256BA

Improvement of the 2.5 angstroms resolution model of cytochrome b562 by redetermining the primary structure and using molecular graphics
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B562
publication title Improvement of the 2.5 A resolution model of cytochrome b562 by redetermining the primary structure and using molecular graphics.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 49
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 256bA00
3ZQVA 2YLIA 4WGYA 2XLMA 3DE8A 4WGZA 2XL6A 4JEAA 2YL0A 3QVZA 2CCYA 2XLEA 1CGOA 3IQ5A 1M6TA 2YL3A 1EKYA 2YLGA 2J8WA 5JLIA 4D4XA 3FOPA 4CDAA 1E85A 1JAFA 3L1MA 3QW0A 4N4WA 4JKVA 5JSLA 3TOMA 3ZTZA 2QLAA 3M15A 1A7VA 1CPRA 5JRAA 5JS5A 2YLDA 1E84A 1CGNA 1APCA 1MQVA 3C63A 4CJOA 4CJGA 1NBBA 2XM0A 3NMJA 3TOLA 3FOOA 1YZAA 3QW1A 4IAQA 5AGFA 2XLHA 4JE9A 1YYXA 3M4CA 1E86A 2YL1A 1CPQA 1GQAA 2BC5A 4L6RA 3HNIA 4N6HA 3U8PA 3ZWIA 4EIYA 2XL8A 4IARA 2XLDA 2YKZA 3IQ6A 3ZTMA 1BBHA 5JUAA 2YL7A 3DE9A 5JP7A 4CDVA 3HNJA 4ER9A 2XM4A 4NC3A 3ZQYA 5JT4A 4CX9A 4JEBA 4U9DA 1S05A 3QVYA 3HNLA 3M4BA 1YYJA 2J9BA 4CDYA 1E83A 1YZCA 2XLWA 1LM3B 4U9EA 4ULVA 3HNKA 3NMIA 4CIPA 3C62A 5B3IA 1QQ3A 4D4NA 5JVEA 1QPUA 2XLVA 256BA 3M79A 3VRCA 3NMKA 1RCPA 4IB4A 2XLOA
chains in the Genus database with same CATH superfamily
2OQMA 5KYNA 2Q4FA 2XXAB 1ST6A 3HLZA 3OWTA 2L7AA 5L0DA 4WGZA 3W8HA 2XL6A 4OINF 3IHUA 3M1CB 4PACA 1F1MA 5T3TA 2CCYA 2QTVA 4JRZA 3TQOA 5L3QA 1OCZC 2XLEA 4MVMA 5KYWB 1J8MF 1BZ4A 1VB5A 4Z9HA 3QTHA 3IQ5A 2A68F 4P6IC 1TKNA 5B1BC 1H6GA 2J8WA 3NRHA 1ZW3A 2P6VA 1BR4A 3UMIA 5KYYB 2VCBA 3B0PA 1JAFA 4XPXA 3LAYA 4DRHB 5JSLA 1YJGA 3ZTZA 2L6GA 2Y3DA 3CAXA 1RJ9A 2XRHA 4GYTA 1OW7A 4KBLA 2EPOA 1A7EA 4JTCB 3SP1A 3UMKA 1FAPB 2P7VA 2QUPA 4PJLA 4YL0A 4A4AA 4JC7A 2UUHA 2Y3GA 4J7YA 2HJ3A 1CGNA 3MX3A 1OW8A 2I15A 4C7OB 4XTKA 1MMNA 1QKRA 4G78A 4KI2A 1R4TA 2PFDA 4R32A 1YDIA 2LD6A 4CJGA 1ZYRF 5AC5A 1SF8A 5KYUB 2ZXRA 2P0NA 4MTFA 4W8PA 2AU5A 2EINC 2VCCA 2HFIA 4XPWA 3FOOA 5COFA 3FVYA 2EPNA 4MS2A 3JZ0A 5A69A 3W8IA 2M4EA 1YYXA 2HKVA 1UFBA 4RDAA 4FAPB 1D1AA 3A11A 1CPQA 1Z3IX 1T6QA 3EFOA 3LUTB 4P9FA 5BUOA 2R7QA 1LE2A 3G50A 4J7TA 5L0GA 1D1BA 3CQZA 1OCRC 4I3MA 1NFNA 3X2QC 2Q9AA 1L7CA 2LFDA 3ABKC 3EZIA 3G4XA 3K1HA 2EPKX 2O9XA 5EK0A 4XLPF 3JRTA 1YA7O 4QI2A 1GGQA 2LSEA 2PF4E 2AP3A 1LPEA 3CEXA 3U0CA 1NZEA 1Q0GA 1BBHA 1TQGA 3VAYA 1D0YA 2R7SA 3B9QA 4O6NA 5JUAA 2P61A 2WZLA 3DE9A 1T6UA 3T6GB 4CDVA 3SNHA 4ZLDA 1WATA 2GFHA 4IWBA 4U5DE 3U2LA 1BR2A 1H7IA 1XWJA 4BG0A 4HEAJ 4K0DA 3FDQA 2EPMX 3C8ZA 4OIRF 2B0HA 5EHHA 2XM4A 3S29A 2C04A 2HSBA 4NC3A 4LDQA 2KW3C 1FR0A 2BL2A 1V55C 4NCQA 3GM3A 1VOMA 4NQFA 4NTAA 1ZU5A 4YL1A 1NSGB 4XLNF 4WJ0A 3VF0A 2GAQA 2VASA 2J9BA 2NSFA 4QI0A 3O55A 1HE9A 2WB7A 1A7DA 1WOLA 1Z6AA 3F46A 1LS1A 4H4KC 1YAUO 2F22A 4Z9JA 3UR3C 3RFYA 1Y6DA 3C8GB 3GODA 1BDJB 