1NFNA

Apolipoprotein e3 (apoe3)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
142
structure length
132
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQRLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords APOLIPOPROTEIN E3
publication title Novel mechanism for defective receptor binding of apolipoprotein E2 in type III hyperlipoproteinemia.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 132
sequence length 142
ec nomenclature
pdb deposition date 1996-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1nfnA00
1BZ4A 3S84A 1H7IA 3R2PA 1B68A 1OR3A 1OR2A 1LS4A 1NFNA 1NFOA 1YA9A 1LPEA 1GS9A 2KC3A 1AEPA 1LE4A 1LE2A 1EA8A 1EQ1A
chains in the Genus database with same CATH superfamily
3MX3A 1F1MA 4BJ5C 4MQ9F 5L0DA 4ANJA 1OW8A 2D5RB 3U8PA 4NTFA 3HTKC 4GQHA 2R7TA 1APCA 2ZPAA 3WODF 1QSPA 4K1OA 5B1BC 4BPMA 2KGOA 1BR1A 2BE5F 3MLGA 2HS5A 4J7TA 5B3IA 5BQGA 4Z9JA 2KQ9A 2R02A 3FOOA 3JTLO 3CEXA 5JLIA 3FVYA 2GDCA 2CYDA 1L3PA 1ZYRF 3CAXA 3JSEO 3EPVA 1Z7Qc 2Y3BA 3KYJA 5DS4A 4ZLDA 4JURI 4C3DA 2FAPB 1ORJA 1DOWA 5KYWB 3DD7A 1A41A 1I4ZA 3EG9B 3O55A 4KC9A 1YJGA 3L0IA 4LLEA 2J46A 1YA7O 3KL4A 3ZDLA 4DJ9A 5A6BD 2HZ8A 2L81A 2VB6A 3LEVA 4JKVA 3VM6A 3U0CA 2W45A 3N24A 2J9WA 1T6UA 4AE4B 4ULVA 1M2OA 4WABA 2CCYA 3DM9B 2J7PA 3G4ZA 5L0JA 1Q0DA 3JRTA 3R2PA 4H54A 3IQ5A 2ICWG 1RKCA 1LM3B 1UFBA 2A0BA 5HV9A 4NQFA 3POVA 1O87A 1QLEC 2A69F 3AG3C 3C8GB 3HNKA 1FMWA 3U5SA 3UGPA 1ZZPA 3IQCA 2VCCA 3G50A 4JCZA 1MMGA 5F5HA 2IXPA 4BJ6A 2JPUA 4CDAA 1HW2A 3AG4C 3RW0A 5E3CA 4OIOF 4HFFB 4XLNF 1Q0GA 1RKEA 1Y4CA 3KMIA 4XPWA 5GPGB 5L3QA 5AC4A 1XWJA 1EKYA 2IXNA 4XEVA 1MQVA 2XXAA 2ZXWC 1H6GA 2R7SA 4FWVA 1FNTc 2IOQA 4XEKA 3KYIA 5DVWA 4G7HF 3M4BA 1W2WA 3RFYA 1OQCA 4JE9A 2AWCA 2DI3A 2I8BA 4ULWA 4CSAC 4JEAA 3ZVRA 2NUPA 4O6NA 4G78A 1OCCC 2C03A 1BDJB 1O5HA 2V26A 3AJMA 1LKXA 1QKRA 2L7AA 2XM0A 4MW8A 4JJGA 4D4XA 4CIPA 3A9CA 4C3BA 2V3CC 5HSWA 1QVXA 3TK0A 1ORYA 4Z9HA 2L6FA 1WTYA 5DLJA 5EHHA 3DE9A 2HSQA 3ATPA 3HKKA 4NCQA 4E17A 3NYMA 1JPNA 1SYQA 2X0CA 3VRCA 2XLVA 5JS5A 2J9UA 3TJ6A 2WZFA 1Z23A 2I15A 4IAOA 4U5DE 5CI8A 3ZQVA 4ER9A 3G4XA 2X51A 1OXBA 1LE2A 2WVNA 1Z5ZA 4DRHB 4BG0A 1CPRA 5BQHA 1M2VA 2ASRA 2W4MA 1T01A 4YL0A 3TOLA 3IEEA 2O9XA 1VLSA 1ST6A 3C8GA 3WAQA 4AK9A 1MNEA 5CIVA 4PJNA 5B3SC 2G3VA 2NUTB 4ONSA 4EBJA 1VTMP 3K66A 3JCUQ 2WZGA 4PR9A 3S90A 1NBBA 1OKKD 1Q0MA 1S05A 2R7QA 2CNWD 1YVIA 1CGME 4CS8C 1J8YF 2YLIA 4E0IA 1Z63A 3LAYA 1H9GA 