3U3BA

Crystal structure of computationally redesigned four-helix bundle
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
104
structure length
104
Chain Sequence
GSHQEYIKKVTDELKELIQNVNDDIKEVEKNPEDMEYWNKIYRLVHTMKEITETMGFSSVAKVLHTIMNLVDKMLNSEIKITSDLIDKVKKKLDMVTRELDKKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing sequence diversity with flexible backbone protein design: the complete redesign of a protein hydrophobic core.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Unknown function
molecule keywords computationally designed four-helix bundle protein
total genus 43
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 3u3bA00
3US6A 1C02A 1A0BA 2LP4A 1I5NA 2A0BA 1OXKA 1YVIA 1BDJB 4G78A 3U3BA 1QSPA 4PACA 1SR2A 2OOCA 1WN0A 1TQGA 3KYIA 1OXBA 4EUKB 1C03A 3KYJA 1Y6DA 2LD6A 2R25A 2LCHA 3IQTA 1FR0A 3MYFA 2Q4FA
chains in the Genus database with same CATH superfamily
2CCYA 4AL1A 5IY5C 4RDAA 2R7RA 3F47A 1FMWA 2LP4A 2R7XA 1M2OA 4MVRA 3I5QA 1VK5A 1BDJB 3UMHA 4LACB 2KK1A 1LE4A 1NLXA 2KQ9A 4N4WA 1GGQA 5DS5A 1BR1A 1WN0A 1YAUO 1ZHYA 2LFDA 2PX3A 3AQCA 3CZ6A 4N6HA 4H4KC 3W2WA 4DBRA 2R7SA 1RJ9B 4XPWA 2M4EA 2Q3TA 3KYJA 1OW8A 1B68A 4CS9C 1LS4A 3AG3C 3DAFA 3HNKA 1RKCA 3RQFA 4MNDA 4U5EE 3T4RA 5DLJA 1H7IA 4JJGA 4YL3A 3LJBA 2MHRA 3N24A 3WG7C 3WODF 1G8XA 1WTYA 1ST6A 4QI2A 2OJQA 1NFNA 1TWHA 2A0BA 3EH1A 2HV6A 1MMNA 1ORJA 1VLSA 3EHMA 4PJNA 1BR4A 4JURI 2EPMX 4O7GA 4BJ5A 1D1AA 4I3MA 4BJTA 1V4AA 3FOPA 3LAYA 1RKEA 3L1MA 1NZEA 3GM3A 4GQHA 5D91A 3S0XA 3S90A 3AGUA 1Z23A 3L0IA 2EPKX 5BUOA 4DVYP 2VCAA 2YQYA 3AGTA 3DE9A 2OQMA 1G5ZA 1WGWA 3T6BA 1Y6DA 2ETSA 1Q0KA 1J8YF 2R25A 1V54C 1TFOB 3R7CA 1FFHA 5E3CA 2E87A 1A7VA 1PD0A 3NMIA 2L6HA 1PD1A 2Q00A 3CAXA 4NQFA 3U0CA 3K33A 3KL4A 1U89A 1TWCA 4AL0A 4GEHA 1DOWA 1W2WA 4MS2A 4RBNA 3ZC4A 3C63A 5BQGA 1I4ZA 1O3UA 5E3AA 3B71A 1VMAA 4J32B 4LLCA 4J7TA 1CPQA 3M79A 2H8AA 4DXWA 5JLIA 3B0VC 2XL8A 2CNWD 1QKRA 1R4TA 2J9UA 2OJED 3C8GA 1EA8A 3EGXA 3QMKA 3MLGA 4G78A 4N6CA 4U5FE 5B1BC 3C18A 2EIJC 3KPHA 2Q9CA 4MVZA 3VAYA 5K0IA 3HNIA 2W9YA 4OIOF 2R7VA 1IZMA 3SXMA 2YVKA 2YL7A 2YLDA 3EGDB 3SZRA 1H6GA 2EILC 4Q5SF 1TQGA 1YZAA 1H9TA 2EINC 2WVNA 4FWVA 5KYXA 2HMQA 1MQVA 4IJJA 4ER9A 3O6XA 3NYJA 2Y3DA 4WGZA 1HE1A 3FAJA 3FVYA 5F28E 3RVYA 4B6IA 4CS7A 2YL0A 2XLHA 4MQ9F 3ABLC 2LSEA 1JR8A 3RFYA 3WHNA 4W8KA 5CIVA 5KYUB 1ZHTA 3RYLA 3T9OA 2XXAA 1A0BA 1F1MA 2I8BA 1SMYF 1ZHZA 4ULWA 5COMA 4ANJA 4DRJB 5KYWA 2RD9A 3EZHA 3S29A 2XLMA 2A0UA 5EGYA 2D5RB 3QTHA 