1RXQA 3X1OA 3HNKA 3NMIA 3RF3A 2LK4A 4OD4A 5L3VA 2ZXWC 1TR2A 4PJJA 3R7CA 4Q7CA 3SEOA 3UNGC 2YQYA 1M56C 1NU7D 2HUJA 1QQ3A 1XZQA 4D4NA 1J8YF 4IRUA 2GWWA 3ATPA 4JIOA 2OG2A 2KGOA 1LI5A 4BJTA 4DXWA 4YWQA 1NU9C 2ASRA 3L34A 4XEKA 1QZXA 3LEOA 4IAOA 3PHF2 1QSPA 3K1IC 2AWYA 2KQ9A 2HV7A 3EG9B 3AG3C 2PNOA 3K1IA 4G0HA 5KYXB 3B0UX 2G62A 2RSEB 1ORYA 4WGYA 1LVKA 1TWCA 2FFHA 2XLMA 1VK5A 3DZAA 5BQIA 1KTMA 3JTLO 4O6YA 2YL0A 3MBGA 4JJGA 2EILC 2B0JA 2DGJA 4BJ6C 1CGOA 4PFPA 3FAPB 4NY3A 4P9TA 3JCUQ 2XS1A 4G7ZF 1T01A 3S28A 1PD1A 4GQHA 5BQGA 5T3WA 1MMAA 2X0CA 2YWAA 4LERA 4CDAA 1T5OA 3FMSA 1E85A 2W45A 4UDVA 2Q00A 1TWHA 5COGA 2NUTA 2AVKA 2FAPB 4K7BA 3IPMO 3S90A 1OCCC 1ZHXA 3UGOA 3GORA 1QLEC 4JKVA 5FZTA 4YT8A 2PP4A 3S9OA 1Z5ZA 4JTDB 1EQ1A 1Z63A 1S7ZA 3KL4A 1A7VA 1CPRA 1MNEA 3DM5A 3RQFA 4U5FE 3MYIA 3LLKA 2XS8A 1JOGA 2CDQA 4JCZA 5FCLA 1EI7A 3QZCA 3EPVA 2CGEA 2XSEA 3U5SA 3US6A 4Q5SF 1A41A 2KSFA 3HTKC 4CJOA 4DRJB 4EBKA 4EBBA 1V4AA 2XM0A 3NMJA 3NYMA 4MVSA 2R7UA 1U6HA 3GEIA 3ZSUA 3J06A 3VYWA 3AGTA 3ABLC 1K05A 4EHPA 2IM8A 3DJUB 4IAQA 3QW1A 4BJ5C 4EWCA 5A6AA 3NKDA 4HE8D 2J46A 1KU2A 2M64A 4BJ5A 5AGFA 2OKUA 5HV9A 2R7WA 3M4CA 5L0JA 5F5HA 1OXBA 1E86A 1UG7A 5CI8A 3E9VA 3EGXB 3GWNA 2R7XA 5L0FA 3BRJA 4MVOA 2GA0A 3HNIA 2W9YA 1LI7A 4NTFA 4N6CA 4N6HA 5E2QA 3U8PA 3U9JA 3GM2A 3Q6NA 1WN0A 4EIYA 3S0XA 2TMVP 4EKWA 2OOCA 2KYHA 2XL8A 1WTYA 1D1CA 2PBEA 4PFOA 3ZTMA 1HMDA 1E2XA 2Q9CA 5DQZA 4O6MA 3PDMP 4LLEA 2YL7A 2UUIA 5JP7A 2R05A 3EGDB 1TWGA 1VYIA 4C3BA 3I4UA 3FXHA 4KNWA 2XXAA 2YVKA 3WHNA 2NPUA 1MMDA 2KNHA 4CSAC 1PV3A 4QDLA 2LP4A 2KK1A 3OEOA 2J45A 3C18A 2IYLD 4EUKB 4CIHA 2HZ8A 5KYWA 2L81A 4CSAA 2WZGA 3ZQYA 5JT4A 3W2WA 4CX9A 5CIVA 5A6BA 1RMVA 2A6HF 3RKOF 2IXOA 3R2PA 4AL0A 1RKEB 1YLMA 2WVOA 5TJ5E 5DS5A 1LIHA 1OR2A 3AQCA 4IGGA 5F28E 3LESA 3ZIBA 4O7GA 4WABA 4CDYA 2IXMA 5KYYA 3RVYA 2ZD9A 4MW3A 2H7BA 3H65A 1HE1A 2NUPB 2R02A 2CYDA 2H7VC 3JT1A 3DAGA 4U9EA 4BPMA 2WL8A 4DVZA 3C62A 4F4BA 3ZWIA 1OXKA 3SZRA 3TJ6A 3UGPA 1MNDA 5B3IA 5HSWA 2Q9BA 3L0IA 2A0BA 1NLXA 4DJ9A 4ONSA 2MWQA 5T1DB 3B71A 4LACB 3AJMA 1SR2A 1XZPA 2VH3A 3M79A 2J9VA 1RCPA 4C7OA 4IB4A 3Q7LA 3SXKA 4MVUA 4C3DA 1AEPA 1D0ZA 5L0HA 1WGWA 2YHSA 3JSZA 5KYUA 1KNYA 4H54A 3ITFA 4Q4ZF 3NYLA 3C7JA 3CZ6A 2EIMC 3DE8A 5B1AC 4E0IA 3QVZA 4OIOF 4XEVA 2AWCA 2R7OA 3KYJA 2ETSA 5E33A 4AE4B 3O10A 3RH3A 2LCHA 2ZXPA 4U5EE 1IZMA 1M6TA 1OW6A 1RKEA 2YL3A 3L8JA 1EKYA 3KYIA 3L8IA 3KMIA 2L6HA 3PCVA 2HV6A 2MHRA 4OD5A 1M2VB 4ULWA 2EPLX 1PCXA 1TWAA 1LE4A 4HFFB 3POVA 3W2VA 4EBJA 4JCHA 3TJ5A 4B6IA 4YT5A 4J32B 3L1MA 3QW0A 3DWWA 4N4WA 5DS4A 2DYSC 3TOMA 2EIKC 3HKKA 4ZLCA 2OJED 4O79A 4DVYP 3EHNA 2E87A 1I4ZA 2Y3BA 3M15A 4CS7A 3H2UA 3I5PA 1VYKA 2D4UA 5JRAA 3N24A 3ZC4A 1E84A 1V74B 3G4ZA 2A6EF 3ECSA 3U8VA 3DI5A 4MVZA 2C03A 3DJNB 1W2WA 4JTAB 1MQVA 3H2VA 4BJ1A 3I5QA 2OJQA 2Q7RA 3EH1A 3DM9B 1OKKA 2WVQA 