3U3BA

Crystal structure of computationally redesigned four-helix bundle
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
104
structure length
104
Chain Sequence
GSHQEYIKKVTDELKELIQNVNDDIKEVEKNPEDMEYWNKIYRLVHTMKEITETMGFSSVAKVLHTIMNLVDKMLNSEIKITSDLIDKVKKKLDMVTRELDKKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords computationally designed four-helix bundle protein
publication title Increasing sequence diversity with flexible backbone protein design: the complete redesign of a protein hydrophobic core.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Unknown function
total genus 43
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 3u3bA00
4G78A 3IQTA 2A0BA 3MYFA 2LCHA 1Y6DA 1YVIA 1QSPA 1OXKA 1BDJB 1FR0A 1C03A 1SR2A 1WN0A 2Q4FA 1C02A 3KYIA 4EUKB 1I5NA 1A0BA 2LP4A 2LD6A 3U3BA 4PACA 3KYJA 2R25A 2OOCA 3US6A 1OXBA 1TQGA
chains in the Genus database with same CATH superfamily
5EK0A 3V5XA 4CDYA 2IM8A 1BZ4A 4E18A 1J8YF 4WJ0A 4FAPB 1H9GA 3X2QC 2XS8A 3A9CA 4IJJA 4HE8D 3V5ZA 2HMZA 3FXHA 4CBEA 2L9JA 3AQBA 3G4ZA 3JTLO 3M1CB 4IGGA 4M63A 4MW8A 4E7ZA 3C62A 2D4UA 3L8JA 1Q0DA 2ZD9A 2A6EF 4MNDA 2KNHA 3RH3A 5BQHA 4EIYA 5B3IA 3B0VC 1FAPB 5KYUB 1R5ID 2V26A 1FFHA 3LUTB 3RQEA 3K33A 3T6JA 3AG3C 1TWGA 4XLNF 1ST6A 3AGUA 3ZWIA 1TWAA 1D1AA 1OKKD 3SP1A 3VM6A 3JYHA 4XPWA 1VTMP 2BC5A 3GEHA 1OXBA 2VCAA 4N4WA 2AWCA 4ULWA 2NUTB 1EA8A 2HS5A 4ONSA 4DXWA 2GDCA 3IQTA 4O6NA 4XPXA 5D91A 5BQIA 2R7XA 1FMWA 2EPLX 1YLMA 3EZHA 5E3CA 3QW1A 2Y3DA 5A6BD 1SMYF 2PX0A 2HJ3A 256BA 3Q7LA 4YL1A 4A4AA 1ZU4A 4I1MA 1K05A 2C03A 3QVYA 3B0PA 1KTMA 5DS5A 3RKOF 2J9WA 2J46A 1OCCC 3LS1A 3EHMA 2EIJC 1LVKA 2XRHA 3O10A 1YYJA 4OD5A 5KYXB 2R7SA 4OIPF 5E3AA 4EBKA 5DQZA 3TOLA 3I4UA 2HKVA 4JURI 3W8HA 3TOMA 3U3FA 4IAOA 4XQ1A 1Y4CA 2A0UA 1G4US 3SNHA 1G8XA 2DYRC 1B68A 2Y3GA 4NTAA 2QTVA 1BR2A 5AC4A 1O3UA 1TFKB 1Q0MA 4FWVA 4YN0B 3EG9A 2J9UA 3LJBA 2IYLD 2YL1A 3S28A 1ZW3A 3PCVA 5L3VA 4N6CA 5KYYB 4XEVA 1VK5A 1QKRA 2Y69C 3K66A 2YLIA 5T1DB 1SF8A 1NU9C 2X0CA 3TK0A 3V5YA 5EGYA 2R7VA 2EIMC 4O6YA 5KYNA 3PMRA 1U89A 4CS7A 4Z9JA 1RMVA 3ABMC 4AE4B 3SZRA 2W4MA 3BRJA 2R7WA 3KYJA 1M2VA 1TR2A 2F22A 2YL0A 4XEKA 1MMGA 1YZCA 2AVKA 2R7OA 1GS9A 5JVEA 2YL3A 4MW3A 2ETSA 4C3DA 5K0IA 1D0YA 2GFHA 3DE8A 4JRZA 2XL8A 2PX3A 2A68F 3RF3A 4BJ5A 4CIPA 2NSFA 5COFA 2WVOA 1I4YA 2QLAA 5HSWA 2QNLA 4FX5A 4CSAA 5KYUA 2NSGA 3RYLA 5F5HA 1L3PA 1VMAA 1QPUA 3RIPA 4CS8A 1T5OA 4BEJA 3FVYA 1Z3IX 2O9XA 3LEVA 1K40A 2J0XA 1QSPA 3C7JA 1BDJB 1HE9A 2J8WA 