256BA

Improvement of the 2.5 angstroms resolution model of cytochrome b562 by redetermining the primary structure and using molecular graphics
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME B562
publication title Improvement of the 2.5 A resolution model of cytochrome b562 by redetermining the primary structure and using molecular graphics.
pubmed doi rcsb
source organism Escherichia coli
total genus 49
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 256bA00
4JE9A 3L1MA 1E83A 4CDAA 3VRCA 4WGYA 5JRAA 4EIYA 4L6RA 4CX9A 3HNJA 4D4XA 3FOOA 1NBBA 3HNIA 2XLOA 4NC3A 3ZQYA 5JVEA 2YLDA 2XLEA 3C63A 4CIPA 3NMIA 3IQ6A 4N6HA 3M15A 2XM4A 4JKVA 4IB4A 3ZTMA 5JUAA 3ZQVA 2YLGA 4D4NA 3FOPA 1RCPA 1E86A 2J8WA 3M4BA 1A7VA 2CCYA 4CDVA 4ULVA 2XL8A 2XLWA 2YL7A 1MQVA 4IARA 3ZWIA 1M6TA 2XLMA 1APCA 2YL3A 1E85A 1LM3B 4WGZA 3QW0A 1CPQA 5JSLA 2QLAA 5JP7A 256BA 1GQAA 4IAQA 1YZCA 5JT4A 2YL0A 3NMJA 4JEAA 5JS5A 2J9BA 2XLHA 3DE9A 5AGFA 3M4CA 3DE8A 2YLIA 3M79A 3QVZA 3HNLA 2BC5A 1JAFA 3NMKA 1E84A 3HNKA 4CDYA 3IQ5A 4U9DA 5B3IA 1CPRA 4JEBA 4U9EA 4CJOA 1YYJA 2XL6A 1S05A 4CJGA 4N4WA 3ZTZA 1YYXA 4ER9A 1QPUA 3U8PA 3QW1A 3QVYA 1CGOA 1YZAA 5JLIA 1EKYA 1BBHA 2XLVA 1CGNA 2XLDA 3TOLA 2YL1A 1QQ3A 3C62A 2YKZA 2XM0A 3TOMA
chains in the Genus database with same CATH superfamily
1FFHA 2AU5A 3L1MA 3GM2A 2FGYA 2V26A 4HE8D 3U8VA 3RVYA 2VCCA 3FDQA 1R4TA 3JSZA 3B0VC 4WGYA 5A6BA 4EIYA 4L6RA 1FR0A 4IWBA 1T5OA 1Z3IX 3HNJA 2MHRA 4EBJA 2GA0A 4Z9IA 3GANA 5COGA 2R7UA 1NSGB 2B0HA 4IRUA 3ZQYA 1XWJA 2CYDA 2M4EA 1M2VA 3O39A 4LDKA 4NTFA 4MVSA 3T6BA 2KQ9A 2QNLA 1PCXA 3BRJA 1OCRC 2MWQA 2QTVA 3N24A 4DBQA 1H6GA 3AQBA 3B71A 1JRAA 2F22A 1Q0FA 4C7OA 1TWAA 1GM5A 2XM4A 3MYIA 3IPMO 1D1BA 2KK1A 3MLGA 1A7EA 1FMWA 1PD1A 1A41A 1LS4A 1NFNA 2OKUA 3IQCA 3EGDB 2C04A 1BDJB 1V54C 1Z5ZA 1ZU5A 2DYRC 2ICWG 3LEVA 4I44A 4IB4A 5A6AA 3CSKA 3NYMA 1VB5A 5L0FA 4CSAC 3U2MA 4ZLDA 1LI5A 2J9WA 5DS4A 4ULWA 3L0IA 1B68A 1QVXA 3RYLA 1MMGA 2QY9A 4NTBA 2LFDA 1PD0A 3KYJA 3F46A 4XLPF 1E86A 2CNWA 3M4BA 2NSFA 1A7VA 3G50A 1JPNA 4PK4A 3ZG1A 4CDVA 1XZPA 4ULVA 5COMA 3TJ6A 2XL8A 5L3QA 2WVOA 3ZSUA 3C7JA 5BQGA 5IY5C 4KI2A 2WVQA 2FFHA 2L7AA 2P6VA 3HTKC 4BJ1A 1K04A 2KSFA 2E87A 2OEXA 1M6TA 3BEHA 2VC9A 1TQGA 2EIKC 2NUTB 2XS1A 3DAGA 2KW3C 2BE5F 2NSGA 2W9YA 3DWWA 1BZ4A 2P0NA 4JJGA 3T9OA 3FVYA 2HV6A 1LPEA 3C8GB 2KC3A 3RFYA 2PNOA 2QLAA 5JP7A 4A2NB 256BA 3ZDLA 4EKWA 3UMHA 5BUOA 3N2ZB 2LD6A 1Z23A 2CGEA 1YZCA 2A69F 4XWJA 2C03A 2J9BA 2RSEB 3OEOA 4OIRF 4IAOA 3DE8A 1FFTC 3G4XA 4O6NA 2GWWA 5L0JA 1ZU4A 3QVZA 3HNLA 4Q4ZF 1H7IA 2HJ3A 3CQZA 1CGME 3NMKA 4Q5SF 5CI9A 3S0XA 2R05A 1RKEA 2A0BA 2Y69C 3GM3A 4N6CA 2EPOA 2RD9A 3UR3C 2GFHA 1A7DA 4J7YA 4PJJA 2YEVA 1LIHA 2EPMX 3EG9B 3SXKA 4YN0B 3RIPA 5KYXA 2R7TA 5T3WA 1YYJA 2HUJA 2IXMA 3H65A 4MW8A 4YL0A 4E17A 2EILC 3LJBA 3QMKA 3I5QA 4H54A 