256BA

Improvement of the 2.5 angstroms resolution model of cytochrome b562 by redetermining the primary structure and using molecular graphics
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Improvement of the 2.5 A resolution model of cytochrome b562 by redetermining the primary structure and using molecular graphics.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords CYTOCHROME B562
total genus 49
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 256bA00
1APCA 4JEAA 4ULVA 2YL1A 1EKYA 4EIYA 4ER9A 2XLEA 5B3IA 2XLOA 3ZTMA 2BC5A 1BBHA 1A7VA 3HNKA 3M4BA 3ZTZA 4CJGA 4NC3A 1YZCA 5JVEA 2YL3A 5AGFA 1NBBA 3U8PA 5JRAA 4N6HA 2XL8A 1M6TA 4IAQA 256BA 1CGNA 4D4XA 2YLGA 4CDYA 4CIPA 4IARA 2CCYA 4L6RA 1LM3B 3M4CA 5JLIA 2YLDA 3TOMA 5JT4A 4CDVA 3C63A 1CPQA 3M15A 1CGOA 2YL7A 4CX9A 1E85A 3FOPA 2QLAA 4CJOA 3DE9A 3M79A 4CDAA 1YZAA 3QW0A 4JKVA 1JAFA 3ZQVA 2XLMA 3DE8A 1GQAA 3TOLA 1E83A 3HNLA 2XL6A 1E84A 3QVZA 3ZQYA 4JEBA 3NMIA 5JS5A 4U9EA 1YYJA 1QQ3A 3HNIA 2XLHA 2YL0A 3L1MA 1CPRA 4WGYA 4WGZA 4D4NA 3QVYA 1YYXA 4U9DA 3NMKA 1QPUA 5JP7A 1RCPA 2J9BA 3C62A 5JSLA 2XM4A 1MQVA 3VRCA 4JE9A 5JUAA 3ZWIA 3QW1A 4N4WA 3FOOA 3HNJA 2XM0A 2YKZA 1S05A 2XLWA 3IQ5A 1E86A 4IB4A 2J8WA 3NMJA 3IQ6A 2XLDA 2XLVA 2YLIA
chains in the Genus database with same CATH superfamily
2DGJA 1LS4A 2Y3DA 2PF4E 4FX5A 2HS5A 3X1OA 3TULA 1JPNA 3GORA 2TMVP 4YT4A 2L81A 5KYWA 5KYUB 4PJNA 2YZSA 1Y4CA 3S28A 1Q0DA 4XWJA 2YEVA 2XLEA 1MNEA 1C17M 1R5ID 3DXJF 5T1DB 2W45A 3S9OA 5B3SC 1OR2A 4CSAA 1QZXA 3K1IC 3AJMA 2X0CA 3TK0A 1G5ZA 3KYJA 1H9GA 2BC5A 3ABMC 2HV6A 5B1BC 1D1BA 1YDIA 3AQBA 3ECSA 3HKKA 3NKEA 4R32A 2Q3TA 3JSEO 3ZTZA 1NZEA 3V7OA 1YARO 3FAJA 1G4US 3AOUA 1OKKA 3GM2A 3LAYA 5JVEA 1IW7F 4MVMA 1TWCA 1XWJA 2EILC 5L0FA 1D0ZA 3GEIA 3OWTA 4YK5A 4XEFA 1WGWA 1V4AA 2GWWA 3TQOA 2AP3A 1M6TA 2XL8A 3ABLC 3C8GD 3FAPB 4LDRA 4XLNF 2RSEB 4HFFB 4D4XA 2CNWD 2YLGA 4DJ9A 4CIPA 1EA8A 4IARA 3WODF 4AE4B 1J8YF 4LACB 4L6RA 4XEKA 1RMVA 3N24A 1AUEA 3L8JA 3EGDB 4RD9A 2WZFA 2H7BA 3DM9B 3RW0A 3FMSA 5FCLA 1TQGA 1OW6A 2NSGA 2H7VC 3ZSUA 4M63A 1CPQA 2Y39A 3M15A 3RQEA 1JOGA 2H7OA 2YL7A 4XLPF 3IHUA 4NTAA 5L0GA 1M56C 4I1MA 4JVSA 5DQTA 1O5HA 5E3AA 1IZMA 2R7TA 2L6GA 4BEJA 3AG1C 4E7ZA 4EHPA 1CGME 3FOPA 4F4BA 2E87A 1Z5ZA 4Z9HA 2KSFA 3U2MA 3DJNB 1Z23A 2Y69C 3DE9A 3M79A 4YWQA 3CEXA 3A9CA 2KYHA 5AC5A 3QW0A 5L0DA 3JCUQ 4JC7A 3IQCA 4JCZA 2QY9A 3RH3A 3DE8A 3EH2A 4LERA 3SXMA 3K33A 1GQAA 1QLEC 3LEOA 4PJJA 1OXKA 1QVXA 4U5CE 1PV3A 2VCBA 3NYMA 1OXBA 1ZU5A 1XZPA 2HV7A 1MMGA 2DYSC 3C7JA 1VB5A 3QVZA 4YT8A 3SEOA 