3LS0A 1B68A 2P1AA 3ZG1A 3GM1A 4CBEA 4E0HA 1VLTA 3DXJF 3JYYA 1T6IA 3C8GA 4JE9A 3TK0A 5DQTA 2QE9A 1BR1A 3NKEA 2V26A 1C03A 1QVXA 1OCOC 4MVQA 1G4WR 1ORJA 4YT2A 3AG1C 4FX5A 1EA8A 1K04A 2BE5F 4XQ1A 3LNMB 2XLDA 1FMVA 1GM5A 3IQ6A 4U5CE 1ZHYA 2Z15A 1HY5A 4PK4A 1C02A 3ASOC 1JR8A 1JPJA 1ZU4A 1CGME 4I1MA 3EG9A 4MTGA 1RJ9B 1T9KA 2PX0A 3HNJA 5KYXA 2Y3HA 1U89A 4FWVA 3K66A 4CS9C 1JMWA 2R7VA 3WAQA 3LLIA 3KKBA 3RIPA 4PJNA 1ZHWA 3RVZA 4CS9A 4DRIB 4AK9A 3A9CA 5BQHA 1Q0MA 4AX2A 1U0BB 4MVRA 2QY9A 2RD9A 3AGUA 4JEBA 4KC9A 4U9DA 4G7HF 1DOVA 3WODF 2L6FA 4M63A 3V5YA 1DOWA 2JPUA 2L9JA 1OKKD 3ABMC 4BEMJ 3SXMA 2WVNA 3HJCA 4E18A 4OIQF 1YZCA 2XL4A 2OU6A 3C8GD 3U9MA 2Y39A 3U2MA 1N1CA 4ULVA 1G4US 3FAJA 3EFOB 4E7SA 3JRMO 1H9GA 3OA1A 1I5NA 3RQEA 1K40A 2HMQA 4JJFA 1ZZPA 2G3VA 3KH2A 1QPUA 4XEFA 3GEEA 2XLVA 4YJWA 4AL1A 2J0WA 256BA 2Y69C 1C17M 2ZPAA 4HFKB 3VRCA 5IY5C 3LJBA 3AG2C 4MW8A 2G3KA 1HMOA 1G8XA 3K6BA 4GEHA 1V54C 3DKAA 4D4XA 4MNDA 1VMAA 3N2ZB 4Z9IA 4YN0B 3ZQVA 5B3SC 4DBRA 1VLSA 2V3CC 2YLIA 2VCAA 2FGYA 2JX0A 3AOUA 4CS8C 2J0XA 3AG4C 1NFOA 2J9WA 1HW2A 2W4MA 4JEAA 4CS8A 1RKCA 2CW0F 3KPHA 5GPGB 4JVSA 4JURI 4U5HA 1SYQA 2CNWA 3DMDA 5D91A 5EGYA 2NG1A 2MYSA 3EGXA 2YLGA 3JYHA 4U5BE 2OEVA 2LQGA 3MLGA 4IJJA 5JLIA 1AVOB 3IQCA 2J9UA 5CI9A 3FOPA 3TULA 1SZIA 2PX3A 2J7PA 5DVWA 3K33A 3JSEO 3GANA 2HMZA 1Q0KA 3IQTA 3MFNA 3N0TA 3SXYA 1TFKB 5L0CA 4MQ9F 3K7DA 2R03A 1IW7F 1Y4CA 4W8KA 1SMYF 3EGDA 1FMWA 3CSKA 3F47A 2QLAA 1M57C 4DBQA 2R9RB 1YARO 4A2NB 1Q0FA 2HJMA 3EQLF 1JPNA 4K1OA 4YK5A 1L3PA 2DB4A 1Q0DA 2GDCA 3E70C 2YLDA 2JD3A 3EZHA 4J30B 5JS5A 5E3AA 2HS5A 3EJNA 2D5RB 1WASA 4BEJA 1APCA 4YT4A 1O5HA 3C63A 5A6BD 1AUEA 3IEEA 1NBBA 1ORSC 2KJGA 3U3BA 2DYRC 4KNVA 2A69F 1M2OA 4X0RA 2YRFA 2DI3A 3LNRA 3TOLA 1YZAA 4MTOA 4N06A 4E17A 4FESA 4LLCA 4RD9A 2NUPA 5E3CA 3RW0A 2CNWD 2XLHA 3RQGA 2VC9A 4ANJA 4C3EA 3LEVA 1OR3A 3ZDLA 3B0VC 2YL1A 1GQAA 2KC3A 2BC5A 2YZSA 4L6RA 1I4YA 2IXNA 3DD7A 4JZAA 1JRAA 1YVIA 3GEHA 4PR9A 5A6JA 4I1OB 5AC4A 2ZXOA 2J7PD 2VB6A 3PMRA 1O87A 1ZHZA 2IOQA 2WZFA 2YKZA 4IARA 4JW1A 4U5GA 3S27A 3RYLA 3VM6A 1FFHA 2NUTB 3B29A 1ZHTA 4LDKA 2R7RA 1A0BA 4OIPF 3EHMA 2I8BA 3O39A 3SXZA 3TD7A 5L0IA 3ASNC 2OCCC 1ZVZA 3S84A 3EH2A 2NSGA 2H8AA 3BEHA 5A6KA 2OEXA 3T6JA 4LDRA 4XPYA 1FTSA 2W4BA 1LS4A 3NYJA 3WG7C 5DLJA 1Z23A 2A0UA 2EIJC 2QNLA 3QMKA 5COMA 4ER9A 4G7OF 1MMGA 3T9OA 4AE4A 1FFTC 1S05A 2A1DD 4E7ZA 1O3UA 2IXPA 5D92A 4I44A 1FNTc 3AQBA 3GWLA 3HNLA 3QVYA 4YL3A 2LIGA 2R25A 1HW1A 1M2VA 1YYJA 3M4BA 3SYNA 3T6BA 5DS6A 1LKXA 3MYFA 2X51A 3V7OA 1E83A 3NDBB 2Q3TA 3U3FA 2XLWA 4DOZA 1PD0A 1Z7Qc 1LM3B 1TFOB 1VTMP 4PJMA 3DAFA 1WWPA 4BJ6A 3V5XA 4CIPA 1OQCA 3FHDA 1D0XA 3NG1A 2YEVA 3ZVRA 1NG1A 3O6XA 2IBFA 3LS1A 2HSQA 4NTBA 1GS9A 1R5ID 4RBNA 5JVEA 2R7TA 3T4RA 2ICWG 1YA9A 4XWJA 1ZW2A 3Q6MA 2LFFA 3V5ZA 1H9TA 3NMKA 5K0IA 2H7OA 3Q7GA 5F5FA 2XLOA 1G5ZA 3UMHA 3W4YA
