2L6HA

Fat domain of focal adhesion kinase tethered to ld4 motif of paxillin via ggs linker
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
154
Chain Sequence
MANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPHSATRELDELMASLSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase,cell adhesion
molecule keywords Focal adhesion kinase 1, linker, Paxillin
publication title Fat Domain of Focal Adhesion Kinase Tethered to Ld4 Motif of Paxillin via GGS Linker
rcsb
source organism Gallus gallus, unidentified
total genus 55
structure length 154
sequence length 180
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2l6hA00
3GM1A 4XEKA 1WOLA 1K05A 3JYYA 1KNYA 2KK1A 1JOGA 2JX0A 1UFBA 3C8GD 4R32A 1OW7A 3C18A 1WWPA 1WTYA 2L6FA 2Q00A 3MFNA 3O10A 3S9OA 1OW8A 1QVXA 3BRJA 2L6HA 4XEVA 4EBKA 3C8GA 3GM3A 3K7DA 2YWAA 3U0CA 3B71A 3JZ0A 3TULA 2L6GA 5F28E 1OW6A 1K40A 3RQEA 2PBEA 2LK4A 1O3UA 3L8JA 3RQGA 1V4AA 3C8GB 1KTMA 1PV3A 1ZZPA 2JPUA 2HSBA 4EBJA 1K04A 3GM2A 4NQFA 4XEFA 3U3FA 3RQFA 3AJMA 3L8IA
chains in the Genus database with same CATH superfamily
2XLDA 4D4NA 2QLAA 3H2VA 3O39A 3TQOA 2GDCA 2OG2A 3Q6NA 3T6JA 3RFYA 2LD6A 3SXZA 2Y3BA 1GS9A 4HFKB 3T9OA 3VF0A 2AVKA 3ZG1A 4B6IA 3B9QA 2Q4FA 4DBRA 5B1BC 3SXMA 5EHHA 1E85A 3E9VA 4X0RA 3DM9B 2Q00A 4G0HA 4YT5A 4AE4B 3F46A 3GEEA 3B0VC 1Q0MA 2Y39A 2EIMC 2CW0F 1MQVA 4NTBA 2CNWD 4DRHB 1SMYF 2FAPB 5BUOA 3TULA 1NU9C 3M4BA 4JE9A 4BJTA 1IW7F 2QE9A 2YL1A 2JD3A 4PACA 3ZTMA 2EPOA 2HSQA 1T6UA 2LK4A 2W45A 2CNWA 2UUIA 4I1MA 3ECSA 5L0HA 4GQHA 2WZGA 1LI5A 3R7CA 1LI7A 1OR3A 4U5BE 4AE4A 2YZSA 2DB4A 5KYNA 3K1IA 4XLPF 4PJLA 3AQCA 4FESA 1O5HA 4YN0B 2P61A 2GWWA 2X0CA 1YYJA 5A6BA 4FAPB 1Z63A 4J7YA 1C02A 1B68A 2G3KA 4EBKA 4U5CE 1TWHA 3DD7A 2LSEA 4N06A 4Q4ZF 1GQAA 3S29A 1Z5ZA 3EGXB 1Z3IX 4W8PA 1JAFA 4CDAA 3NDBB 256BA 3IQ5A 5HV9A 2B0JA 1Q0GA 2YVKA 2GAQA 2EPMX 2H8AA 3DI5A 4NTFA 1ZZPA 3W2VA 1RXQA 2YL3A 3TD7A 3OA1A 4U5DE 5L0JA 2IOQA 3L0IA 2W4BA 3MX3A 4E0HA 3K1IC 4GYTA 1NLXA 3EFOB 1VLSA 3ZIBA 3NMIA 5KYUB 2FGYA 2QY9A 4PFPA 5T3TA 3RW0A 2ETSA 2D5RB 3LNRA 3AGUA 3JTLO 3HNKA 4LDQA 3X1OA 4G7ZF 3EGXA 4OIQF 2CGEA 3DKAA 3LNMB 3EZIA 4MS2A 3QW1A 2H7OA 1RMVA 4IWBA 4JEAA 1VYIA 4CX9A 1UG7A 2XS8A 3KL4A 1LS4A 2AP3A 3CEXA 5CI9A 1CGME 3GORA 3UGOA 1OW6A 1ZHTA 1TFKB 2L9JA 3GWLA 1HW2A 2HV7A 3LEVA 3V5XA 1XZPA 3RF3A 4P6IC 1FMVA 3AG1C 4HFFB 3SXYA 1ZHXA 3ZQYA 5KYUA 4U5GA 1SZIA 3FVYA 4U9DA 4WABA 4K7BA 3W8HA 1SF8A 2WZFA 3B71A 2OJED 4FWVA 5BQGA 3FDQA 2YEVA 3QMKA 4RDAA 1C17M 1QQ3A 1UFBA 2DYSC 4QDLA 4JURI 1ORYA 1JRAA 2HMQA 5A6JA 4O7GA 2HS5A 3I5PA 1ZU4A 2R05A 1YZCA 4YL1A 4LLEA 