  1ZU4 A;  3K1H A;  2OJE D;  3W4Y A;  1AVO B;  1LI7 A;  1NU7 D;  4WGY A;  3M15 A;  1WOL A;  2CCY A;  2XXA B;  1ZW3 A;  4IAQ A;  1F1M A;  2XM0 A;  1SF8 A;  1J8M F;  3R7C A;  4JEB A;  4MVZ A;  2XLE A;  4CSA A;  1OCZ C;  3N0T A;  4U5D E;  1LS1 A;  1RKC A;  2A6H F;  5B1B C;  5T3W A;  2NG1 A;  4U5E E;  4MS2 A;  1RCP A;  2AP3 A;  4NY3 A;  1I4Z A;  2OJQ A;  3Q7L A;  1HMD A;  2PFD A;  2Y3D A;  3DAF A;  2LP4 A;  3RFY A;  3U8V A;  3M1C B;  4KI2 A;  2XLV A;  2FFH A;  3QVY A;  1HW2 A;  1L7C A;  3MYI A;  1E85 A;  2YL0 A;  1D1B A;  3S28 A;  3RKO F;  1QKR A;  2R05 A;  1S05 A;  4E18 A;  1G8X A;  3O10 A;  3DE9 A;  1MMG A;  4XPW A;  1FNT c;  3DI5 A;  4I1O B;  1QPU A;  3ECS A;  1TKN A;  2JX0 A;  1IZM A;  4CX9 A;  3T6B A;  1ST6 A;  4MND A;  2WZG A;  1DOW A;  2XL6 A;  3S29 A;  4JRZ A;  1OR2 A;  4JTC B;  2XL8 A;  3BRJ A;  2GAQ A;  1D1C A;  2Q9B A;  3ATP A;  5COM A;  4OIN F;  2VCA A;  1D0Z A;  1VYI A;  4A4A A;  2NSG A;  3L34 A;  2AVK A;  3PCV A;  1M2V A;  3GEE A;  5KYX B;  4RBN A;  4O6M A;  4GEH A;  2DYR C;  2Q9C A;  3ZTM A;  4DVY P;  2HJM A;  5EK0 A;  3I4U A;  4CSA C;  4IGG A;  2NUT B;  2QLA A;  4MVU A;  2FGY A;  3T9O A;  3PDM P;  1UG7 A;  2LQG A;  3S84 A;  2JD3 A;  1Q0K A;  5B1A C;  1FFH A;  2HMQ A;  2P7V A;  5E3C A;  4O6Y A;  5JLI A;  1EKY A;  2DI3 A;  4E7Z A;  4K7B A;  2QY9 A;  1HY5 A;  1N1C A;  2KQ9 A;  1VLT A;  3LUT B;  4CS8 A;  2QNL A;  3UGP A;  3UNG C;  1NFN A;  5BQH A;  3EFO A;  3SP1 A;  3EQL F;  1Q0D A;  2OCC C;  3MX3 A;  1ZHZ A;  1HW1 A;  2TMV P;  2BE5 F;  2YWA A;  4HE8 D;  2IOQ A;  2XLH A;  4FES A;  2L81 A;  3AJM A;  3C18 A;  1BR4 A;  2E87 A;  2EPN A;  4NC3 A;  2P6V A;  4QDL A;  1EQ1 A;  3KMI A;  1YZC A;  3ASN C;  3C8Z A;  3A11 A;  3WAQ A;  1YYJ A;  4PJN A;  3U5S A;  1A0B A;  3U2M A;  1GS9 A;  2OEX A;  2R02 A;  1EA8 A;  1NBB A;  2VB6 A;  3NKD A;  3W2V A;  3TUL A;  4K0D A;  1A7D A;  2LSE A;  3EGX B;  1G4W R;  1MND A;  3EZI A;  2RD9 A;  3K1I A;  2OU6 A;  2Q9A A;  3K6B A;  4MQ9 F;  3VAY A;  4XEV A;  5EGY A;  2XXA A;  4OIO F;  1MMA A;  4Z9H A;  4G0H A;  2Q4F A;  3RQE A;  4O79 A;  4P9F A;  3ZQY A;  3QW0 A;  3HKK A;  2J7P D;  4U5B E;  2H8A A;  5F28 E;  3RF3 A;  5KYU B;  5KYY B;  5KYU A;  5DQT A;  4OD5 A;  4MTG A;  2R7Q A;  1APC A;  3B9Q A;  3AQC A;  3G4X A;  5D91 A;  3SEO A;  2ZXO A;  3QMK A;  3TOL A;  2PX0 A;  4E0I A;  