1LS1A 2Q00A 2Y3BA 4K1OA 3ZSUA 4AL1A 3U9JA 3ASOC 4WGYA 4CDVA 3OWTA 4RD9A 2L7AA 2NUTA 3X1OA 3KYIA 4D4NA 4EKWA 1HMDA 1A0BA 2LP4A 3CSKA 5EHHA 1NG1A 3GANA 2XM0A 1VLTA 3IQ6A 5JUAA 3M4BA 4WGZA 2HZ8A 3WODF 1Q0FA 1L7CA 3O39A 2HV7A 3SXZA 4LDRA 4WABA 3K1IA 1NU7D 4I44A 1H6GA 4PJJA 1RCPA 4AX2A 4KNVA 4U9DA 1ZZPA 2ICWG 1QZXA 4MVRA 4NTBA 4P9FA 1U0BB 4EHPA 3S27A 3AG4C 3C8GB 4O79A 2BE5F 4K0DA 4NTFA 4OIQF 2WB7A 3UNGC 4MS2A 3ATPA 2MYSA 3N0TA 3AQCA 1G5ZA 3HNLA 1CGOA 4KI2A 4JTDB 2P1AA 1NFOA 3WHNA 4HFKB 5KYYA 1HW2A 1XZPA 2D5RB 1O5HA 2LK4A 3ITFA 4Q7CA 3H2UA 2XLVA 3US6A 2EPNA 1WOLA 3EFOB 5TJ5E 5COGA 2Y39A 3U2LA 4U5CE 5L0FA 4XTKA 5FCLA 5L0IA 2RSEB 4ULVA 1ZHTA 1E83A 3Q6NA 2GAQA 1EQ1A 3AGTA 2LFDA 1CPRA 4AL0A 3V7OA 3RW0A 2I8BA 3IQCA 3TQOA 1WASA 1M2VB 1WGWA 1Z23A 2CYDA 1RKEA 3HJCA 3I5PA 2ZXPA 4YL0A 4C3BA 3UGOA 1DOVA 3DMDA 3N24A 3KKBA 4CJOA 2HFIA 4U5DE 1WATA 2ASRA 2LQGA 3O55A 4C7OB 4CS9C 2CNWA 2IXOA 3K1IC 2Q3TA 3U2MA 5KYWB 3TULA 1IW7F 3HNJA 4J30B 4N6HA 4QI2A 1C17M 1OKKA 3CZ6A 1YJGA 1OCZC 4PJMA 2IBFA 5CI9A 4MVUA 4J32B 4NC3A 1IZMA 1WWPA 2ZXOA 1J8MF 3EQLF 4L6RA 3GM3A 3LNRA 3B0UX 1TWHA 1A7DA 2EIKC 3JYYA 3RFYA 1FFTC 4E7SA 2B0JA 2YL7A 5CI8A 4YK5A 2LIGA 3LAYA 2YRFA 3HNKA 1LM3B 4E0IA 5AC5A 1OCOC 2NUPB 4G7ZF 4OIRF 3FHDA 1C02A 1APCA 1JPJA 3IQ5A 4IWBA 4NCQA 1U6HA 3GM2A 5HV9A 2VCBA 4K7BA 1PCXA 2VC9A 3JSZA 4JC7A 1XZQA 3QVZA 2KJGA 2R7TA 1LI7A 3A11A 3C8GA 2WZFA 1T9KA 1V4AA 1JR8A 1NZEA 3ZDLA 4G0HA 2KYHA 1T6UA 2CDQA 2YKZA 4EWCA 3TD7A 1V54C 3MYFA 3RQGA 3TJ6A 1G4WR 2KC3A 4PK4A 1V55C 1QQ3A 2QUPA 2P6VA 1NSGB 3SXKA 2XLHA 1HMOA 2WVQA 1OQCA 4JW1A 1Z6AA 4CDAA 4GEHA 4LLCA 3VF0A 2NG1A 3EFOA 3MX3A 5JRAA 1UFBA 5F5FA 2OG2A 3LLKA 3EH2A 3LNMB 4ZLCA 4JZAA 3MBGA 5L0GA 1K04A 4JJFA 1HW1A 4Q4ZF 2QY9A 2CCYA 1KNYA 4IRUA 3C8ZA 1DOWA 1A41A 2B0HA 3QZCA 1T01A 1RKEB 2YLDA 4KC9A 3S84A 4OD4A 1TFOB 4BJ6A 1S7ZA 4C7OA 3NRHA 3FAPB 2XLOA 3IPMO 2P61A 3ECSA 4JEBA 4C3EA 3K1HA 5L3QA 3QMKA 3U8PA 3K7DA 2V3CC 1YVIA 4XWJA 2JD3A 2RD9A 2UUHA 4Z9IA 1Q0GA 4YT5A 4BPMA 2LSEA 1A7EA 3DI5A 4U5GA 3U0CA 2OKUA 4MTOA 3GEIA 1BBHA 2DI3A 1YYXA 5T3TA 4IB4A 3NDBB 3L1MA 3RVZA 2NPUA 3DAGA 3RQFA 4ER9A 4EUKB 5DS4A 4HEAJ 3DAFA 2XL6A 1AEPA 3M79A 4DBRA 2EPKX 2EPMX 4U5EE 3T6GB 2OOCA 5KYWA 2R7QA 4I3MA 5DLJA 3S9OA 3DM9B 2NUPA 3ZTMA 3C18A 1JMWA 2G3VA 2EPOA 2MHRA 3WAQA 1H9TA 2WVNA 1NFNA 4JE9A 2DGJA 1TKNA 2XL4A 1D0XA 2J7PA 2OJED 4XEFA 3SXMA 4Z9HA 1E85A 1OW8A 1Y6DA 3W2VA 2PNOA 5A6JA 4R32A 2PF4E 4UDVA 1FR0A 2OQMA 4MVSA 2IOQA 3U9MA 4DRIB 1EI7A 1M6TA 4JIOA 