2R7WA 5KYNA 5T3TA 5L0CA 2VCBA 4IGGA 5A6JA 1YJGA 4U5DE 5DQTA 5BQIA 1T6UA 2IOQA 3U2MA 5FCLA 3UGOA 4E7ZA 5CI9A 4PR9A 1Q0DA 3RW0A 4CSAC 3Q6MA 3BEHA 2PX0A 4CDAA 4LDRA 4QDLA 1U0BB 3NYMA 3AG4C 1S7ZA 2VASA 4NC3A 3H65A 1HMDA 4KNVA 4U5GA 2YWAA 4KBLA 1RJ9A 1FNTc 4WABA 2IXNA 4DJ9A 2HZ8A 3CQZA 3AJMA 4CS8A 1BBHA 4YT8A 3NKEA 3UNGC 2H7BA 3DWWA 4R32A 5KYYA 3VRCA 4CS9A 2DI3A 2YHSA 3N2ZB 4NTAA 3S9OA 1PCXA 3PHF2 1LS1A 2JX0A 5T3WA 4ONSA 3UMIA 4ZLCA 3T6JA 3EGDA 3GWLA 2V26A 1G4US 4Q7CA 5COGA 2MYSA 3LS0A 1QSPA 1BR2A 3HNLA 1SZIA 3H2VA 3A9CA 4PACA 3ZTZA 3ZQVA 2J0WA 2PF4E 2YLIA 4MW8A 4DBQA 5A69A 3EJNA 1OKKA 2XLVA 4E0IA 2GA0A 2P61A 4KNWA 5TJ5E 4OINF 1ORYA 1OW7A 3FMSA 2B0HA 3G4ZA 4DVZA 4FAPB 4E0HA 1T9KA 3AG1C 2EIMC 2CDQA 2VH3A 3GODA 2QLAA 3NYLA 4O6NA 1M6TA 1Y4CA 2A68F 3E70C 3TJ5A 1J8MF 2ZPAA 1R5ID 1VTMP 3B0UX 4C3EA 2OU6A 4OIRF 4W8PA 3OEOA 1A7EA 2AWYA 3IPMO 1ZU4A 2JD3A 2WZFA 4J7YA 1GQAA 5KYWB 3L8JA 1LVKA 1YZCA 5JSLA 1E86A 3QW0A 4CIPA 2WZLA 3ZDLA 2AWCA 3N0TA 5BQHA 2L6GA 2R7TA 3GM1A 4U5BE 2OEXA 2XRHA 4O6YA 2O9XA 3C8GB 3SP1A 2J9BA 3RF3A 2EPOA 3BRJA 3EFOB 3ZIBA 3ZG1A 3EPVA 4EUKB 1LM3B 3UGPA 3VF0A 1ZYRF 1EI7A 3LEOA 3E9VA 4MTOA 2TMVP 2NUPA 2YZSA 3EHNA 4AK9A 4D4NA 1M57C 5FZTA 3GEIA 1HW2A 1OW6A 1TWGA 5E33A 3QZCA 5KYYB 2YRFA 3B0PA 3H2UA 2C04A 1FAPB 1RXQA 2A6EF 1C02A 1TKNA 1OCZC 3ZSUA 3F46A 2Q9AA 1H9GA 3AQBA 1T01A 1XZPA 3K6BA 3LNMB 1M56C 3R2PA 4X0RA 3UMKA 2NPUA 3V7OA 2KSFA 1D0XA 3TOMA 1NFOA 4PFOA 3V5ZA 1XZQA 2CW0F 4M63A 3M15A 3TK0A 1AEPA 3DZAA 3ABMC 2KGOA 2Y39A 4JTAB 2P0NA 1Z3IX 5A6AA 2H7OA 1NBBA 2DB4A 1BZ4A 2Z15A 3PCVA 5DS6A 1C03A 2VC9A 4NCQA 3HKKA 4YJWA 2HKVA 1HMOA 2YL3A 4IAOA 4L6RA 2LFFA 2P1AA 4JEBA 1Z7Qc 3K1IA 4JJFA 1YA9A 4JCZA 4A4AA 1C17M 2NG1A 3DJUB 3I5PA 1TFKB 3K1IC 5B1AC 3JSZA 4DRHB 2QE9A 4MTFA 1APCA 1JMWA 2YEVA 3DM9B 4HEAJ 4IWBA 1I5NA 3SXKA 1ZU5A 1HY5A 2UUIA 2I15A 1Q0FA 2J8WA 4CJOA 4U5CE 3ZTMA 4LDKA 3G4XA 1E2XA 3ECSA 3DM5A 3JZ0A 4KI2A 4J30B 4U9EA 1E83A 5L0DA 1QQ3A 3ZQYA 4E17A 4DOZA 5AC4A 5KYUA 3MX3A 4MVUA 1SYQA 1LE2A 256BA 2GDCA 4JTDB 1Q0MA 2A6HF 4BJ6A 3U9JA 3TQOA 5JRAA 1I4YA 4BEJA 2IM8A 3IQTA 4YT2A 3LEVA 3MYFA 3DE8A 3S28A 3V5XA 3JYHA 3L8IA 3QVYA 4Z9HA 3TOLA 2PFDA 1GM5A 4NY3A 4P9FA 1AUEA 3U8PA 1YDIA 1JAFA 4AE4A 1OR3A 2R02A 2X51A 5T1DB 4BG0A 4G7HF 2XLEA 5A6KA 2VCCA 4MW3A 4P9TA 3DKAA 5JS5A 2LQGA 3DMDA 4LDQA 3Q6NA 3LS1A 4CSAA 1KU2A 5COFA 4EKWA 1OQCA 1WOLA 2B0JA 1TR2A 2WB7A 4OD4A 1TWAA 3C7JA 4H54A 5DS4A 2GAQA 2EPNA 1JRAA 4F4BA 3IHUA 4XEKA 4OD5A 1V55C 2L9JA 2WVOA 3FXHA 4Q4ZF 