chains in the Genus database with same CATH topology
3ZQVA 2YLIA 4WGYA 2XLMA 3DE8A 4WGZA 2XL6A 4JEAA 2YL0A 3QVZA 2CCYA 2XLEA 1CGOA 3IQ5A 1M6TA 2YL3A 1EKYA 2YLGA 2J8WA 5JLIA 4D4XA 3FOPA 4CDAA 1E85A 1JAFA 3L1MA 3QW0A 4N4WA 4JKVA 5JSLA 3TOMA 3ZTZA 2QLAA 3M15A 1A7VA 1CPRA 5JRAA 5JS5A 2YLDA 1E84A 1CGNA 1APCA 1MQVA 3C63A 4CJOA 4CJGA 1NBBA 2XM0A 3NMJA 3TOLA 3FOOA 1YZAA 3QW1A 4IAQA 5AGFA 2XLHA 4JE9A 1YYXA 3M4CA 1E86A 2YL1A 1CPQA 1GQAA 2BC5A 4L6RA 3HNIA 4N6HA 3U8PA 3ZWIA 4EIYA 2XL8A 4IARA 2XLDA 2YKZA 3IQ6A 3ZTMA 1BBHA 5JUAA 2YL7A 3DE9A 5JP7A 4CDVA 3HNJA 4ER9A 2XM4A 4NC3A 3ZQYA 5JT4A 4CX9A 4JEBA 4U9DA 1S05A 3QVYA 3HNLA 3M4BA 1YYJA 2J9BA 4CDYA 1E83A 1YZCA 2XLWA 1LM3B 4U9EA 4ULVA 3HNKA 3NMIA 4CIPA 3C62A 5B3IA 1QQ3A 4D4NA 5JVEA 1QPUA 2XLVA 256BA 3M79A 3VRCA 3NMKA 1RCPA 4IB4A 2XLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQV A;  2YLI A;  4WGY A;  2XLM A;  3DE8 A;  4WGZ A;  2XL6 A;  4JEA A;  2YL0 A;  3QVZ A;  2CCY A;  2XLE A;  1CGO A;  3IQ5 A;  1M6T A;  2YL3 A;  1EKY A;  2YLG A;  2J8W A;  5JLI A;  4D4X A;  3FOP A;  4CDA A;  1E85 A;  1JAF A;  3L1M A;  3QW0 A;  4N4W A;  4JKV A;  5JSL A;  3TOM A;  3ZTZ A;  2QLA A;  3M15 A;  1A7V A;  1CPR A;  5JRA A;  5JS5 A;  2YLD A;  1E84 A;  1CGN A;  1APC A;  1MQV A;  3C63 A;  4CJO A;  4CJG A;  1NBB A;  2XM0 A;  3NMJ A;  3TOL A;  3FOO A;  1YZA A;  3QW1 A;  4IAQ A;  5AGF A;  2XLH A;  4JE9 A;  1YYX A;  3M4C A;  1E86 A;  2YL1 A;  1CPQ A;  1GQA A;  2BC5 A;  4L6R A;  3HNI A;  4N6H A;  3U8P A;  3ZWI A;  4EIY A;  2XL8 A;  4IAR A;  2XLD A;  2YKZ A;  3IQ6 A;  3ZTM A;  1BBH A;  5JUA A;  2YL7 A;  3DE9 A;  5JP7 A;  4CDV A;  3HNJ A;  4ER9 A;  2XM4 A;  4NC3 A;  3ZQY A;  5JT4 A;  4CX9 A;  4JEB A;  4U9D A;  1S05 A;  3QVY A;  3HNL A;  3M4B A;  1YYJ A;  2J9B A;  4CDY A;  1E83 A;  1YZC A;  2XLW A;  1LM3 B;  4U9E A;  4ULV A;  3HNK A;  3NMI A;  4CIP A;  3C62 A;  5B3I A;  1QQ3 A;  4D4N A;  5JVE A;  1QPU A;  2XLV A;  256B A;  3M79 A;  3VRC A;  3NMK A;  1RCP A;  4IB4 A;  2XLO A; 
#chains in the Genus database with same CATH topology
 2OQM A;  5KYN A;  2Q4F A;  2XXA B;  1ST6 A;  3HLZ A;  3OWT A;  2L7A A;  5L0D A;  4WGZ A;  3W8H A;  2XL6 A;  4OIN F;  3IHU A;  3M1C B;  4PAC A;  1F1M A;  5T3T A;  2CCY A;  2QTV A;  4JRZ A;  3TQO A;  5L3Q A;  1OCZ C;  2XLE A;  4MVM A;  5KYW B;  1J8M F;  1BZ4 A;  1VB5 A;  4Z9H A;  3QTH A;  3IQ5 A;  2A68 F;  4P6I C;  1TKN A;  5B1B C;  1H6G A;  2J8W A;  3NRH A;  1ZW3 A;  2P6V A;  1BR4 A;  3UMI A;  5KYY B;  2VCB A;  3B0P A;  1JAF A;  4XPX A;  3LAY A;  4DRH B;  5JSL A;  1YJG A;  3ZTZ A;  2L6G A;  2Y3D A;  3CAX A;  1RJ9 A;  2XRH A;  4GYT A;  1OW7 A;  4KBL A;  2EPO A;  1A7E A;  4JTC B;  3SP1 A;  3UMK A;  1FAP B;  2P7V A;  2QUP A;  4PJL A;  4YL0 A;  4A4A A;  4JC7 A;  2UUH A;  2Y3G A;  4J7Y A;  2HJ3 A;  