3U3BA

Crystal structure of computationally redesigned four-helix bundle
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
104
structure length
104
Chain Sequence
GSHQEYIKKVTDELKELIQNVNDDIKEVEKNPEDMEYWNKIYRLVHTMKEITETMGFSSVAKVLHTIMNLVDKMLNSEIKITSDLIDKVKKKLDMVTRELDKKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing sequence diversity with flexible backbone protein design: the complete redesign of a protein hydrophobic core.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Unknown function
molecule keywords computationally designed four-helix bundle protein
total genus 43
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 3u3bA00
4G78A 1C02A 1C03A 2LP4A 1YVIA 1QSPA 3IQTA 2LD6A 3KYJA 1OXKA 1A0BA 3US6A 1WN0A 1OXBA 2LCHA 1I5NA 2Q4FA 1BDJB 3MYFA 4EUKB 2OOCA 1FR0A 1Y6DA 4PACA 3U3BA 1TQGA 2R25A 2A0BA 3KYIA 1SR2A
chains in the Genus database with same CATH superfamily
2J9WA 3JRMO 2H7OA 3RQFA 1T01A 3EGDA 2XLWA 2R02A 3L8JA 5JSLA 3RF3A 3TJ6A 1O87A 5A6BD 1D0ZA 3A9CA 3NKDA 1AUEA 3LEOA 2LD6A 5JS5A 1VB5A 2YKZA 2KC3A 1JOGA 2G62A 3JYYA 3VYWA 1ST6A 2CCYA 3U9MA 2VASA 4I1MA 2NG1A 4U5FE 3SZRA 5E33A 2AU5A 1J8MF 4FESA 4J32B 5FZTA 5B1AC 2XLVA 3WAQA 3DE9A 5JRAA 1QKRA 3B9QA 5DS5A 3ASOC 4XWJA 2Q9CA 3DD7A 3ZTZA 2B0JA 2M4EA 2Q7RA 4ONSA 1ORSC 1OQCA 4DRHB 4MTOA 5BUOA 3C63A 2YQYA 4MVMA 3W2WA 4GYTA 2WZGA 2J7PD 4AE4A 4LACB 3TK0A 4W8KA 4EKWA 3M1CB 2IBFA 4BEMJ 2X0CA 5JLIA 3GEIA 3LNMB 4JEAA 4XLPF 4DVZA 3UGOA 3UMIA 4KI2A 4PJMA 3PMRA 1FMVA 4JZAA 1QQ3A 1CGME 5L0GA 1JR8A 4C7OA 1NBBA 1G8XA 4IAQA 4FWVA 4E0HA 3B71A 2XM0A 3K1HA 4A2NB 1H9TA 3TQOA 2Y3GA 3NMJA 1OCRC 4K1OA 1ZU4A 2OKUA 1VOMA 2OU6A 1T6IA 2JPUA 3KMIA 3X2QC 2PF4E 4DBQA 3ZVRA 1K05A 1FFTC 1H9GA 2GA0A 1U89A 1YAUO 4Z9HA 2OCCC 1OXBA 2VCCA 4JEBA 2Q4FA 5KYYA 3O10A 4MQ9F 2HZ8A 3ATPA 2FFHA 3MBGA 3WODF 3WG7C 2IXOA 3EPVA 3VAYA 4IARA 3QVYA 1ORJA 3C8GD 3DWWA 3I5PA 3UGPA 3L0IA 1SR2A 3K1IA 4O7GA 1JMWA 3RIPA 2XXAB 4OIPF 4MNDA 3UMKA 4CBEA 2Q9AA 3GANA 1FAPB 4LLCA 2J45A 2NUTB 4IB4A 4CS9C 4DVYP 4PJJA 2R7TA 4I1OB 5COFA 1IZMA 2W4MA 5BQGA 3PHF2 4MVRA 1EKYA 4D4NA 2WVOA 1NZEA 3FHDA 4JKVA 4YL0A 1WN0A 1YZAA 1ZHZA 4G7ZF 2DI3A 1HY5A 2XLHA 1E86A 1VYKA 2IXMA 1L7CA 4ZLDA 1LI7A 1ZHTA 4PJLA 5A6JA 2I15A 4BJ6C 1VMAA 1SF8A 1Z6AA 1XZPA 2LFDA 3KL4A 3LS1A 3SXKA 3M4CA 5JUAA 2TMVP 1E2XA 2ZXPA 3DI5A 3LLKA 5L0HA 4JTCB 4MTGA 5AC4A 2PX0A 3K6BA 2KK1A 4KBLA 2HKVA 2BE5F 2WVNA 4NC3A 5T3TA 1HMOA 4J7TA 4BJ5A 4P9FA 3RQGA 1OCOC 1JPJA 1T5OA 4DRIB 5L0IA 2XL6A 