4Z9IA 5JP7A 2ASRA 3T6BA 5KYXB 3ZTZA 1QKRA 4JTCB 4EWCA 5F28E 5DLJA 2OU6A 4C3BA 3S27A 2R7XA 2OQMA 5F5FA 2AU5A 5T3WA 1H9GA 3U8PA 3V7OA 4JKVA 1WATA 4CJOA 4DVZA 1V4AA 3DZAA 5AC5A 3PCVA 3EHMA 4EBJA 3EG9B 1H9TA 3FHDA 2QTVA 3O55A 3W8IA 3U3FA 3G4XA 4YT2A 3NG1A 2KQ9A 2IBFA 4IARA 3C63A 4MVRA 4P9FA 4YJWA 3SXKA 3TOLA 1MMAA 3BEHA 1RJ9B 5KYXA 1M2OA 1N1CA 1YDIA 2YKZA 3L34A 4MW8A 5L0CA 3GODA 2IXPA 3MFNA 2RD9A 2J0XA 1FMWA 4EIYA 4IAOA 1OW8A 4JTDB 2W4MA 2HJMA 1L3PA 1D0XA 2M64A 2R03A 2IXMA 1I5NA 1M56C 3GM3A 3PHF2 2P6VA 3C7JA 2HMZA 5E2QA 3EG9A 2R7RA 5EK0A 2P0NA 2F22A 1GGQA 2HZ8A 1BR1A 1F1MA 1TWGA 3A9CA 1KTMA 4AK9A 4JVSA 1FTSA 1RJ9A 2VC9A 3EPVA 1BR4A 1OCZC 3ABKC 3KYIA 4XQ1A 3IQ6A 3K6BA 3Q6MA 2YHSA 4A4AA 4MTOA 3HJCA 3UNGC 1K05A 2NSGA 5BQIA 3LEOA 2D4UA 3SZRA 2MHRA 3R2PA 4YWQA 5A69A 4JRZA 2A1DD 1MNEA 4U5EE 3QVZA 4E7SA 3MLGA 1Q0DA 3DAFA 3QW0A 3S9OA 3JSEO 1QVXA 4U9EA 4OINF 5E3CA 1ZHYA 2I8BA 3UR3C 1G4US 5JSLA 4C7OB 1EKYA 4CS7A 4L6RA 3T4RA 3SP1A 4JJGA 1VK5A 1MNDA 1A7DA 1W2WA 1MMNA 4W8KA 3RQGA 3KMIA 2MYSA 3WAQA 3Q7LA 5D92A 5COFA 2KYHA 3M4CA 3WHNA 2PX0A 3QZCA 4E7ZA 3ZDLA 2VH3A 1NBBA 3HNLA 2EIJC 1EA8A 4ULVA 1AVOB 4N6CA 4OD5A 1NFNA 3ZQVA 2PX3A 1E84A 1I4YA 3S84A 1HMDA 2DGJA 3OEOA 5COMA 5JUAA 4C7OA 1MMDA 1FR0A 1FAPB 3MYIA 4H54A 2CYDA 3ABLC 1PCXA 2LFDA 4C3EA 1L7CA 3EGDB 4WJ0A 2Q7RA 5L0GA 1RKCA 4H4KC 3GWNA 2Z15A 2C03A 2AWYA 4J32B 2R7SA 2FFHA 4IB4A 1ZVZA 1D1CA 4PK4A 4KI2A 2XS1A 1SYQA 3C8ZA 4XLNF 5BQHA 2GA0A 1FFHA 3U2LA 4Z9HA 1JPJA 4PJMA 2WL8A 4EBBA 3C8GB 1NG1A 3M79A 4DJ9A 2R02A 3EZHA 5JLIA 2IXNA 3EGDA 2Q9CA 4U5HA 5GPGB 4CS8A 2NUPB 3AGTA 2G62A 3LS1A 3C8GD 3E70C 3NYJA 4DXWA 2QUPA 3DE9A 4MVUA 4WGZA 5DVWA 5L0IA 1HE9A 1WTYA 3UGPA 3DJUB 2R7QA 2OEVA 1APCA 2Q3TA 2O9XA 2OOCA 5L0FA 3C8GA 2VCAA 4G7HF 4CIHA 3W4YA 1TWAA 3IPMO 4CS9A 1XWJA 2L6GA 1YVIA 1BR2A 1VB5A 2OKUA 4XTKA 3VM6A 2EPNA 2ZD9A 2EPLX 2PBEA 3AG2C 1Q0FA 3AQBA 2HFIA 4JEBA 4DRIB 2NUPA 2PF4E 3EFOA 1YYXA 1G4WR 4JW1A 2ICWG 4LDRA 3B0PA 3RQFA 5JS5A 3L8IA 1CGOA 2OEXA 4GEHA 4LLCA 4CS8C 4F4BA 2R7VA 2XXAA 2BL2A 2KK1A 3JCUQ 2V26A 4ANJA 1CPQA 1TWCA 2H7VC 3WODF 3DAGA 3FXHA 1OW7A 2HJ3A 4MVSA 4HE8D 1PD0A 2YQYA 2KJGA 5CI8A 2XSEA 3GEHA 3LAYA 1J8YF 4XEVA 3FMSA 1TFOB 4CS9C 3NMJA 2XM0A 2J7PD 3RH3A 3U9JA 1WASA 3LLIA 1MMGA 3UMIA 2HKVA 5B3IA 3U5SA 1YAUO 1R5ID 2J7PA 4O6NA 5K0IA 1PV3A 1H7IA 2JPUA 5AGFA 2KNHA 4QI2A 2EILC 3CQZA 3WG7C 2LQGA 3ASOC 4CSAA 1HY5A 2P7VA 1E2XA 4MVOA 4ONSA 4E17A 2G3VA 3CAXA 3GM1A 4JTAB 4XEKA 5COGA 2J45A 4CDYA 2OCCC 1TKNA 1V54C 3ITFA 1I4ZA 1NSGB 2BC5A 2VB6A 3M15A 3V5YA 3IQCA 1WWPA 3F47A 1WGWA 4QI0A 1D0ZA 4JJFA 4JCZA 4U5FE 4AL0A 4DRJB 3U8VA 3S0XA 