4UDVA 4P9TA 2PF4E 3LNMB 4XPWA 3V5YA 4DOZA 1QSPA 3B9QA 2XRHA 3EJNA 2KJGA 3QW1A 1GS9A 1T6UA 2A1DD 2OJQA 3EPVA 3DD7A 3I4UA 3QVYA 1CGOA 3U2LA 2Q00A 2G3KA 1BR2A 3AQCA 2HS5A 2Q4FA 2YZSA 3HLZA 1IZMA 1FMVA 3IQTA 2B0JA 1EKYA 1OQCA 2G3VA 3MYFA 2WB7A 2DB4A 2EPKX 4BJ6A 5A6BD 3S84A 4YT8A 3KMIA 3DJUB 1QQ3A 3SZRA 2WL8A 2D5RB 3QTHA 2J9VA 2LP4A 2VB6A 4KNWA 1OW6A 4CS8C 4FWVA 1ZVZA 1E83A 3B0UX 4EWCA 2J46A 3U0CA 4MVQA 3PDMP 3VM6A 3N0TA 4CS9C 4EBKA 4XPXA 1L3PA 3V5XA 2R7OA 4G7ZF 4XEKA 3FOOA 2YVKA 1MMAA 3TULA 4QI0A 1YA7O 1NFOA 2Y3HA 1BR4A 2NUPB 2XLOA 1NU7D 1VYKA 2ZD9A 1YLMA 3K7DA 4JE9A 4OINF 5KYWA 3EQLF 2ZXOA 1C02A 1Z63A 4JZAA 1H9TA 2YLDA 2YQYA 3S29A 4FX5A 3UMIA 4BJ5A 1TFOB 2KGOA 3A11A 1IW7F 4HFFB 1AUEA 2NPUA 5L0GA 2O9XA 1JMWA 2R7QA 2J45A 3LESA 3LUTB 4MQ9F 2XXAB 3IQ6A 3LLKA 3T4RA 4GEHA 3LEOA 1WATA 3QZCA 1OXKA 1LS1A 4PR9A 1G8XA 2CNWD 1KU2A 1S7ZA 2KYHA 4X0RA 1RJ9B 5GPGB 1Z7Qc 5L3VA 2R7SA 4QI2A 3LS0A 5JUAA 4RD9A 3GODA 2NG1A 3VAYA 1YA9A 2EPNA 2GAQA 3EZHA 3GM1A 2YLGA 4PACA 3W8IA 4LLCA 4A4AA 3CAXA 2ETSA 1C03A 2H7OA 3DMDA 3GEEA 2J0XA 1ORSC 1R5ID 4I1OB 1ZHYA 4EBBA 5F5FA 2XLWA 2X51A 1YARO 2OG2A 1OKKA 2I8BA 3H2UA 4JURI 1BR1A 4PJLA 3NKDA 3ZWIA 4BJTA 3MBGA 1ZHZA 2XLMA 1APCA 2X0CA 5HV9A 4XEVA 2LCHA 1LM3B 1G4US 1D1CA 4KBLA 1NLXA 2W4MA 4XTKA 3EGXA 4OIOF 3EH2A 4O6YA 2G62A 4NY3A 3DAFA 2PX3A 3KYIA 1O5HA 4C7OB 2PX0A 5CIVA 3K1IC 3U9JA 3NDBB 1M57C 1MMNA 5FZTA 3CZ6A 4P9FA 5COFA 3K66A 4DJ9A 3M4CA 3LAYA 2CW0F 3M79A 1KTMA 1T9KA 2L9JA 2WZLA 4JIOA 3SP1A 3TJ5A 4FAPB 3TK0A 2YHSA 3Q6NA 1JAFA 1HW1A 1VOMA 3LLIA 1NZEA 2R9RB 3C8ZA 3EGDA 3LS1A 3JYYA 4YL1A 2VASA 3JT1A 5B1BC 4BEMJ 4YL3A 5B3IA 4G78A 2J0WA 4JEBA 1V55C 3J06A 1JR8A 3US6A 4CBEA 3S9OA 2W45A 1SR2A 1WGWA 2OEVA 2A0UA 3PMRA 4N4WA 1RMVA 2PFDA 3ZTZA 5BQIA 2ZXPA 2IXNA 2IXOA 5KYUA 3VYWA 1KNYA 4KNVA 3F47A 4ER9A 1PV3A 3AG4C 4C3DA 2CDQA 4R32A 5TJ5E 3U8PA 2XL4A 4PJMA 2XS8A 1LVKA 2R7RA 1VLSA 1Q0MA 1EA8A 3M1CB 4PFOA 5KYNA 2A68F 5CI8A 4U5FE 1VYIA 3O55A 3H2VA 2OU6A 1NU9C 2JX0A 3ABLC 3C8GA 3EFOA 3X1OA 2XLVA 2YWAA 4MW3A 3UMKA 4XQ1A 4JTDB 4JC7A 1G5ZA 3EHMA 4K0DA 2A6HF 3ASOC 3C62A 3MFNA 1LE4A 3HJCA 2YKZA 3E70C 2H7VC 2PP4A 2KNHA 2P7VA 3G4ZA 3GWLA 3OWTA 3TQOA 4G7OF 1ZHXA 3E9VA 3TOMA 3ABKC 1OR3A 3OA1A 4W8PA 3W2WA 3PHF2 3Q7LA 4HEAJ 2XSEA 3UGOA 1RKEB 1ORJA 3VRCA 1ST6A 4WABA 3ZIBA 2WVNA 2Q9CA 3PCVA 4DRIB 4LERA 2H7BA 3RF3A 1NBBA 2R7VA 2AWCA 3SXMA 2IOQA 4E0HA 2R7XA 1TWGA 4NC3A 3R7CA 2R02A 3NG1A 3SNHA 4XPYA 5BQHA 1E2XA 3AG3C 5JVEA 2HMZA 3RVZA 1OCZC 5A69A 2OOCA 2JD3A 4J32B 3GORA 4CIHA 3O6XA 4JKVA 2LQGA 1H9GA 3O10A 3C63A 2IXPA 3EH1A 4CIPA 4JW1A 1AVOB 3NMIA 1D0YA 4MS2A 1M2OA 2J7PD 3M15A 5AC4A 4N06A 4U5GA 4AE4A 3RQFA 3U9MA 1WOLA 4BJ6C 1I4YA 3KH2A 1OW8A 4RBNA 4JJFA 1ZW2A 4O79A 4ZLCA 3S90A 1TWHA 3ZTMA 4O6MA 4W8KA 5EGYA 3DZAA 3JSEO 1SYQA 4IGGA 3ZQVA 1OKKD 5HSWA 1YAUO 3FOPA 4MVZA 