5EK0A 1NU9C 2R7OA 3EQLF 3NMJA 1WWPA 2Q4FA 2NUPB 4D4XA 5HSWA 4A2NB 3EH2A 2IXOA 1G4WR 1WATA 3J06A 1V74B 3JSEO 1JOGA 4EIYA 1YVIA 1AVOB 3JTLO 3MYIA 4HFKB 3ZWIA 1N1CA 4PJMA 4MVQA 1NG1A 3MFNA 2NSGA 2UUHA 3X1OA 4XLPF 1UG7A 4IAQA 3FHDA 4NTFA 5JVEA 2AVKA 4I1OB 5B3IA 4UDVA 4BEMJ 1D0ZA 3UR3C 2OOCA 3JT1A 1CGME 2LK4A 2LIGA 3EG9A 4GYTA 3DAGA 3DI5A 3TJ6A 5EHHA 4C3DA 1ZVZA 1UFBA 2A69F 1SF8A 1M2VB 2Y3GA 2ZXWC 3CEXA 4PK4A 3FAPB 5D92A 5E2QA 2XXAB 2AP3A 1VYKA 2ZXOA 2HJMA 2XS8A 4PJJA 1MNEA 2G62A 3VYWA 3ATPA 2NUTA 5L3VA 2Y69C 2L81A 2KJGA 3GWNA 1FMVA 2GFHA 3EG9B 5A6BD 1XWJA 3OWTA 2Q7RA 1O87A 4ULVA 3ABKC 1CGOA 3U5SA 2PP4A 3DD7A 1VLTA 3EGXB 4I44A 2Y3HA 4MVOA 3X2QC 2ZD9A 1VB5A 3KH2A 2BE5F 2IXMA 3V5YA 1QLEC 2CYDA 3GM2A 4XTKA 3M4CA 2HMZA 2YKZA 2RSEB 3JCUQ 5L0GA 5F5FA 1RMVA 1LKXA 2Q9BA 3KYIA 1A7DA 2YLGA 3O39A 4XPXA 1T5OA 5HV9A 1E84A 4BJ5C 4JE9A 3SNHA 3PDMP 4CX9A 2HUJA 1OCCC 1VYIA 4C3BA 5KYXB 4RD9A 2HV7A 2QY9A 4G7ZF 1OCRC 4AX2A 2KC3A 3W2VA 3Q7LA 4OIQF 3MBGA 4I1MA 2WVQA 4YWQA 2C03A 1KNYA 2FAPB 2L7AA 4JEAA 4JRZA 4K1OA 4C7OA 3RKOF 2R7QA 4CDVA 3LUTB 5CI8A 1LI5A 4CJGA 2VB6A 3SEOA 1PV3A 5L0FA 3L34A 1MMAA 3DXJF 4CBEA 3IQ6A 2XLOA 2PBEA 4MTGA 4IRUA 4AE4B 2KYHA 2J45A 3OA1A 1K05A 4C7OB 1IW7F 2XS1A 3ASOC 2J7PD 4LLEA 2QNLA 2X0CA 1WASA 4EBJA 2G3KA 1HW1A 2JPUA 4FESA 4EWCA 2EPLX 3ASNC 1ZHXA 2Y3BA 1LPEA 1Q0GA 2W45A 3S84A 1ZW2A 1FTSA 1YYXA 5JT4A 3SXZA 4PFPA 1FR0A 3W4YA 1YYJA 2HSBA 4WGYA 2HSQA 1EKYA 3RVZA 1KTMA 2OCCC 4WJ0A 1A41A 1DOVA 4YL1A 3AOUA 2J7PA 3LLIA 4CS8C 2IYLD 3K66A 4CDYA 4YT4A 4ZLDA 1YA7O 1ZW3A 4PJLA 1EQ1A 4XLNF 5L3QA 1O5HA 3JRMO 4BJ6C 2XSEA 3GANA 3QVZA 4KC9A 4O6MA 3U3BA 2OKUA 1D0YA 2BL2A 3B9QA 3NDBB 3M4BA 3GEHA 4QI0A 4JKVA 4XEFA 1OCOC 3K1HA 3PMRA 1ORSC 2P7VA 4JZAA 3HLZA 3KMIA 4Z9JA 2HJ3A 2D4UA 2IBFA 3IEEA 2J0XA 2J9WA 1LIHA 3POVA 4JVSA 1M2VA 3QW1A 2L6FA 1L3PA 2HS5A 3LLKA 4HE8D 3EZIA 1D1BA 3NG1A 4DRIB 2XM0A 1QPUA 4IARA 2OG2A 1LI7A 3GEEA 2H7VC 4LERA 3SXYA 3IQCA 2V3CC 3B29A 3JRTA 3VM6A 3WAQA 1L7CA 2GWWA 1E85A 2FGYA 3NRHA 3Q7GA 4XQ1A 2J9VA 1SR2A 3LNRA 4XPYA 4N06A 1OXBA 4JIOA 5DVWA 5GPGB 2MWQA 2YL1A 3KKBA 4BJ1A 3EFOA 3NKDA 2LD6A 2W4MA 1JPNA 1Z63A 1OR2A 3U9MA 1HE9A 2ZXPA 4YT5A 4JCHA 2R9RB 3G50A 4U9DA 2KW3C 3LESA 3W8IA 2XL6A 4E7SA 3ITFA 4K7BA 3GORA 1OXKA 2EIKC 1JPJA 3TD7A 2BC5A 4MVMA 1CGNA 1NSGB 2A1DD 1ZHWA 4IB4A 2NUTB 2CGEA 2R03A 1Z6AA 2M64A 3U2LA 3NMKA 5JUAA 3HTKC 1T6IA 1QVXA 4MVSA 4OIPF 2G3VA 3HJCA 1QZXA 3O10A 4HFFB 3C62A 1CPRA 4U5HA 3RQGA 2F22A 1S05A 4JTCB 5F5HA 4CIHA 4O79A 