5COFA 1BR2A 4LERA 1G5ZA 1TWAA 2LFDA 2R7OA 1V55C 3QZCA 4B6IA 3C63A 1HE1A 3OWTA 3E9VA 1JAFA 1LIHA 4HE8D 4J30B 3SEOA 4DBRA 3DM5A 4JW1A 1G8XA 3LS1A 1YYXA 3W8IA 1GS9A 3DWWA 2D4UA 3GODA 4XTKA 2DYRC 3N0TA 1R4TA 2KC3A 2IXOA 2NSFA 1RCPA 4XQ1A 2MYSA 2LIGA 3NKEA 1ZU4A 2EPKX 3MFNA 3QVZA 4DVYP 5K0IA 3RVZA 2R7VA 4DRIB 3I5PA 3U9MA 2Y3HA 1NLXA 2R7UA 1KNYA 2XLWA 2IBFA 1NU9C 3FAPB 2YHSA 3ABMC 3RF3A 4IWBA 3E70C 2LP4A 2XRHA 2A68F 3S29A 1VLTA 3CSKA 3T4RA 2L6HA 2EIJC 2J9VA 2OOCA 5COMA 1MMAA 4CJGA 1WOLA 2KYHA 1OCZC 1ZHYA 256BA 3S9OA 3FDQA 2QNLA 2LQGA 4OINF 1BR4A 4O6YA 5A6BA 4CS9A 1ZHTA 4JTDB 4MTGA 2J45A 5T3WA 2YZSA 4GEHA 1VYIA 1RKEB 1ZHZA 3JRMO 5DQZA 4A4AA 3EH2A 3W4YA 2R7RA 2XXAB 1YDIA 1EA8A 1QPUA 4YL1A 2YLDA 3O10A 1EQ1A 3DMDA 4E18A 2G62A 3JT1A 3AQBA 2ZXRA 3ZQYA 1LI7A 4YT5A 4AL1A 5EGYA 3QW0A 1K40A 3SYNA 5BQIA 1VOMA 2HSBA 4XWJA 4NC3A 2G3KA 3DXJF 3EGDA 3I4UA 2NUPB 3SNHA 1GM5A 2RD9A 4LDRA 3FXHA 4W8KA 1MMDA 2QE9A 3KPHA 3U9JA 1RXQA 4XLPF 1PV3A 1D0YA 1FFHA 4KNVA 3DJNB 4PJJA 1JMWA 1HW1A 3H65A 2WB7A 3GEEA 1NFNA 5EK0A 3PHF2 1LPEA 4CX9A 1EI7A 4CS7A 3M79A 2OKUA 3AQCA 4YT8A 3GEIA 2YWAA 3T6GB 3SZRA 1LE4A 2HJMA 3SP1A 1OW7A 4P9FA 3ZC4A 5KYYA 1U6HA 2YRFA 1SF8A 4QI0A 2M4EA 3N2ZB 1ZHXA 3LESA 1YYJA 5E2QA 3UGOA 3LEOA 1S7ZA 4MVQA 2PF4E 4RDAA 2OG2A 2MHRA 3Q6NA 4MVMA 1M2VB 1YZCA 1E85A 2XLOA 5L0IA 2VASA 1YZAA 3TOMA 1JOGA 1HY5A 2CGEA 3HNJA 4N06A 3C18A 4U9DA 2ZD9A 2KK1A 4YK5A 4BEJA 1BBHA 1NG1A 1LI5A 4IARA 3EZHA 5JRAA 2J9BA 2R7XA 3ZG1A 1XZQA 4MVOA 3SXMA 4IB4A 3V7OA 2XLMA 1G4WR 1JR8A 3ITFA 1YA9A 3RQGA 2EPOA 5COGA 1NU7D 1YLMA 3PDMP 2GWWA 3V5ZA 5A6JA 5KYNA 3FMSA 3Q6MA 5KYUA 1D0XA 1I4YA 2P61A 4KBLA 4E0HA 4CIHA 4C7OA 1OKKA 1D1BA 2CNWA 3W8HA 3WG7C 5F5FA 2AU5A 5BUOA 3K7DA 2EINC 1RJ9A 4Q5SF 3T6BA 4M63A 1Z6AA 1Y6DA 3UMKA 4JCHA 2ZXPA 4LDQA 2XL6A 2AVKA 2IXMA 2R03A 4JC7A 3GM2A 1U89A 1L7CA 1LVKA 4NTAA 4HFKB 1TQGA 3LNMB 3V5XA 4C3EA 2C04A 4JVSA 3I5QA 1OR2A 3HLZA 2A6EF 4R32A 4U5EE 1K04A 2CDQA 2QY9A 5DS5A 2L6GA 2WVQA 1SMYF 2EILC 2B0JA 2WVOA 3EHMA 3EHNA 3EJNA 2PX3A 4XPYA 4JTCB 3RQEA 4N6CA 2J0WA 3KH2A 2P6VA 1Q0FA 2GFHA 3GORA 4I1MA 4IAQA 2GA0A 2KW3C 3NMIA 3LUTB 2RSEB 3AGTA 3FAJA 4NTBA 2QLAA 4YL3A 3S27A 2LSEA 1YARO 1VYKA 1FFTC 2WZLA 2ZXOA 3NG1A 4IGGA 1BZ4A 1NSGB 3C8ZA 3OEOA 2LFFA 3MYFA 1GGQA 1OR3A 2OQMA 3NMKA 1WASA 3SXZA 5L0CA 4BJ6C 1T5OA 4N6HA 1CPQA 3U2MA 4OIPF 2HFIA 2YLGA 3K6BA 3ZWIA 4G7OF 3EGXA 3EGDB 1HMOA 4E7SA 4JIOA 1KTMA 5AC5A 2XS1A 4PACA 1PCXA 