1ZHTA 4LDRA 4D4NA 3T6JA 4E18A 1RCPA 2EIMC 1YJGA 2OJED 2J8WA 5DVWA 5DLJA 1D0XA 2CCYA 2DYSC 1VK5A 2ZPAA 3EZIA 1FTSA 4AL1A 1OCOC 4C3EA 5KYYA 3ZC4A 1YVIA 4H4KC 3VF0A 1VLTA 1MQVA 1MNEA 4IARA 4FESA 4MTFA 3RQEA 4BEJA 5KYWB 3V5ZA 1VTMP 2Z15A 4JCZA 3DKAA 4Z9JA 4DRJB 1E85A 4WGZA 3QW0A 3Q6MA 3V7OA 5JSLA 3FAPB 3K33A 1N1CA 1WTYA 4OIPF 3JCUQ 4JCHA 2HMQA 1HW2A 1TFKB 3FHDA 3NKEA 1K05A 5JT4A 1U6HA 2Q9BA 3ASNC 1I4ZA 2J7PA 2XLHA 3U3FA 1YDIA 1SZIA 2YLIA 2ZXWC 3UGPA 3RKOF 2UUHA 2W4BA 1SMYF 3RW0A 3S28A 4BPMA 1TWCA 2IYLD 2ZXRA 1WASA 1WWPA 1JPJA 2L6GA 4NTAA 4MVUA 5E2QA 3W2VA 3A9CA 1VMAA 1ZYRF 5E3AA 1OR2A 4AX2A 4JVSA 4U5BE 5FCLA 3IQ5A 4OD5A 3ATPA 1CPRA 3GWNA 1RKCA 4U9EA 1Q0KA 4NCQA 5B3SC 5L0CA 2Y3BA 3FAJA 4MNDA 1GGQA 5D92A 1M2VB 3AGTA 1U0BB 1K40A 1S05A 2JPUA 2MYSA 4CJGA 1YYXA 3SXYA 3C8GD 5DQTA 1QPUA 3DM5A 2VCAA 5T3TA 5EK0A 4E0IA 1AEPA 3Q7GA 1ZZPA 4YK5A 3ECSA 4C3BA 4K1OA 3LNRA 1G4WR 2DI3A 2A6EF 3IHUA 4DVZA 2HJMA 5JLIA 1HE9A 3EGXB 2LSEA 5AC5A 1D0ZA 1BBHA 4XEFA 4U5CE 1L7CA 2XLDA 2AVKA 1DOWA 4GYTA 3TOLA 4QDLA 1T6IA 4CSAA 2LK4A 5DQZA 1F1MA 1OXBA 2HFIA 1V74B 2EPLX 1EI7A 2XM0A 3K1IA 3AJMA 4YT5A 2L6FA 5E33A 4U5HA 1QKRA 2UUIA 1LI7A 1D1AA 1OW7A 1TR2A 2AWYA 2D4UA 1Z6AA 3NYJA 5L0IA 4CDAA 3POVA 5JRAA 2HSBA 5D91A 4CX9A 4Z9HA 1V4AA 2P61A 3T6GB 3ABMC 5F28E 4D4XA 2Q9AA 3JYHA 4DXWA 4ONSA 3ZVRA 3HNIA 4E7ZA 2J9UA 1XZQA 3UNGC 3IEEA 4HFKB 1NG1A 3JZ0A 4PJNA 3SEOA 5KYUB 1HMDA 4XLNF 2NUTA 2HKVA 2IM8A 3K1HA 1UFBA 3W4YA 1A0BA 2XLEA 4OD4A 1U89A 4AL0A 3JRTA 1DOVA 5T1DB 3U3BA 4JTAB 4E7SA 3C18A 1ORYA 4LDQA 1T6QA 4N6HA 4M63A 1UG7A 5A6JA 3X2QC 1I5NA 3KPHA 3EFOB 1RXQA 1FAPB 1SF8A 4WJ0A 3AOUA 2L81A 4I1MA 4MVMA 3TD7A 3K6BA 1W2WA 4K7BA 3B29A 1EQ1A 3DXJF 2DGJA 2FAPB 2I15A 2Q7RA 3NYLA 1Q0DA 2BL2A 5DS6A 2R03A 5KYXB 2P1AA 4MVRA 2HZ8A 3KKBA 1MMDA 3EG9A 1Y6DA 2V3CC 4DBRA 3DJNB 2AP3A 1WN0A 2QE9A 3SYNA 4YJWA 3AGUA 4DVYP 2VH3A 4RDAA 4IJJA 2YL7A 3AG1C 3KL4A 4G7HF 1C17M 4Q7CA 3W8HA 3I5PA 1LE2A 4GQHA 4G0HA 2YL3A 2IBFA 1J8YF 5F5HA 5K0IA 1CPQA 5DS5A 1OCCC 3B0PA 2PBEA 1O3UA 1JOGA 2L6HA 3HKKA 3SXZA 3ITFA 4F4BA 1GQAA 2WZGA 5B1AC 1Q0GA 1M56C 3DM9B 4IAQA 4NQFA 3JTLO 1Y4CA 4J30B 2YL0A 1QZXA 3NMJA 4AE4B 4JEAA 2LFFA 4PFPA 1MNDA 4CS7A 5JS5A 3DE9A 3NRHA 5AGFA 1O87A 3GEIA 3WG7C 4EHPA 4KC9A 4BG0A 2R7WA 3L8IA 1HY5A 4JRZA 2BC5A 2OQMA 5E3CA 2LIGA 4CS8A 3FMSA 2M64A 4YT2A 1E84A 3HNKA 2YRFA 4JTCB 4MTGA 4CS9A 2WZFA 4CDYA 2R25A 4U9DA 1J8MF 2Y39A 3CEXA 4CJOA 4MTOA 2XL6A 2NUPA 3FXHA 2ASRA 5KYYB 3RH3A 4BJ5C 5L0HA 4AK9A 3WODF 3L34A 2GDCA 3RQGA 1FNTc 3S27A 3GEHA 4OIQF 2HSQA 1TKNA 2Y3GA 4EUKB 1T01A 5L0DA 1QLEC 4P6IC 3DI5A 2TMVP 3U5SA 3R2PA 5EHHA 2VCBA 4LACB 2H8AA 1YZAA 2XXAA 1HMOA 3AG2C 4MVOA 4I3MA 2HV7A 4YWQA 2EIJC 2QUPA 2EINC 3MX3A 4O7GA 4YT4A 3WAQA 4LLEA 3EHNA 1ZHWA 1RJ9A 1CGNA 2OCCC 1LKXA 4U5DE 3WHNA 4U5EE 4ANJA 4J7TA 4B6IA 2YL1A 2Q3TA 2Y3DA 4DRHB 1ZW3A 3JRMO 5A6KA 3L8JA 1HE1A