1LPEA 2XSEA 4E17A 5L0JA 3ZC4A 3U3BA 3RVYA 2XLDA 5AGFA 4NQFA 3EZIA 4BJ5C 3ZVRA 2BL2A 2HUJA 2HSBA 3HKKA 4DRJB 1FTSA 3QTHA 4CSAC 1ZU5A 3AG2C 3F46A 2GWWA 4CS8C 3ZQVA 3UMKA 3UGPA 2R9RB 3KH2A 3UR3C 5JT4A 1SYQA 1ZW2A 4JVSA 3TJ5A 4JJGA 1LKXA 1Z63A 2H7VC 3QW0A 4RBNA 3H2VA 4AE4A 1GM5A 2A6HF 2J9BA 2HJMA 3HLZA 3L0IA 2Q7RA 5IY5C 1YA9A 3ZTZA 1O87A 2XS1A 2ZXWC 5L0HA 4G7HF 1C03A 1OW7A 1VB5A 3JRTA 3M15A 3NYMA 4YT2A 1W2WA 3S0XA 2DYSC 1M57C 1MNEA 4P9TA 3T9OA 4GQHA 5DS6A 1JRAA 2MWQA 4HFFB 1YZAA 1I5NA 3S90A 2L6FA 3O6XA 2LD6A 3HTKC 1GQAA 2CW0F 2LFFA 3W8IA 5COMA 4KBLA 2I15A 4DJ9A 3U5SA 2J0WA 2KW3C 1ZHWA 3DZAA 3MLGA 3W4YA 1E2XA 1F1MA 2A69F 2IXMA 5A6KA 5BQGA 3PDMP 3N2ZB 1BR1A 3GWNA 4LDQA 2HSQA 4CX9A 1BR4A 3M4CA 4XPYA 5DQTA 2Y3HA 2YEVA 3J06A 1H7IA 3DD7A 4W8KA 1ZHXA 2VCCA 1ZHYA 2KSFA 4DVYP 3I5QA 4MVQA 1YARO 1S05A 1HE1A 3FOPA 1HY5A 2OJQA 5A6BA 1OXKA 1RKCA 1SR2A 2KQ9A 2VH3A 2HMQA 1ORYA 2E87A 4YJWA 5B1BC 1GGQA 2VB6A 4MTGA 1ZYRF 1NBBA 4J7TA 1LE4A 1OCRC 1YA7O 3ASNC 2XLMA 4JCZA 4JCHA 5JLIA 2H7BA 4P6IC 3LLIA 1AUEA 3B29A 2CNWD 3ABLC 4MVMA 3NMKA 1FMVA 1YAUO 4LACB 3SYNA 1CGNA 1MMDA 3T6BA 2R25A 4JTAB 1VYKA 2PFDA 4LDKA 1CGME 1YDIA 3NG1A 2GA0A 1VOMA 2YQYA 3B71A 3JCUQ 3AG1C 3JZ0A 3NKDA 2YVKA 3UMIA 4BEMJ 3GODA 3FDQA 2C04A 3EHNA 3NMIA 1JPNA 2YZSA 3KPHA 3R2PA 3FMSA 2EINC 2TMVP 3C63A 4GYTA 4OIOF 1ZHZA 1PD0A 2EILC 3EJNA 3E9VA 2KK1A 3FOOA 3SEOA 3SXYA 4W8PA 1Q0KA 2XLWA 3GM1A 4X0RA 4DVZA 4D4XA 4YT8A 1E86A 4G7OF 2R7RA 4FESA 1WN0A 4PFOA 3VYWA 2ZXRA 1RJ9B 2Q4FA 1VLSA 1A7VA 3CEXA 4O7GA 4PJNA 3U8VA 2G62A 3NKEA 3NMJA 2JPUA 1SZIA 2WZLA 4H4KC 1MMNA 3OA1A 3B9QA 4U5BE 1D0ZA 2IXPA 2J45A 2Q9CA 1TWCA 3DJUB 3EGXB 2WL8A 4PJLA 3G50A 3S29A 2R05A 3H65A 2W45A 2R03A 3DJNB 4YWQA 4CIHA 2WZGA 3GWLA 3C8GD 3HNIA 1M2OA 3NYLA 3NYJA 4IARA 4OINF 4EBJA 5E33A 1VYIA 4O6MA 1TQGA 2W9YA 5A69A 3IEEA 5DVWA 1ORJA 4N06A 2CGEA 1R4TA 4XLPF 2W4BA 5E2QA 2XM4A 2OU6A 4Q5SF 2G3KA 1N1CA 4B6IA 2OEXA 2DB4A 2KGOA 1CPQA 2AP3A 1Z7Qc 1I4ZA 2HV6A 2UUIA 3DM5A 1Z5ZA 4BG0A 2XXAB 1LI5A 2L81A 3EGDB 2OCCC 2A1DD 1D1BA 3GORA 3LEOA 4LLEA 4J7YA 1LE2A 4RDAA 1OR3A 3WG7C 1E84A 3AJMA 2Z15A 3AOUA 2PBEA 3VAYA 3EH1A 5JS5A 2M4EA 3DE9A 2AWYA 3K6BA 3MYIA 5F28E 3UMHA 4DRHB 4A2NB 1UG7A 1JAFA 1D1CA 2JX0A 3ABKC 3CAXA 2FFHA 3F47A 4QDLA 1ZVZA 1QVXA 1V74B 2VASA 2X51A 4MQ9F 5BUOA 2FAPB 5A6AA 2PP4A 4G78A 4IAQA 5JSLA 1KU2A 2A0BA 3KL4A 4U5FE 1EKYA 4ANJA 2FGYA 2LCHA 4NY3A 5B1AC 2H7OA 3ZIBA 4JEAA 1XWJA 2YLGA 3Q6MA 5L0CA 3L8IA 3JRMO 2L6GA 1ORSC 3JT1A 3Q7GA 2YHSA 2IXNA 2OEVA 