4CS7A 3NMIA 1M2OA 2A6HF 1A7EA 2NUTB 2ASRA 1FFTC 1L7CA 2WVOA 1HE1A 3U9MA 3AGTA 1ZHYA 2HUJA 3U0CA 1OW7A 3HNIA 3EGDA 4JRZA 2G3KA 2YL0A 3DM5A 3JZ0A 4NCQA 1Z7Qc 1BR2A 3VM6A 2L6HA 3HLZA 4K7BA 4WGZA 4EBBA 4FAPB 1VK5A 3QVYA 4HFKB 4LDQA 1Q0GA 2FGYA 2M4EA 5JP7A 4U5DE 4AK9A 3C62A 4IRUA 2XM4A 2AVKA 3UMIA 4KBLA 3TJ6A 1OW8A 3ZWIA 3FOOA 3OA1A 2XM0A 1OCRC 2YKZA 2MHRA 3E70C 4IWBA 5KYXA 3C8GB 3W8IA 2OKUA 4DVYP 3SNHA 1L3PA 2IOQA 4PJLA 1LI5A 2W4BA 3UGOA 1I5NA 4KNWA 2CGEA 4FWVA 3GEHA 3GEEA 2G3VA 1ZHTA 2J9UA 2JD3A 2DB4A 1NU7D 2EPKX 2L9JA 2XLDA 2YLIA 1APCA 3ASNC 2X51A 4NQFA 4ULVA 5EK0A 3CSKA 3IPMO 2YL1A 5KYYA 4N06A 1EKYA 4JTAB 1GS9A 2OG2A 2DI3A 4ER9A 3J06A 4ZLDA 1R4TA 2J0WA 2R05A 2Q7RA 4CS9A 4BJ5A 4NTBA 2VCCA 3LJBA 4U5FE 2IXOA 1HMOA 5COGA 5T3TA 3ZTMA 1A7DA 3NKDA 4JJFA 1MMAA 1PD0A 3V5ZA 1BBHA 1NFNA 2V26A 3I5QA 4MVZA 3ATPA 1OQCA 3AQCA 2HSQA 4NC3A 1LIHA 1AVOB 2O9XA 2GA0A 4BG0A 5DS5A 2UUHA 3AG3C 2R7UA 1K40A 3UR3C 4G7ZF 3F46A 1FAPB 3G50A 1C03A 3RYLA 2L7AA 2EPLX 2Q9AA 3EJNA 4NY3A 5DVWA 3MBGA 2Q4FA 4E0HA 3US6A 2Q00A 3DI5A 3Q7LA 4MVQA 2MYSA 2XS8A 3NG1A 3R2PA 3B9QA 3S27A 1ZHWA 3T6JA 1CGNA 2LD6A 3EFOB 1VTMP 2VH3A 3JT1A 1EQ1A 4CDYA 2VASA 1HE9A 4JURI 1NFOA 2CCYA 1ZW2A 4MNDA 3H2UA 5EHHA 1M2VA 3MFNA 1OKKD 1LM3B 1ORSC 2A6EF 4HEAJ 4I3MA 4Z9JA 2YLDA 3LEVA 5BQGA 3U2LA 1DOWA 3DJUB 4PR9A 1LI7A 3NYJA 2KW3C 4MVOA 3K1IA 3JRTA 4BJ5C 4O6YA 4K0DA 2D4UA 2A1DD 2HMZA 2J45A 5JT4A 2ETSA 1O3UA 5F28E 5CIVA 3RQGA 2Y3GA 3O10A 3Q6MA 2LK4A 3SXZA 4BEMJ 5F5FA 4ANJA 2RD9A 3BRJA 3FXHA 4XEVA 3SXYA 3W2WA 4CX9A 5IY5C 1OCOC 3FHDA 4U5BE 2Q9CA 1E85A 3I4UA 3WAQA 2EIJC 3L34A 2LFFA 2VB6A 1Q0MA 2CYDA 2PX3A 3C8ZA 2WZLA 4CDAA 1A41A 1OCCC 2W4MA 3LNRA 1AEPA 3ZQVA 3C18A 1OCZC 5KYYB 5BQIA 1TFKB 1D0YA 4YL3A 4O7GA 1K04A 4O6NA 5HV9A 1BDJB 3EZHA 3T9OA 2EPMX 5T3WA 1QKRA 1E84A 3ZQYA 1G8XA 2HJMA 3KL4A 3HTKC 1PD1A 2LFDA 2QUPA 2PP4A 3O6XA 4MS2A 4U5GA 5COFA 4YN0B 4U9EA 5E2QA 3ITFA 4A2NB 4C3BA 5JS5A 4BPMA 3G4ZA 5F5HA 1ZW3A 3GWNA 4Z9IA 4MQ9F 4BJ1A 5DQZA 1SF8A 2IBFA 4BJ6C 2JPUA 1ZVZA 4W8PA 2OJQA 4WGYA 4LDKA 3B29A 2KJGA 3GODA 2ICWG 1PCXA 4AL0A 1BR1A 1YYXA 4IAOA 4JTDB 1QPUA 4MVSA 1HY5A 2EINC 4GYTA 3ZG1A 5L0JA 1G4WR 2J9BA 2A0BA 1WATA 2Y3BA 2YVKA 1HMDA 3DKAA 5JSLA 4CS8C 1GM5A 3L8IA 4JE9A 3VRCA 2Z15A 2M64A 3QW1A 4BJTA 3EG9A 3KKBA 3DZAA 2HJ3A 4CBEA 3GWLA 3UMHA 2Y3HA 3W2VA 2R7WA 2LCHA 1XZQA 1S05A 2C04A 4OIPF 3M1CB 2VCAA 2XSEA 4IGGA 4J32B 4MTGA 2J8WA 2QTVA 2LQGA 5GPGB 5K0IA 3K1HA 1N1CA 1YVIA 1KNYA 3IQ6A 4MW3A 2NUPB 3ZIBA 4I44A 2UUIA 1MNDA 1T6IA 2B0JA 1J8MF 2EIMC 1D1CA 3IEEA 4JEAA 1V55C 2KK1A 2AWYA 