chains in the Genus database with same CATH topology
4JE9A 3L1MA 1E83A 4CDAA 3VRCA 4WGYA 5JRAA 4EIYA 4L6RA 4CX9A 3HNJA 4D4XA 3FOOA 1NBBA 3HNIA 2XLOA 4NC3A 3ZQYA 5JVEA 2YLDA 2XLEA 3C63A 4CIPA 3NMIA 3IQ6A 4N6HA 3M15A 2XM4A 4JKVA 4IB4A 3ZTMA 5JUAA 3ZQVA 2YLGA 4D4NA 3FOPA 1RCPA 1E86A 2J8WA 3M4BA 1A7VA 2CCYA 4CDVA 4ULVA 2XL8A 2XLWA 2YL7A 1MQVA 4IARA 3ZWIA 1M6TA 2XLMA 1APCA 2YL3A 1E85A 1LM3B 4WGZA 3QW0A 1CPQA 5JSLA 2QLAA 5JP7A 256BA 1GQAA 4IAQA 1YZCA 5JT4A 2YL0A 3NMJA 4JEAA 5JS5A 2J9BA 2XLHA 3DE9A 5AGFA 3M4CA 3DE8A 2YLIA 3M79A 3QVZA 3HNLA 2BC5A 1JAFA 3NMKA 1E84A 3HNKA 4CDYA 3IQ5A 4U9DA 5B3IA 1CPRA 4JEBA 4U9EA 4CJOA 1YYJA 2XL6A 1S05A 4CJGA 4N4WA 3ZTZA 1YYXA 4ER9A 1QPUA 3U8PA 3QW1A 3QVYA 1CGOA 1YZAA 5JLIA 1EKYA 1BBHA 2XLVA 1CGNA 2XLDA 3TOLA 2YL1A 1QQ3A 3C62A 2YKZA 2XM0A 3TOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JE9 A;  3L1M A;  1E83 A;  4CDA A;  3VRC A;  4WGY A;  5JRA A;  4EIY A;  4L6R A;  4CX9 A;  3HNJ A;  4D4X A;  3FOO A;  1NBB A;  3HNI A;  2XLO A;  4NC3 A;  3ZQY A;  5JVE A;  2YLD A;  2XLE A;  3C63 A;  4CIP A;  3NMI A;  3IQ6 A;  4N6H A;  3M15 A;  2XM4 A;  4JKV A;  4IB4 A;  3ZTM A;  5JUA A;  3ZQV A;  2YLG A;  4D4N A;  3FOP A;  1RCP A;  1E86 A;  2J8W A;  3M4B A;  1A7V A;  2CCY A;  4CDV A;  4ULV A;  2XL8 A;  2XLW A;  2YL7 A;  1MQV A;  4IAR A;  3ZWI A;  1M6T A;  2XLM A;  1APC A;  2YL3 A;  1E85 A;  1LM3 B;  4WGZ A;  3QW0 A;  1CPQ A;  5JSL A;  2QLA A;  5JP7 A;  256B A;  1GQA A;  4IAQ A;  1YZC A;  5JT4 A;  2YL0 A;  3NMJ A;  4JEA A;  5JS5 A;  2J9B A;  2XLH A;  3DE9 A;  5AGF A;  3M4C A;  3DE8 A;  2YLI A;  3M79 A;  3QVZ A;  3HNL A;  2BC5 A;  1JAF A;  3NMK A;  1E84 A;  3HNK A;  4CDY A;  3IQ5 A;  4U9D A;  5B3I A;  1CPR A;  4JEB A;  4U9E A;  4CJO A;  1YYJ A;  2XL6 A;  1S05 A;  4CJG A;  4N4W A;  3ZTZ A;  1YYX A;  4ER9 A;  1QPU A;  3U8P A;  3QW1 A;  3QVY A;  1CGO A;  1YZA A;  5JLI A;  1EKY A;  1BBH A;  2XLV A;  1CGN A;  2XLD A;  3TOL A;  2YL1 A;  1QQ3 A;  3C62 A;  2YKZ A;  2XM0 A;  3TOM A; 
#chains in the Genus database with same CATH topology
 1FFH A;  2AU5 A;  3L1M A;  3GM2 A;  2FGY A;  2V26 A;  4HE8 D;  3U8V A;  3RVY A;  2VCC A;  3FDQ A;  1R4T A;  3JSZ A;  3B0V C;  4WGY A;  5A6B A;  4EIY A;  4L6R A;  1FR0 A;  4IWB A;  1T5O A;  1Z3I X;  3HNJ A;  2MHR A;  4EBJ A;  2GA0 A;  4Z9I A;  3GAN A;  5COG A;  2R7U A;  1NSG B;  2B0H A;  4IRU A;  3ZQY A;  1XWJ A;  2CYD A;  2M4E A;  1M2V A;  3O39 A;  4LDK A;  4NTF A;  4MVS A;  3T6B A;  2KQ9 A;  2QNL A;  1PCX A;  3BRJ A;  1OCR C;  2MWQ A;  2QTV A;  3N24 A;  4DBQ A;  1H6G A;  3AQB A;  3B71 A;  1JRA A;  2F22 A;  1Q0F A;  4C7O A;  1TWA A;  1GM5 A;  2XM4 A;  3MYI A;  3IPM O;  1D1B A;  2KK1 A;  3MLG A;  1A7E A;  1FMW A;  1PD1 A;  1A41 A;  1LS4 A;  1NFN A;  2OKU A;  3IQC A;  3EGD B;  2C04 A;  1BDJ B;  1V54 C;  1Z5Z A;  1ZU5 A;  2DYR C;  2ICW G;  3LEV A;  4I44 A;  4IB4 A;  5A6A A;  3CSK A;  3NYM A;  1VB5 A;  5L0F A;  4CSA C;  3U2M A;  4ZLD A;  1LI5 A;  2J9W A;  5DS4 A;  4ULW A;  3L0I A;  1B68 A;  1QVX A;  3RYL A;  1MMG A;  2QY9 A;  4NTB A;  2LFD A;  1PD0 A;  3KYJ A;  3F46 A;  4XLP F;  1E86 A;  2CNW A;  3M4B A;  2NSF A;  1A7V A;  3G50 A;  1JPN A;  4PK4 A;  3ZG1 A;  4CDV A;  1XZP A;  4ULV A;  5COM A;  3TJ6 A;  2XL8 A;  5L3Q A;  2WVO A;  3ZSU A;  3C7J A;  5BQG A;  5IY5 C;  4KI2 A;  2WVQ A;  2FFH A;  2L7A A;  2P6V A;  3HTK C;  4BJ1 A;  1K04 A;  2KSF A;  2E87 A;  2OEX A;  1M6T A;  3BEH A;  2VC9 A;  1TQG A;  2EIK C;  2NUT B;  2XS1 A;  3DAG A;  2KW3 C;  2BE5 F;  2NSG A;  2W9Y A;  3DWW A;  1BZ4 A;  2P0N A;  4JJG A;  3T9O A;  3FVY A;  2HV6 A;  1LPE A;  3C8G B;  2KC3 A;  3RFY A;  2PNO A;  2QLA A;  5JP7 A;  4A2N B;  256B A;  3ZDL A;  4EKW A;  3UMH A;  5BUO A;  3N2Z B;  2LD6 A;  1Z23 A;  2CGE A;  1YZC A;  2A69 F;  4XWJ A;  2C03 A;  2J9B A;  2RSE B;  3OEO A;  4OIR F;  4IAO A;  3DE8 A;  1FFT C;  3G4X A;  4O6N A;  2GWW A;  5L0J A;  1ZU4 A;  3QVZ A;  3HNL A;  4Q4Z F;  1H7I A;  2HJ3 A;  3CQZ A;  1CGM E;  3NMK A;  4Q5S F;  5CI9 A;  3S0X A;  2R05 A;  1RKE A;  2A0B A;  2Y69 C;  3GM3 A;  4N6C A;  2EPO A;  2RD9 A;  3UR3 C;  2GFH A;  1A7D A;  4J7Y A;  4PJJ A;  2YEV A;  1LIH A;  2EPM X;  3EG9 B;  3SXK A;  4YN0 B;  3RIP A;  5KYX A;  2R7T A;  5T3W A;  1YYJ A;  2HUJ A;  2IXM A;  3H65 A;  4MW8 A;  4YL0 A;  4E17 A;  2EIL C;  3LJB A;  3QMK A;  3I5Q A;  4H54 A;  4UDV A;  4P9T A;  2PF4 E;  3LNM B;  4XPW A;  3V5Y A;  4DOZ A;  1QSP A;  3B9Q A;  2XRH A;  3EJN A;  2KJG A;  3QW1 A;  1GS9 A;  1T6U A;  2A1D D;  2OJQ A;  3EPV A;  3DD7 A;  3I4U A;  3QVY A;  1CGO A;  3U2L A;  2Q00 A;  2G3K A;  1BR2 A;  3AQC A;  2HS5 A;  2Q4F A;  2YZS A;  3HLZ A;  1IZM A;  1FMV A;  3IQT A;  2B0J A;  1EKY A;  1OQC A;  2G3V A;  3MYF A;  2WB7 A;  2DB4 A;  2EPK X;  4BJ6 A;  5A6B D;  3S84 A;  4YT8 A;  3KMI A;  3DJU B;  1QQ3 A;  3SZR A;  2WL8 A;  2D5R B;  3QTH A;  2J9V A;  2LP4 A;  2VB6 A;  4KNW A;  1OW6 A;  4CS8 C;  4FWV A;  1ZVZ A;  1E83 A;  3B0U X;  4EWC A;  2J46 A;  3U0C A;  4MVQ A;  3PDM P;  3VM6 A;  3N0T A;  4CS9 C;  4EBK A;  4XPX A;  1L3P A;  3V5X A;  2R7O A;  4G7Z F;  4XEK A;  3FOO A;  2YVK A;  1MMA A;  3TUL A;  4QI0 A;  1YA7 O;  1NFO A;  2Y3H A;  1BR4 A;  2NUP B;  2XLO A;  1NU7 D;  1VYK A;  2ZD9 A;  1YLM A;  3K7D A;  4JE9 A;  4OIN F;  5KYW A;  3EQL F;  2ZXO A;  1C02 A;  1Z63 A;  4JZA A;  1H9T A;  2YLD A;  2YQY A;  3S29 A;  4FX5 A;  3UMI A;  4BJ5 A;  1TFO B;  2KGO A;  3A11 A;  1IW7 F;  4HFF B;  1AUE A;  2NPU A;  5L0G A;  2O9X A;  1JMW A;  2R7Q A;  2J45 A;  3LES A;  3LUT B;  4MQ9 F;  2XXA B;  3IQ6 A;  3LLK A;  3T4R A;  4GEH A;  3LEO A;  1WAT A;  3QZC A;  1OXK A;  1LS1 A;  4PR9 A;  1G8X A;  2CNW D;  