3L34A 5T3WA 3GEEA 3OEOA 1MNDA 3VRCA 3LS0A 5D92A 4BJ6C 1OR2A 3KMIA 4LERA 2AU5A 5GPGB 3W2WA 2QE9A 5B3SC 4JKVA 4DOZA 4DBQA 1AVOB 2Q9AA 1RJ9A 4YL3A 3ZG1A 3IHUA 4CS9A 4F4BA 1FNTc 2ZPAA 4E0HA 1RXQA 3JSEO 4U5HA 2YWAA 4ZLDA 4YT4A 3DWWA 3CQZA 2J7PD 4JTCB 5KYXA 1OW6A 1NLXA 2H8AA 1PD1A 2Q9BA 1QLEC 3E70C 3EGXA 2P0NA 2XLEA 3DKAA 4PR9A 4BJTA 1MMAA 3BEHA 3EPVA 4PFPA 3R7CA 1JOGA 2P7VA 3T4RA 3ZQYA 4EBBA 4I1OB 1MQVA 1WTYA 4U9EA 4MVOA 1PV3A 3POVA 1T6IA 4H54A 3DXJF 1T6QA 3MFNA 4CJGA 4KNWA 1LS4A 4PACA 1LIHA 5JP7A 2R7UA 3EG9B 3G4XA 3PHF2 2J9VA 2L6HA 2M64A 1M56C 4QI0A 5FZTA 4BJ1A 5CIVA 3FAJA 4AK9A 2XXAA 3EGDA 4MTFA 5L0DA 4MVZA 2R02A 3LESA
chains in the Genus database with same CATH topology
4G78A 3IQTA 2A0BA 3MYFA 2LCHA 1Y6DA 1YVIA 1QSPA 1OXKA 1BDJB 1FR0A 1C03A 1SR2A 1WN0A 2Q4FA 1C02A 3KYIA 4EUKB 1I5NA 1A0BA 2LP4A 2LD6A 3U3BA 4PACA 3KYJA 2R25A 2OOCA 3US6A 1OXBA 1TQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G78 A;  3IQT A;  2A0B A;  3MYF A;  2LCH A;  1Y6D A;  1YVI A;  1QSP A;  1OXK A;  1BDJ B;  1FR0 A;  1C03 A;  1SR2 A;  1WN0 A;  2Q4F A;  1C02 A;  3KYI A;  4EUK B;  1I5N A;  1A0B A;  2LP4 A;  2LD6 A;  3U3B A;  4PAC A;  3KYJ A;  2R25 A;  2OOC A;  3US6 A;  1OXB A;  1TQG A; 
#chains in the Genus database with same CATH topology
 5EK0 A;  3V5X A;  4CDY A;  2IM8 A;  1BZ4 A;  4E18 A;  1J8Y F;  4WJ0 A;  4FAP B;  1H9G A;  3X2Q C;  2XS8 A;  3A9C A;  4IJJ A;  4HE8 D;  3V5Z A;  2HMZ A;  3FXH A;  4CBE A;  2L9J A;  3AQB A;  3G4Z A;  3JTL O;  3M1C B;  4IGG A;  4M63 A;  4MW8 A;  4E7Z A;  3C62 A;  2D4U A;  3L8J A;  1Q0D A;  2ZD9 A;  2A6E F;  4MND A;  2KNH A;  3RH3 A;  5BQH A;  4EIY A;  5B3I A;  3B0V C;  1FAP B;  5KYU B;  1R5I D;  2V26 A;  1FFH A;  3LUT B;  3RQE A;  3K33 A;  3T6J A;  3AG3 C;  1TWG A;  4XLN F;  1ST6 A;  3AGU A;  3ZWI A;  1TWA A;  1D1A A;  1OKK D;  3SP1 A;  3VM6 A;  3JYH A;  4XPW A;  1VTM P;  2BC5 A;  3GEH A;  1OXB A;  2VCA A;  4N4W A;  2AWC A;  4ULW A;  2NUT B;  1EA8 A;  2HS5 A;  4ONS A;  4DXW A;  2GDC A;  3IQT A;  4O6N A;  4XPX A;  5D91 A;  5BQI A;  2R7X A;  1FMW A;  2EPL X;  1YLM A;  3EZH A;  5E3C A;  3QW1 A;  2Y3D A;  5A6B D;  1SMY F;  2PX0 A;  2HJ3 A;  256B A;  3Q7L A;  4YL1 A;  4A4A A;  1ZU4 A;  4I1M A;  1K05 A;  2C03 A;  3QVY A;  3B0P A;  1KTM A;  5DS5 A;  3RKO F;  2J9W A;  2J46 A;  1OCC C;  3LS1 A;  3EHM A;  2EIJ C;  1LVK A;  2XRH A;  3O10 A;  1YYJ A;  4OD5 A;  5KYX B;  2R7S A;  4OIP F;  5E3A A;  4EBK A;  5DQZ A;  3TOL A;  3I4U A;  2HKV A;  4JUR