2YQYA 2L6FA 2EPNA 2R7VA 4EIYA 5DS6A 3K7DA 3MYIA 1NSGB 3VAYA 1W2WA 2P6VA 3EQLF 4J30B 4OD5A 1WASA 5B3IA 3POVA 1JPJA 3JRMO 3RVYA 4BJ6A 2HSBA 2A68F 2XLOA 2V3CC 4RDAA 2IM8A 4E18A 4DVZA 4MTOA 3RVZA 1RJ9B 5DLJA 4O79A 2FFHA 2NUTA 1ST6A 2J46A 3HNKA 3M4BA 2ZXWC 4FESA 2FAPB 4CJGA 1S7ZA 2GAQA 4KI2A 1U6HA 1FR0A 2MWQA 3V5YA 2NUPA 2EIKC 3T4RA 4J7TA 1NG1A 1TFOB 1I4YA 1JR8A 3W8HA 3U8PA 4X0RA 3U3FA 5JRAA 2P7VA 3K6BA 2BE5F 5A6JA 4G7HF 4IAQA 1LS1A 3T6BA 5B1AC 256BA 3SXKA 5TJ5E 2B0HA 2KC3A 1UFBA 2DYRC 2ZXPA 2J7PD 4YJWA 2W9YA 3OEOA 4H54A 3JTLO 3M4CA 4AE4A 3UNGC 3NYLA 5JLIA 4G0HA 2P61A 1VOMA 2QE9A 2BL2A 2XS1A 3GANA 4LLEA 4PACA 3RQFA 4DRJB 1Z63A 3BEHA 4XPWA 4CDVA 3R7CA 1CGOA 2PNOA 3U8VA 5COMA 1JMWA 1FMVA 2VC9A 3U3BA 4JIOA 3RFYA 3S84A 4E0IA 3O55A 4Q7CA 1RJ9A 3T6GB 4I1OB 4Q5SF 2LIGA 2GFHA 4MVUA 5L0CA 4UDVA 1T5OA 3FVYA 1YZAA 1F1MA 4JKVA 1TWGA 3H65A 3JYYA 1ORJA 4C3EA 2NSFA 2QNLA 3SYNA 2P1AA 1SMYF 2J9VA 3GM3A 3U9JA 3E9VA 1VYKA 2PX0A 2YWAA 1Q0FA 3V5XA 4G78A 1E83A 4DBRA 3ZC4A 5L0HA 4P9FA 4JW1A 4NTFA 1YA7O 2ZD9A 1HW1A 3RIPA 3HNLA 4EKWA 1V54C 1MMNA 1VYIA 5A6BD 5L0IA 4YL1A 1O87A 2AU5A 2HKVA 1TWHA 3LLKA 1D1AA 2A0UA 4E7SA 2LSEA 4YT2A 2OJED 4LLCA 5A69A 3S0XA 4EBKA 1T6QA 1YYJA 4JZAA 3DWWA 3Q7GA 4DBQA 2XLHA 3IQTA 4YL0A 3L1MA 2NPUA 1CPRA 1RKEA 3KH2A 4CS9C 2OEVA 3KYIA 2C03A 4PJMA 4D4NA 3W4YA 2OQMA 5HSWA 1KTMA 1RCPA 4AX2A 2ZXOA 5L3VA 1V74B 3GM1A 3AG2C 3ASOC 5DS4A 1YJGA 3S29A 2XXAA 1MQVA 5A6AA 3PHF2 4C7OB 2R7SA 2XL4A 4K1OA 2IYLD 4CIHA 4C7OA 5KYNA 1ZYRF 4N4WA 1BR4A 3C8GA 4JCHA 1K05A 4JJGA 3RF3A 5AC4A 2KGOA 3IQ5A 3K66A 2HZ8A 3QTHA 2R03A 3HJCA 3EGXA 2KQ9A 3NMJA 1WTYA 1SR2A 4MVRA 4KC9A 2XLVA 2I8BA 2PBEA 2A69F 3MYFA 4B6IA 1M57C 1HW2A 1I4ZA 1LPEA 2OU6A 3KMIA 3JSZA 3L0IA 4WJ0A 2ZPAA 3CAXA 4MTFA 3RKOF 4ULWA 1EI7A 2R7QA 1LE4A 3A11A 2IXNA 4J7YA 2R25A 4DXWA 4U5HA 5BUOA 3N0TA 1TWAA 1M2VB 2WZGA 1A7VA 3VYWA 3DMDA 4GEHA 2WVNA 3AG4C 4HE8D 3PDMP 1U0BB 1ZHZA 1YAUO 3VF0A 3WG7C 1H6GA 3CZ6A 1RKEB 3EHMA 1H9TA 3N2ZB 1Z6AA 1RKCA 2LP4A 1LKXA 1YZCA 3ABKC 4O6MA 4XTKA 1T01A 4E17A 2YL3A 1WWPA 4ONSA 5AGFA 1NBBA 2ZXRA 1Z3IX 2IXMA 2H8AA 5A6KA 1U89A 4EBJA 2XXAB 3B0PA 2KNHA 4N6HA 2WB7A 2OEXA 3PCVA 3EFOA 4WABA 3DAFA 3DAGA 2J0XA 3NRHA 2OOCA 2NG1A 5FZTA 2HMQA 3LUTB 3I5PA 3PMRA 3EG9B 4RBNA 3LLIA 3EPVA 4DOZA 2CNWA 1QSPA 1YLMA 2HFIA 1VLTA 2J9WA 2R02A 2R7OA 4IJJA 4P9TA 1T9KA 4P6IC 5D91A 4OINF 3ZDLA 4OIQF 1UG7A 3EGXB 3DD7A 1FFHA 1A0BA 4YT5A 1Q0KA 1VMAA 3TOMA 1FTSA 4CSAC 3S90A 3FDQA 4QI2A 3C63A 3LNMB 4N6CA 1GGQA 3SZRA 5KYWB 4KNVA 3LESA 5CI9A 1T6UA 3B71A 3LS1A 5EGYA 2R7RA 3TJ5A 3MX3A 