2ZXRA 3A11A 2PX3A 1MMAA 2A6HF 2EIJC 3JTLO 5T1DB 2H7BA 2P61A 1ZHXA 3B0PA 4O79A 4BEJA 4EBKA 1QLEC 4U5BE 4XPWA 4N06A 2ICWG 1FNTc 1RMVA 3Q6MA 4CX9A 3K1IC 1NSGB 3DM9B 3FVYA 4PK4A 4K7BA 3Q7LA 3EHNA 2RSEB 2XSEA 3JT1A 2QE9A 5DLJA 4IGGA 4CS9A 1JRAA 1TKNA 3QTHA 4RDAA 3SYNA 1BZ4A 4YK5A 4E7SA 1WATA 5TJ5E 1UFBA 2R7VA 4DOZA 1L3PA 2A6EF 2ZXOA 2JD3A 3T9OA 2J8WA 1YVIA 3N24A 3DAGA 3I5QA 4WABA 1YLMA 2VCBA 5B3IA 1GQAA 4IRUA 5COMA 2IXNA 3GM1A 1M57C 1A0BA 2R7QA 2VCAA 2HSBA 3FXHA 4BJ6A 5HSWA 2E87A 3L34A 1D1BA 1NU7D 2BC5A 2EPNA 2L6HA 4JVSA 4CIPA 4I44A 5L0CA 4EBBA 1BDJB 2L6GA 3X1OA 1RXQA 3J06A 3NKEA 3RH3A 2PFDA 4PACA 1XWJA 1OR3A 1RJ9A 2OQMA 2AP3A 3AG2C 1FFHA 2R9RB 3LLIA 4O6NA 1LKXA 2OJED 3NRHA 1MQVA 3IPMO 4XEKA 3TJ5A 1MNDA 3CSKA 2EIKC 3EH2A 4YT8A 1EQ1A 4XEVA 4GQHA 4XQ1A 3V5YA 3ZIBA 1VK5A 3RVZA 1A7EA 5DVWA 3I4UA 4CSAA 1APCA 2Y69C 2RD9A 2L81A 3ZDLA 4CS8C 2X51A 3EHMA 5KYWB 4E7ZA 1N1CA 2ASRA 2XL4A 2W45A 2YEVA 4YT4A 3LJBA 4OD5A 2EPKX 3ZWIA 2ETSA 3EGXA 4LLEA 3HNIA 3HNKA 1U0BB 4U9EA 4G7OF 1Q0FA 4ANJA 2D4UA 1QZXA 2HMQA 3FMSA 3KKBA 5L0JA 2I8BA 2NSGA 4C3DA 3Q6NA 4M63A 2PBEA 3GM2A 2FAPB 2IYLD 2GDCA 3LNRA 4H4KC 4CDYA 2HJMA 4G78A 2F22A 2YZSA 1M2VA 3AGTA 3C18A 4YL1A 3VRCA 3ZC4A 1LI5A 2DYSC 2Q3TA 2AVKA 1LM3B 3M15A 3NMIA 4NCQA 2O9XA 1LS1A 4ZLCA 3ABMC 5CI9A 4ER9A 4MVZA 5JT4A 1S7ZA 2V3CC 5IY5C 2JX0A 2EPMX 1OW6A 2EILC 4CJGA 1GS9A 4NTFA 5F5HA 2R05A 2NUPA 1RCPA 2OEXA 1F1MA 3CQZA 1FTSA 4O6MA 1Z23A 4MS2A 2MYSA 2R7UA 3GM3A 1KU2A 3N0TA 2A69F 1GM5A 2A1DD 1OKKA 1LVKA 2J9BA 3QVZA 1T9KA 2UUIA 4K0DA 3V5XA 1RKCA 3IQCA 3JCUQ 1M2OA 3EG9A 3JSEO 1G4WR 1YA7O 2IOQA 3DMDA 4U5EE 4WJ0A 1YA9A 2C03A 3FOPA 3ASNC 3LUTB 4MVUA 4XPYA 2QUPA 1OCZC 1R4TA 2QTVA 4DBRA 1UG7A 1SYQA 2WZFA 1JPNA 1U6HA 3PDMP 2YL7A 1W2WA 2DB4A 3CZ6A 3EG9B 3UR3C 2YWAA 4F4BA 3H65A 5COGA 3T6JA 1BR2A 1WTYA 2GFHA 2CYDA 2J9VA 3MYFA 3T6BA 3MLGA 4WGYA 5B1BC 2B0HA 2Q00A 3MYIA 1R5ID 3DZAA 4OINF 3TULA 3C8ZA 1YARO 1LIHA 4MVSA 2WB7A 3C8GA 3SXZA 3POVA 2PNOA 1MMGA 3F46A 2HV6A 1CPQA 1ZW2A 2M64A 4QI0A 5CI8A 3WHNA 2NSFA 2BL2A 2CNWD 2WZLA 3GWLA 4Z9JA 3GORA 4G0HA 1BR4A 3FAJA 1VLTA 3U3FA 4Q5SF 1CGNA 1J8YF 3DE8A 3EGDB 1LE4A 3JRTA 2NUTA 3TOMA 4OIOF 2ZD9A 1T6UA 2HSQA 4YT5A 1K40A 3OWTA 4OD4A 2AWCA 1Z7Qc 4L6RA 4AL1A 3T6GB 2LCHA 2P6VA 2QY9A 1YZCA 2J9UA 4CS8A 1D1AA 1ZYRF 4LDQA 1ZU5A 4IJJA 4E0IA 2HS5A 1K04A 4NTAA 4BJ1A 3M79A 2XXAA 3O39A 2P0NA 1H7IA 2PP4A 1Z3IX 2P1AA 2CGEA 1HE1A 1WWPA 2YVKA 3QMKA 4NY3A 1CPRA 3OEOA 4A4AA 5AC5A 1ZVZA 2MWQA 3TD7A 4DXWA 2KNHA 3C8GB 1C17M 