1CGN A;  3MX3 A;  1OW8 A;  2I15 A;  4C7O B;  4XTK A;  1MMN A;  1QKR A;  4G78 A;  4KI2 A;  1R4T A;  2PFD A;  4R32 A;  1YDI A;  2LD6 A;  4CJG A;  1ZYR F;  5AC5 A;  1SF8 A;  5KYU B;  2ZXR A;  2P0N A;  4MTF A;  4W8P A;  2AU5 A;  2EIN C;  2VCC A;  2HFI A;  4XPW A;  3FOO A;  5COF A;  3FVY A;  2EPN A;  4MS2 A;  3JZ0 A;  5A69 A;  3W8I A;  2M4E A;  1YYX A;  2HKV A;  1UFB A;  4RDA A;  4FAP B;  1D1A A;  3A11 A;  1CPQ A;  1Z3I X;  1T6Q A;  3EFO A;  3LUT B;  4P9F A;  5BUO A;  2R7Q A;  1LE2 A;  3G50 A;  4J7T A;  5L0G A;  1D1B A;  3CQZ A;  1OCR C;  4I3M A;  1NFN A;  3X2Q C;  2Q9A A;  1L7C A;  2LFD A;  3ABK C;  3EZI A;  3G4X A;  3K1H A;  2EPK X;  2O9X A;  5EK0 A;  4XLP F;  3JRT A;  1YA7 O;  4QI2 A;  1GGQ A;  2LSE A;  2PF4 E;  2AP3 A;  1LPE A;  3CEX A;  3U0C A;  1NZE A;  1Q0G A;  1BBH A;  1TQG A;  3VAY A;  1D0Y A;  2R7S A;  3B9Q A;  4O6N A;  5JUA A;  2P61 A;  2WZL A;  3DE9 A;  1T6U A;  3T6G B;  4CDV A;  3SNH A;  4ZLD A;  1WAT A;  2GFH A;  4IWB A;  4U5D E;  3U2L A;  1BR2 A;  1H7I A;  1XWJ A;  4BG0 A;  4HEA J;  4K0D A;  3FDQ A;  2EPM X;  3C8Z A;  4OIR F;  2B0H A;  5EHH A;  2XM4 A;  3S29 A;  2C04 A;  2HSB A;  4NC3 A;  4LDQ A;  2KW3 C;  1FR0 A;  2BL2 A;  1V55 C;  4NCQ A;  3GM3 A;  1VOM A;  4NQF A;  4NTA A;  1ZU5 A;  4YL1 A;  1NSG B;  4XLN F;  4WJ0 A;  3VF0 A;  2GAQ A;  2VAS A;  2J9B A;  2NSF A;  4QI0 A;  3O55 A;  1HE9 A;  2WB7 A;  1A7D A;  1WOL A;  1Z6A A;  3F46 A;  1LS1 A;  4H4K C;  1YAU O;  2F22 A;  4Z9J A;  3UR3 C;  3RFY A;  1Y6D A;  3C8G B;  3GOD A;  1BDJ B;  1RXQ A;  3X1O A;  3HNK A;  3NMI A;  3RF3 A;  2LK4 A;  4OD4 A;  5L3V A;  2ZXW C;  1TR2 A;  4PJJ A;  3R7C A;  4Q7C A;  3SEO A;  3UNG C;  2YQY A;  1M56 C;  1NU7 D;  2HUJ A;  1QQ3 A;  1XZQ A;  4D4N A;  1J8Y F;  4IRU A;  2GWW A;  3ATP A;  4JIO A;  2OG2 A;  2KGO A;  1LI5 A;  4BJT A;  4DXW A;  4YWQ A;  1NU9 C;  2ASR A;  3L34 A;  4XEK A;  1QZX A;  3LEO A;  4IAO A;  3PHF 2;  1QSP A;  3K1I C;  2AWY A;  2KQ9 A;  2HV7 A;  3EG9 B;  3AG3 C;  2PNO A;  3K1I A;  4G0H A;  5KYX B;  3B0U X;  2G62 A;  2RSE B;  1ORY A;  4WGY A;  1LVK A;  1TWC A;  2FFH A;  2XLM A;  1VK5 A;  3DZA A;  5BQI A;  1KTM A;  3JTL O;  4O6Y A;  2YL0 A;  3MBG A;  4JJG A;  2EIL C;  2B0J A;  2DGJ A;  4BJ6 C;  1CGO A;  4PFP A;  3FAP B;  4NY3 A;  4P9T A;  3JCU Q;  2XS1 A;  4G7Z F;  1T01 A;  3S28 A;  1PD1 A;  4GQH A;  5BQG A;  5T3W A;  1MMA A;  2X0C A;  2YWA A;  4LER A;  4CDA A;  1T5O A;  3FMS A;  1E85 A;  2W45 A;  4UDV A;  2Q00 A;  1TWH A;  5COG A;  2NUT A;  2AVK A;  2FAP B;  4K7B A;  3IPM O;  3S90 A;  1OCC C;  1ZHX A;  3UGO A;  3GOR A;  1QLE C;  4JKV A;  5FZT A;  4YT8 A;  2PP4 A;  3S9O A;  1Z5Z A;  4JTD B;  1EQ1 A;  1Z63 A;  1S7Z A;  3KL4 A;  1A7V A;  1CPR A;  1MNE A;  3DM5 A;  3RQF A;  4U5F E;  3MYI A;  3LLK A;  2XS8 A;  1JOG A;  2CDQ A;  4JCZ A;  5FCL A;  1EI7 