4KNWA 3AJMA 2B0HA 4XPXA 2OJQA 3LS0A 5FCLA 2J9BA 3HNJA 3EH1A 3PDMP 2A69F 2L81A 2KSFA 3LLKA 4M63A 3TK0A 1OCRC 1Y6DA 1RKEB 5HSWA 4MTGA 5L3VA 1OCCC 3IEEA 2NUTB 4C3DA 2XLVA 3HTKC 4DVYP 4CSAC 1JMWA 2P1AA 3SYNA 1M6TA 3L1MA 2XL6A 1ORSC 2ZXWC 2W9YA 1A7VA 1VLTA 3A11A 3HKKA 3NRHA 3X2QC 3EHNA 4NCQA 3ZC4A 1Y4CA 4BJ1A 2XM4A 4YK5A 3RIPA 4BEJA 1JOGA 4E18A 1EQ1A 2YLGA 5DS6A 1BDJB 1V74B 3LJBA 2ZXOA 4PJJA 1VTMP 3Q7GA 3W2WA 1U0BB 2L6FA 2XLHA 2EIKC 1IZMA 2AWCA 1LS1A 1RCPA 4ZLDA 1RKEA 2QNLA 1YARO 3AG4C 2KW3C 1T01A 2YWAA 2CCYA 2DYRC 3FOPA 4KBLA 4PR9A 2NUTA 4DOZA 3U0CA 1Z6AA 4ER9A 5L0DA 4Z9JA 5EGYA 3TOMA 4P9TA 1NFOA 3L8JA 1YLMA 2ZPAA 2A0BA 1Z23A 4NTAA 5AC4A 4O79A 3QVYA 1T9KA 1E83A 3DJNB 3DWWA 5D91A 1OQCA 2Q9BA 3RYLA 2RSEB 2LP4A 1KNYA 3DXJF 1CPRA 5CIVA 3N24A 4RBNA 2R7WA 1OR2A 3ATPA 3EQLF 1LE2A 1NZEA 3CSKA 4ULWA 4YT8A 1T6QA 3DM5A 5L3QA 1V55C 3ABMC 2VCBA 3BRJA 2DI3A 2L6HA 2WVNA 2YL0A 3K66A 3NYLA 3QTHA 4IGGA 3RVZA 1A41A 4N6HA 4CIPA 2C04A 4MVMA 1C03A 2PNOA 2Y3GA 4EKWA 1HW1A 1LE4A 2V3CC 1T6IA 1HE1A 1ST6A 2Y3DA 4OD4A 2UUHA 1ZW2A 1XZQA 2E87A 2HV6A 1ORJA 2J9WA 1J8MF 3IHUA 5E33A 1K04A 2J9VA 1U89A 1T5OA 4MTFA 4EHPA 3J06A 1ZHZA 3CZ6A 2XLWA 3FOOA 5A6BD 3C62A 3JRTA 3JYYA 4FX5A 3OWTA 3ASNC 1TQGA 4YT4A 2J9UA 3LESA 1YA9A 2NPUA 4CJGA 1WN0A 1VMAA 2R9RB 2IXOA 4IRUA 3H65A 1DOWA 1PD1A 1D1BA 1YZAA 3PMRA 4MNDA 3N2ZB 4JZAA 3U3BA 1FFTC 3ZVRA 4BG0A 4Q5SF 2Y69C 1YA7O 4K1OA 4J30B 4N4WA 4JIOA 5DQZA 2IYLD 2ZXRA 3B29A 4KNVA 2R7UA 3I5QA 2BE5F 3GEIA 2Y3HA 4I3MA 2PP4A 4LDKA 4JC7A 1SR2A 4JCHA 4XPWA 2WZLA 5B1AC 3S28A 3DE8A 2M4EA 1A7EA 4NQFA 5F5HA 5E3AA 1QSPA 2GFHA 3H2UA 2YL7A 1YJGA 4AL1A 2J8WA 4EUKB 1OXBA 3G50A 2YRFA 4OIPF 3TJ6A 3M1CB 3TJ5A 1H6GA 2H7BA 2IM8A 4G78A 2A6HF 1BZ4A 3GANA 3I4UA 1S7ZA 3K7DA 1OXKA 4NY3A 1EI7A 2MWQA 4BEMJ 1ZHWA 5KYYB 2R25A 2LFFA 4BPMA 1E86A 1VYKA 2LIGA 4BJ6A 4IAQA 2VASA 1K40A 1LVKA 3HLZA 2A68F 3UMHA 3NMKA 1D1AA 3UMKA 4IJJA 2XLMA 3LUTB 3VAYA 2VCCA 3JSZA 2J46A 5B3SC 2EINC 3O6XA 2WVQA 4LACB 4MQ9F 5DQTA 1O87A 2TMVP 4I1OB 2XLEA 4OIOF 5IY5C 1ZYRF 2A6EF 3S90A 1JPNA 4O6MA 2R7OA 3NKDA 2NSFA 3VYWA 1FNTc 1NU7D 1AEPA 1BBHA 1LIHA 1OKKD 2PFDA 1ZU5A 1OCOC 3K33A 4R32A 4ZLCA 3C18A 5KYYA 5A6AA 3VRCA 5JT4A 1M2VB 2WVOA 3JRMO 4AX2A 1QZXA 5JRAA 3DMDA 1GM5A 4LERA 5JVEA 1VOMA 1G8XA 1OKKA 2XL8A 1LPEA 3AOUA 4XPYA 3ZSUA 4MVZA 3MYFA 4BJ6C 2EPKX 4I44A 3B0UX 5T1DB 1LKXA 4G7OF 1U6HA 5TJ5E 2R7TA 2X51A 3EH2A 2XLOA 1LM3B 3ZWIA 1ZW3A 3N0TA 4YL0A 4DBQA 4CDVA 2HSBA 3RVYA 1KU2A 4WGYA 3U9MA 4A2NB 1D0YA 5DS4A 2KGOA 4XEFA 3FAPB 2XRHA 4BJ5A 1CGNA 2LCHA 5DS5A 1M2VA 3NYMA 1WOLA 3KKBA 1R4TA 4MVQA 1DOVA 2JX0A 3SNHA 4O6YA 2J0WA 