1ZW3A 2HKVA 3GWNA 3RH3A 4CDVA 4DVZA 3OA1A 5KYXA 2HV6A 4OIQF 1WWPA 3TQOA 2VCBA 3B0UX 1AEPA 1JPJA 5FCLA 5L0FA 4PJMA 4PK4A 1K05A 3LJBA 4P6IC 4G7ZF 2A0UA 1V4AA 1MNDA 3ABLC 3TD7A 1GQAA 1IZMA 2Y69C 1PD0A 4U5FE 3S84A 3U3BA 4BJ5A 5KYYB 1A7DA 3PCVA 1IW7F 2CW0F 3S0XA 2J0XA 4U9EA 1TWHA 2JX0A 5TJ5E 2VCAA 2QUPA 3GM1A 1TFKB 4I1OB 3T9OA 4OIRF 3QW1A 2PFDA 3U8VA 2XS8A 2B0HA 1FMVA 4WGYA 2Q3TA 1HMDA 3T6JA 2ETSA 4K0DA 3SXYA 1U0BB 4XPXA 2XL4A 2R05A 3LLIA 3RVYA 4D4NA 1T6IA 2YL3A 4O6MA 2Q9BA 1KU2A 1V54C 3H2VA 1D1CA 5KYUB 2EPMX 4NY3A 4C7OB 3NMJA 2EPNA 5L0HA 2XLDA 2R9RB 4EBKA 4ZLCA 2Q9AA 3EH1A 2Y39A 4L6RA 2FGYA 1B68A 1O3UA 1WGWA 3CZ6A 2YL1A 4Q7CA 1RJ9B 1FR0A 3KKBA 4EKWA 3U2LA 3LS0A 1YAUO 3UMIA 1M57C 3C8GD 4OD4A 2MWQA 1OCRC 4F4BA 1J8MF 3DAFA 2A6HF 4YN0B 4YT2A 1VK5A 1AVOB 1FAPB 3HNLA 1NFOA 3EQLF 2Z15A 4U5GA 5A6AA 2NSGA 4H4KC 3ASNC 3K1HA 4Z9IA 3AG2C 3IQTA 3TJ5A 3V5YA 3B29A 2J8WA 5A69A 4J7YA 4XEFA 4RBNA 1TWGA 2A1DD 3M4CA 3B9QA 3R7CA 1ZHWA 1OW6A 2XL8A 4CSAA 2YL0A 2NG1A 4CJOA 4BJ1A 2OEVA 2F22A 2NPUA 3K1IC 4FAPB 1WATA 2Q00A 4O7GA 3EFOA 5CI9A 3NKDA 4MTOA 1D0ZA 2PP4A 2OEXA 1A7EA 4BJTA 2HJ3A 2QTVA 4PJLA 4MVUA 2XSEA 5D92A 4DRJB 4LACB 5L0GA 2XLHA 1R5ID 4IRUA 4CS9C 3GEHA 3RYLA 4AL0A 4MTFA 2EPLX 5JUAA 4G0HA 1TR2A 2HMZA 3L1MA 5JVEA 1V74B 3EGXB 4MNDA 4E7ZA 1XZPA 3VF0A 2DB4A 5AGFA 1SZIA 2KJGA 2P7VA 1Z3IX 2Q4FA 4DOZA 1RMVA 5KYXB 1UG7A 3B0VC 2DGJA 4U5CE 4EBBA 2HMQA 5E33A 1H7IA 3Q7GA 1PD1A 4JZAA 5F28E 1HE9A 2P0NA 4I3MA 1I5NA 3PMRA 2OJED 3AOUA 3UNGC 2W4BA 5DS6A 2M64A 3A11A 5T3TA 3SXKA 5JP7A 2IM8A 1TKNA 5D91A 2H7BA 4LDKA 3S28A 3QVYA 1T9KA 4CS8A 3M15A 2LK4A 4JEBA 4LLCA 1E84A 3RIPA 2YQYA 4J32B 1C02A 4WJ0A 4JRZA 1JRAA 3C7JA 3DE8A 2LCHA 2AP3A 3CQZA 3IHUA 1D1AA 4MW3A 1FTSA 1Q0KA 1ZU5A 4FX5A 2UUIA 3LNRA 4MVZA 1A7VA 5JT4A 5FZTA 1WN0A 2OU6A 3ECSA 3LLKA 3GM3A 2GAQA 1AUEA 3DI5A 3QMKA 1ZVZA 3RQFA 3US6A 2BC5A 2AWYA 2PX0A 3WHNA 2OCCC 4KI2A 3NYLA 1E2XA 1OCOC 3GWLA 4KNWA 1LS1A 4GYTA 2PNOA 3AG1C 3L34A 3Q7LA 4QDLA 5E3AA 3UMHA 3ZIBA 2HUJA 2Q9CA 3X1OA 1M56C 1TFOB 3VAYA 2XLEA 1C03A 4P9TA 1ZW2A 4WGZA 1A0BA 3ZSUA 1N1CA 2J7PD 2Q7RA 3NDBB 1T6QA 3VYWA 2KSFA 5KYWA 4HEAJ 3EG9A 4U5BE 2UUHA 3F46A 3JYYA 3W2WA 2H7VC 4AE4A 2FFHA 3ZTMA 4CBEA 4FESA 4PFPA 4K7BA 4DBQA 3ZTZA 4UDVA 3MYIA 3RKOF 2R7WA 3HNIA 4MVRA 3IQ6A 4MS2A 4MVSA 5T1DB 4QI2A 4BEMJ 3B0PA 3EZIA 5B1AC 1H9TA 1SR2A 2Y3GA 3MBGA 2KNHA 1DOVA 4YWQA 1CGOA 4EIYA 5IY5C 1OXKA 3O39A 2VH3A 1G4US 4EWCA 4N4WA 2H7OA 