1T6QA 5A6BA 2NSFA 2J46A 2QUPA 3C8ZA 2QTVA 5DQZA 2DGJA 4FX5A 4JC7A 1VOMA 1K04A 2OEVA 2WZGA 3S27A 4EBBA 2AU5A 2FFHA 3RIPA 2IXPA 1MNDA 3O55A 1RCPA 1ZZPA 4K0DA 2R7UA 4XWJA 2DYRC 3HNJA 4XEVA 1Z5ZA 3JYYA 3US6A 4G0HA 4YN0B 5JP7A 3SYNA 3U8VA 3W8HA 4G7OF 5L0HA 1OKKD 2XL4A 4P6IC 3M1CB 2W4BA 2XM4A 1FFTC 3K7DA 3TULA 5L0IA 4BPMA 3RH3A 4NTBA 2XLDA 3AG2C 2CNWA 3C8GD 2HFIA 2XLWA 2KNHA 5AGFA 4Z9IA 3I4UA 3ZVRA 1K40A 1MMGA 3DJNB 3RQEA 3FOOA 3FDQA 3CSKA 1RKEB 5L0JA 4EHPA 1MMDA 5B3SC 1D1CA 4YK5A 1YLMA 3A11A 4EBKA 5AC5A 2WL8A 2ICWG 2ZXRA 3T6GB 1GS9A 4JW1A 2DYSC 1NU7D 4YL0A 2P6VA 2LCHA 1U6HA 4E18A 2R05A 2PNOA 3U3FA 3IQ5A 1YARO 2ASRA
chains in the Genus database with same CATH topology
3US6A 1C02A 1A0BA 2LP4A 1I5NA 2A0BA 1OXKA 1YVIA 1BDJB 4G78A 3U3BA 1QSPA 4PACA 1SR2A 2OOCA 1WN0A 1TQGA 3KYIA 1OXBA 4EUKB 1C03A 3KYJA 1Y6DA 2LD6A 2R25A 2LCHA 3IQTA 1FR0A 3MYFA 2Q4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3US6 A;  1C02 A;  1A0B A;  2LP4 A;  1I5N A;  2A0B A;  1OXK A;  1YVI A;  1BDJ B;  4G78 A;  3U3B A;  1QSP A;  4PAC A;  1SR2 A;  2OOC A;  1WN0 A;  1TQG A;  3KYI A;  1OXB A;  4EUK B;  1C03 A;  3KYJ A;  1Y6D A;  2LD6 A;  2R25 A;  2LCH A;  3IQT A;  1FR0 A;  3MYF A;  2Q4F A; 
#chains in the Genus database with same CATH topology
 2CCY A;  4AL1 A;  5IY5 C;  4RDA A;  2R7R A;  3F47 A;  1FMW A;  2LP4 A;  2R7X A;  1M2O A;  4MVR A;  3I5Q A;  1VK5 A;  1BDJ B;  3UMH A;  4LAC B;  2KK1 A;  1LE4 A;  1NLX A;  2KQ9 A;  4N4W A;  1GGQ A;  5DS5 A;  1BR1 A;  1WN0 A;  1YAU O;  1ZHY A;  2LFD A;  2PX3 A;  3AQC A;  3CZ6 A;  4N6H A;  4H4K C;  3W2W A;  4DBR A;  2R7S A;  1RJ9 B;  4XPW A;  2M4E A;  2Q3T A;  3KYJ A;  1OW8 A;  1B68 A;  4CS9 C;  1LS4 A;  3AG3 C;  3DAF A;  3HNK A;  1RKC A;  3RQF A;  4MND A;  4U5E E;  3T4R A;  5DLJ A;  1H7I A;  4JJG A;  4YL3 A;  3LJB A;  2MHR A;  3N24 A;  3WG7 C;  3WOD F;  1G8X A;  1WTY A;  1ST6 A;  4QI2 A;  2OJQ A;  1NFN A;  1TWH A;  2A0B A;  3EH1 A;  2HV6 A;  1MMN A;  1ORJ A;  1VLS A;  3EHM A;  4PJN A;  1BR4 A;  4JUR I;  2EPM X;  4O7G A;  4BJ5 A;  1D1A A;  4I3M A;  4BJT A;  1V4A A;  3FOP A;  3LAY A;  1RKE A;  3L1M A;  1NZE A;  3GM3 A;  4GQH A;  5D91 A;  3S0X A;  3S90 A;  3AGU A;  1Z23 A;  3L0I A;  2EPK X;  5BUO A;  4DVY P;  2VCA A;  2YQY A;  3AGT A;  3DE9 A;  2OQM A;  1G5Z A;  1WGW A;  3T6B A;  1Y6D A;  2ETS A;  1Q0K A;  1J8Y F;  2R25 A;  1V54 C;  1TFO B;  3R7C A;  1FFH A;  5E3C A;  2E87 A;  1A7V A;  1PD0 A;  3NMI A;  2L6H A;  1PD1 A;  2Q00 A;  3CAX A;  4NQF