3X2QC 1VLSA 2PFDA 5A6BA 1Y6DA 5D92A 1ZU4A 2G62A 5E3CA 2QLAA 3H2VA 4XQ1A 3CQZA 5KYXB 1SYQA 3F47A 4CJOA 3TD7A 5E33A 2D5RB 4PK4A 1NLXA 4OIOF 1WOLA 1H7IA 4CS8A 2Q9BA 1JAFA 4OIRF 2JX0A 1NU9C 1OR3A 1C02A 1TR2A 1DOVA 2XLMA 4U5EE 3TOLA 4DRHB 1YA9A 2AWCA 4A4AA 3UMKA 1RXQA 1FMWA 2IXPA 2XL6A 2CW0F 3QMKA 3NDBB 3KPHA 1LE2A 2WL8A 4JEBA 4Q4ZF 1ORYA 5BQHA 3AGUA 1WN0A 2EPOA 3EZIA 1JRAA 1LVKA 1QQ3A 1TKNA 2XRHA 4EWCA 3G4XA 1MMDA 2YHSA 4MW8A 3LS0A 2F22A 1ZHXA 3Q6NA 4XPXA 3EH1A 3B0UX 2CDQA 4W8KA 3B0VC 4U9DA 2OCCC 4C3DA 2WVQA 3NMKA 2YRFA 4PFOA 5KYUA 5CI8A 2R9RB 3U5SA 4AL1A 4OD4A 2GDCA 4GQHA 3WHNA 5JUAA 4PFPA 2R7XA 3UGPA 1E2XA 3JYHA 2P0NA 3HNJA 1B68A 4ZLCA 2I15A 4QDLA 1KU2A 3ZVRA 1SZIA 4DRIB 3QZCA 2XLWA 3O39A 1BZ4A 3EHNA 1E86A 4XPYA 1D0XA 1FNTc 1ZZPA 2J7PA 4IB4A 4EUKB 4JTCB 4G7OF 3MLGA 5L3QA 4QI0A 4H4KC 3SP1A
chains in the Genus database with same CATH topology
1APCA 4JEAA 4ULVA 2YL1A 1EKYA 4EIYA 4ER9A 2XLEA 5B3IA 2XLOA 3ZTMA 2BC5A 1BBHA 1A7VA 3HNKA 3M4BA 3ZTZA 4CJGA 4NC3A 1YZCA 5JVEA 2YL3A 5AGFA 1NBBA 3U8PA 5JRAA 4N6HA 2XL8A 1M6TA 4IAQA 256BA 1CGNA 4D4XA 2YLGA 4CDYA 4CIPA 4IARA 2CCYA 4L6RA 1LM3B 3M4CA 5JLIA 2YLDA 3TOMA 5JT4A 4CDVA 3C63A 1CPQA 3M15A 1CGOA 2YL7A 4CX9A 1E85A 3FOPA 2QLAA 4CJOA 3DE9A 3M79A 4CDAA 1YZAA 3QW0A 4JKVA 1JAFA 3ZQVA 2XLMA 3DE8A 1GQAA 3TOLA 1E83A 3HNLA 2XL6A 1E84A 3QVZA 3ZQYA 4JEBA 3NMIA 5JS5A 4U9EA 1YYJA 1QQ3A 3HNIA 2XLHA 2YL0A 3L1MA 1CPRA 4WGYA 4WGZA 4D4NA 3QVYA 1YYXA 4U9DA 3NMKA 1QPUA 5JP7A 1RCPA 2J9BA 3C62A 5JSLA 2XM4A 1MQVA 3VRCA 4JE9A 5JUAA 3ZWIA 3QW1A 4N4WA 3FOOA 3HNJA 2XM0A 2YKZA 1S05A 2XLWA 3IQ5A 1E86A 4IB4A 2J8WA 3NMJA 3IQ6A 2XLDA 2XLVA 2YLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1APC A;  4JEA A;  4ULV A;  2YL1 A;  1EKY A;  4EIY A;  4ER9 A;  2XLE A;  5B3I A;  2XLO A;  3ZTM A;  2BC5 A;  1BBH A;  1A7V A;  3HNK A;  3M4B A;  3ZTZ A;  4CJG A;  4NC3 A;  1YZC A;  5JVE A;  2YL3 A;  5AGF A;  1NBB A;  3U8P A;  5JRA A;  4N6H A;  2XL8 A;  1M6T A;  4IAQ A;  256B A;  1CGN A;  4D4X A;  2YLG A;  4CDY A;  4CIP A;  4IAR A;  2CCY A;  4L6R A;  1LM3 B;  3M4C A;  5JLI A;  2YLD A;  3TOM A;  5JT4 A;  4CDV A;  3C63 A;  1CPQ A;  3M15 A;  1CGO A;  2YL7 A;  4CX9 A;  1E85 A;  3FOP A;  2QLA A;  4CJO A;  3DE9 A;  3M79 A;  4CDA A;  1YZA A;  3QW0 A;  4JKV A;  1JAF A;  3ZQV A;  2XLM A;  3DE8 A;  1GQA A;  3TOL A;  1E83 A;  3HNL A;  2XL6 A;  1E84 A;  3QVZ A;  3ZQY A;  4JEB A;  3NMI A;  5JS5 A;  4U9E A;  1YYJ A;  1QQ3 A;  3HNI A;  2XLH A;  2YL0 A;  3L1M A;  1CPR A;  4WGY A;  4WGZ A;  4D4N A;  3QVY A;  1YYX A;  4U9D A;  3NMK A;  1QPU A;  5JP7 A;  1RCP A;  2J9B A;  3C62 A;  5JSL A;  2XM4 A;  1MQV A;  3VRC A;  4JE9 A;  5JUA A;  3ZWI A;  3QW1 A;  4N4W A;  3FOO A;  3HNJ A;  2XM0 A;  2YKZ A;  1S05 A;  2XLW A;  3IQ5 A;  1E86 A;  4IB4 A;  2J8W A;  3NMJ A;  3IQ6 A;  2XLD A;  2XLV A;  2YLI A; 