4O6YA 5DQZA 4U9DA 3AQCA 2H7VC 1HW2A 1XZQA 2XL8A 2R7WA 3N2ZB 2WVQA 3EFOB 3IQ6A 4KNVA 2OEVA 4MVOA 5B3SC 2R7OA 5HV9A 4IAOA 4R32A 3HKKA 5CIVA 2FGYA 4YN0B 3S0XA 1TFKB 2A0UA 3NYJA 1TWCA 2LK4A 3O6XA 3IHUA 1BBHA 3HNJA 4X0RA 4AX2A 1WGWA 4B6IA 1JAFA 3B0VC 3MFNA 1CGOA 4JE9A 4C3EA 1Q0KA 4CIHA 2KYHA 3U3BA 4AK9A 2J7PA 3M4BA 3VF0A 1LS4A 5EGYA 2CW0F 2R25A 2L7AA 1QPUA 4N6HA 1BR1A 1A41A 1A7DA 2GWWA 4U5GA 5A6KA 1TR2A 2LIGA 3RW0A 3LS0A 3RVYA 5A6BA 2HUJA 3IQTA 5D91A 4EHPA 3NDBB 1OW8A 2HFIA 3KYJA 1V4AA 3Q7GA 2NUPB 3DXJF 4P9TA 3U8PA 3HNLA 3SXMA 3UNGC 3G50A 5E2QA 5JVEA 4JURI 2D5RB 3AG4C 3FOOA 4MTFA 1NFNA 2EPOA 2GAQA 3GEEA 3ITFA 3K7DA 3IQ5A 4CJOA 3EH1A 4I3MA 3W8IA 5DS6A 2YL1A 1ZHWA 3AGUA 2P7VA 3S9OA 1M2VB 1ZW3A 4H54A 3ZQVA 2J0XA 2OJQA 1TFOB 4D4XA 3KYIA 3TOLA 2Q9BA 1G5ZA 2XLEA 2LSEA 5F5FA 4PFPA 5KYXA 3B29A 4LDKA 3F47A 5EK0A 3U9JA 5L0DA 2NPUA 3EFOA 3U5SA 3T4RA 1A7VA 3W8HA 5A6AA 1TWHA 4Z9IA 4EIYA 1ZZPA 2KQ9A 3NYMA 2IM8A 1B68A 5KYUB 4KC9A 5DS4A 2KSFA 1VLSA 1NU9C 1NFOA 3QZCA 2Y3DA 4U5CE 3DM5A 1QVXA 4OIRF 3MX3A 2VC9A 1G4US 1Y4CA 3RKOF 3KH2A 3EJNA 4HE8D 4N6CA 3AG1C 4PJNA 2Y3HA 4JC7A 1DOWA 3AJMA 5GPGB 2YL0A 2VH3A 3KPHA 4JCHA 2KW3C 4JTAB 2KJGA 4J30B 1GGQA 1AEPA 4E18A 4QI2A 4BJTA 2XLDA 1H6GA 2DYRC 4CDVA 1PCXA 1D0XA 5L0FA 2HV7A 3HLZA 4BPMA 2HMZA 2R7XA 4CS7A 2CDQA 4W8PA 3FAPB 1C03A 3LESA 4EWCA 4YL3A 2LP4A 4AE4B 2KGOA 2OG2A 4XTKA 3SP1A 4JIOA 4GEHA 4FX5A 3RYLA 3W4YA 5DQTA 5L3VA 3AOUA 3G4ZA 1VTMP 3U2MA 3DKAA 2XM4A 3PCVA 4CSAC 3HTKC 1O5HA 4JW1A 4JJGA 1SMYF 4Q7CA 3EZHA 1VYIA 2XS8A 1I5NA 3EZIA 3E9VA 3BRJA 2ZPAA 2DGJA 2OOCA 256BA 2YLDA 4BG0A 4AL0A 3IEEA 4C3BA 3S90A 1Z5ZA 2R03A 1EI7A 4U5HA 2HJ3A 1TQGA 2QNLA 1EA8A 4RBNA 1HMDA 3ZG1A 5JP7A 1PD1A 3R2PA 4MW3A 4N4WA 1T6QA 1TWAA 1Z63A 3W2VA 4MW8A 2EPLX 5T3WA 3ZTMA 1Q0MA 3OA1A 3V7OA 1NG1A 1ORYA 2UUHA 1QSPA 2YLGA 4WGZA 2J0WA 3ECSA 1KNYA 1NLXA 1OCCC 2VB6A 2YRFA 3E70C 4IWBA 4EBJA 1PV3A 1YJGA 3SEOA 3US6A 1MNEA 5A69A 3FDQA 3U8VA 1S05A 4CDAA 2R7SA 4JRZA 2G3VA 2EINC 2L9JA 3AG3C 3QW1A 1V55C 1TWGA 1YYXA 2LQGA 1I4YA 5EHHA 2WL8A 2W4BA 5BQHA 3V5ZA 1PD0A 1WOLA 4HFFB 4NQFA 1E84A 3DJUB 2XRHA 3GODA 4G7HF 1D1CA 1OKKD 1RKEB 2V26A 3VM6A 4FAPB 2MHRA 4QDLA 5D92A 3NG1A 1E85A 2Z15A 3CAXA 3JZ0A 1C02A 3QW0A 3S27A 3S84A 1YYJA 2H8AA 1I4ZA 3L1MA 3C7JA 2XLMA 2YLIA 3NMKA 5E3CA 3RFYA 3L8IA 5K0IA 2CNWA 1Q0DA 5AGFA 3JYHA 1KTMA 3DAFA 2AWYA 2G3KA 3ABLC 4DRJB 1V54C 3C62A 1SZIA 1OW7A 2QLAA 3ABKC 2W9YA 3AQBA 1LPEA 1YDIA 4U5DE 4XLNF 3SNHA 4MVQA 4YT2A 3H2UA 2YL3A 3DJNB 3LAYA 