I;  3W8H A;  3TOM A;  3U3F A;  4IAO A;  4XQ1 A;  1Y4C A;  2A0U A;  1G4U S;  3SNH A;  1G8X A;  2DYR C;  1B68 A;  2Y3G A;  4NTA A;  2QTV A;  1BR2 A;  5AC4 A;  1O3U A;  1TFK B;  1Q0M A;  4FWV A;  4YN0 B;  3EG9 A;  2J9U A;  3LJB A;  2IYL D;  2YL1 A;  3S28 A;  1ZW3 A;  3PCV A;  5L3V A;  4N6C A;  5KYY B;  4XEV A;  1VK5 A;  1QKR A;  2Y69 C;  3K66 A;  2YLI A;  5T1D B;  1SF8 A;  1NU9 C;  2X0C A;  3TK0 A;  3V5Y A;  5EGY A;  2R7V A;  2EIM C;  4O6Y A;  5KYN A;  3PMR A;  1U89 A;  4CS7 A;  4Z9J A;  1RMV A;  3ABM C;  4AE4 B;  3SZR A;  2W4M A;  3BRJ A;  2R7W A;  3KYJ A;  1M2V A;  1TR2 A;  2F22 A;  2YL0 A;  4XEK A;  1MMG A;  1YZC A;  2AVK A;  2R7O A;  1GS9 A;  5JVE A;  2YL3 A;  4MW3 A;  2ETS A;  4C3D A;  5K0I A;  1D0Y A;  2GFH A;  3DE8 A;  4JRZ A;  2XL8 A;  2PX3 A;  2A68 F;  3RF3 A;  4BJ5 A;  4CIP A;  2NSF A;  5COF A;  2WVO A;  1I4Y A;  2QLA A;  5HSW A;  2QNL A;  4FX5 A;  4CSA A;  5KYU A;  2NSG A;  3RYL A;  5F5H A;  1L3P A;  1VMA A;  1QPU A;  3RIP A;  4CS8 A;  1T5O A;  4BEJ A;  3FVY A;  1Z3I X;  2O9X A;  3LEV A;  1K40 A;  2J0X A;  1QSP A;  3C7J A;  1BDJ B;  1HE9 A;  2J8W A;  1LS1 A;  2Q00 A;  2Y3B A;  4K1O A;  3ZSU A;  4AL1 A;  3U9J A;  3ASO C;  4WGY A;  4CDV A;  3OWT A;  4RD9 A;  2L7A A;  2NUT A;  3X1O A;  3KYI A;  4D4N A;  4EKW A;  1HMD A;  1A0B A;  2LP4 A;  3CSK A;  5EHH A;  1NG1 A;  3GAN A;  2XM0 A;  1VLT A;  3IQ6 A;  5JUA A;  3M4B A;  4WGZ A;  2HZ8 A;  3WOD F;  1Q0F A;  1L7C A;  3O39 A;  2HV7 A;  3SXZ A;  4LDR A;  4WAB A;  3K1I A;  1NU7 D;  4I44 A;  1H6G A;  4PJJ A;  1RCP A;  4AX2 A;  4KNV A;  4U9D A;  1ZZP A;  2ICW G;  1QZX A;  4MVR A;  4NTB A;  4P9F A;  1U0B B;  4EHP A;  3S27 A;  3AG4 C;  3C8G B;  4O79 A;  2BE5 F;  4K0D A;  4NTF A;  4OIQ F;  2WB7 A;  3UNG C;  4MS2 A;  3ATP A;  2MYS A;  3N0T A;  3AQC A;  1G5Z A;  3HNL A;  1CGO A;  4KI2 A;  4JTD B;  2P1A A;  1NFO A;  3WHN A;  4HFK B;  5KYY A;  1HW2 A;  1XZP A;  2D5R B;  1O5H A;  2LK4 A;  3ITF A;  4Q7C A;  3H2U A;  2XLV A;  3US6 A;  2EPN A;  1WOL A;  3EFO B;  5TJ5 E;  5COG A;  2Y39 A;  3U2L A;  4U5C E;  5L0F A;  4XTK A;  5FCL A;  5L0I A;  2RSE B;  4ULV A;  1ZHT A;  1E83 A;  3Q6N A;  2GAQ A;  1EQ1 A;  3AGT A;  2LFD A;  1CPR A;  4AL0 A;  3V7O A;  3RW0 A;  2I8B A;  3IQC A;  3TQO A;  1WAS A;  1M2V B;  1WGW A;  1Z23 A;  2CYD A;  1RKE A;  3HJC A;  3I5P A;  2ZXP A;  4YL0 A;  4C3B A;  3UGO A;  1DOV A;  3DMD A;  3N24 A;  3KKB A;  4CJO A;  2HFI A;  4U5D E;  1WAT A;  2ASR A;  2LQG A;  3O55 A;  4C7O B;  4CS9 C;  