1XZP A;  4KC9 A;  3B0U X;  1VLS A;  1Z3I X;  2GFH A;  3ABM C;  3ABK C;  3DE8 A;  4N6H A;  1OW8 A;  3JSE O;  1Z63 A;  3EJN A;  3GM1 A;  3IQT A;  2AWC A;  3MLG A;  3LNR A;  3G4Z A;  1FFT C;  5DS5 A;  4HFK B;  1PD0 A;  3RQG A;  2KSF A;  2NUP A;  3HNI A;  1SYQ A;  2BL2 A;  3M79 A;  2L6F A;  3OEO A;  4YT4 A;  2IYL D;  3NMJ A;  2ETS A;  2UUI A;  3UR3 C;  2RSE B;  3HNJ A;  4JJF A;  3TOM A;  3UMI A;  3V7O A;  3RW0 A;  4C3E A;  1O5H A;  2IXN A;  4AK9 A;  4YL0 A;  4OIQ F;  2R03 A;  4XLN F;  2J9W A;  4EHP A;  1ZW2 A;  1LM3 B;  4Z9I A;  2YL3 A;  2VAS A;  2W45 A;  4P6I C;  4I44 A;  3LS0 A;  2GDC A;  2ZXR A;  1Y6D A;  2CW0 F;  2V3C C;  1CGN A;  4ONS A;  4AL0 A;  4BEM J;  5JUA A;  5HV9 A;  3E70 C;  4IB4 A;  3RQF A;  2ZPA A;  3AQB A;  2G3V A;  1T6U A;  2HSB A;  3E9V A;  3OWT A;  2G62 A;  4JUR I;  1HE9 A;  1OKK A;  1JPN A;  3GOR A;  2NUT A;  5KYN A;  4KNW A;  1GM5 A;  2LFD A;  4F4B A;  3DAG A;  2O9X A;  4MW8 A;  1NSG B;  4YK5 A;  5AGF A;  2ZXP A;  1R5I D;  4CS7 A;  4NTF A;  1Y4C A;  1KU2 A;  1T9K A;  1I4Y A;  2A0B A;  3EFO B;  4XPY A;  1FMW A;  4XPX A;  2CNW A;  2LFF A;  1NFO A;  3LNM B;  3RIP A;  1WAS A;  4RDA A;  1M6T A;  5KYW B;  2IM8 A;  4PFO A;  4GQH A;  1Q0M A;  4NCQ A;  4ANJ A;  2R7V A;  4AE4 A;  3ZWI A;  3HTK C;  1U6H A;  2B0H A;  2CYD A;  5E2Q A;  1DOV A;  4IJJ A;  3ZSU A;  5AC5 A;  2XS1 A;  3ITF A;  2KK1 A;  4I3M A;  4N6C A;  1H9T A;  5BUO A;  2R7T A;  3FMS A;  2VCB A;  2PP4 A;  4AE4 B;  1PD1 A;  3DM5 A;  3ZIB A;  5A6B A;  4JJG A;  3H2U A;  1U0B B;  3AGU A;  2Z15 A;  3IEE A;  4XWJ A;  3A9C A;  1VB5 A;  1Z5Z A;  2CNW D;  1VOM A;  1XZQ A;  3IQ5 A;  4DVZ A;  2F22 A;  1ZYR F;  3IQ6 A;  3GM2 A;  1JR8 A;  1TR2 A;  4MTF A;  1A7E A;  3C8G B;  1M57 C;  2WVQ A;  3NYJ A;  2C04 A;  2EIL C;  1MMD A;  3ZVR A;  1LE4 A;  1LKX A;  2ICW G;  1AUE A;  2L9J A;  3C63 A;  3GOD A;  3KPH A;  2ZXW C;  2HUJ A;  5A6B D;  4BG0 A;  2C03 A;  3WHN A;  3O6X A;  4DRI B;  4EBB A;  2YRF A;  1OR3 A;  2J9B A;  4IAR A;  5F5F A;  2J0X A;  4JVS A;  1E86 A;  2YL7 A;  4UDV A;  1BR2 A;  3Q7G A;  4N06 A;  1C03 A;  3EHN A;  4E17 A;  2AWY A;  3QVZ A;  4W8P A;  1RMV A;  2LCH A;  3DXJ F;  3O39 A;  3KYI A;  1TQG A;  2PBE A;  3QTH A;  2MHR A;  1B68 A;  3F47 A;  4CS9 C;  4E7S A;  3WOD F;  1YA9 A;  1OW6 A;  1YAU O;  1TWA A;  1YDI A;  3LEO A;  3RVZ A;  4DBQ A;  