4UDVA 4Q4ZF 2A68F 4P6IC 2Y3BA 3R7CA 1HE9A 5BQIA 3UMHA 3H2VA 4XPXA 1OR2A 2EIMC 4OIQF 1Y6DA 1ZHYA 2XLOA 3EGXB 3G4XA 4JJFA 3O55A 5FCLA 4JCZA 5KYYB 3ZQYA 2A0BA 4LERA 4LDRA 3GEHA 1M6TA 4HEAJ 2C04A 4NTBA 1MMDA 1IW7F 4KNWA 4JTDB 5KYWA 3K66A 3HJCA 3ZSUA 1RKEA 2L6FA 5E3AA 3JSZA 4XEFA 1FMWA 4YWQA 2Y39A 3EQLF 4PFOA 5KYNA 5KYUA 2IXPA 4DJ9A 4YJWA 4E17A 1MMNA 1OXKA 1AVOB 1O3UA 1D0YA 4J7YA 2XS1A 5L3QA 3K33A 4ULVA 2J46A 1Q0GA 3S28A 1WASA 1DOVA 1RJ9B 1V74B 2YHSA 3SXYA 3B0UX 4EUKB 4RD9A 2R7RA 3S29A 1E83A 3CEXA 1FR0A 4PR9A 5KYXB 1LE2A 3U0CA 4C7OB 5F28E 3LEVA 3GWNA 3NYLA 4HFKB 2ZXWC 1HW1A 3RQEA 3U2LA 4BJ5C 3BEHA 1M56C 4ULWA 2LFFA
chains in the Genus database with same CATH topology
4G78A 1C02A 1C03A 2LP4A 1YVIA 1QSPA 3IQTA 2LD6A 3KYJA 1OXKA 1A0BA 3US6A 1WN0A 1OXBA 2LCHA 1I5NA 2Q4FA 1BDJB 3MYFA 4EUKB 2OOCA 1FR0A 1Y6DA 4PACA 3U3BA 1TQGA 2R25A 2A0BA 3KYIA 1SR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G78 A;  1C02 A;  1C03 A;  2LP4 A;  1YVI A;  1QSP A;  3IQT A;  2LD6 A;  3KYJ A;  1OXK A;  1A0B A;  3US6 A;  1WN0 A;  1OXB A;  2LCH A;  1I5N A;  2Q4F A;  1BDJ B;  3MYF A;  4EUK B;  2OOC A;  1FR0 A;  1Y6D A;  4PAC A;  3U3B A;  1TQG A;  2R25 A;  2A0B A;  3KYI A;  1SR2 A; 
#chains in the Genus database with same CATH topology
 2J9W A;  3JRM O;  2H7O A;  3RQF A;  1T01 A;  3EGD A;  2XLW A;  2R02 A;  3L8J A;  5JSL A;  3RF3 A;  3TJ6 A;  1O87 A;  5A6B D;  1D0Z A;  3A9C A;  3NKD A;  1AUE A;  3LEO A;  2LD6 A;  5JS5 A;  1VB5 A;  2YKZ A;  2KC3 A;  1JOG A;  2G62 A;  3JYY A;  3VYW A;  1ST6 A;  2CCY A;  3U9M A;  2VAS A;  4I1M A;  2NG1 A;  4U5F E;  3SZR A;  5E33 A;  2AU5 A;  1J8M F;  4FES A;  4J32 B;  5FZT A;  5B1A C;  2XLV A;  3WAQ A;  3DE9 A;  5JRA A;  1QKR A;  3B9Q A;  5DS5 A;  3ASO C;  4XWJ A;  2Q9C A;  3DD7 A;  3ZTZ A;  2B0J A;  2M4E A;  2Q7R A;  4ONS A;  1ORS C;  1OQC A;  4DRH B;  4MTO A;  5BUO A;  3C63 A;  2YQY A;  4MVM A;  3W2W A;  4GYT A;  2WZG A;  2J7P D;  4AE4 A;  4LAC B;  3TK0 A;  4W8K A;  4EKW A;  3M1C B;  2IBF A;  4BEM J;  2X0C A;  5JLI A;  3GEI A;  3LNM B;  4JEA A;  4XLP F;  4DVZ A;  3UGO A;  3UMI A;  4KI2 A;  4PJM A;  3PMR A;  1FMV A;  4JZA A;  1QQ3 A;  1CGM E;  5L0G A;  1JR8 A;  4C7O A;  1NBB A;  1G8X A;  4IAQ A;  4FWV A;  4E0H A;  3B71 A;  2XM0 A;  3K1H A;  4A2N B;  1H9T A;  3TQO A;  2Y3G A;  3NMJ A;  1OCR C;  4K1O A;  1ZU4 A;  2OKU A;  1VOM A;  2OU6 A;  1T6I A;  2JPU A;  3KMI A;  3X2Q C;  2PF4 E;  4DBQ A;  3ZVR A;  1K05 A;  1FFT C;  1H9G A;  2GA0 A;  1U89 