2CNW A;  2IXO A;  3K1I C;  2Q3T A;  3U2M A;  5KYW B;  3TUL A;  1IW7 F;  3HNJ A;  4J30 B;  4N6H A;  4QI2 A;  1C17 M;  1OKK A;  3CZ6 A;  1YJG A;  1OCZ C;  4PJM A;  2IBF A;  5CI9 A;  4MVU A;  4J32 B;  4NC3 A;  1IZM A;  1WWP A;  2ZXO A;  1J8M F;  3EQL F;  4L6R A;  3GM3 A;  3LNR A;  3B0U X;  1TWH A;  1A7D A;  2EIK C;  3JYY A;  3RFY A;  1FFT C;  4E7S A;  2B0J A;  2YL7 A;  5CI8 A;  4YK5 A;  2LIG A;  3LAY A;  2YRF A;  3HNK A;  1LM3 B;  4E0I A;  5AC5 A;  1OCO C;  2NUP B;  4G7Z F;  4OIR F;  3FHD A;  1C02 A;  1APC A;  1JPJ A;  3IQ5 A;  4IWB A;  4NCQ A;  1U6H A;  3GM2 A;  5HV9 A;  2VCB A;  4K7B A;  1PCX A;  2VC9 A;  3JSZ A;  4JC7 A;  1XZQ A;  3QVZ A;  2KJG A;  2R7T A;  1LI7 A;  3A11 A;  3C8G A;  2WZF A;  1T9K A;  1V4A A;  1JR8 A;  1NZE A;  3ZDL A;  4G0H A;  2KYH A;  1T6U A;  2CDQ A;  2YKZ A;  4EWC A;  3TD7 A;  1V54 C;  3MYF A;  3RQG A;  3TJ6 A;  1G4W R;  2KC3 A;  4PK4 A;  1V55 C;  1QQ3 A;  2QUP A;  2P6V A;  1NSG B;  3SXK A;  2XLH A;  1HMO A;  2WVQ A;  1OQC A;  4JW1 A;  1Z6A A;  4CDA A;  4GEH A;  4LLC A;  3VF0 A;  2NG1 A;  3EFO A;  3MX3 A;  5JRA A;  1UFB A;  5F5F A;  2OG2 A;  3LLK A;  3EH2 A;  3LNM B;  4ZLC A;  4JZA A;  3MBG A;  5L0G A;  1K04 A;  4JJF A;  1HW1 A;  4Q4Z F;  2QY9 A;  2CCY A;  1KNY A;  4IRU A;  3C8Z A;  1DOW A;  1A41 A;  2B0H A;  3QZC A;  1T01 A;  1RKE B;  2YLD A;  4KC9 A;  3S84 A;  4OD4 A;  1TFO B;  4BJ6 A;  1S7Z A;  4C7O A;  3NRH A;  3FAP B;  2XLO A;  3IPM O;  2P61 A;  3ECS A;  4JEB A;  4C3E A;  3K1H A;  5L3Q A;  3QMK A;  3U8P A;  3K7D A;  2V3C C;  1YVI A;  4XWJ A;  2JD3 A;  2RD9 A;  2UUH A;  4Z9I A;  1Q0G A;  4YT5 A;  4BPM A;  2LSE A;  1A7E A;  3DI5 A;  4U5G A;  3U0C A;  2OKU A;  4MTO A;  3GEI A;  1BBH A;  2DI3 A;  1YYX A;  5T3T A;  4IB4 A;  3NDB B;  3L1M A;  3RVZ A;  2NPU A;  3DAG A;  3RQF A;  4ER9 A;  4EUK B;  5DS4 A;  4HEA J;  3DAF A;  2XL6 A;  1AEP A;  3M79 A;  4DBR A;  2EPK X;  2EPM X;  4U5E E;  3T6G B;  2OOC A;  5KYW A;  2R7Q A;  4I3M A;  5DLJ A;  3S9O A;  3DM9 B;  2NUP A;  3ZTM A;  3C18 A;  1JMW A;  2G3V A;  2EPO A;  2MHR A;  3WAQ A;  1H9T A;  2WVN A;  1NFN A;  4JE9 A;  2DGJ A;  1TKN A;  2XL4 A;  1D0X A;  2J7P A;  2OJE D;  4XEF A;  3SXM A;  4Z9H A;  1E85 A;  1OW8 A;  1Y6D A;  3W2V A;  2PNO A;  5A6J A;  4R32 A;  2PF4 E;  4UDV A;  1FR0 A;  2OQM A;  4MVS A;  2IOQ A;  3U9M A;  4DRI B;  1EI7 A;  1M6T A;  4JIO A;  1LPE A;  2XSE A;  4E17 A;  5L0J A;  3ZC4 A;  3U3B A;  3RVY A;  2XLD A;  5AGF A;  4NQF A;  3EZI A;  4BJ5 C;  3ZVR A;  2BL2 