A;  3QZC A;  3EPV A;  2CGE A;  2XSE A;  3U5S A;  3US6 A;  4Q5S F;  1A41 A;  2KSF A;  3HTK C;  4CJO A;  4DRJ B;  4EBK A;  4EBB A;  1V4A A;  2XM0 A;  3NMJ A;  3NYM A;  4MVS A;  2R7U A;  1U6H A;  3GEI A;  3ZSU A;  3J06 A;  3VYW A;  3AGT A;  3ABL C;  1K05 A;  4EHP A;  2IM8 A;  3DJU B;  4IAQ A;  3QW1 A;  4BJ5 C;  4EWC A;  5A6A A;  3NKD A;  4HE8 D;  2J46 A;  1KU2 A;  2M64 A;  4BJ5 A;  5AGF A;  2OKU A;  5HV9 A;  2R7W A;  3M4C A;  5L0J A;  5F5H A;  1OXB A;  1E86 A;  1UG7 A;  5CI8 A;  3E9V A;  3EGX B;  3GWN A;  2R7X A;  5L0F A;  3BRJ A;  4MVO A;  2GA0 A;  3HNI A;  2W9Y A;  1LI7 A;  4NTF A;  4N6C A;  4N6H A;  5E2Q A;  3U8P A;  3U9J A;  3GM2 A;  3Q6N A;  1WN0 A;  4EIY A;  3S0X A;  2TMV P;  4EKW A;  2OOC A;  2KYH A;  2XL8 A;  1WTY A;  1D1C A;  2PBE A;  4PFO A;  3ZTM A;  1HMD A;  1E2X A;  2Q9C A;  5DQZ A;  4O6M A;  3PDM P;  4LLE A;  2YL7 A;  2UUI A;  5JP7 A;  2R05 A;  3EGD B;  1TWG A;  1VYI A;  4C3B A;  3I4U A;  3FXH A;  4KNW A;  2XXA A;  2YVK A;  3WHN A;  2NPU A;  1MMD A;  2KNH A;  4CSA C;  1PV3 A;  4QDL A;  2LP4 A;  2KK1 A;  3OEO A;  2J45 A;  3C18 A;  2IYL D;  4EUK B;  4CIH A;  2HZ8 A;  5KYW A;  2L81 A;  4CSA A;  2WZG A;  3ZQY A;  5JT4 A;  3W2W A;  4CX9 A;  5CIV A;  5A6B A;  1RMV A;  2A6H F;  3RKO F;  2IXO A;  3R2P A;  4AL0 A;  1RKE B;  1YLM A;  2WVO A;  5TJ5 E;  5DS5 A;  1LIH A;  1OR2 A;  3AQC A;  4IGG A;  5F28 E;  3LES A;  3ZIB A;  4O7G A;  4WAB A;  4CDY A;  2IXM A;  5KYY A;  3RVY A;  2ZD9 A;  4MW3 A;  2H7B A;  3H65 A;  1HE1 A;  2NUP B;  2R02 A;  2CYD A;  2H7V C;  3JT1 A;  3DAG A;  4U9E A;  4BPM A;  2WL8 A;  4DVZ A;  3C62 A;  4F4B A;  3ZWI A;  1OXK A;  3SZR A;  3TJ6 A;  3UGP A;  1MND A;  5B3I A;  5HSW A;  2Q9B A;  3L0I A;  2A0B A;  1NLX A;  4DJ9 A;  4ONS A;  2MWQ A;  5T1D B;  3B71 A;  4LAC B;  3AJM A;  1SR2 A;  1XZP A;  2VH3 A;  3M79 A;  2J9V A;  1RCP A;  4C7O A;  4IB4 A;  3Q7L A;  3SXK A;  4MVU A;  4C3D A;  1AEP A;  1D0Z A;  5L0H A;  1WGW A;  2YHS A;  3JSZ A;  5KYU A;  1KNY A;  4H54 A;  3ITF A;  4Q4Z F;  3NYL A;  3C7J A;  3CZ6 A;  2EIM C;  3DE8 A;  5B1A C;  4E0I A;  3QVZ A;  4OIO F;  4XEV A;  2AWC A;  2R7O A;  3KYJ A;  2ETS A;  5E33 A;  4AE4 B;  3O10 A;  3RH3 A;  2LCH A;  2ZXP A;  4U5E E;  1IZM A;  1M6T A;  1OW6 A;  1RKE A;  2YL3 A;  3L8J A;  1EKY A;  3KYI A;  3L8I A;  3KMI A;  2L6H A;  3PCV A;  2HV6 A;  2MHR A;  4OD5 A;  1M2V B;  4ULW A;  2EPL X;  1PCX A;  1TWA A;  1LE4 A;  4HFF B;  3POV A;  3W2V A;  4EBJ A;  4JCH A;  3TJ5 A;  4B6I A;  4YT5 A;  4J32 B;  3L1M A;  3QW0 A;  3DWW A;  4N4W A;  5DS4 A;  2DYS C;  3TOM A;  2EIK C;  3HKK A;  4ZLC A;  2OJE D;  4O79 A;  4DVY P;  3EHN A;  2E87 A;  1I4Z A;  2Y3B A;  3M15 A;  4CS7 A;  3H2U A;  3I5P A;  1VYK A;  2D4U A;  5JRA A;  3N24 A;  3ZC4 A;  1E84 A;  1V74 B;  3G4Z A;  2A6E F;  3ECS A;  3U8V A;  3DI5 A;  4MVZ A;  2C03 