1TR2A 3JT1A 3U2MA 5KYWB 3HNIA 5FZTA 1S05A 2KC3A 3KH2A 3KYJA 4Q7CA 3O10A 3RKOF 4HEAJ 3MBGA 4YL3A 3POVA 3NKEA 4D4XA 3KPHA 2XXAB 2XL4A 3IQTA 3JYHA 3SEOA 1G5ZA 4J7TA 3JZ0A 5A6KA 1Z7Qc 1QPUA 1AUEA 1Q0KA 2L7AA 2CDQA 3K1HA 2NG1A 3FAJA 2I15A 3RQEA 3G4ZA 3T6GB 3V5ZA 1O3UA 2YLIA 4MW3A 4UDVA 3US6A 4PFOA 2WB7A 2ZXPA 3AG3C 4PJNA 4OIRF 1A0BA 1HMOA 2HUJA 4KC9A 2A0UA 4RD9A 4BJ5C 3EJNA 1JR8A 2YLDA 3GM2A 1QLEC 4NC3A 4K0DA 4CBEA 4E0IA 5KYWA 4XWJA 2Q9AA 1M57C
chains in the Genus database with same CATH topology
3GM1A 4XEKA 1WOLA 1K05A 3JYYA 1KNYA 2KK1A 1JOGA 2JX0A 1UFBA 3C8GD 4R32A 1OW7A 3C18A 1WWPA 1WTYA 2L6FA 2Q00A 3MFNA 3O10A 3S9OA 1OW8A 1QVXA 3BRJA 2L6HA 4XEVA 4EBKA 3C8GA 3GM3A 3K7DA 2YWAA 3U0CA 3B71A 3JZ0A 3TULA 2L6GA 5F28E 1OW6A 1K40A 3RQEA 2PBEA 2LK4A 1O3UA 3L8JA 3RQGA 1V4AA 3C8GB 1KTMA 1PV3A 1ZZPA 2JPUA 2HSBA 4EBJA 1K04A 3GM2A 4NQFA 4XEFA 3U3FA 3RQFA 3AJMA 3L8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GM1 A;  4XEK A;  1WOL A;  1K05 A;  3JYY A;  1KNY A;  2KK1 A;  1JOG A;  2JX0 A;  1UFB A;  3C8G D;  4R32 A;  1OW7 A;  3C18 A;  1WWP A;  1WTY A;  2L6F A;  2Q00 A;  3MFN A;  3O10 A;  3S9O A;  1OW8 A;  1QVX A;  3BRJ A;  2L6H A;  4XEV A;  4EBK A;  3C8G A;  3GM3 A;  3K7D A;  2YWA A;  3U0C A;  3B71 A;  3JZ0 A;  3TUL A;  2L6G A;  5F28 E;  1OW6 A;  1K40 A;  3RQE A;  2PBE A;  2LK4 A;  1O3U A;  3L8J A;  3RQG A;  1V4A A;  3C8G B;  1KTM A;  1PV3 A;  1ZZP A;  2JPU A;  2HSB A;  4EBJ A;  1K04 A;  3GM2 A;  4NQF A;  4XEF A;  3U3F A;  3RQF A;  3AJM A;  3L8I A; 
#chains in the Genus database with same CATH topology
 2XLD A;  4D4N A;  2QLA A;  3H2V A;  3O39 A;  3TQO A;  2GDC A;  2OG2 A;  3Q6N A;  3T6J A;  3RFY A;  2LD6 A;  3SXZ A;  2Y3B A;  1GS9 A;  4HFK B;  3T9O A;  3VF0 A;  2AVK A;  3ZG1 A;  4B6I A;  3B9Q A;  2Q4F A;  4DBR A;  5B1B C;  3SXM A;  5EHH A;  1E85 A;  3E9V A;  4X0R A;  3DM9 B;  2Q00 A;  4G0H A;  4YT5 A;  4AE4 B;  3F46 A;  3GEE A;  3B0V C;  1Q0M A;  2Y39 A;  2EIM C;  2CW0 F;  1MQV A;  4NTB A;  2CNW D;  4DRH B;  1SMY F;  2FAP B;  5BUO A;  3TUL A;  1NU9 C;  3M4B A;  4JE9 A;  4BJT A;  1IW7 F;  2QE9 A;  2YL1 A;  2JD3 A;  4PAC A;  3ZTM A;  2EPO A;  2HSQ A;  1T6U A;  2LK4 A;  2W45 A;  2CNW A;  2UUI A;  4I1M A;  3ECS A;  5L0H A;  4GQH A;  2WZG A;  1LI5 A;  3R7C A;  1LI7 A;  1OR3 A;  4U5B E;  4AE4 A;  2YZS A;  2DB4 A;  5KYN A;  3K1I A;  4XLP F;  4PJL A;  3AQC A;  4FES A;  1O5H A;  4YN0 B;  2P61 A;  2GWW A;  2X0C A;  1YYJ A;  5A6B A;  4FAP B;  1Z63 A;  4J7Y A;  1C02 A;  1B68 A;  2G3K A;  4EBK A;  4U5C E;  1TWH A;  3DD7 A;  2LSE A;  4N06 A;  4Q4Z F;  1GQA A;  3S29 A;  1Z5Z A;  3EGX B;  1Z3I X;  4W8P A;  1JAF A;  4CDA A;  3NDB B;  256B A;  3IQ5 A;  5HV9 A;  2B0J A;  1Q0G A;  2YVK A;  2GAQ A;  2EPM X;  2H8A A;  3DI5 A;  4NTF A;  1ZZP A;  3W2V A;  1RXQ A;  2YL3 A;  3TD7 A;  3OA1 A;  4U5D E;  5L0J A;  2IOQ A;  3L0I A;  2W4B A;  3MX3 A;  4E0H A;  3K1I C;  4GYT A;  1NLX A;  3EFO B;  1VLS A;  3ZIB A;  3NMI A;  5KYU B;  2FGY A;  2QY9 A;  4PFP A;  5T3T A;  3RW0 A;  2ETS A;  2D5R B;  3LNR A;  3AGU A;  3JTL O;  3HNK A;  4LDQ A;  3X1O A;  4G7Z F;  3EGX A;  4OIQ F;  2CGE A;  3DKA A;  3LNM B;  3EZI A;  4MS2 A;  3QW1 A;  2H7O A;  1RMV A;  4IWB A;  4JEA A;  1VYI A;  4CX9 A;  1UG7 A;  2XS8 A;  3KL4 A;  1LS4 A;  2AP3 A;  3CEX A;  5CI9 A;  1CGM E;  3GOR A;  3UGO A;  1OW6 A;  1ZHT A;  1TFK B;  2L9J A;  3GWL A;  1HW2 A;  2HV7 A;  3LEV A;  3V5X A;  1XZP A;  3RF3 A;  4P6I C;  1FMV A;  3AG1 C;  4HFF B;  3SXY A;  1ZHX A;  3ZQY A;  5KYU A;  4U5G A;  1SZI A;  3FVY A;  4U9D A;  4WAB A;  4K7B A;  3W8H A;  1SF8 A;  2WZF A;  3B71 A;  2OJE D;  4FWV A;  5BQG A;  3FDQ A;  2YEV A;  3QMK A;  4RDA A;  1C17 M;  1QQ3 A;  1UFB A;  2DYS C;  4QDL A;  4JUR I;  1ORY A;  1JRA A;  2HMQ A;  5A6J A;  4O7G A;  2HS5 A;  3I5P A;  1ZU4 A;  2R05 A;  1YZC A;  4YL1 A;  4LLE A;  4Z9I A;  5JP7 A;  2ASR A;  3T6B A;  5KYX B;  3ZTZ A;  1QKR A;  4JTC B;  4EWC A;  5F28 E;  5DLJ A;  2OU6 A;  4C3B A;  3S27 A;  2R7X A;  2OQM A;  5F5F A;  2AU5 A;  5T3W A;  1H9G A;  3U8P A;  3V7O A;  4JKV A;  1WAT A;  4CJO A;  4DVZ A;  1V4A A;  3DZA A;  5AC5 A;  3PCV A;  3EHM A;  4EBJ A;  3EG9 B;  1H9T A;  3FHD A;  2QTV A;  3O55 A;  3W8I A;  3U3F A;  3G4X A;  4YT2 A;  3NG1 A;  2KQ9 A;  2IBF A;  4IAR A;  3C63 A;  4MVR A;  4P9F A;  4YJW A;  3SXK A;  3TOL A;  1MMA A;  3BEH A;  1RJ9 B;  5KYX A;  1M2O A;  1N1C A;  1YDI A;  2YKZ A;  3L34 A;  4MW8 A;  5L0C A;  3GOD A;  2IXP A;  3MFN A;  2RD9 A;  2J0X A;  1FMW A;  4EIY A;  4IAO A;  1OW8 A;  4JTD B;  2W4M A;  2HJM A;  1L3P A;  1D0X A;  2M64 A;  2R03 A;  2IXM A;  1I5N A;  1M56 C;  3GM3 A;  3PHF 2;  2P6V A;  3C7J A;  2HMZ A;  5E2Q A;  3EG9 A;  2R7R A;  5EK0 A;  2P0N A;  2F22 A;  1GGQ A;  2HZ8 A;  1BR1 A;  1F1M A;  1TWG A;  3A9C A;  1KTM A;  4AK9 A;  4JVS A;  1FTS A;  1RJ9 A;  2VC9 A;  3EPV A;  1BR4 A;  1OCZ C;  3ABK C;  3KYI A;  4XQ1 A;  3IQ6 A;  3K6B A;  3Q6M A;  2YHS A;  4A4A A;  4MTO A;  3HJC A;  3UNG C;  1K05 A;  2NSG A;  5BQI A;  3LEO A;  2D4U A;  3SZR A;  2MHR A;  3R2P A;  4YWQ A;  5A69 A;  4JRZ A;  2A1D D;  1MNE A;  4U5E E;  3QVZ A;  4E7S A;  3MLG A;  1Q0D A;  3DAF A;  3QW0 A;  3S9O A;  3JSE O;  1QVX A;  4U9E A;  4OIN F;  5E3C A;  1ZHY A;  2I8B A;  3UR3 