4EWC A;  1Q0F A;  2WZF A;  4E0H A;  1JOG A;  1WTY A;  2EIM C;  3AG1 C;  5DVW A;  1JAF A;  1ZHT A;  4K1O A;  3S9O A;  4Q4Z F;  3VM6 A;  2AU5 A;  4HFF B;  3ABL C;  4CJG A;  3N2Z B;  4M63 A;  3TK0 A;  3US6 A;  4WJ0 A;  3SXM A;  5KYW A;  3WG7 C;  2M4E A;  2LD6 A;  4KNV A;  1VYK A;  1VK5 A;  2A1D D;  2IXM A;  4JKV A;  5AC4 A;  1ZVZ A;  4MVS A;  3DMD A;  1ZU5 A;  1PV3 A;  4LDQ A;  1TFO B;  2LIG A;  3L8J A;  3CSK A;  3AG2 C;  3L0I A;  3DWW A;  3U9J A;  4ZLC A;  4PJM A;  2HMZ A;  2KGO A;  2J46 A;  2J9V A;  2PX3 A;  4YL1 A;  3EGD A;  4C7O B;  3F46 A;  2R7U A;  4XQ1 A;  3K1I C;  2L6G A;  1RJ9 B;  4IWB A;  4XTK A;  3HJC A;  1NU9 C;  1H9G A;  1R4T A;  3CZ6 A;  4BJT A;  1BBH A;  2DGJ A;  3JRT A;  1WGW A;  3LLI A;  5B3S C;  3UGO A;  4HEA J;  3C8G A;  2A6E F;  1ORY A;  3JSZ A;  1K40 A;  3AGT A;  3VYW A;  2IXP A;  2XLD A;  3LES A;  5COG A;  1M2V B;  4YWQ A;  3K33 A;  4QI0 A;  3W8I A;  2R7X A;  2KC3 A;  1LPE A;  3UMK A;  1FMV A;  4OD4 A;  1GQA A;  3I5P A;  1M2O A;  2OOC A;  5A6K A;  4JTD B;  1BDJ B;  4NTA A;  4LLE A;  5A6J A;  1OW7 A;  1J8Y F;  2IBF A;  4CIP A;  3NMK A;  3W8H A;  1H7I A;  1OQC A;  3TJ5 A;  2Y3B A;  1A7V A;  1O3U A;  4D4X A;  2J7P A;  2HS5 A;  4BJ5 A;  5BQG A;  1V74 B;  3C8G D;  1M56 C;  3TQO A;  3IQC A;  2YL1 A;  4ULW A;  256B A;  3T6G B;  2D4U A;  2I8B A;  4IRU A;  3GEH A;  4X0R A;  1HMO A;  3R2P A;  1V54 C;  4EKW A;  1VTM P;  3AOU A;  4PK4 A;  3B0P A;  1E2X A;  2M64 A;  1XWJ A;  2IXO A;  4C3D A;  1T6Q A;  2WVO A;  3M4C A;  4LDK A;  5COF A;  5D92 A;  3TD7 A;  4CDY A;  1TWG A;  1TFK B;  1YZA A;  1S7Z A;  1SR2 A;  1RKE B;  3IPM O;  2HZ8 A;  3DKA A;  2DB4 A;  2VCC A;  4AL1 A;  1ZHW A;  2KJG A;  4O7G A;  5BQI A;  1O87 A;  3J06 A;  3G50 A;  4CBE A;  4I1M A;  4J7Y A;  4NTB A;  3TJ6 A;  1FR0 A;  1C17 M;  5JSL A;  5T3T A;  3EGX A;  2HSQ A;  1I5N A;  2NSF A;  2OEV A;  3EGD B;  3N24 A;  3NRH A;  3SXZ A;  5JT4 A;  2H7V C;  3JZ0 A;  3M4B A;  2H7B A;  1E83 A;  3SXY A;  3NDB B;  2G3K A;  1RJ9 A;  2XLW A;  4CIH A;  1V4A A;  1JRA A;  2A69 F;  4W8K A;  4YJW A;  3U9M A;  5L0G A;  1OXK A;  3IHU A;  2GWW A;  2HJ3 A;  3B0V C;  2R7S A;  2CGE A;  4JE9 A;  3U0C A;  2EPL X;  2P61 A;  3W2W A;  2WL8 A;  1SMY F;  3FXH A;  4JCH A;  4XEF A;  4G78 A;  3AG3 C;  3EHM A;  4U5C E;  2J8W A;  2NPU A;  3ZG1 A;  5TJ5 E;  3OA1 A;  3S0X A;  4QI2 