1KU2 A;  1S7Z A;  2KYH A;  4X0R A;  1RJ9 B;  5GPG B;  1Z7Q c;  5L3V A;  2R7S A;  4QI2 A;  3LS0 A;  5JUA A;  4RD9 A;  3GOD A;  2NG1 A;  3VAY A;  1YA9 A;  2EPN A;  2GAQ A;  3EZH A;  3GM1 A;  2YLG A;  4PAC A;  3W8I A;  4LLC A;  4A4A A;  3CAX A;  2ETS A;  1C03 A;  2H7O A;  3DMD A;  3GEE A;  2J0X A;  1ORS C;  1R5I D;  4I1O B;  1ZHY A;  4EBB A;  5F5F A;  2XLW A;  2X51 A;  1YAR O;  2OG2 A;  1OKK A;  2I8B A;  3H2U A;  4JUR I;  1BR1 A;  4PJL A;  3NKD A;  3ZWI A;  4BJT A;  3MBG A;  1ZHZ A;  2XLM A;  1APC A;  2X0C A;  5HV9 A;  4XEV A;  2LCH A;  1LM3 B;  1G4U S;  1D1C A;  4KBL A;  1NLX A;  2W4M A;  4XTK A;  3EGX A;  4OIO F;  3EH2 A;  4O6Y A;  2G62 A;  4NY3 A;  3DAF A;  2PX3 A;  3KYI A;  1O5H A;  4C7O B;  2PX0 A;  5CIV A;  3K1I C;  3U9J A;  3NDB B;  1M57 C;  1MMN A;  5FZT A;  3CZ6 A;  4P9F A;  5COF A;  3K66 A;  4DJ9 A;  3M4C A;  3LAY A;  2CW0 F;  3M79 A;  1KTM A;  1T9K A;  2L9J A;  2WZL A;  4JIO A;  3SP1 A;  3TJ5 A;  4FAP B;  3TK0 A;  2YHS A;  3Q6N A;  1JAF A;  1HW1 A;  1VOM A;  3LLI A;  1NZE A;  2R9R B;  3C8Z A;  3EGD A;  3LS1 A;  3JYY A;  4YL1 A;  2VAS A;  3JT1 A;  5B1B C;  4BEM J;  4YL3 A;  5B3I A;  4G78 A;  2J0W A;  4JEB A;  1V55 C;  3J06 A;  1JR8 A;  3US6 A;  4CBE A;  3S9O A;  2W45 A;  1SR2 A;  1WGW A;  2OEV A;  2A0U A;  3PMR A;  4N4W A;  1RMV A;  2PFD A;  3ZTZ A;  5BQI A;  2ZXP A;  2IXN A;  2IXO A;  5KYU A;  3VYW A;  1KNY A;  4KNV A;  3F47 A;  4ER9 A;  1PV3 A;  3AG4 C;  4C3D A;  2CDQ A;  4R32 A;  5TJ5 E;  3U8P A;  2XL4 A;  4PJM A;  2XS8 A;  1LVK A;  2R7R A;  1VLS A;  1Q0M A;  1EA8 A;  3M1C B;  4PFO A;  5KYN A;  2A68 F;  5CI8 A;  4U5F E;  1VYI A;  3O55 A;  3H2V A;  2OU6 A;  1NU9 C;  2JX0 A;  3ABL C;  3C8G A;  3EFO A;  3X1O A;  2XLV A;  2YWA A;  4MW3 A;  3UMK A;  4XQ1 A;  4JTD B;  4JC7 A;  1G5Z A;  3EHM A;  4K0D A;  2A6H F;  3ASO C;  3C62 A;  3MFN A;  1LE4 A;  3HJC A;  2YKZ A;  3E70 C;  2H7V C;  2PP4 A;  2KNH A;  2P7V A;  3G4Z A;  3GWL A;  3OWT A;  3TQO A;  4G7O F;  1ZHX A;  3E9V A;  3TOM A;  3ABK C;  1OR3 A;  3OA1 A;  4W8P A;  3W2W A;  3PHF 2;  3Q7L A;  4HEA J;  2XSE A;  3UGO A;  1RKE B;  1ORJ A;  3VRC A;  1ST6 A;  4WAB A;  3ZIB A;  2WVN A;  2Q9C A;  3PCV A;  4DRI B;  4LER A;  2H7B A;  3RF3 A;  1NBB A;  2R7V A;  2AWC A;  3SXM A;  2IOQ A;  4E0H A;  2R7X A;  1TWG A;  4NC3 A;  3R7C A;  2R02 A;  3NG1 A;  3SNH A;  4XPY A;  5BQH A;  1E2X A;  3AG3 C;  5JVE A;  2HMZ A;  3RVZ A;  1OCZ C;  5A69 A;  2OOC A;  2JD3 A;  4J32 B;  3GOR A;  4CIH A;  3O6X A;  4JKV A;  2LQG A;  1H9G A;  3O10 A;  3C63 A;  2IXP A;  3EH1 A;  4CIP A;  4JW1 A;  1AVO B;  3NMI A;  1D0Y A;  4MS2 A;  1M2O A;  2J7P D;  3M15 A;  5AC4 A;  4N06 A;  4U5G A;  4AE4 A;  3RQF A;  3U9M A;  1WOL A;  4BJ6 C;  1I4Y A;  3KH2 A;  1OW8 A;  4RBN A;  4JJF A;  1ZW2 A;  4O79 A;  4ZLC A;  3S90 A;  1TWH A;  3ZTM A;  4O6M A;  