A;  2HUJ A;  2HSB A;  3HKK A;  4DRJ B;  1FTS A;  3QTH A;  4CSA C;  1ZU5 A;  3AG2 C;  3F46 A;  2GWW A;  4CS8 C;  3ZQV A;  3UMK A;  3UGP A;  2R9R B;  3KH2 A;  3UR3 C;  5JT4 A;  1SYQ A;  1ZW2 A;  4JVS A;  3TJ5 A;  4JJG A;  1LKX A;  1Z63 A;  2H7V C;  3QW0 A;  4RBN A;  3H2V A;  4AE4 A;  1GM5 A;  2A6H F;  2J9B A;  2HJM A;  3HLZ A;  3L0I A;  2Q7R A;  5IY5 C;  1YA9 A;  3ZTZ A;  1O87 A;  2XS1 A;  2ZXW C;  5L0H A;  4G7H F;  1C03 A;  1OW7 A;  1VB5 A;  3JRT A;  3M15 A;  3NYM A;  4YT2 A;  1W2W A;  3S0X A;  2DYS C;  1M57 C;  1MNE A;  4P9T A;  3T9O A;  4GQH A;  5DS6 A;  1JRA A;  2MWQ A;  4HFF B;  1YZA A;  1I5N A;  3S90 A;  2L6F A;  3O6X A;  2LD6 A;  3HTK C;  1GQA A;  2CW0 F;  2LFF A;  3W8I A;  5COM A;  4KBL A;  2I15 A;  4DJ9 A;  3U5S A;  2J0W A;  2KW3 C;  1ZHW A;  3DZA A;  3MLG A;  3W4Y A;  1E2X A;  1F1M A;  2A69 F;  2IXM A;  5A6K A;  5BQG A;  3PDM P;  3N2Z B;  1BR1 A;  3GWN A;  4LDQ A;  2HSQ A;  4CX9 A;  1BR4 A;  3M4C A;  4XPY A;  5DQT A;  2Y3H A;  2YEV A;  3J06 A;  1H7I A;  3DD7 A;  4W8K A;  1ZHX A;  2VCC A;  1ZHY A;  2KSF A;  4DVY P;  3I5Q A;  4MVQ A;  1YAR O;  1S05 A;  1HE1 A;  3FOP A;  1HY5 A;  2OJQ A;  5A6B A;  1OXK A;  1RKC A;  1SR2 A;  2KQ9 A;  2VH3 A;  2HMQ A;  1ORY A;  2E87 A;  4YJW A;  5B1B C;  1GGQ A;  2VB6 A;  4MTG A;  1ZYR F;  1NBB A;  4J7T A;  1LE4 A;  1OCR C;  1YA7 O;  3ASN C;  2XLM A;  4JCZ A;  4JCH A;  5JLI A;  2H7B A;  4P6I C;  3LLI A;  1AUE A;  3B29 A;  2CNW D;  3ABL C;  4MVM A;  3NMK A;  1FMV A;  1YAU O;  4LAC B;  3SYN A;  1CGN A;  1MMD A;  3T6B A;  2R25 A;  4JTA B;  1VYK A;  2PFD A;  4LDK A;  1CGM E;  1YDI A;  3NG1 A;  2GA0 A;  1VOM A;  2YQY A;  3B71 A;  3JCU Q;  3AG1 C;  3JZ0 A;  3NKD A;  2YVK A;  3UMI A;  4BEM J;  3GOD A;  3FDQ A;  2C04 A;  3EHN A;  3NMI A;  1JPN A;  2YZS A;  3KPH A;  3R2P A;  3FMS A;  2EIN C;  2TMV P;  3C63 A;  4GYT A;  4OIO F;  1ZHZ A;  1PD0 A;  2EIL C;  3EJN A;  3E9V A;  2KK1 A;  3FOO A;  3SEO A;  3SXY A;  4W8P A;  1Q0K A;  2XLW A;  3GM1 A;  4X0R A;  4DVZ A;  4D4X A;  4YT8 A;  1E86 A;  4G7O F;  2R7R A;  4FES A;  1WN0 A;  4PFO A;  3VYW A;  2ZXR A;  1RJ9 B;  2Q4F A;  1VLS A;  1A7V A;  3CEX A;  4O7G A;  4PJN A;  3U8V A;  2G62 A;  3NKE A;  3NMJ A;  2JPU A;  1SZI A;  2WZL A;  4H4K C;  1MMN A;  3OA1 A;  3B9Q A;  4U5B E;  1D0Z A;  2IXP A;  2J45 A;  2Q9C A;  1TWC A;  3DJU B;  3EGX B;  2WL8 A;  4PJL A;  3G50 A;  3S29 A;  2R05 A;  3H65 A;  2W45 A;  2R03 A;  3DJN B;  4YWQ A;  4CIH A;  2WZG A;  3GWL A;  3C8G D;  3HNI A;  