A;  3U0C A;  3K33 A;  3KL4 A;  1U89 A;  1TWC A;  4AL0 A;  4GEH A;  1DOW A;  1W2W A;  4MS2 A;  4RBN A;  3ZC4 A;  3C63 A;  5BQG A;  1I4Z A;  1O3U A;  5E3A A;  3B71 A;  1VMA A;  4J32 B;  4LLC A;  4J7T A;  1CPQ A;  3M79 A;  2H8A A;  4DXW A;  5JLI A;  3B0V C;  2XL8 A;  2CNW D;  1QKR A;  1R4T A;  2J9U A;  2OJE D;  3C8G A;  1EA8 A;  3EGX A;  3QMK A;  3MLG A;  4G78 A;  4N6C A;  4U5F E;  5B1B C;  3C18 A;  2EIJ C;  3KPH A;  2Q9C A;  4MVZ A;  3VAY A;  5K0I A;  3HNI A;  2W9Y A;  4OIO F;  2R7V A;  1IZM A;  3SXM A;  2YVK A;  2YL7 A;  2YLD A;  3EGD B;  3SZR A;  1H6G A;  2EIL C;  4Q5S F;  1TQG A;  1YZA A;  1H9T A;  2EIN C;  2WVN A;  4FWV A;  5KYX A;  2HMQ A;  1MQV A;  4IJJ A;  4ER9 A;  3O6X A;  3NYJ A;  2Y3D A;  4WGZ A;  1HE1 A;  3FAJ A;  3FVY A;  5F28 E;  3RVY A;  4B6I A;  4CS7 A;  2YL0 A;  2XLH A;  4MQ9 F;  3ABL C;  2LSE A;  1JR8 A;  3RFY A;  3WHN A;  4W8K A;  5CIV A;  5KYU B;  1ZHT A;  3RYL A;  3T9O A;  2XXA A;  1A0B A;  1F1M A;  2I8B A;  1SMY F;  1ZHZ A;  4ULW A;  5COM A;  4ANJ A;  4DRJ B;  5KYW A;  2RD9 A;  3EZH A;  3S29 A;  2XLM A;  2A0U A;  5EGY A;  2D5R B;  3QTH A;  2R7W A;  5KYN A;  5T3T A;  5L0C A;  2VCB A;  4IGG A;  5A6J A;  1YJG A;  4U5D E;  5DQT A;  5BQI A;  1T6U A;  2IOQ A;  3U2M A;  5FCL A;  3UGO A;  4E7Z A;  5CI9 A;  4PR9 A;  1Q0D A;  3RW0 A;  4CSA C;  3Q6M A;  3BEH A;  2PX0 A;  4CDA A;  4LDR A;  4QDL A;  1U0B B;  3NYM A;  3AG4 C;  1S7Z A;  2VAS A;  4NC3 A;  3H65 A;  1HMD A;  4KNV A;  4U5G A;  2YWA A;  4KBL A;  1RJ9 A;  1FNT c;  4WAB A;  2IXN A;  4DJ9 A;  2HZ8 A;  3CQZ A;  3AJM A;  4CS8 A;  1BBH A;  4YT8 A;  3NKE A;  3UNG C;  2H7B A;  3DWW A;  4R32 A;  5KYY A;  3VRC A;  4CS9 A;  2DI3 A;  2YHS A;  3N2Z B;  4NTA A;  3S9O A;  1PCX A;  3PHF 2;  1LS1 A;  2JX0 A;  5T3W A;  4ONS A;  3UMI A;  4ZLC A;  3T6J A;  3EGD A;  3GWL A;  2V26 A;  1G4U S;  4Q7C A;  5COG A;  2MYS A;  3LS0 A;  1QSP A;  1BR2 A;  3HNL A;  1SZI A;  3H2V A;  3A9C A;  4PAC A;  3ZTZ A;  3ZQV A;  2J0W A;  2PF4 E;  2YLI A;  4MW8 A;  4DBQ A;  5A69 A;  3EJN A;  1OKK A;  2XLV A;  4E0I A;  2GA0 A;  2P61 A;  4KNW A;  5TJ5 E;  4OIN F;  1ORY A;  1OW7 A;  3FMS A;  2B0H A;  3G4Z A;  4DVZ A;  4FAP B;  4E0H A;  1T9K A;  3AG1 C;  2EIM C;  2CDQ A;  2VH3 A;  3GOD A;  2QLA A;  3NYL A;  4O6N A;  1M6T A;  1Y4C A;  2A68 F;  3E70 C;  3TJ5 A;  1J8M F;  2ZPA A;  1R5I D;  1VTM P;  3B0U X;  4C3E A;  2OU6 A;  4OIR F;  4W8P A;  3OEO A;  1A7E A;  2AWY A;  3IPM O;  1ZU4 A;  2JD3 A;  2WZF A;  4J7Y A;  1GQA