C;  1G4U S;  5JSL A;  4C7O B;  1EKY A;  4CS7 A;  4L6R A;  3T4R A;  3SP1 A;  4JJG A;  1VK5 A;  1MND A;  1A7D A;  1W2W A;  1MMN A;  4W8K A;  3RQG A;  3KMI A;  2MYS A;  3WAQ A;  3Q7L A;  5D92 A;  5COF A;  2KYH A;  3M4C A;  3WHN A;  2PX0 A;  3QZC A;  4E7Z A;  3ZDL A;  2VH3 A;  1NBB A;  3HNL A;  2EIJ C;  1EA8 A;  4ULV A;  1AVO B;  4N6C A;  4OD5 A;  1NFN A;  3ZQV A;  2PX3 A;  1E84 A;  1I4Y A;  3S84 A;  1HMD A;  2DGJ A;  3OEO A;  5COM A;  5JUA A;  4C7O A;  1MMD A;  1FR0 A;  1FAP B;  3MYI A;  4H54 A;  2CYD A;  3ABL C;  1PCX A;  2LFD A;  4C3E A;  1L7C A;  3EGD B;  4WJ0 A;  2Q7R A;  5L0G A;  1RKC A;  4H4K C;  3GWN A;  2Z15 A;  2C03 A;  2AWY A;  4J32 B;  2R7S A;  2FFH A;  4IB4 A;  1ZVZ A;  1D1C A;  4PK4 A;  4KI2 A;  2XS1 A;  1SYQ A;  3C8Z A;  4XLN F;  5BQH A;  2GA0 A;  1FFH A;  3U2L A;  4Z9H A;  1JPJ A;  4PJM A;  2WL8 A;  4EBB A;  3C8G B;  1NG1 A;  3M79 A;  4DJ9 A;  2R02 A;  3EZH A;  5JLI A;  2IXN A;  3EGD A;  2Q9C A;  4U5H A;  5GPG B;  4CS8 A;  2NUP B;  3AGT A;  2G62 A;  3LS1 A;  3C8G D;  3E70 C;  3NYJ A;  4DXW A;  2QUP A;  3DE9 A;  4MVU A;  4WGZ A;  5DVW A;  5L0I A;  1HE9 A;  1WTY A;  3UGP A;  3DJU B;  2R7Q A;  2OEV A;  1APC A;  2Q3T A;  2O9X A;  2OOC A;  5L0F A;  3C8G A;  2VCA A;  4G7H F;  4CIH A;  3W4Y A;  1TWA A;  3IPM O;  4CS9 A;  1XWJ A;  2L6G A;  1YVI A;  1BR2 A;  1VB5 A;  2OKU A;  4XTK A;  3VM6 A;  2EPN A;  2ZD9 A;  2EPL X;  2PBE A;  3AG2 C;  1Q0F A;  3AQB A;  2HFI A;  4JEB A;  4DRI B;  2NUP A;  2PF4 E;  3EFO A;  1YYX A;  1G4W R;  4JW1 A;  2ICW G;  4LDR A;  3B0P A;  3RQF A;  5JS5 A;  3L8I A;  1CGO A;  2OEX A;  4GEH A;  4LLC A;  4CS8 C;  4F4B A;  2R7V A;  2XXA A;  2BL2 A;  2KK1 A;  3JCU Q;  2V26 A;  4ANJ A;  1CPQ A;  1TWC A;  2H7V C;  3WOD F;  3DAG A;  3FXH A;  1OW7 A;  2HJ3 A;  4MVS A;  4HE8 D;  1PD0 A;  2YQY A;  2KJG A;  5CI8 A;  2XSE A;  3GEH A;  3LAY A;  1J8Y F;  4XEV A;  3FMS A;  1TFO B;  4CS9 C;  3NMJ A;  2XM0 A;  2J7P D;  3RH3 A;  3U9J A;  1WAS A;  3LLI A;  1MMG A;  3UMI A;  2HKV A;  5B3I A;  3U5S A;  1YAU O;  1R5I D;  2J7P A;  4O6N A;  5K0I A;  1PV3 A;  1H7I A;  2JPU A;  5AGF A;  2KNH A;  4QI2 A;  2EIL C;  3CQZ A;  3WG7 C;  2LQG A;  3ASO C;  4CSA A;  1HY5 A;  2P7V A;  1E2X A;  4MVO A;  4ONS A;  4E17 A;  2G3V A;  3CAX A;  3GM1 A;  4JTA B;  4XEK A;  5COG A;  2J45 A;  4CDY A;  2OCC C;  1TKN A;  1V54 C;  3ITF A;  1I4Z A;  1NSG B;  2BC5 A;  2VB6 A;  3M15 A;  3V5Y A;  3IQC A;  1WWP A;  3F47 A;  1WGW A;  4QI0 A;  1D0Z A;  4JJF A;  4JCZ A;  4U5F E;  4AL0 A;  4DRJ B;  3U8V A;  3S0X A;  4KNW A;  3AJM A;  2B0H A;  4XPX A;  2OJQ A;  3LS0 A;  5FCL A;  2J9B