1LS4A 3EFOB 3K33A 3JZ0A 5L3VA 1E83A 1QQ3A 3L8IA 3NRHA 4I44A 3DJUB 2Y3DA 3TULA 2IYLD 4OD5A 2WL8A 2R25A 2YL7A 3JYHA 1MMNA 2P1AA 3H2UA 4U5HA 3U3FA 1E86A 4Q4ZF 3FHDA 3DZAA 2YKZA 4RD9A 4JJFA 3X2QC 2VC9A 3GANA 4DXWA 3B71A 5DQTA 3O6XA 4IJJA 2EIKC 3ASOC 3HJCA 3DAGA 1TWCA 2YVKA 4PFOA 3K1IA 3M1CB 4O79A 2W9YA 4YJWA 4EHPA 2PBEA 3NYJA 1NZEA 1CGNA 4JTAB 4W8PA 3W2VA 4CDYA 4YT4A 3BRJA 2L9JA 3L8JA 2LD6A 3JSZA 3DKAA 2JD3A 2E87A 2HV7A 3AGUA 2YEVA 3ABKC 2OJQA 3F47A 4AX2A 5A6KA 1M6TA 1VB5A 3C62A 1ORSC 2XM4A 5JSLA 3UR3C 4A2NB 3BEHA 3J06A 2H8AA 3QTHA 4EUKB 1C17M 1QZXA 4X0RA 2NUTA 2TMVP 2EIMC 2DYSC 3IPMO 2BL2A 3FOPA 1VMAA
chains in the Genus database with same CATH topology
1BZ4A 3S84A 1H7IA 3R2PA 1B68A 1OR3A 1OR2A 1LS4A 1NFNA 1NFOA 1YA9A 1LPEA 1GS9A 2KC3A 1AEPA 1LE4A 1LE2A 1EA8A 1EQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BZ4 A;  3S84 A;  1H7I A;  3R2P A;  1B68 A;  1OR3 A;  1OR2 A;  1LS4 A;  1NFN A;  1NFO A;  1YA9 A;  1LPE A;  1GS9 A;  2KC3 A;  1AEP A;  1LE4 A;  1LE2 A;  1EA8 A;  1EQ1 A; 
#chains in the Genus database with same CATH topology
 3MX3 A;  1F1M A;  4BJ5 C;  4MQ9 F;  5L0D A;  4ANJ A;  1OW8 A;  2D5R B;  3U8P A;  4NTF A;  3HTK C;  4GQH A;  2R7T A;  1APC A;  2ZPA A;  3WOD F;  1QSP A;  4K1O A;  5B1B C;  4BPM A;  2KGO A;  1BR1 A;  2BE5 F;  3MLG A;  2HS5 A;  4J7T A;  5B3I A;  5BQG A;  4Z9J A;  2KQ9 A;  2R02 A;  3FOO A;  3JTL O;  3CEX A;  5JLI A;  3FVY A;  2GDC A;  2CYD A;  1L3P A;  1ZYR F;  3CAX A;  3JSE O;  3EPV A;  1Z7Q c;  2Y3B A;  3KYJ A;  5DS4 A;  4ZLD A;  4JUR I;  4C3D A;  2FAP B;  1ORJ A;  1DOW A;  5KYW B;  3DD7 A;  1A41 A;  1I4Z A;  3EG9 B;  3O55 A;  4KC9 A;  1YJG A;  3L0I A;  4LLE A;  2J46 A;  1YA7 O;  3KL4 A;  3ZDL A;  4DJ9 A;  5A6B D;  2HZ8 A;  2L81 A;  2VB6 A;  3LEV A;  4JKV A;  3VM6 A;  3U0C A;  2W45 A;  3N24 A;  2J9W A;  1T6U A;  4AE4 B;  4ULV A;  1M2O A;  4WAB A;  2CCY A;  3DM9 B;  2J7P A;  3G4Z A;  5L0J A;  1Q0D A;  3JRT A;  3R2P A;  4H54 A;  3IQ5 A;  2ICW G;  1RKC A;  1LM3 B;  1UFB A;  2A0B A;  5HV9 A;  4NQF A;  3POV A;  1O87 A;  1QLE C;  2A69 F;  3AG3 C;  3C8G B;  3HNK A;  1FMW A;  3U5S A;  3UGP A;  1ZZP A;  3IQC A;  2VCC A;  3G50 A;  4JCZ A;  1MMG A;  5F5H A;  2IXP A;  4BJ6 A;  2JPU A;  4CDA A;  1HW2 A;  3AG4 C;  3RW0 A;  5E3C A;  4OIO F;  4HFF B;  4XLN F;  1Q0G A;  1RKE A;  1Y4C A;  3KMI A;  4XPW A;  5GPG B;  5L3Q A;  5AC4 A;  1XWJ A;  1EKY A;  2IXN A;  4XEV A;  1MQV A;  