A;  1YAU O;  4Z9H A;  2OCC C;  1OXB A;  2VCC A;  4JEB A;  2Q4F A;  5KYY A;  3O10 A;  4MQ9 F;  2HZ8 A;  3ATP A;  2FFH A;  3MBG A;  3WOD F;  3WG7 C;  2IXO A;  3EPV A;  3VAY A;  4IAR A;  3QVY A;  1ORJ A;  3C8G D;  3DWW A;  3I5P A;  3UGP A;  3L0I A;  1SR2 A;  3K1I A;  4O7G A;  1JMW A;  3RIP A;  2XXA B;  4OIP F;  4MND A;  3UMK A;  4CBE A;  2Q9A A;  3GAN A;  1FAP B;  4LLC A;  2J45 A;  2NUT B;  4IB4 A;  4CS9 C;  4DVY P;  4PJJ A;  2R7T A;  4I1O B;  5COF A;  1IZM A;  2W4M A;  5BQG A;  3PHF 2;  4MVR A;  1EKY A;  4D4N A;  2WVO A;  1NZE A;  3FHD A;  4JKV A;  4YL0 A;  1WN0 A;  1YZA A;  1ZHZ A;  4G7Z F;  2DI3 A;  1HY5 A;  2XLH A;  1E86 A;  1VYK A;  2IXM A;  1L7C A;  4ZLD A;  1LI7 A;  1ZHT A;  4PJL A;  5A6J A;  2I15 A;  4BJ6 C;  1VMA A;  1SF8 A;  1Z6A A;  1XZP A;  2LFD A;  3KL4 A;  3LS1 A;  3SXK A;  3M4C A;  5JUA A;  2TMV P;  1E2X A;  2ZXP A;  3DI5 A;  3LLK A;  5L0H A;  4JTC B;  4MTG A;  5AC4 A;  2PX0 A;  3K6B A;  2KK1 A;  4KBL A;  2HKV A;  2BE5 F;  2WVN A;  4NC3 A;  5T3T A;  1HMO A;  4J7T A;  4BJ5 A;  4P9F A;  3RQG A;  1OCO C;  1JPJ A;  1T5O A;  4DRI B;  5L0I A;  2XL6 A;  2ZXR A;  3A11 A;  2PX3 A;  1MMA A;  2A6H F;  2EIJ C;  3JTL O;  5T1D B;  2H7B A;  2P61 A;  1ZHX A;  3B0P A;  4O79 A;  4BEJ A;  4EBK A;  1QLE C;  4U5B E;  4XPW A;  4N06 A;  2ICW G;  1FNT c;  1RMV A;  3Q6M A;  4CX9 A;  3K1I C;  1NSG B;  3DM9 B;  3FVY A;  4PK4 A;  4K7B A;  3Q7L A;  3EHN A;  2RSE B;  2XSE A;  3JT1 A;  2QE9 A;  5DLJ A;  4IGG A;  4CS9 A;  1JRA A;  1TKN A;  3QTH A;  4RDA A;  3SYN A;  1BZ4 A;  4YK5 A;  4E7S A;  1WAT A;  5TJ5 E;  1UFB A;  2R7V A;  4DOZ A;  1L3P A;  2A6E F;  2ZXO A;  2JD3 A;  3T9O A;  2J8W A;  1YVI A;  3N24 A;  3DAG A;  3I5Q A;  4WAB A;  1YLM A;  2VCB A;  5B3I A;  1GQA A;  4IRU A;  5COM A;  2IXN A;  3GM1 A;  1M57 C;  1A0B A;  2R7Q A;  2VCA A;  2HSB A;  3FXH A;  4BJ6 A;  5HSW A;  2E87 A;  3L34 A;  1D1B A;  1NU7 D;  2BC5 A;  2EPN A;  2L6H A;  4JVS A;  4CIP A;  4I44 A;  5L0C A;  4EBB A;  1BDJ B;  2L6G A;  3X1O A;  1RXQ A;  3J06 A;  3NKE A;  3RH3 A;  2PFD A;  4PAC A;  1XWJ A;  1OR3 A;  1RJ9 A;  2OQM A;  2AP3 A;  3AG2 C;  1FFH A;  2R9R B;  3LLI A;  4O6N A;  1LKX A;  2OJE D;  3NRH A;  1MQV A;  3IPM O;  4XEK A;  3TJ5 A;  1MND A;  3CSK A;  2EIK C;  3EH2 A;  4YT8 A;  1EQ1 A;  4XEV A;  4GQH A;  4XQ1 A;  3V5Y A;  3ZIB A;  1VK5 A;  3RVZ A;  1A7E A;  5DVW A;  3I4U A;  4CSA A;  1APC A;  2Y69 C;  2RD9 A;  2L81 A;  3ZDL A;  4CS8 C;  2X51 A;  3EHM A;  5KYW B;  4E7Z A;  1N1C