A;  3DJN B;  1W2W A;  4JTA B;  1MQV A;  3H2V A;  4BJ1 A;  3I5Q A;  2OJQ A;  2Q7R A;  3EH1 A;  3DM9 B;  1OKK A;  2WVQ A;  3LS0 A;  1B68 A;  2P1A A;  3ZG1 A;  3GM1 A;  4CBE A;  4E0H A;  1VLT A;  3DXJ F;  3JYY A;  1T6I A;  3C8G A;  4JE9 A;  3TK0 A;  5DQT A;  2QE9 A;  1BR1 A;  3NKE A;  2V26 A;  1C03 A;  1QVX A;  1OCO C;  4MVQ A;  1G4W R;  1ORJ A;  4YT2 A;  3AG1 C;  4FX5 A;  1EA8 A;  1K04 A;  2BE5 F;  4XQ1 A;  3LNM B;  2XLD A;  1FMV A;  1GM5 A;  3IQ6 A;  4U5C E;  1ZHY A;  2Z15 A;  1HY5 A;  4PK4 A;  1C02 A;  3ASO C;  1JR8 A;  1JPJ A;  1ZU4 A;  1CGM E;  4I1M A;  3EG9 A;  4MTG A;  1RJ9 B;  1T9K A;  2PX0 A;  3HNJ A;  5KYX A;  2Y3H A;  1U89 A;  4FWV A;  3K66 A;  4CS9 C;  1JMW A;  2R7V A;  3WAQ A;  3LLI A;  3KKB A;  3RIP A;  4PJN A;  1ZHW A;  3RVZ A;  4CS9 A;  4DRI B;  4AK9 A;  3A9C A;  5BQH A;  1Q0M A;  4AX2 A;  1U0B B;  4MVR A;  2QY9 A;  2RD9 A;  3AGU A;  4JEB A;  4KC9 A;  4U9D A;  4G7H F;  1DOV A;  3WOD F;  2L6F A;  4M63 A;  3V5Y A;  1DOW A;  2JPU A;  2L9J A;  1OKK D;  3ABM C;  4BEM J;  3SXM A;  2WVN A;  3HJC A;  4E18 A;  4OIQ F;  1YZC A;  2XL4 A;  2OU6 A;  3C8G D;  3U9M A;  2Y39 A;  3U2M A;  1N1C A;  4ULV A;  1G4U S;  3FAJ A;  3EFO B;  4E7S A;  3JRM O;  1H9G A;  3OA1 A;  1I5N A;  3RQE A;  1K40 A;  2HMQ A;  4JJF A;  1ZZP A;  2G3V A;  3KH2 A;  1QPU A;  4XEF A;  3GEE A;  2XLV A;  4YJW A;  4AL1 A;  2J0W A;  256B A;  2Y69 C;  1C17 M;  2ZPA A;  4HFK B;  3VRC A;  5IY5 C;  3LJB A;  3AG2 C;  4MW8 A;  2G3K A;  1HMO A;  1G8X A;  3K6B A;  4GEH A;  1V54 C;  3DKA A;  4D4X A;  4MND A;  1VMA A;  3N2Z B;  4Z9I A;  4YN0 B;  3ZQV A;  5B3S C;  4DBR A;  1VLS A;  2V3C C;  2YLI A;  2VCA A;  2FGY A;  2JX0 A;  3AOU A;  4CS8 C;  2J0X A;  3AG4 C;  1NFO A;  2J9W A;  1HW2 A;  2W4M A;  4JEA A;  4CS8 A;  1RKC A;  2CW0 F;  3KPH A;  5GPG B;  4JVS A;  4JUR I;  4U5H A;  1SYQ A;  2CNW A;  3DMD A;  5D91 A;  5EGY A;  2NG1 A;  2MYS A;  3EGX A;  2YLG A;  3JYH A;  4U5B E;  2OEV A;  2LQG A;  3MLG A;  4IJJ A;  5JLI A;  1AVO B;  3IQC A;  2J9U A;  5CI9 A;  3FOP A;  3TUL A;  1SZI A;  2PX3 A;  2J7P A;  5DVW A;  3K33 A;  3JSE O;  3GAN A;  2HMZ A;  1Q0K A;  3IQT A;  3MFN A;  3N0T A;  3SXY A;  1TFK B;  5L0C A;  4MQ9 F;  3K7D A;  2R03 A;  1IW7 F;  1Y4C A;  4W8K A;  1SMY F;  3EGD A;  1FMW A;  3CSK A;  3F47 A;  2QLA A;  1M57 C;  4DBQ A;  2R9R B;  1YAR O;  4A2N B;  1Q0F A;  2HJM A;  3EQL F;  1JPN A;  4K1O A;  4YK5 A;  1L3P A;  2DB4 A;  1Q0D A;  2GDC A;  3E70 C;  2YLD A;  2JD3 A;  3EZH A;  4J30 B;  5JS5 A;  5E3A A;  2HS5 A;  3EJN A;  2D5R B;  1WAS A;  4BEJ A;  1APC A;  4YT4 A;  1O5H A;  3C63 A;  5A6B D;  1AUE A;  3IEE A;  1NBB A;  1ORS C;  2KJG A;  3U3B A;  2DYR C;  4KNV A;  2A69 F;  1M2O A;  4X0R A;  2YRF A;  2DI3 A;  3LNR A;  3TOL A;  1YZA A;  4MTO A;  4N06 A;  4E17 A;  4FES A;  4LLC A;  4RD9 A;  2NUP A;  