#chains in the Genus database with same CATH topology
 2DGJ A;  1LS4 A;  2Y3D A;  2PF4 E;  4FX5 A;  2HS5 A;  3X1O A;  3TUL A;  1JPN A;  3GOR A;  2TMV P;  4YT4 A;  2L81 A;  5KYW A;  5KYU B;  4PJN A;  2YZS A;  1Y4C A;  3S28 A;  1Q0D A;  4XWJ A;  2YEV A;  2XLE A;  1MNE A;  1C17 M;  1R5I D;  3DXJ F;  5T1D B;  2W45 A;  3S9O A;  5B3S C;  1OR2 A;  4CSA A;  1QZX A;  3K1I C;  3AJM A;  2X0C A;  3TK0 A;  1G5Z A;  3KYJ A;  1H9G A;  2BC5 A;  3ABM C;  2HV6 A;  5B1B C;  1D1B A;  1YDI A;  3AQB A;  3ECS A;  3HKK A;  3NKE A;  4R32 A;  2Q3T A;  3JSE O;  3ZTZ A;  1NZE A;  3V7O A;  1YAR O;  3FAJ A;  1G4U S;  3AOU A;  1OKK A;  3GM2 A;  3LAY A;  5JVE A;  1IW7 F;  4MVM A;  1TWC A;  1XWJ A;  2EIL C;  5L0F A;  1D0Z A;  3GEI A;  3OWT A;  4YK5 A;  4XEF A;  1WGW A;  1V4A A;  2GWW A;  3TQO A;  2AP3 A;  1M6T A;  2XL8 A;  3ABL C;  3C8G D;  3FAP B;  4LDR A;  4XLN F;  2RSE B;  4HFF B;  4D4X A;  2CNW D;  2YLG A;  4DJ9 A;  4CIP A;  1EA8 A;  4IAR A;  3WOD F;  4AE4 B;  1J8Y F;  4LAC B;  4L6R A;  4XEK A;  1RMV A;  3N24 A;  1AUE A;  3L8J A;  3EGD B;  4RD9 A;  2WZF A;  2H7B A;  3DM9 B;  3RW0 A;  3FMS A;  5FCL A;  1TQG A;  1OW6 A;  2NSG A;  2H7V C;  3ZSU A;  4M63 A;  1CPQ A;  2Y39 A;  3M15 A;  3RQE A;  1JOG A;  2H7O A;  2YL7 A;  4XLP F;  3IHU A;  4NTA A;  5L0G A;  1M56 C;  4I1M A;  4JVS A;  5DQT A;  1O5H A;  5E3A A;  1IZM A;  2R7T A;  2L6G A;  4BEJ A;  3AG1 C;  4E7Z A;  4EHP A;  1CGM E;  3FOP A;  4F4B A;  2E87 A;  1Z5Z A;  4Z9H A;  2KSF A;  3U2M A;  3DJN B;  1Z23 A;  2Y69 C;  3DE9 A;  3M79 A;  4YWQ A;  3CEX A;  3A9C A;  2KYH A;  5AC5 A;  3QW0 A;  5L0D A;  3JCU Q;  4JC7 A;  3IQC A;  4JCZ A;  2QY9 A;  3RH3 A;  3DE8 A;  3EH2 A;  4LER A;  3SXM A;  3K33 A;  1GQA A;  1QLE C;  3LEO A;  4PJJ A;  1OXK A;  1QVX A;  4U5C E;  1PV3 A;  2VCB A;  3NYM A;  1OXB A;  1ZU5 A;  1XZP A;  2HV7 A;  1MMG A;  2DYS C;  3C7J A;  1VB5 A;  3QVZ A;  4YT8 A;  3SEO A;  4CS7 A;  3NMI A;  1M2O A;  2A6H F;  1A7E A;  2NUT B;  2ASR A;  1FFT C;  1L7C A;  2WVO A;  1HE1 A;  3U9M A;  3AGT A;  1ZHY A;  2HUJ A;  3U0C A;  1OW7 A;  3HNI A;  3EGD A;  4JRZ A;  2G3K A;  2YL0 A;  3DM5 A;  3JZ0 A;  4NCQ A;  1Z7Q c;  1BR2 A;  3VM6 A;  2L6H A;  3HLZ A;  4K7B A;  4WGZ A;  4EBB A;  4FAP B;  1VK5 A;  3QVY A;  4HFK B;  4LDQ A;  