A;  3HNJ A;  3EH1 A;  3PDM P;  2A69 F;  2L81 A;  2KSF A;  3LLK A;  4M63 A;  3TK0 A;  1OCR C;  1Y6D A;  1RKE B;  5HSW A;  4MTG A;  5L3V A;  1OCC C;  3IEE A;  2NUT B;  4C3D A;  2XLV A;  3HTK C;  4DVY P;  4CSA C;  1JMW A;  2P1A A;  3SYN A;  1M6T A;  3L1M A;  2XL6 A;  1ORS C;  2ZXW C;  2W9Y A;  1A7V A;  1VLT A;  3A11 A;  3HKK A;  3NRH A;  3X2Q C;  3EHN A;  4NCQ A;  3ZC4 A;  1Y4C A;  4BJ1 A;  2XM4 A;  4YK5 A;  3RIP A;  4BEJ A;  1JOG A;  4E18 A;  1EQ1 A;  2YLG A;  5DS6 A;  1BDJ B;  1V74 B;  3LJB A;  2ZXO A;  4PJJ A;  1VTM P;  3Q7G A;  3W2W A;  1U0B B;  2L6F A;  2XLH A;  2EIK C;  1IZM A;  2AWC A;  1LS1 A;  1RCP A;  4ZLD A;  1RKE A;  2QNL A;  1YAR O;  3AG4 C;  2KW3 C;  1T01 A;  2YWA A;  2CCY A;  2DYR C;  3FOP A;  4KBL A;  4PR9 A;  2NUT A;  4DOZ A;  3U0C A;  1Z6A A;  4ER9 A;  5L0D A;  4Z9J A;  5EGY A;  3TOM A;  4P9T A;  1NFO A;  3L8J A;  1YLM A;  2ZPA A;  2A0B A;  1Z23 A;  4NTA A;  5AC4 A;  4O79 A;  3QVY A;  1T9K A;  1E83 A;  3DJN B;  3DWW A;  5D91 A;  1OQC A;  2Q9B A;  3RYL A;  2RSE B;  2LP4 A;  1KNY A;  3DXJ F;  1CPR A;  5CIV A;  3N24 A;  4RBN A;  2R7W A;  1OR2 A;  3ATP A;  3EQL F;  1LE2 A;  1NZE A;  3CSK A;  4ULW A;  4YT8 A;  1T6Q A;  3DM5 A;  5L3Q A;  1V55 C;  3ABM C;  2VCB A;  3BRJ A;  2DI3 A;  2L6H A;  2WVN A;  2YL0 A;  3K66 A;  3NYL A;  3QTH A;  4IGG A;  3RVZ A;  1A41 A;  4N6H A;  4CIP A;  2C04 A;  4MVM A;  1C03 A;  2PNO A;  2Y3G A;  4EKW A;  1HW1 A;  1LE4 A;  2V3C C;  1T6I A;  1HE1 A;  1ST6 A;  2Y3D A;  4OD4 A;  2UUH A;  1ZW2 A;  1XZQ A;  2E87 A;  2HV6 A;  1ORJ A;  2J9W A;  1J8M F;  3IHU A;  5E33 A;  1K04 A;  2J9V A;  1U89 A;  1T5O A;  4MTF A;  4EHP A;  3J06 A;  1ZHZ A;  3CZ6 A;  2XLW A;  3FOO A;  5A6B D;  3C62 A;  3JRT A;  3JYY A;  4FX5 A;  3OWT A;  3ASN C;  1TQG A;  4YT4 A;  2J9U A;  3LES A;  1YA9 A;  2NPU A;  4CJG A;  1WN0 A;  1VMA A;  2R9R B;  2IXO A;  4IRU A;  3H65 A;  1DOW A;  1PD1 A;  1D1B A;  1YZA A;  3PMR A;  4MND A;  3N2Z B;  4JZA A;  3U3B A;  1FFT C;  3ZVR A;  4BG0 A;  4Q5S F;  2Y69 C;  1YA7 O;  4K1O A;  4J30 B;  4N4W A;  4JIO A;  5DQZ A;  2IYL D;  2ZXR A;  3B29 A;  4KNV A;  2R7U A;  3I5Q A;  2BE5 F;  3GEI A;  2Y3H A;  4I3M A;  2PP4 A;  4LDK A;  4JC7 A;  1SR2 A;  4JCH A;  4XPW A;  2WZL A;  5B1A C;  3S28 A;  3DE8 A;  2M4E A;  1A7E A;  4NQF A;  5F5H A;  5E3A A;  1QSP A;  2GFH A;  3H2U A;  2YL7 A;  1YJG A;  4AL1 A;  2J8W A;  4EUK B;  1OXB A;  3G50 A;  2YRF A;  4OIP F;  3TJ6 A;  3M1C B;  3TJ5 A;  1H6G A;  2H7B A;  2IM8 A;  4G78 A;  2A6H F;  1BZ4 A;  3GAN A;  3I4U A;  1S7Z A;  3K7D A;  1OXK A;  4NY3 A;  1EI7 A;  2MWQ A;  4BEM J;  1ZHW A;  5KYY