A;  5KYW B;  3L8J A;  1LVK A;  1YZC A;  5JSL A;  1E86 A;  3QW0 A;  4CIP A;  2WZL A;  3ZDL A;  2AWC A;  3N0T A;  5BQH A;  2L6G A;  2R7T A;  3GM1 A;  4U5B E;  2OEX A;  2XRH A;  4O6Y A;  2O9X A;  3C8G B;  3SP1 A;  2J9B A;  3RF3 A;  2EPO A;  3BRJ A;  3EFO B;  3ZIB A;  3ZG1 A;  3EPV A;  4EUK B;  1LM3 B;  3UGP A;  3VF0 A;  1ZYR F;  1EI7 A;  3LEO A;  3E9V A;  4MTO A;  2TMV P;  2NUP A;  2YZS A;  3EHN A;  4AK9 A;  4D4N A;  1M57 C;  5FZT A;  3GEI A;  1HW2 A;  1OW6 A;  1TWG A;  5E33 A;  3QZC A;  5KYY B;  2YRF A;  3B0P A;  3H2U A;  2C04 A;  1FAP B;  1RXQ A;  2A6E F;  1C02 A;  1TKN A;  1OCZ C;  3ZSU A;  3F46 A;  2Q9A A;  1H9G A;  3AQB A;  1T01 A;  1XZP A;  3K6B A;  3LNM B;  1M56 C;  3R2P A;  4X0R A;  3UMK A;  2NPU A;  3V7O A;  2KSF A;  1D0X A;  3TOM A;  1NFO A;  4PFO A;  3V5Z A;  1XZQ A;  2CW0 F;  4M63 A;  3M15 A;  3TK0 A;  1AEP A;  3DZA A;  3ABM C;  2KGO A;  2Y39 A;  4JTA B;  2P0N A;  1Z3I X;  5A6A A;  2H7O A;  1NBB A;  2DB4 A;  1BZ4 A;  2Z15 A;  3PCV A;  5DS6 A;  1C03 A;  2VC9 A;  4NCQ A;  3HKK A;  4YJW A;  2HKV A;  1HMO A;  2YL3 A;  4IAO A;  4L6R A;  2LFF A;  2P1A A;  4JEB A;  1Z7Q c;  3K1I A;  4JJF A;  1YA9 A;  4JCZ A;  4A4A A;  1C17 M;  2NG1 A;  3DJU B;  3I5P A;  1TFK B;  3K1I C;  5B1A C;  3JSZ A;  4DRH B;  2QE9 A;  4MTF A;  1APC A;  1JMW A;  2YEV A;  3DM9 B;  4HEA J;  4IWB A;  1I5N A;  3SXK A;  1ZU5 A;  1HY5 A;  2UUI A;  2I15 A;  1Q0F A;  2J8W A;  4CJO A;  4U5C E;  3ZTM A;  4LDK A;  3G4X A;  1E2X A;  3ECS A;  3DM5 A;  3JZ0 A;  4KI2 A;  4J30 B;  4U9E A;  1E83 A;  5L0D A;  1QQ3 A;  3ZQY A;  4E17 A;  4DOZ A;  5AC4 A;  5KYU A;  3MX3 A;  4MVU A;  1SYQ A;  1LE2 A;  256B A;  2GDC A;  4JTD B;  1Q0M A;  2A6H F;  4BJ6 A;  3U9J A;  3TQO A;  5JRA A;  1I4Y A;  4BEJ A;  2IM8 A;  3IQT A;  4YT2 A;  3LEV A;  3MYF A;  3DE8 A;  3S28 A;  3V5X A;  3JYH A;  3L8I A;  3QVY A;  4Z9H A;  3TOL A;  2PFD A;  1GM5 A;  4NY3 A;  4P9F A;  1AUE A;  3U8P A;  1YDI A;  1JAF A;  4AE4 A;  1OR3 A;  2R02 A;  2X51 A;  5T1D B;  4BG0 A;  4G7H F;  2XLE A;  5A6K A;  2VCC A;  4MW3 A;  4P9T A;  3DKA A;  5JS5 A;  2LQG A;  3DMD A;  4LDQ A;  3Q6N A;  3LS1 A;  4CSA A;  1KU2 A;  5COF A;  4EKW A;  1OQC A;  1WOL A;  2B0J A;  1TR2 A;  2WB7 A;  4OD4 A;  1TWA A;  3C7J A;  4H54 A;  5DS4 A;  2GAQ A;  2EPN A;  1JRA A;  4F4B A;  3IHU A;  4XEK A;  4OD5 A;  1V55 C;  2L9J A;  2WVO A;  3FXH A;  4Q4Z F;  5EK0 A;  1NU9 C;  2R7O A;  3EQL F;  3NMJ A;  1WWP A;  2Q4F A;  2NUP B;  4D4X A;  5HSW A;  4A2N B;  3EH2 A;  