A;  2ASR A;  2XL4 A;  2W45 A;  2YEV A;  4YT4 A;  3LJB A;  4OD5 A;  2EPK X;  3ZWI A;  2ETS A;  3EGX A;  4LLE A;  3HNI A;  3HNK A;  1U0B B;  4U9E A;  4G7O F;  1Q0F A;  4ANJ A;  2D4U A;  1QZX A;  2HMQ A;  3FMS A;  3KKB A;  5L0J A;  2I8B A;  2NSG A;  4C3D A;  3Q6N A;  4M63 A;  2PBE A;  3GM2 A;  2FAP B;  2IYL D;  2GDC A;  3LNR A;  4H4K C;  4CDY A;  2HJM A;  4G78 A;  2F22 A;  2YZS A;  1M2V A;  3AGT A;  3C18 A;  4YL1 A;  3VRC A;  3ZC4 A;  1LI5 A;  2DYS C;  2Q3T A;  2AVK A;  1LM3 B;  3M15 A;  3NMI A;  4NCQ A;  2O9X A;  1LS1 A;  4ZLC A;  3ABM C;  5CI9 A;  4ER9 A;  4MVZ A;  5JT4 A;  1S7Z A;  2V3C C;  5IY5 C;  2JX0 A;  2EPM X;  1OW6 A;  2EIL C;  4CJG A;  1GS9 A;  4NTF A;  5F5H A;  2R05 A;  2NUP A;  1RCP A;  2OEX A;  1F1M A;  3CQZ A;  1FTS A;  4O6M A;  1Z23 A;  4MS2 A;  2MYS A;  2R7U A;  3GM3 A;  1KU2 A;  3N0T A;  2A69 F;  1GM5 A;  2A1D D;  1OKK A;  1LVK A;  2J9B A;  3QVZ A;  1T9K A;  2UUI A;  4K0D A;  3V5X A;  1RKC A;  3IQC A;  3JCU Q;  1M2O A;  3EG9 A;  3JSE O;  1G4W R;  1YA7 O;  2IOQ A;  3DMD A;  4U5E E;  4WJ0 A;  1YA9 A;  2C03 A;  3FOP A;  3ASN C;  3LUT B;  4MVU A;  4XPY A;  2QUP A;  1OCZ C;  1R4T A;  2QTV A;  4DBR A;  1UG7 A;  1SYQ A;  2WZF A;  1JPN A;  1U6H A;  3PDM P;  2YL7 A;  1W2W A;  2DB4 A;  3CZ6 A;  3EG9 B;  3UR3 C;  2YWA A;  4F4B A;  3H65 A;  5COG A;  3T6J A;  1BR2 A;  1WTY A;  2GFH A;  2CYD A;  2J9V A;  3MYF A;  3T6B A;  3MLG A;  4WGY A;  5B1B C;  2B0H A;  2Q00 A;  3MYI A;  1R5I D;  3DZA A;  4OIN F;  3TUL A;  3C8Z A;  1YAR O;  1LIH A;  4MVS A;  2WB7 A;  3C8G A;  3SXZ A;  3POV A;  2PNO A;  1MMG A;  3F46 A;  2HV6 A;  1CPQ A;  1ZW2 A;  2M64 A;  4QI0 A;  5CI8 A;  3WHN A;  2NSF A;  2BL2 A;  2CNW D;  2WZL A;  3GWL A;  4Z9J A;  3GOR A;  4G0H A;  1BR4 A;  3FAJ A;  1VLT A;  3U3F A;  4Q5S F;  1CGN A;  1J8Y F;  3DE8 A;  3EGD B;  1LE4 A;  3JRT A;  2NUT A;  3TOM A;  4OIO F;  2ZD9 A;  1T6U A;  2HSQ A;  4YT5 A;  1K40 A;  3OWT A;  4OD4 A;  2AWC A;  1Z7Q c;  4L6R A;  4AL1 A;  3T6G B;  2LCH A;  2P6V A;  2QY9 A;  1YZC A;  2J9U A;  4CS8 A;  1D1A A;  1ZYR F;  4LDQ A;  1ZU5 A;  4IJJ A;  4E0I A;  2HS5 A;  1K04 A;  4NTA A;  4BJ1 A;  3M79 A;  2XXA A;  3O39 A;  2P0N A;  1H7I A;  2PP4 A;  1Z3I X;  2P1A A;  2CGE A;  1HE1 A;  1WWP A;  2YVK A;  3QMK A;  4NY3 A;  1CPR A;  3OEO A;  4A4A A;  5AC5 A;  1ZVZ A;  2MWQ A;  3TD7 A;  4DXW A;  2KNH A;  3C8G B;  1C17 M;  4O6Y A;  5DQZ A;  4U9D A;  3AQC A;  2H7V C;  1HW2 A;  1XZQ A;  2XL8 A;  2R7W A;  3N2Z B;  2WVQ A;  3EFO B;  