A;  1QSP A;  1G4U S;  3RVY A;  3JTL O;  4LLC A;  3PHF 2;  4PR9 A;  1A41 A;  2YVK A;  2XL4 A;  3K66 A;  1Q0G A;  3B29 A;  3S90 A;  2R7O A;  1NG1 A;  2QUP A;  2W4M A;  4XEK A;  5L0H A;  2FAP B;  2WZL A;  3DD7 A;  3LS1 A;  5A6A A;  5HSW A;  1WWP A;  1ORJ A;  1TWH A;  2XLO A;  3JT1 A;  3X1O A;  4CDA A;  2J0W A;  5JRA A;  2YHS A;  2W9Y A;  3JRM O;  4CJO A;  1OKK D;  4FAP B;  4PJJ A;  1NZE A;  4MVO A;  1JMW A;  3GAN A;  4PAC A;  4EIY A;  1D1A A;  3QW1 A;  4IAO A;  3X2Q C;  1RKE A;  4YT2 A;  4J32 B;  3ZQV A;  4MVR A;  1SZI A;  5B3I A;  1ZZP A;  1FAP B;  3DZA A;  4B6I A;  5EHH A;  3GWN A;  2KW3 C;  3LJB A;  5FZT A;  1BR1 A;  2OQM A;  1OCC C;  3CQZ A;  3NG1 A;  4FWV A;  2MWQ A;  2WVN A;  4LER A;  3SZR A;  4U5H A;  2YZS A;  1YA7 O;  3U3B A;  4CS8 C;  1YAR O;  4JCZ A;  4NQF A;  1K04 A;  4JW1 A;  4MVQ A;  3L8I A;  5FCL A;  4CS9 A;  2XM4 A;  4BPM A;  2Y3H A;  1U89 A;  2KNH A;  1T6I A;  4DBR A;  1W2W A;  3JYY A;  2HV6 A;  1YYX A;  4JIO A;  1Z7Q c;  3C7J A;  3FDQ A;  2BC5 A;  2EIK C;  1MQV A;  4WGZ A;  2UUH A;  3BEH A;  2XLM A;  1QLE C;  1HE1 A;  3I5Q A;  3JYH A;  2P0N A;  1MNE A;  4H54 A;  4CDV A;  1E84 A;  1YVI A;  3ZTZ A;  2OG2 A;  2L6H A;  3LEV A;  4BJ5 C;  1LE2 A;  2PF4 E;  2YQY A;  5KYY A;  1TWC A;  3GM3 A;  3U3F A;  3VF0 A;  3CEX A;  2MYS A;  4DRJ B;  1EI7 A;  3L1M A;  4DRH B;  4XLP F;  4FX5 A;  5L3Q A;  2JPU A;  2H7O A;  3QZC A;  3FOP A;  1T01 A;  4BJ6 C;  4EBJ A;  4MVM A;  1T5O A;  5DQZ A;  5K0I A;  4OIP F;  4LAC B;  1G5Z A;  3U8P A;  3PMR A;  5DLJ A;  3DJN B;  1LIH A;  3NYL A;  4OIR F;  4EUK B;  2KYH A;  3KYJ A;  3S27 A;  1Z6A A;  4C3B A;  3SNH A;  1LVK A;  4JC7 A; 
#chains in the Genus database with same CATH homology
 1WWP A;  4XEV A;  3O10 A;  3JYY A;  1JOG A;  1WTY A;  1UFB A;  3C8G B;  3RQE A;  1WOL A;  3K7D A;  3C8G A;  3S9O A;  3U0C A;  2JX0 A;  2Q00 A;  1K40 A;  5F28 E;  4XEF A;  4EBK A;  2L6H A;  2YWA A;  3BRJ A;  4R32 A;  1KTM A;  3MFN A;  3B71 A;  3GM3 A;  3AJM A;  3C18 A;  1ZZP A;  3U3F A;  1OW7 A;  1KNY A;  1PV3 A;  2KK1 A;  1K05 A;  1QVX A;  3L8J A;  3RQF A;  1O3U A;  1OW8 A;  2JPU A;  2HSB A;  3GM1 A;  2LK4 A;  4EBJ A;  3C8G D;  3TUL A;  3JZ0 A;  2PBE A;  4NQF A;  1K04 A;  4XEK A;  3RQG A;  2L6G A;  2L6F A;  1OW6 A;  3L8I A;  1V4A A;  3GM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...