2IXO A;  1G4W R;  1WAT A;  3J06 A;  1V74 B;  3JSE O;  1JOG A;  4EIY A;  1YVI A;  1AVO B;  3JTL O;  3MYI A;  4HFK B;  3ZWI A;  1N1C A;  4PJM A;  4MVQ A;  1NG1 A;  3MFN A;  2NSG A;  2UUH A;  3X1O A;  4XLP F;  1UG7 A;  4IAQ A;  3FHD A;  4NTF A;  5JVE A;  2AVK A;  4I1O B;  5B3I A;  4UDV A;  4BEM J;  1D0Z A;  3UR3 C;  2OOC A;  3JT1 A;  1CGM E;  2LK4 A;  2LIG A;  3EG9 A;  4GYT A;  3DAG A;  3DI5 A;  3TJ6 A;  5EHH A;  4C3D A;  1ZVZ A;  1UFB A;  2A69 F;  1SF8 A;  1M2V B;  2Y3G A;  2ZXW C;  3CEX A;  4PK4 A;  3FAP B;  5D92 A;  5E2Q A;  2XXA B;  2AP3 A;  1VYK A;  2ZXO A;  2HJM A;  2XS8 A;  4PJJ A;  1MNE A;  2G62 A;  3VYW A;  3ATP A;  2NUT A;  5L3V A;  2Y69 C;  2L81 A;  2KJG A;  3GWN A;  1FMV A;  2GFH A;  3EG9 B;  5A6B D;  1XWJ A;  3OWT A;  2Q7R A;  1O87 A;  4ULV A;  3ABK C;  1CGO A;  3U5S A;  2PP4 A;  3DD7 A;  1VLT A;  3EGX B;  4I44 A;  2Y3H A;  4MVO A;  3X2Q C;  2ZD9 A;  1VB5 A;  3KH2 A;  2BE5 F;  2IXM A;  3V5Y A;  1QLE C;  2CYD A;  3GM2 A;  4XTK A;  3M4C A;  2HMZ A;  2YKZ A;  2RSE B;  3JCU Q;  5L0G A;  5F5F A;  1RMV A;  1LKX A;  2Q9B A;  3KYI A;  1A7D A;  2YLG A;  3O39 A;  4XPX A;  1T5O A;  5HV9 A;  1E84 A;  4BJ5 C;  4JE9 A;  3SNH A;  3PDM P;  4CX9 A;  2HUJ A;  1OCC C;  1VYI A;  4C3B A;  5KYX B;  4RD9 A;  2HV7 A;  2QY9 A;  4G7Z F;  1OCR C;  4AX2 A;  2KC3 A;  3W2V A;  3Q7L A;  4OIQ F;  3MBG A;  4I1M A;  2WVQ A;  4YWQ A;  2C03 A;  1KNY A;  2FAP B;  2L7A A;  4JEA A;  4JRZ A;  4K1O A;  4C7O A;  3RKO F;  2R7Q A;  4CDV A;  3LUT B;  5CI8 A;  1LI5 A;  4CJG A;  2VB6 A;  3SEO A;  1PV3 A;  5L0F A;  3L34 A;  1MMA A;  3DXJ F;  4CBE A;  3IQ6 A;  2XLO A;  2PBE A;  4MTG A;  4IRU A;  4AE4 B;  2KYH A;  2J45 A;  3OA1 A;  1K05 A;  4C7O B;  1IW7 F;  2XS1 A;  3ASO C;  2J7P D;  4LLE A;  2QNL A;  2X0C A;  1WAS A;  4EBJ A;  2G3K A;  1HW1 A;  2JPU A;  4FES A;  4EWC A;  2EPL X;  3ASN C;  1ZHX A;  2Y3B A;  1LPE A;  1Q0G A;  2W45 A;  3S84 A;  1ZW2 A;  1FTS A;  1YYX A;  5JT4 A;  3SXZ A;  4PFP A;  1FR0 A;  3W4Y A;  1YYJ A;  2HSB A;  4WGY A;  2HSQ A;  1EKY A;  3RVZ A;  1KTM A;  2OCC C;  4WJ0 A;  1A41 A;  1DOV A;  4YL1 A;  3AOU A;  2J7P A;  3LLI A;  4CS8 C;  2IYL D;  3K66 A;  4CDY A;  4YT4 A;  4ZLD A;  1YA7 O;  1ZW3 A;  4PJL A;  1EQ1 A;  4XLN F;  5L3Q A;  1O5H A;  3JRM O;  4BJ6 C;  2XSE A;  3GAN A;  3QVZ A;  4KC9 A;  4O6M A;  3U3B A;  2OKU A;  1D0Y A;  2BL2 A;  3B9Q A;  3NDB B;  3M4B A;  3GEH A;  4QI0 A;  4JKV A;  4XEF A;  1OCO C;  3K1H A;  3PMR A;  1ORS C;  2P7V A;  4JZA A;  3HLZ A;  3KMI A;  4Z9J A;  2HJ3 A;  2D4U A;  2IBF A;  3IEE A;  2J0X A;  2J9W A;  1LIH A;  3POV A;  4JVS A;  1M2V A;  3QW1 A;  2L6F A;  1L3P A;  2HS5 A;  3LLK A;  4HE8 D;  3EZI A;  1D1B A;  3NG1 A;  4DRI B;  2XM0 A;  1QPU A;  4IAR A;  2OG2 A;  1LI7 A;  3GEE A;  2H7V C;  4LER A;  3SXY A;  3IQC A;  2V3C C;  3B29 A;  3JRT A;  3VM6 A;  3WAQ A;  1L7C A;  2GWW A;  1E85 A;  2FGY A;  3NRH A;  3Q7G A;  4XQ1 A;  2J9V A;  1SR2 A;  3LNR A;  4XPY A;  4N06 A;  1OXB A;  4JIO A;  5DVW A;  5GPG B;  2MWQ A;  2YL1 A;  3KKB A;  4BJ1 A;  3EFO A;  3NKD A;  2LD6 A;  2W4M A;  1JPN A;  1Z63 A;  1OR2 A;  3U9M A;  1HE9 A;  2ZXP A;  4YT5 A;  4JCH A;  2R9R B;  3G50 A;  4U9D A;  2KW3 C;  3LES A;  3W8I A;  2XL6 A;  4E7S A;  3ITF A;  4K7B A;  3GOR A;  1OXK A;  2EIK C;  1JPJ A;  3TD7 A;  2BC5 A;  4MVM A;  1CGN A;  1NSG B;  2A1D D;  1ZHW A;  4IB4 A;  2NUT B;  2CGE A;  2R03 A;  1Z6A A;  2M64 A;  3U2L A;  3NMK A;  5JUA A;  3HTK C;  1T6I A;  1QVX A;  4MVS A;  4OIP F;  2G3V A;  3HJC A;  1QZX A;  3O10 A;  4HFF B;  3C62 A;  1CPR A;  4U5H A;  3RQG A;  2F22 A;  1S05 A;  4JTC B;  5F5H A;  4CIH A;  4O79 A;  1T6Q A;  5A6B A;  2NSF A;  2J46 A;  2QUP A;  3C8Z A;  2QTV A;  5DQZ A;  2DGJ A;  4FX5 A;  4JC7 A;  1VOM A;  1K04 A;  2OEV A;  2WZG A;  3S27 A;  4EBB A;  2AU5 A;  2FFH A;  3RIP A;  2IXP A;  1MND A;  3O55 A;  1RCP A;  1ZZP A;  4K0D A;  2R7U A;  4XWJ A;  2DYR C;  3HNJ A;  4XEV A;  1Z5Z A;  3JYY A;  3US6 A;  4G0H A;  4YN0 B;  5JP7 A;  3SYN A;  3U8V A;  3W8H A;  4G7O F;  5L0H A;  1OKK D;  2XL4 A;  4P6I C;  3M1C B;  2W4B A;  2XM4 A;  1FFT C;  3K7D A;  3TUL A;  5L0I A;  4BPM A;  3RH3 A;  4NTB A;  2XLD A;  3AG2 C;  2CNW A;  3C8G D;  2HFI A;  2XLW A;  2KNH A;  5AGF A;  4Z9I A;  3I4U A;  3ZVR A;  1K40 A;  1MMG A;  3DJN B;  3RQE A;  3FOO A;  3FDQ A;  3CSK A;  1RKE B;  5L0J A;  4EHP A;  1MMD A;  5B3S C;  1D1C A;  4YK5 A;  1YLM A;  3A11 A;  4EBK A;  5AC5 A;  2WL8 A;  2ICW G;  2ZXR A;  3T6G B;  1GS9 A;  4JW1 A;  2DYS C;  1NU7 D;  4YL0 A;  2P6V A;  2LCH A;  1U6H A;  4E18 A;  2R05 A;  2PNO A;  3U3F A;  3IQ5 A;  1YAR O;  2ASR A; 
#chains in the Genus database with same CATH homology
 3US6 A;  1C02 A;  1A0B A;  2LP4 A;  1I5N A;  2A0B A;  1OXK A;  1YVI A;  1BDJ B;  4G78 A;  3U3B A;  1QSP A;  4PAC A;  1SR2 A;  2OOC A;  1WN0 A;  1TQG A;  3KYI A;  1OXB A;  4EUK B;  1C03 A;  3KYJ A;  1Y6D A;  2LD6 A;  2R25 A;  2LCH A;  3IQT A;  1FR0 A;  3MYF A;  2Q4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...