2XXA A;  2ZXW C;  1H6G A;  2R7S A;  4FWV A;  1FNT c;  2IOQ A;  4XEK A;  3KYI A;  5DVW A;  4G7H F;  3M4B A;  1W2W A;  3RFY A;  1OQC A;  4JE9 A;  2AWC A;  2DI3 A;  2I8B A;  4ULW A;  4CSA C;  4JEA A;  3ZVR A;  2NUP A;  4O6N A;  4G78 A;  1OCC C;  2C03 A;  1BDJ B;  1O5H A;  2V26 A;  3AJM A;  1LKX A;  1QKR A;  2L7A A;  2XM0 A;  4MW8 A;  4JJG A;  4D4X A;  4CIP A;  3A9C A;  4C3B A;  2V3C C;  5HSW A;  1QVX A;  3TK0 A;  1ORY A;  4Z9H A;  2L6F A;  1WTY A;  5DLJ A;  5EHH A;  3DE9 A;  2HSQ A;  3ATP A;  3HKK A;  4NCQ A;  4E17 A;  3NYM A;  1JPN A;  1SYQ A;  2X0C A;  3VRC A;  2XLV A;  5JS5 A;  2J9U A;  3TJ6 A;  2WZF A;  1Z23 A;  2I15 A;  4IAO A;  4U5D E;  5CI8 A;  3ZQV A;  4ER9 A;  3G4X A;  2X51 A;  1OXB A;  1LE2 A;  2WVN A;  1Z5Z A;  4DRH B;  4BG0 A;  1CPR A;  5BQH A;  1M2V A;  2ASR A;  2W4M A;  1T01 A;  4YL0 A;  3TOL A;  3IEE A;  2O9X A;  1VLS A;  1ST6 A;  3C8G A;  3WAQ A;  4AK9 A;  1MNE A;  5CIV A;  4PJN A;  5B3S C;  2G3V A;  2NUT B;  4ONS A;  4EBJ A;  1VTM P;  3K66 A;  3JCU Q;  2WZG A;  4PR9 A;  3S90 A;  1NBB A;  1OKK D;  1Q0M A;  1S05 A;  2R7Q A;  2CNW D;  1YVI A;  1CGM E;  4CS8 C;  1J8Y F;  2YLI A;  4E0I A;  1Z63 A;  3LAY A;  1H9G A;  5COF A;  1BR2 A;  4LER A;  1G5Z A;  1TWA A;  2LFD A;  2R7O A;  1V55 C;  3QZC A;  4B6I A;  3C63 A;  1HE1 A;  3OWT A;  3E9V A;  1JAF A;  1LIH A;  4HE8 D;  4J30 B;  3SEO A;  4DBR A;  3DM5 A;  4JW1 A;  1G8X A;  3LS1 A;  1YYX A;  3W8I A;  1GS9 A;  3DWW A;  2D4U A;  3GOD A;  4XTK A;  2DYR C;  3N0T A;  1R4T A;  2KC3 A;  2IXO A;  2NSF A;  1RCP A;  4XQ1 A;  2MYS A;  2LIG A;  3NKE A;  1ZU4 A;  2EPK X;  3MFN A;  3QVZ A;  4DVY P;  5K0I A;  3RVZ A;  2R7V A;  4DRI B;  3I5P A;  3U9M A;  2Y3H A;  1NLX A;  2R7U A;  1KNY A;  2XLW A;  2IBF A;  1NU9 C;  3FAP B;  2YHS A;  3ABM C;  3RF3 A;  4IWB A;  3E70 C;  2LP4 A;  2XRH A;  2A68 F;  3S29 A;  1VLT A;  3CSK A;  3T4R A;  2L6H A;  2EIJ C;  2J9V A;  2OOC A;  5COM A;  1MMA A;  4CJG A;  1WOL A;  2KYH A;  1OCZ C;  1ZHY A;  256B A;  3S9O A;  3FDQ A;  2QNL A;  2LQG A;  4OIN F;  1BR4 A;  4O6Y A;  5A6B A;  4CS9 A;  1ZHT A;  4JTD B;  4MTG A;  2J45 A;  5T3W A;  2YZS A;  4GEH A;  1VYI A;  1RKE B;  1ZHZ A;  3JRM O;  5DQZ A;  4A4A A;  3EH2 A;  3W4Y A;  2R7R A;  2XXA B;  1YDI A;  1EA8 A;  1QPU A;  4YL1 A;  2YLD A;  3O10 A;  1EQ1 A;  3DMD A;  4E18 A;  2G62 A;  3JT1 A;  3AQB A;  2ZXR A;  3ZQY A;  1LI7 A;  4YT5 A;  4AL1 A;  5EGY A;  3QW0 A;  1K40 A;  