1Q0G A;  2FGY A;  2M4E A;  5JP7 A;  4U5D E;  4AK9 A;  3C62 A;  4IRU A;  2XM4 A;  2AVK A;  3UMI A;  4KBL A;  3TJ6 A;  1OW8 A;  3ZWI A;  3FOO A;  3OA1 A;  2XM0 A;  1OCR C;  2YKZ A;  2MHR A;  3E70 C;  4IWB A;  5KYX A;  3C8G B;  3W8I A;  2OKU A;  4DVY P;  3SNH A;  1L3P A;  2IOQ A;  4PJL A;  1LI5 A;  2W4B A;  3UGO A;  1I5N A;  4KNW A;  2CGE A;  4FWV A;  3GEH A;  3GEE A;  2G3V A;  1ZHT A;  2J9U A;  2JD3 A;  2DB4 A;  1NU7 D;  2EPK X;  2L9J A;  2XLD A;  2YLI A;  1APC A;  3ASN C;  2X51 A;  4NQF A;  4ULV A;  5EK0 A;  3CSK A;  3IPM O;  2YL1 A;  5KYY A;  4N06 A;  1EKY A;  4JTA B;  1GS9 A;  2OG2 A;  2DI3 A;  4ER9 A;  3J06 A;  4ZLD A;  1R4T A;  2J0W A;  2R05 A;  2Q7R A;  4CS9 A;  4BJ5 A;  4NTB A;  2VCC A;  3LJB A;  4U5F E;  2IXO A;  1HMO A;  5COG A;  5T3T A;  3ZTM A;  1A7D A;  3NKD A;  4JJF A;  1MMA A;  1PD0 A;  3V5Z A;  1BBH A;  1NFN A;  2V26 A;  3I5Q A;  4MVZ A;  3ATP A;  1OQC A;  3AQC A;  2HSQ A;  4NC3 A;  1LIH A;  1AVO B;  2O9X A;  2GA0 A;  4BG0 A;  5DS5 A;  2UUH A;  3AG3 C;  2R7U A;  1K40 A;  3UR3 C;  4G7Z F;  3F46 A;  1FAP B;  3G50 A;  1C03 A;  3RYL A;  2L7A A;  2EPL X;  2Q9A A;  3EJN A;  4NY3 A;  5DVW A;  3MBG A;  2Q4F A;  4E0H A;  3US6 A;  2Q00 A;  3DI5 A;  3Q7L A;  4MVQ A;  2MYS A;  2XS8 A;  3NG1 A;  3R2P A;  3B9Q A;  3S27 A;  1ZHW A;  3T6J A;  1CGN A;  2LD6 A;  3EFO B;  1VTM P;  2VH3 A;  3JT1 A;  1EQ1 A;  4CDY A;  2VAS A;  1HE9 A;  4JUR I;  1NFO A;  2CCY A;  1ZW2 A;  4MND A;  3H2U A;  5EHH A;  1M2V A;  3MFN A;  1OKK D;  1LM3 B;  1ORS C;  2A6E F;  4HEA J;  4I3M A;  4Z9J A;  2YLD A;  3LEV A;  5BQG A;  3U2L A;  1DOW A;  3DJU B;  4PR9 A;  1LI7 A;  3NYJ A;  2KW3 C;  4MVO A;  3K1I A;  3JRT A;  4BJ5 C;  4O6Y A;  4K0D A;  2D4U A;  2A1D D;  2HMZ A;  2J45 A;  5JT4 A;  2ETS A;  1O3U A;  5F28 E;  5CIV A;  3RQG A;  2Y3G A;  3O10 A;  3Q6M A;  2LK4 A;  3SXZ A;  4BEM J;  5F5F A;  4ANJ A;  2RD9 A;  3BRJ A;  3FXH A;  4XEV A;  3SXY A;  3W2W A;  4CX9 A;  5IY5 C;  1OCO C;  3FHD A;  4U5B E;  2Q9C A;  1E85 A;  3I4U A;  3WAQ A;  2EIJ C;  3L34 A;  2LFF A;  2VB6 A;  1Q0M A;  2CYD A;  2PX3 A;  3C8Z A;  2WZL A;  4CDA A;  1A41 A;  1OCC C;  2W4M A;  3LNR A;  1AEP A;  3ZQV A;  3C18 A;  1OCZ C;  5KYY B;  5BQI A;  1TFK B;  1D0Y A;  4YL3 A;  4O7G A;  1K04 A;  4O6N A;  5HV9 A;  1BDJ B;  3EZH A;  3T9O A;  2EPM X;  5T3W A;  1QKR A;  1E84 A;  3ZQY A;  1G8X A;  2HJM A;  3KL4 A;  3HTK C;  1PD1 A;  2LFD A;  2QUP A;  2PP4 A;  3O6X A;  4MS2 A;  4U5G A;  5COF A;  4YN0 B;  4U9E A;  5E2Q A;  3ITF A;  4A2N B;  4C3B A;  5JS5 A;  4BPM A;  3G4Z A;  5F5H