4W8K A;  5EGY A;  3DZA A;  3JSE O;  1SYQ A;  4IGG A;  3ZQV A;  1OKK D;  5HSW A;  1YAU O;  3FOP A;  4MVZ A;  1ZHT A;  4LDR A;  4D4N A;  3T6J A;  4E18 A;  1RCP A;  2EIM C;  1YJG A;  2OJE D;  2J8W A;  5DVW A;  5DLJ A;  1D0X A;  2CCY A;  2DYS C;  1VK5 A;  2ZPA A;  3EZI A;  1FTS A;  4AL1 A;  1OCO C;  4C3E A;  5KYY A;  3ZC4 A;  1YVI A;  4H4K C;  3VF0 A;  1VLT A;  1MQV A;  1MNE A;  4IAR A;  4FES A;  4MTF A;  3RQE A;  4BEJ A;  5KYW B;  3V5Z A;  1VTM P;  2Z15 A;  4JCZ A;  3DKA A;  4Z9J A;  4DRJ B;  1E85 A;  4WGZ A;  3QW0 A;  3Q6M A;  3V7O A;  5JSL A;  3FAP B;  3K33 A;  1N1C A;  1WTY A;  4OIP F;  3JCU Q;  4JCH A;  2HMQ A;  1HW2 A;  1TFK B;  3FHD A;  3NKE A;  1K05 A;  5JT4 A;  1U6H A;  2Q9B A;  3ASN C;  1I4Z A;  2J7P A;  2XLH A;  3U3F A;  1YDI A;  1SZI A;  2YLI A;  2ZXW C;  3UGP A;  3RKO F;  2UUH A;  2W4B A;  1SMY F;  3RW0 A;  3S28 A;  4BPM A;  1TWC A;  2IYL D;  2ZXR A;  1WAS A;  1WWP A;  1JPJ A;  2L6G A;  4NTA A;  4MVU A;  5E2Q A;  3W2V A;  3A9C A;  1VMA A;  1ZYR F;  5E3A A;  1OR2 A;  4AX2 A;  4JVS A;  4U5B E;  5FCL A;  3IQ5 A;  4OD5 A;  3ATP A;  1CPR A;  3GWN A;  1RKC A;  4U9E A;  1Q0K A;  4NCQ A;  5B3S C;  5L0C A;  2Y3B A;  3FAJ A;  4MND A;  1GGQ A;  5D92 A;  1M2V B;  3AGT A;  1U0B B;  1K40 A;  1S05 A;  2JPU A;  2MYS A;  4CJG A;  1YYX A;  3SXY A;  3C8G D;  5DQT A;  1QPU A;  3DM5 A;  2VCA A;  5T3T A;  5EK0 A;  4E0I A;  1AEP A;  3Q7G A;  1ZZP A;  4YK5 A;  3ECS A;  4C3B A;  4K1O A;  3LNR A;  1G4W R;  2DI3 A;  2A6E F;  3IHU A;  4DVZ A;  2HJM A;  5JLI A;  1HE9 A;  3EGX B;  2LSE A;  5AC5 A;  1D0Z A;  1BBH A;  4XEF A;  4U5C E;  1L7C A;  2XLD A;  2AVK A;  1DOW A;  4GYT A;  3TOL A;  4QDL A;  1T6I A;  4CSA A;  2LK4 A;  5DQZ A;  1F1M A;  1OXB A;  2HFI A;  1V74 B;  2EPL X;  1EI7 A;  2XM0 A;  3K1I A;  3AJM A;  4YT5 A;  2L6F A;  5E33 A;  4U5H A;  1QKR A;  2UUI A;  1LI7 A;  1D1A A;  1OW7 A;  1TR2 A;  2AWY A;  2D4U A;  1Z6A A;  3NYJ A;  5L0I A;  4CDA A;  3POV A;  5JRA A;  2HSB A;  5D91 A;  4CX9 A;  4Z9H A;  1V4A A;  2P61 A;  3T6G B;  3ABM C;  5F28 E;  4D4X A;  2Q9A A;  3JYH A;  4DXW A;  4ONS A;  3ZVR A;  3HNI A;  4E7Z A;  2J9U A;  1XZQ A;  3UNG C;  3IEE A;  4HFK B;  1NG1 A;  3JZ0 A;  4PJN A;  3SEO A;  5KYU B;  1HMD A;  4XLN F;  2NUT A;  2HKV A;  2IM8 A;  3K1H A;  1UFB A;  3W4Y A;  1A0B A;  2XLE A;  4OD4 A;  1U89 A;  4AL0 A;  3JRT A;  1DOV A;  5T1D B;  3U3B A;  4JTA B;  4E7S A;  3C18 A;  1ORY A;  4LDQ A;  1T6Q A;  4N6H A;  4M63 A;  1UG7 A;  5A6J A;  3X2Q C;  1I5N A;  3KPH A;  3EFO B;  1RXQ A;  1FAP B;  1SF8 A;  4WJ0 A;  3AOU A;  2L81 A;  4I1M A;  4MVM A;  3TD7 A;  3K6B A;  1W2W A;  4K7B A;  3B29 A;  1EQ1 A;  3DXJ F;  2DGJ A;  2FAP B;  2I15 A;  2Q7R A;  3NYL A;  1Q0D A;  2BL2 A;  5DS6 A;  2R03 A;  5KYX B;  2P1A A;  4MVR A;  2HZ8 A;  3KKB A;  1MMD A;  3EG9 A;  1Y6D A;  2V3C C;  