B;  2R25 A;  2LFF A;  4BPM A;  1E86 A;  1VYK A;  2LIG A;  4BJ6 A;  4IAQ A;  2VAS A;  1K40 A;  1LVK A;  3HLZ A;  2A68 F;  3UMH A;  3NMK A;  1D1A A;  3UMK A;  4IJJ A;  2XLM A;  3LUT B;  3VAY A;  2VCC A;  3JSZ A;  2J46 A;  5B3S C;  2EIN C;  3O6X A;  2WVQ A;  4LAC B;  4MQ9 F;  5DQT A;  1O87 A;  2TMV P;  4I1O B;  2XLE A;  4OIO F;  5IY5 C;  1ZYR F;  2A6E F;  3S90 A;  1JPN A;  4O6M A;  2R7O A;  3NKD A;  2NSF A;  3VYW A;  1FNT c;  1NU7 D;  1AEP A;  1BBH A;  1LIH A;  1OKK D;  2PFD A;  1ZU5 A;  1OCO C;  3K33 A;  4R32 A;  4ZLC A;  3C18 A;  5KYY A;  5A6A A;  3VRC A;  5JT4 A;  1M2V B;  2WVO A;  3JRM O;  4AX2 A;  1QZX A;  5JRA A;  3DMD A;  1GM5 A;  4LER A;  5JVE A;  1VOM A;  1G8X A;  1OKK A;  2XL8 A;  1LPE A;  3AOU A;  4XPY A;  3ZSU A;  4MVZ A;  3MYF A;  4BJ6 C;  2EPK X;  4I44 A;  3B0U X;  5T1D B;  1LKX A;  4G7O F;  1U6H A;  5TJ5 E;  2R7T A;  2X51 A;  3EH2 A;  2XLO A;  1LM3 B;  3ZWI A;  1ZW3 A;  3N0T A;  4YL0 A;  4DBQ A;  4CDV A;  2HSB A;  3RVY A;  1KU2 A;  4WGY A;  3U9M A;  4A2N B;  1D0Y A;  5DS4 A;  2KGO A;  4XEF A;  3FAP B;  2XRH A;  4BJ5 A;  1CGN A;  2LCH A;  5DS5 A;  1M2V A;  3NYM A;  1WOL A;  3KKB A;  1R4T A;  4MVQ A;  1DOV A;  2JX0 A;  3SNH A;  4O6Y A;  2J0W A;  1TR2 A;  3JT1 A;  3U2M A;  5KYW B;  3HNI A;  5FZT A;  1S05 A;  2KC3 A;  3KH2 A;  3KYJ A;  4Q7C A;  3O10 A;  3RKO F;  4HEA J;  3MBG A;  4YL3 A;  3POV A;  3NKE A;  4D4X A;  3KPH A;  2XXA B;  2XL4 A;  3IQT A;  3JYH A;  3SEO A;  1G5Z A;  4J7T A;  3JZ0 A;  5A6K A;  1Z7Q c;  1QPU A;  1AUE A;  1Q0K A;  2L7A A;  2CDQ A;  3K1H A;  2NG1 A;  3FAJ A;  2I15 A;  3RQE A;  3G4Z A;  3T6G B;  3V5Z A;  1O3U A;  2YLI A;  4MW3 A;  4UDV A;  3US6 A;  4PFO A;  2WB7 A;  2ZXP A;  3AG3 C;  4PJN A;  4OIR F;  1A0B A;  1HMO A;  2HUJ A;  4KC9 A;  2A0U A;  4RD9 A;  4BJ5 C;  3EJN A;  1JR8 A;  2YLD A;  3GM2 A;  1QLE C;  4NC3 A;  4K0D A;  4CBE A;  4E0I A;  5KYW A;  4XWJ A;  2Q9A A;  1M57 C; 
#chains in the Genus database with same CATH homology
 3GM1 A;  4XEK A;  1WOL A;  1K05 A;  3JYY A;  1KNY A;  2KK1 A;  1JOG A;  2JX0 A;  1UFB A;  3C8G D;  4R32 A;  1OW7 A;  3C18 A;  1WWP A;  1WTY A;  2L6F A;  2Q00 A;  3MFN A;  3O10 A;  3S9O A;  1OW8 A;  1QVX A;  3BRJ A;  2L6H A;  4XEV A;  4EBK A;  3C8G A;  3GM3 A;  3K7D A;  2YWA A;  3U0C A;  3B71 A;  3JZ0 A;  3TUL A;  2L6G A;  5F28 E;  1OW6 A;  1K40 A;  3RQE A;  2PBE A;  2LK4 A;  1O3U A;  3L8J A;  3RQG A;  1V4A A;  3C8G B;  1KTM A;  1PV3 A;  1ZZP A;  2JPU A;  2HSB A;  4EBJ A;  1K04 A;  3GM2 A;  4NQF A;  4XEF A;  3U3F A;  3RQF A;  3AJM A;  3L8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...