A;  1ZW3 A;  3GWN A;  4Z9I A;  4MQ9 F;  4BJ1 A;  5DQZ A;  1SF8 A;  2IBF A;  4BJ6 C;  2JPU A;  1ZVZ A;  4W8P A;  2OJQ A;  4WGY A;  4LDK A;  3B29 A;  2KJG A;  3GOD A;  2ICW G;  1PCX A;  4AL0 A;  1BR1 A;  1YYX A;  4IAO A;  4JTD B;  1QPU A;  4MVS A;  1HY5 A;  2EIN C;  4GYT A;  3ZG1 A;  5L0J A;  1G4W R;  2J9B A;  2A0B A;  1WAT A;  2Y3B A;  2YVK A;  1HMD A;  3DKA A;  5JSL A;  4CS8 C;  1GM5 A;  3L8I A;  4JE9 A;  3VRC A;  2Z15 A;  2M64 A;  3QW1 A;  4BJT A;  3EG9 A;  3KKB A;  3DZA A;  2HJ3 A;  4CBE A;  3GWL A;  3UMH A;  2Y3H A;  3W2V A;  2R7W A;  2LCH A;  1XZQ A;  1S05 A;  2C04 A;  4OIP F;  3M1C B;  2VCA A;  2XSE A;  4IGG A;  4J32 B;  4MTG A;  2J8W A;  2QTV A;  2LQG A;  5GPG B;  5K0I A;  3K1H A;  1N1C A;  1YVI A;  1KNY A;  3IQ6 A;  4MW3 A;  2NUP B;  3ZIB A;  4I44 A;  2UUI A;  1MND A;  1T6I A;  2B0J A;  1J8M F;  2EIM C;  1D1C A;  3IEE A;  4JEA A;  1V55 C;  2KK1 A;  2AWY A;  2YQY A;  2L6F A;  2EPN A;  2R7V A;  4EIY A;  5DS6 A;  3K7D A;  3MYI A;  1NSG B;  3VAY A;  1W2W A;  2P6V A;  3EQL F;  4J30 B;  4OD5 A;  1WAS A;  5B3I A;  3POV A;  1JPJ A;  3JRM O;  3RVY A;  4BJ6 A;  2HSB A;  2A68 F;  2XLO A;  2V3C C;  4RDA A;  2IM8 A;  4E18 A;  4DVZ A;  4MTO A;  3RVZ A;  1RJ9 B;  5DLJ A;  4O79 A;  2FFH A;  2NUT A;  1ST6 A;  2J46 A;  3HNK A;  3M4B A;  2ZXW C;  4FES A;  2FAP B;  4CJG A;  1S7Z A;  2GAQ A;  4KI2 A;  1U6H A;  1FR0 A;  2MWQ A;  3V5Y A;  2NUP A;  2EIK C;  3T4R A;  4J7T A;  1NG1 A;  1TFO B;  1I4Y A;  1JR8 A;  3W8H A;  3U8P A;  4X0R A;  3U3F A;  5JRA A;  2P7V A;  3K6B A;  2BE5 F;  5A6J A;  4G7H F;  4IAQ A;  1LS1 A;  3T6B A;  5B1A C;  256B A;  3SXK A;  5TJ5 E;  2B0H A;  2KC3 A;  1UFB A;  2DYR C;  2ZXP A;  2J7P D;  4YJW A;  2W9Y A;  3OEO A;  4H54 A;  3JTL O;  3M4C A;  4AE4 A;  3UNG C;  3NYL A;  5JLI A;  4G0H A;  2P61 A;  1VOM A;  2QE9 A;  2BL2 A;  2XS1 A;  3GAN A;  4LLE A;  4PAC A;  3RQF A;  4DRJ B;  1Z63 A;  3BEH A;  4XPW A;  4CDV A;  3R7C A;  1CGO A;  2PNO A;  3U8V A;  5COM A;  1JMW A;  1FMV A;  2VC9 A;  3U3B A;  4JIO A;  3RFY A;  3S84 A;  4E0I A;  3O55 A;  4Q7C A;  1RJ9 A;  3T6G B;  4I1O B;  4Q5S F;  2LIG A;  2GFH A;  4MVU A;  5L0C A;  4UDV A;  1T5O A;  3FVY A;  1YZA A;  1F1M A;  4JKV A;  1TWG A;  3H65 A;  3JYY A;  1ORJ A;  4C3E A;  2NSF A;  2QNL A;  3SYN A;  2P1A A;  1SMY F;  2J9V A;  3GM3 A;  3U9J A;  3E9V A;  1VYK A;  2PX0 A;  2YWA A;  1Q0F A;  3V5X A;  4G78 A;  1E83 A;  4DBR A;  3ZC4 A;  5L0H A;  4P9F A;  4JW1 A;  4NTF A;  1YA7 O;  2ZD9 A;  1HW1 A;  3RIP A;  3HNL A;  4EKW A;  1V54 C;  1MMN A;  1VYI A;  5A6B