3IQ6 A;  4KNV A;  2OEV A;  4MVO A;  5B3S C;  2R7O A;  5HV9 A;  4IAO A;  4R32 A;  3HKK A;  5CIV A;  2FGY A;  4YN0 B;  3S0X A;  1TFK B;  2A0U A;  3NYJ A;  1TWC A;  2LK4 A;  3O6X A;  3IHU A;  1BBH A;  3HNJ A;  4X0R A;  4AX2 A;  1WGW A;  4B6I A;  1JAF A;  3B0V C;  3MFN A;  1CGO A;  4JE9 A;  4C3E A;  1Q0K A;  4CIH A;  2KYH A;  3U3B A;  4AK9 A;  2J7P A;  3M4B A;  3VF0 A;  1LS4 A;  5EGY A;  2CW0 F;  2R25 A;  2L7A A;  1QPU A;  4N6H A;  1BR1 A;  1A41 A;  1A7D A;  2GWW A;  4U5G A;  5A6K A;  1TR2 A;  2LIG A;  3RW0 A;  3LS0 A;  3RVY A;  5A6B A;  2HUJ A;  3IQT A;  5D91 A;  4EHP A;  3NDB B;  1OW8 A;  2HFI A;  3KYJ A;  1V4A A;  3Q7G A;  2NUP B;  3DXJ F;  4P9T A;  3U8P A;  3HNL A;  3SXM A;  3UNG C;  3G50 A;  5E2Q A;  5JVE A;  4JUR I;  2D5R B;  3AG4 C;  3FOO A;  4MTF A;  1NFN A;  2EPO A;  2GAQ A;  3GEE A;  3ITF A;  3K7D A;  3IQ5 A;  4CJO A;  3EH1 A;  4I3M A;  3W8I A;  5DS6 A;  2YL1 A;  1ZHW A;  3AGU A;  2P7V A;  3S9O A;  1M2V B;  1ZW3 A;  4H54 A;  3ZQV A;  2J0X A;  2OJQ A;  1TFO B;  4D4X A;  3KYI A;  3TOL A;  2Q9B A;  1G5Z A;  2XLE A;  2LSE A;  5F5F A;  4PFP A;  5KYX A;  3B29 A;  4LDK A;  3F47 A;  5EK0 A;  3U9J A;  5L0D A;  2NPU A;  3EFO A;  3U5S A;  3T4R A;  1A7V A;  3W8H A;  5A6A A;  1TWH A;  4Z9I A;  4EIY A;  1ZZP A;  2KQ9 A;  3NYM A;  2IM8 A;  1B68 A;  5KYU B;  4KC9 A;  5DS4 A;  2KSF A;  1VLS A;  1NU9 C;  1NFO A;  3QZC A;  2Y3D A;  4U5C E;  3DM5 A;  1QVX A;  4OIR F;  3MX3 A;  2VC9 A;  1G4U S;  1Y4C A;  3RKO F;  3KH2 A;  3EJN A;  4HE8 D;  4N6C A;  3AG1 C;  4PJN A;  2Y3H A;  4JC7 A;  1DOW A;  3AJM A;  5GPG B;  2YL0 A;  2VH3 A;  3KPH A;  4JCH A;  2KW3 C;  4JTA B;  2KJG A;  4J30 B;  1GGQ A;  1AEP A;  4E18 A;  4QI2 A;  4BJT A;  2XLD A;  1H6G A;  2DYR C;  4CDV A;  1PCX A;  1D0X A;  5L0F A;  2HV7 A;  3HLZ A;  4BPM A;  2HMZ A;  2R7X A;  4CS7 A;  2CDQ A;  4W8P A;  3FAP B;  1C03 A;  3LES A;  4EWC A;  4YL3 A;  2LP4 A;  4AE4 B;  2KGO A;  2OG2 A;  4XTK A;  3SP1 A;  4JIO A;  4GEH A;  4FX5 A;  3RYL A;  3W4Y A;  5DQT A;  5L3V A;  3AOU A;  3G4Z A;  1VTM P;  3U2M A;  3DKA A;  2XM4 A;  3PCV A;  4CSA C;  3HTK C;  1O5H A;  4JW1 A;  4JJG A;  1SMY F;  4Q7C A;  3EZH A;  1VYI A;  2XS8 A;  1I5N A;  3EZI A;  3E9V A;  3BRJ A;  2ZPA A;  2DGJ A;  2OOC A;  256B A;  2YLD A;  4BG0 A;  4AL0 A;  3IEE A;  4C3B A;  3S90 A;  1Z5Z A;  2R03 A;  1EI7 A;  4U5H A;  2HJ3 A;  1TQG A;  2QNL A;  1EA8 A;  4RBN A;  1HMD A;  3ZG1 A;  5JP7 A;  1PD1 A;  3R2P A;  4MW3 A;  4N4W A;  1T6Q A;  1TWA A;  1Z63 A;  3W2V A;  4MW8 A;  2EPL X;  5T3W A;  3ZTM A;  1Q0M A;  3OA1 A;  3V7O A;  1NG1 A;  1ORY A;  2UUH A;  1QSP A;  2YLG A;  4WGZ A;  2J0W A;  3ECS A;  1KNY A;  1NLX A;  1OCC C;  2VB6 A;  2YRF A;  3E70 C;  4IWB A;  4EBJ A;  1PV3 A;  1YJG A;  3SEO A;  3US6 A;  1MNE A;  5A69 A;  3FDQ A;  3U8V A;  1S05 A;  4CDA A;  2R7S A;  4JRZ A;  2G3V A;  2EIN C;  2L9J A;  3AG3 C;  3QW1 A;  1V55 C;  1TWG A;  1YYX A;  2LQG A;  1I4Y A;  5EHH A;  2WL8 A;  2W4B A;  5BQH A;  3V5Z A;  1PD0 A;  1WOL A;  4HFF B;  4NQF A;  1E84 A;  3DJU B;  2XRH A;  3GOD A;  4G7H F;  1D1C A;  1OKK D;  1RKE B;  2V26 A;  3VM6 A;  4FAP B;  2MHR A;  4QDL A;  5D92 A;  3NG1 A;  1E85 A;  2Z15 A;  3CAX A;  3JZ0 A;  1C02 A;  3QW0 A;  3S27 A;  3S84 A;  1YYJ A;  2H8A A;  1I4Z A;  3L1M A;  3C7J A;  2XLM A;  2YLI A;  3NMK A;  5E3C A;  3RFY A;  3L8I A;  5K0I A;  2CNW A;  1Q0D A;  5AGF A;  3JYH A;  1KTM A;  3DAF A;  2AWY A;  2G3K A;  3ABL C;  4DRJ B;  1V54 C;  3C62 A;  1SZI A;  1OW7 A;  2QLA A;  3ABK C;  2W9Y A;  3AQB A;  1LPE A;  1YDI A;  4U5D E;  4XLN F;  3SNH A;  4MVQ A;  4YT2 A;  3H2U A;  2YL3 A;  3DJN B;  3LAY A;  4UDV A;  4Q4Z F;  2A68 F;  4P6I C;  2Y3B A;  3R7C A;  1HE9 A;  5BQI A;  3UMH A;  3H2V A;  4XPX A;  1OR2 A;  2EIM C;  4OIQ F;  1Y6D A;  1ZHY A;  2XLO A;  3EGX B;  3G4X A;  4JJF A;  3O55 A;  5FCL A;  4JCZ A;  5KYY B;  3ZQY A;  2A0B A;  4LER A;  4LDR A;  3GEH A;  1M6T A;  4HEA J;  2C04 A;  4NTB A;  1MMD A;  1IW7 F;  4KNW A;  4JTD B;  5KYW A;  3K66 A;  3HJC A;  3ZSU A;  1RKE A;  2L6F A;  5E3A A;  3JSZ A;  4XEF A;  1FMW A;  4YWQ A;  2Y39 A;  3EQL F;  4PFO A;  5KYN A;  5KYU A;  2IXP A;  4DJ9 A;  4YJW A;  4E17 A;  1MMN A;  1OXK A;  1AVO B;  1O3U A;  1D0Y A;  4J7Y A;  2XS1 A;  5L3Q A;  3K33 A;  4ULV A;  2J46 A;  1Q0G A;  3S28 A;  1WAS A;  1DOV A;  1RJ9 B;  1V74 B;  2YHS A;  3SXY A;  3B0U X;  4EUK B;  4RD9 A;  2R7R A;  3S29 A;  1E83 A;  3CEX A;  1FR0 A;  4PR9 A;  5KYX B;  1LE2 A;  3U0C A;  4C7O B;  5F28 E;  3LEV A;  3GWN A;  3NYL A;  4HFK B;  2ZXW C;  1HW1 A;  3RQE A;  3U2L A;  4BJ5 C;  3BEH A;  1M56 C;  4ULW A;  2LFF A; 
#chains in the Genus database with same CATH homology
 4G78 A;  1C02 A;  1C03 A;  2LP4 A;  1YVI A;  1QSP A;  3IQT A;  2LD6 A;  3KYJ A;  1OXK A;  1A0B A;  3US6 A;  1WN0 A;  1OXB A;  2LCH A;  1I5N A;  2Q4F A;  1BDJ B;  3MYF A;  4EUK B;  2OOC A;  1FR0 A;  1Y6D A;  4PAC A;  3U3B A;  1TQG A;  2R25 A;  2A0B A;  3KYI A;  1SR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...