3SYN A;  5BQI A;  1VOM A;  2HSB A;  4XWJ A;  4NC3 A;  2G3K A;  3DXJ F;  3EGD A;  3I4U A;  2NUP B;  3SNH A;  1GM5 A;  2RD9 A;  4LDR A;  3FXH A;  4W8K A;  1MMD A;  2QE9 A;  3KPH A;  3U9J A;  1RXQ A;  4XLP F;  1PV3 A;  1D0Y A;  1FFH A;  4KNV A;  3DJN B;  4PJJ A;  1JMW A;  1HW1 A;  3H65 A;  2WB7 A;  3GEE A;  1NFN A;  5EK0 A;  3PHF 2;  1LPE A;  4CX9 A;  1EI7 A;  4CS7 A;  3M79 A;  2OKU A;  3AQC A;  4YT8 A;  3GEI A;  2YWA A;  3T6G B;  3SZR A;  1LE4 A;  2HJM A;  3SP1 A;  1OW7 A;  4P9F A;  3ZC4 A;  5KYY A;  1U6H A;  2YRF A;  1SF8 A;  4QI0 A;  2M4E A;  3N2Z B;  1ZHX A;  3LES A;  1YYJ A;  5E2Q A;  3UGO A;  3LEO A;  1S7Z A;  4MVQ A;  2PF4 E;  4RDA A;  2OG2 A;  2MHR A;  3Q6N A;  4MVM A;  1M2V B;  1YZC A;  1E85 A;  2XLO A;  5L0I A;  2VAS A;  1YZA A;  3TOM A;  1JOG A;  1HY5 A;  2CGE A;  3HNJ A;  4N06 A;  3C18 A;  4U9D A;  2ZD9 A;  2KK1 A;  4YK5 A;  4BEJ A;  1BBH A;  1NG1 A;  1LI5 A;  4IAR A;  3EZH A;  5JRA A;  2J9B A;  2R7X A;  3ZG1 A;  1XZQ A;  4MVO A;  3SXM A;  4IB4 A;  3V7O A;  2XLM A;  1G4W R;  1JR8 A;  3ITF A;  1YA9 A;  3RQG A;  2EPO A;  5COG A;  1NU7 D;  1YLM A;  3PDM P;  2GWW A;  3V5Z A;  5A6J A;  5KYN A;  3FMS A;  3Q6M A;  5KYU A;  1D0X A;  1I4Y A;  2P61 A;  4KBL A;  4E0H A;  4CIH A;  4C7O A;  1OKK A;  1D1B A;  2CNW A;  3W8H A;  3WG7 C;  5F5F A;  2AU5 A;  5BUO A;  3K7D A;  2EIN C;  1RJ9 A;  4Q5S F;  3T6B A;  4M63 A;  1Z6A A;  1Y6D A;  3UMK A;  4JCH A;  2ZXP A;  4LDQ A;  2XL6 A;  2AVK A;  2IXM A;  2R03 A;  4JC7 A;  3GM2 A;  1U89 A;  1L7C A;  1LVK A;  4NTA A;  4HFK B;  1TQG A;  3LNM B;  3V5X A;  4C3E A;  2C04 A;  4JVS A;  3I5Q A;  1OR2 A;  3HLZ A;  2A6E F;  4R32 A;  4U5E E;  1K04 A;  2CDQ A;  2QY9 A;  5DS5 A;  2L6G A;  2WVQ A;  1SMY F;  2EIL C;  2B0J A;  2WVO A;  3EHM A;  3EHN A;  3EJN A;  2PX3 A;  4XPY A;  4JTC B;  3RQE A;  4N6C A;  2J0W A;  3KH2 A;  2P6V A;  1Q0F A;  2GFH A;  3GOR A;  4I1M A;  4IAQ A;  2GA0 A;  2KW3 C;  3NMI A;  3LUT B;  2RSE B;  3AGT A;  3FAJ A;  4NTB A;  2QLA A;  4YL3 A;  3S27 A;  2LSE A;  1YAR O;  1VYK A;  1FFT C;  2WZL A;  2ZXO A;  3NG1 A;  4IGG A;  1BZ4 A;  1NSG B;  3C8Z A;  3OEO A;  2LFF A;  3MYF A;  1GGQ A;  1OR3 A;  2OQM A;  3NMK A;  1WAS A;  3SXZ A;  5L0C A;  4BJ6 C;  1T5O A;  4N6H A;  1CPQ A;  3U2M A;  4OIP F;  2HFI A;  2YLG A;  3K6B A;  3ZWI A;  4G7O F;  3EGX A;  3EGD B;  1HMO A;  4E7S A;  4JIO A;  1KTM A;  5AC5 A;  2XS1 A;  4PAC A;  1PCX A;  1ZW3 A;  2HKV A;  