5E3C A;  3RW0 A;  2CNW D;  2XLH A;  3RQG A;  2VC9 A;  4ANJ A;  4C3E A;  3LEV A;  1OR3 A;  3ZDL A;  3B0V C;  2YL1 A;  1GQA A;  2KC3 A;  2BC5 A;  2YZS A;  4L6R A;  1I4Y A;  2IXN A;  3DD7 A;  4JZA A;  1JRA A;  1YVI A;  3GEH A;  4PR9 A;  5A6J A;  4I1O B;  5AC4 A;  2ZXO A;  2J7P D;  2VB6 A;  3PMR A;  1O87 A;  1ZHZ A;  2IOQ A;  2WZF A;  2YKZ A;  4IAR A;  4JW1 A;  4U5G A;  3S27 A;  3RYL A;  3VM6 A;  1FFH A;  2NUT B;  3B29 A;  1ZHT A;  4LDK A;  2R7R A;  1A0B A;  4OIP F;  3EHM A;  2I8B A;  3O39 A;  3SXZ A;  3TD7 A;  5L0I A;  3ASN C;  2OCC C;  1ZVZ A;  3S84 A;  3EH2 A;  2NSG A;  2H8A A;  3BEH A;  5A6K A;  2OEX A;  3T6J A;  4LDR A;  4XPY A;  1FTS A;  2W4B A;  1LS4 A;  3NYJ A;  3WG7 C;  5DLJ A;  1Z23 A;  2A0U A;  2EIJ C;  2QNL A;  3QMK A;  5COM A;  4ER9 A;  4G7O F;  1MMG A;  3T9O A;  4AE4 A;  1FFT C;  1S05 A;  2A1D D;  4E7Z A;  1O3U A;  2IXP A;  5D92 A;  4I44 A;  1FNT c;  3AQB A;  3GWL A;  3HNL A;  3QVY A;  4YL3 A;  2LIG A;  2R25 A;  1HW1 A;  1M2V A;  1YYJ A;  3M4B A;  3SYN A;  3T6B A;  5DS6 A;  1LKX A;  3MYF A;  2X51 A;  3V7O A;  1E83 A;  3NDB B;  2Q3T A;  3U3F A;  2XLW A;  4DOZ A;  1PD0 A;  1Z7Q c;  1LM3 B;  1TFO B;  1VTM P;  4PJM A;  3DAF A;  1WWP A;  4BJ6 A;  3V5X A;  4CIP A;  1OQC A;  3FHD A;  1D0X A;  3NG1 A;  2YEV A;  3ZVR A;  1NG1 A;  3O6X A;  2IBF A;  3LS1 A;  2HSQ A;  4NTB A;  1GS9 A;  1R5I D;  4RBN A;  5JVE A;  2R7T A;  3T4R A;  2ICW G;  1YA9 A;  4XWJ A;  1ZW2 A;  3Q6M A;  2LFF A;  3V5Z A;  1H9T A;  3NMK A;  5K0I A;  2H7O A;  3Q7G A;  5F5F A;  2XLO A;  1G5Z A;  3UMH A;  3W4Y A; 
#chains in the Genus database with same CATH homology
 3ZQV A;  2YLI A;  4WGY A;  2XLM A;  3DE8 A;  4WGZ A;  2XL6 A;  4JEA A;  2YL0 A;  3QVZ A;  2CCY A;  2XLE A;  1CGO A;  3IQ5 A;  1M6T A;  2YL3 A;  1EKY A;  2YLG A;  2J8W A;  5JLI A;  4D4X A;  3FOP A;  4CDA A;  1E85 A;  1JAF A;  3L1M A;  3QW0 A;  4N4W A;  4JKV A;  5JSL A;  3TOM A;  3ZTZ A;  2QLA A;  3M15 A;  1A7V A;  1CPR A;  5JRA A;  5JS5 A;  2YLD A;  1E84 A;  1CGN A;  1APC A;  1MQV A;  3C63 A;  4CJO A;  4CJG A;  1NBB A;  2XM0 A;  3NMJ A;  3TOL A;  3FOO A;  1YZA A;  3QW1 A;  4IAQ A;  5AGF A;  2XLH A;  4JE9 A;  1YYX A;  3M4C A;  1E86 A;  2YL1 A;  1CPQ A;  1GQA A;  2BC5 A;  4L6R A;  3HNI A;  4N6H A;  3U8P A;  3ZWI A;  4EIY A;  2XL8 A;  4IAR A;  2XLD A;  2YKZ A;  3IQ6 A;  3ZTM A;  1BBH A;  5JUA A;  2YL7 A;  3DE9 A;  5JP7 A;  4CDV A;  3HNJ A;  4ER9 A;  2XM4 A;  4NC3 A;  3ZQY A;  5JT4 A;  4CX9 A;  4JEB A;  4U9D A;  1S05 A;  3QVY A;  3HNL A;  3M4B A;  1YYJ A;  2J9B A;  4CDY A;  1E83 A;  1YZC A;  2XLW A;  1LM3 B;  4U9E A;  4ULV A;  3HNK A;  3NMI A;  4CIP A;  3C62 A;  5B3I A;  1QQ3 A;  4D4N A;  5JVE A;  1QPU A;  2XLV A;  256B A;  3M79 A;  3VRC A;  3NMK A;  1RCP A;  4IB4 A;  2XLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...