1M2O A;  3NYL A;  3NYJ A;  4IAR A;  4OIN F;  4EBJ A;  5E33 A;  1VYI A;  4O6M A;  1TQG A;  2W9Y A;  5A69 A;  3IEE A;  5DVW A;  1ORJ A;  4N06 A;  2CGE A;  1R4T A;  4XLP F;  2W4B A;  5E2Q A;  2XM4 A;  2OU6 A;  4Q5S F;  2G3K A;  1N1C A;  4B6I A;  2OEX A;  2DB4 A;  2KGO A;  1CPQ A;  2AP3 A;  1Z7Q c;  1I4Z A;  2HV6 A;  2UUI A;  3DM5 A;  1Z5Z A;  4BG0 A;  2XXA B;  1LI5 A;  2L81 A;  3EGD B;  2OCC C;  2A1D D;  1D1B A;  3GOR A;  3LEO A;  4LLE A;  4J7Y A;  1LE2 A;  4RDA A;  1OR3 A;  3WG7 C;  1E84 A;  3AJM A;  2Z15 A;  3AOU A;  2PBE A;  3VAY A;  3EH1 A;  5JS5 A;  2M4E A;  3DE9 A;  2AWY A;  3K6B A;  3MYI A;  5F28 E;  3UMH A;  4DRH B;  4A2N B;  1UG7 A;  1JAF A;  1D1C A;  2JX0 A;  3ABK C;  3CAX A;  2FFH A;  3F47 A;  4QDL A;  1ZVZ A;  1QVX A;  1V74 B;  2VAS A;  2X51 A;  4MQ9 F;  5BUO A;  2FAP B;  5A6A A;  2PP4 A;  4G78 A;  4IAQ A;  5JSL A;  1KU2 A;  2A0B A;  3KL4 A;  4U5F E;  1EKY A;  4ANJ A;  2FGY A;  2LCH A;  4NY3 A;  5B1A C;  2H7O A;  3ZIB A;  4JEA A;  1XWJ A;  2YLG A;  3Q6M A;  5L0C A;  3L8I A;  3JRM O;  2L6G A;  1ORS C;  3JT1 A;  3Q7G A;  2YHS A;  2IXN A;  2OEV A;  3L34 A;  5T3W A;  3GEE A;  3OEO A;  1MND A;  3VRC A;  3LS0 A;  5D92 A;  4BJ6 C;  1OR2 A;  3KMI A;  4LER A;  2AU5 A;  5GPG B;  3W2W A;  2QE9 A;  5B3S C;  4JKV A;  4DOZ A;  4DBQ A;  1AVO B;  2Q9A A;  1RJ9 A;  4YL3 A;  3ZG1 A;  3IHU A;  4CS9 A;  4F4B A;  1FNT c;  2ZPA A;  4E0H A;  1RXQ A;  3JSE O;  4U5H A;  2YWA A;  4ZLD A;  4YT4 A;  3DWW A;  3CQZ A;  2J7P D;  4JTC B;  5KYX A;  1OW6 A;  1NLX A;  2H8A A;  1PD1 A;  2Q9B A;  1QLE C;  3E70 C;  3EGX A;  2P0N A;  2XLE A;  3DKA A;  4PR9 A;  4BJT A;  1MMA A;  3BEH A;  3EPV A;  4PFP A;  3R7C A;  1JOG A;  2P7V A;  3T4R A;  3ZQY A;  4EBB A;  4I1O B;  1MQV A;  1WTY A;  4U9E A;  4MVO A;  1PV3 A;  3POV A;  1T6I A;  4H54 A;  3DXJ F;  1T6Q A;  3MFN A;  4CJG A;  4KNW A;  1LS4 A;  4PAC A;  1LIH A;  5JP7 A;  2R7U A;  3EG9 B;  3G4X A;  3PHF 2;  2J9V A;  2L6H A;  2M64 A;  1M56 C;  4QI0 A;  5FZT A;  4BJ1 A;  5CIV A;  3FAJ A;  4AK9 A;  2XXA A;  3EGD A;  4MTF A;  5L0D A;  4MVZ A;  2R02 A;  3LES A; 
#chains in the Genus database with same CATH homology
 4G78 A;  3IQT A;  2A0B A;  3MYF A;  2LCH A;  1Y6D A;  1YVI A;  1QSP A;  1OXK A;  1BDJ B;  1FR0 A;  1C03 A;  1SR2 A;  1WN0 A;  2Q4F A;  1C02 A;  3KYI A;  4EUK B;  1I5N A;  1A0B A;  2LP4 A;  2LD6 A;  3U3B A;  4PAC A;  3KYJ A;  2R25 A;  2OOC A;  3US6 A;  1OXB A;  1TQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...