3GWN A;  3RH3 A;  4CDV A;  4DVZ A;  3OA1 A;  5KYX A;  2HV6 A;  4OIQ F;  1WWP A;  3TQO A;  2VCB A;  3B0U X;  1AEP A;  1JPJ A;  5FCL A;  5L0F A;  4PJM A;  4PK4 A;  1K05 A;  3LJB A;  4P6I C;  4G7Z F;  2A0U A;  1V4A A;  1MND A;  3ABL C;  3TD7 A;  1GQA A;  1IZM A;  2Y69 C;  1PD0 A;  4U5F E;  3S84 A;  3U3B A;  4BJ5 A;  5KYY B;  1A7D A;  3PCV A;  1IW7 F;  2CW0 F;  3S0X A;  2J0X A;  4U9E A;  1TWH A;  2JX0 A;  5TJ5 E;  2VCA A;  2QUP A;  3GM1 A;  1TFK B;  4I1O B;  3T9O A;  4OIR F;  3QW1 A;  2PFD A;  3U8V A;  2XS8 A;  2B0H A;  1FMV A;  4WGY A;  2Q3T A;  1HMD A;  3T6J A;  2ETS A;  4K0D A;  3SXY A;  1U0B B;  4XPX A;  2XL4 A;  2R05 A;  3LLI A;  3RVY A;  4D4N A;  1T6I A;  2YL3 A;  4O6M A;  2Q9B A;  1KU2 A;  1V54 C;  3H2V A;  1D1C A;  5KYU B;  2EPM X;  4NY3 A;  4C7O B;  3NMJ A;  2EPN A;  5L0H A;  2XLD A;  2R9R B;  4EBK A;  4ZLC A;  2Q9A A;  3EH1 A;  2Y39 A;  4L6R A;  2FGY A;  1B68 A;  1O3U A;  1WGW A;  3CZ6 A;  2YL1 A;  4Q7C A;  1RJ9 B;  1FR0 A;  3KKB A;  4EKW A;  3U2L A;  3LS0 A;  1YAU O;  3UMI A;  1M57 C;  3C8G D;  4OD4 A;  2MWQ A;  1OCR C;  4F4B A;  1J8M F;  3DAF A;  2A6H F;  4YN0 B;  4YT2 A;  1VK5 A;  1AVO B;  1FAP B;  3HNL A;  1NFO A;  3EQL F;  2Z15 A;  4U5G A;  5A6A A;  2NSG A;  4H4K C;  3ASN C;  3K1H A;  4Z9I A;  3AG2 C;  3IQT A;  3TJ5 A;  3V5Y A;  3B29 A;  2J8W A;  5A69 A;  4J7Y A;  4XEF A;  4RBN A;  1TWG A;  2A1D D;  3M4C A;  3B9Q A;  3R7C A;  1ZHW A;  1OW6 A;  2XL8 A;  4CSA A;  2YL0 A;  2NG1 A;  4CJO A;  4BJ1 A;  2OEV A;  2F22 A;  2NPU A;  3K1I C;  4FAP B;  1WAT A;  2Q00 A;  4O7G A;  3EFO A;  5CI9 A;  3NKD A;  4MTO A;  1D0Z A;  2PP4 A;  2OEX A;  1A7E A;  4BJT A;  2HJ3 A;  2QTV A;  4PJL A;  4MVU A;  2XSE A;  5D92 A;  4DRJ B;  4LAC B;  5L0G A;  2XLH A;  1R5I D;  4IRU A;  4CS9 C;  3GEH A;  3RYL A;  4AL0 A;  4MTF A;  2EPL X;  5JUA A;  4G0H A;  1TR2 A;  2HMZ A;  3L1M A;  5JVE A;  1V74 B;  3EGX B;  4MND A;  4E7Z A;  1XZP A;  3VF0 A;  2DB4 A;  5AGF A;  1SZI A;  2KJG A;  2P7V A;  1Z3I X;  2Q4F A;  4DOZ A;  1RMV A;  5KYX B;  1UG7 A;  3B0V C;  2DGJ A;  4U5C E;  4EBB A;  2HMQ A;  5E33 A;  1H7I A;  3Q7G A;  1PD1 A;  4JZA A;  5F28 E;  1HE9 A;  2P0N A;  4I3M A;  1I5N A;  3PMR A;  2OJE D;  3AOU A;  3UNG C;  2W4B A;  5DS6 A;  2M64 A;  3A11 A;  5T3T A;  3SXK A;  5JP7 A;  2IM8 A;  1TKN A;  5D91 A;  2H7B A;  4LDK A;  3S28 A;  3QVY A;  1T9K A;  4CS8 A;  3M15 A;  2LK4 A;  4JEB A;  4LLC A;  1E84 A;  3RIP A;  2YQY