4DBR A;  3DJN B;  2AP3 A;  1WN0 A;  2QE9 A;  3SYN A;  4YJW A;  3AGU A;  4DVY P;  2VH3 A;  4RDA A;  4IJJ A;  2YL7 A;  3AG1 C;  3KL4 A;  4G7H F;  1C17 M;  4Q7C A;  3W8H A;  3I5P A;  1LE2 A;  4GQH A;  4G0H A;  2YL3 A;  2IBF A;  1J8Y F;  5F5H A;  5K0I A;  1CPQ A;  5DS5 A;  1OCC C;  3B0P A;  2PBE A;  1O3U A;  1JOG A;  2L6H A;  3HKK A;  3SXZ A;  3ITF A;  4F4B A;  1GQA A;  2WZG A;  5B1A C;  1Q0G A;  1M56 C;  3DM9 B;  4IAQ A;  4NQF A;  3JTL O;  1Y4C A;  4J30 B;  2YL0 A;  1QZX A;  3NMJ A;  4AE4 B;  4JEA A;  2LFF A;  4PFP A;  1MND A;  4CS7 A;  5JS5 A;  3DE9 A;  3NRH A;  5AGF A;  1O87 A;  3GEI A;  3WG7 C;  4EHP A;  4KC9 A;  4BG0 A;  2R7W A;  3L8I A;  1HY5 A;  4JRZ A;  2BC5 A;  2OQM A;  5E3C A;  2LIG A;  4CS8 A;  3FMS A;  2M64 A;  4YT2 A;  1E84 A;  3HNK A;  2YRF A;  4JTC B;  4MTG A;  4CS9 A;  2WZF A;  4CDY A;  2R25 A;  4U9D A;  1J8M F;  2Y39 A;  3CEX A;  4CJO A;  4MTO A;  2XL6 A;  2NUP A;  3FXH A;  2ASR A;  5KYY B;  3RH3 A;  4BJ5 C;  5L0H A;  4AK9 A;  3WOD F;  3L34 A;  2GDC A;  3RQG A;  1FNT c;  3S27 A;  3GEH A;  4OIQ F;  2HSQ A;  1TKN A;  2Y3G A;  4EUK B;  1T01 A;  5L0D A;  1QLE C;  4P6I C;  3DI5 A;  2TMV P;  3U5S A;  3R2P A;  5EHH A;  2VCB A;  4LAC B;  2H8A A;  1YZA A;  2XXA A;  1HMO A;  3AG2 C;  4MVO A;  4I3M A;  2HV7 A;  4YWQ A;  2EIJ C;  2QUP A;  2EIN C;  3MX3 A;  4O7G A;  4YT4 A;  3WAQ A;  4LLE A;  3EHN A;  1ZHW A;  1RJ9 A;  1CGN A;  2OCC C;  1LKX A;  4U5D E;  3WHN A;  4U5E E;  4ANJ A;  4J7T A;  4B6I A;  2YL1 A;  2Q3T A;  2Y3D A;  4DRH B;  1ZW3 A;  3JRM O;  5A6K A;  3L8J A;  1HE1 A; 
#chains in the Genus database with same CATH homology
 4JE9 A;  3L1M A;  1E83 A;  4CDA A;  3VRC A;  4WGY A;  5JRA A;  4EIY A;  4L6R A;  4CX9 A;  3HNJ A;  4D4X A;  3FOO A;  1NBB A;  3HNI A;  2XLO A;  4NC3 A;  3ZQY A;  5JVE A;  2YLD A;  2XLE A;  3C63 A;  4CIP A;  3NMI A;  3IQ6 A;  4N6H A;  3M15 A;  2XM4 A;  4JKV A;  4IB4 A;  3ZTM A;  5JUA A;  3ZQV A;  2YLG A;  4D4N A;  3FOP A;  1RCP A;  1E86 A;  2J8W A;  3M4B A;  1A7V A;  2CCY A;  4CDV A;  4ULV A;  2XL8 A;  2XLW A;  2YL7 A;  1MQV A;  4IAR A;  3ZWI A;  1M6T A;  2XLM A;  1APC A;  2YL3 A;  1E85 A;  1LM3 B;  4WGZ A;  3QW0 A;  1CPQ A;  5JSL A;  2QLA A;  5JP7 A;  256B A;  1GQA A;  4IAQ A;  1YZC A;  5JT4 A;  2YL0 A;  3NMJ A;  4JEA A;  5JS5 A;  2J9B A;  2XLH A;  3DE9 A;  5AGF A;  3M4C A;  3DE8 A;  2YLI A;  3M79 A;  3QVZ A;  3HNL A;  2BC5 A;  1JAF A;  3NMK A;  1E84 A;  3HNK A;  4CDY A;  3IQ5 A;  4U9D A;  5B3I A;  1CPR A;  4JEB A;  4U9E A;  4CJO A;  1YYJ A;  2XL6 A;  1S05 A;  4CJG A;  4N4W A;  3ZTZ A;  1YYX A;  4ER9 A;  1QPU A;  3U8P A;  3QW1 A;  3QVY A;  1CGO A;  1YZA A;  5JLI A;  1EKY A;  1BBH A;  2XLV A;  1CGN A;  2XLD A;  3TOL A;  2YL1 A;  1QQ3 A;  3C62 A;  2YKZ A;  2XM0 A;  3TOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...