A;  4J32 B;  1C02 A;  4WJ0 A;  4JRZ A;  1JRA A;  3C7J A;  3DE8 A;  2LCH A;  2AP3 A;  3CQZ A;  3IHU A;  1D1A A;  4MW3 A;  1FTS A;  1Q0K A;  1ZU5 A;  4FX5 A;  2UUI A;  3LNR A;  4MVZ A;  1A7V A;  5JT4 A;  5FZT A;  1WN0 A;  2OU6 A;  3ECS A;  3LLK A;  3GM3 A;  2GAQ A;  1AUE A;  3DI5 A;  3QMK A;  1ZVZ A;  3RQF A;  3US6 A;  2BC5 A;  2AWY A;  2PX0 A;  3WHN A;  2OCC C;  4KI2 A;  3NYL A;  1E2X A;  1OCO C;  3GWL A;  4KNW A;  1LS1 A;  4GYT A;  2PNO A;  3AG1 C;  3L34 A;  3Q7L A;  4QDL A;  5E3A A;  3UMH A;  3ZIB A;  2HUJ A;  2Q9C A;  3X1O A;  1M56 C;  1TFO B;  3VAY A;  2XLE A;  1C03 A;  4P9T A;  1ZW2 A;  4WGZ A;  1A0B A;  3ZSU A;  1N1C A;  2J7P D;  2Q7R A;  3NDB B;  1T6Q A;  3VYW A;  2KSF A;  5KYW A;  4HEA J;  3EG9 A;  4U5B E;  2UUH A;  3F46 A;  3JYY A;  3W2W A;  2H7V C;  4AE4 A;  2FFH A;  3ZTM A;  4CBE A;  4FES A;  4PFP A;  4K7B A;  4DBQ A;  3ZTZ A;  4UDV A;  3MYI A;  3RKO F;  2R7W A;  3HNI A;  4MVR A;  3IQ6 A;  4MS2 A;  4MVS A;  5T1D B;  4QI2 A;  4BEM J;  3B0P A;  3EZI A;  5B1A C;  1H9T A;  1SR2 A;  2Y3G A;  3MBG A;  2KNH A;  1DOV A;  4YWQ A;  1CGO A;  4EIY A;  5IY5 C;  1OXK A;  3O39 A;  2VH3 A;  1G4U S;  4EWC A;  4N4W A;  2H7O A;  1LS4 A;  3EFO B;  3K33 A;  3JZ0 A;  5L3V A;  1E83 A;  1QQ3 A;  3L8I A;  3NRH A;  4I44 A;  3DJU B;  2Y3D A;  3TUL A;  2IYL D;  4OD5 A;  2WL8 A;  2R25 A;  2YL7 A;  3JYH A;  1MMN A;  2P1A A;  3H2U A;  4U5H A;  3U3F A;  1E86 A;  4Q4Z F;  3FHD A;  3DZA A;  2YKZ A;  4RD9 A;  4JJF A;  3X2Q C;  2VC9 A;  3GAN A;  4DXW A;  3B71 A;  5DQT A;  3O6X A;  4IJJ A;  2EIK C;  3ASO C;  3HJC A;  3DAG A;  1TWC A;  2YVK A;  4PFO A;  3K1I A;  3M1C B;  4O79 A;  2W9Y A;  4YJW A;  4EHP A;  2PBE A;  3NYJ A;  1NZE A;  1CGN A;  4JTA B;  4W8P A;  3W2V A;  4CDY A;  4YT4 A;  3BRJ A;  2L9J A;  3L8J A;  2LD6 A;  3JSZ A;  3DKA A;  2JD3 A;  2E87 A;  2HV7 A;  3AGU A;  2YEV A;  3ABK C;  2OJQ A;  3F47 A;  4AX2 A;  5A6K A;  1M6T A;  1VB5 A;  3C62 A;  1ORS C;  2XM4 A;  5JSL A;  3UR3 C;  4A2N B;  3BEH A;  3J06 A;  2H8A A;  3QTH A;  4EUK B;  1C17 M;  1QZX A;  4X0R A;  2NUT A;  2TMV P;  2EIM C;  2DYS C;  3IPM O;  2BL2 A;  3FOP A;  1VMA A; 
#chains in the Genus database with same CATH homology
 1BZ4 A;  3S84 A;  1H7I A;  3R2P A;  1B68 A;  1OR3 A;  1OR2 A;  1LS4 A;  1NFN A;  1NFO A;  1YA9 A;  1LPE A;  1GS9 A;  2KC3 A;  1AEP A;  1LE4 A;  1LE2 A;  1EA8 A;  1EQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...