D;  5L0I A;  4YL1 A;  1O87 A;  2AU5 A;  2HKV A;  1TWH A;  3LLK A;  1D1A A;  2A0U A;  4E7S A;  2LSE A;  4YT2 A;  2OJE D;  4LLC A;  5A69 A;  3S0X A;  4EBK A;  1T6Q A;  1YYJ A;  4JZA A;  3DWW A;  3Q7G A;  4DBQ A;  2XLH A;  3IQT A;  4YL0 A;  3L1M A;  2NPU A;  1CPR A;  1RKE A;  3KH2 A;  4CS9 C;  2OEV A;  3KYI A;  2C03 A;  4PJM A;  4D4N A;  3W4Y A;  2OQM A;  5HSW A;  1KTM A;  1RCP A;  4AX2 A;  2ZXO A;  5L3V A;  1V74 B;  3GM1 A;  3AG2 C;  3ASO C;  5DS4 A;  1YJG A;  3S29 A;  2XXA A;  1MQV A;  5A6A A;  3PHF 2;  4C7O B;  2R7S A;  2XL4 A;  4K1O A;  2IYL D;  4CIH A;  4C7O A;  5KYN A;  1ZYR F;  4N4W A;  1BR4 A;  3C8G A;  4JCH A;  1K05 A;  4JJG A;  3RF3 A;  5AC4 A;  2KGO A;  3IQ5 A;  3K66 A;  2HZ8 A;  3QTH A;  2R03 A;  3HJC A;  3EGX A;  2KQ9 A;  3NMJ A;  1WTY A;  1SR2 A;  4MVR A;  4KC9 A;  2XLV A;  2I8B A;  2PBE A;  2A69 F;  3MYF A;  4B6I A;  1M57 C;  1HW2 A;  1I4Z A;  1LPE A;  2OU6 A;  3KMI A;  3JSZ A;  3L0I A;  4WJ0 A;  2ZPA A;  3CAX A;  4MTF A;  3RKO F;  4ULW A;  1EI7 A;  2R7Q A;  1LE4 A;  3A11 A;  2IXN A;  4J7Y A;  2R25 A;  4DXW A;  4U5H A;  5BUO A;  3N0T A;  1TWA A;  1M2V B;  2WZG A;  1A7V A;  3VYW A;  3DMD A;  4GEH A;  2WVN A;  3AG4 C;  4HE8 D;  3PDM P;  1U0B B;  1ZHZ A;  1YAU O;  3VF0 A;  3WG7 C;  1H6G A;  3CZ6 A;  1RKE B;  3EHM A;  1H9T A;  3N2Z B;  1Z6A A;  1RKC A;  2LP4 A;  1LKX A;  1YZC A;  3ABK C;  4O6M A;  4XTK A;  1T01 A;  4E17 A;  2YL3 A;  1WWP A;  4ONS A;  5AGF A;  1NBB A;  2ZXR A;  1Z3I X;  2IXM A;  2H8A A;  5A6K A;  1U89 A;  4EBJ A;  2XXA B;  3B0P A;  2KNH A;  4N6H A;  2WB7 A;  2OEX A;  3PCV A;  3EFO A;  4WAB A;  3DAF A;  3DAG A;  2J0X A;  3NRH A;  2OOC A;  2NG1 A;  5FZT A;  2HMQ A;  3LUT B;  3I5P A;  3PMR A;  3EG9 B;  4RBN A;  3LLI A;  3EPV A;  4DOZ A;  2CNW A;  1QSP A;  1YLM A;  2HFI A;  1VLT A;  2J9W A;  2R02 A;  2R7O A;  4IJJ A;  4P9T A;  1T9K A;  4P6I C;  5D91 A;  4OIN F;  3ZDL A;  4OIQ F;  1UG7 A;  3EGX B;  3DD7 A;  1FFH A;  1A0B A;  4YT5 A;  1Q0K A;  1VMA A;  3TOM A;  1FTS A;  4CSA C;  3S90 A;  3FDQ A;  4QI2 A;  3C63 A;  3LNM B;  4N6C A;  1GGQ A;  3SZR A;  5KYW B;  4KNV A;  3LES A;  5CI9 A;  1T6U A;  3B71 A;  3LS1 A;  5EGY A;  2R7R A;  3TJ5 A;  3MX3 A;  3X2Q C;  1VLS A;  2PFD A;  5A6B A;  1Y6D A;  5D92 A;  1ZU4 A;  2G62 A;  5E3C A;  2QLA A;  3H2V A;  4XQ1 A;  3CQZ A;  5KYX B;  1SYQ A;  3F47 A;  4CJO A;  3TD7 A;  5E33 A;  2D5R B;  4PK4 A;  1NLX A;  4OIO F;  1WOL A;  1H7I A;  4CS8 A;  2Q9B A;  1JAF A;  4OIR F;  2JX0 A;  1NU9 C;  1OR3 A;  1C02 A;  1TR2 A;  1DOV A;  2XLM A;  4U5E E;  3TOL A;  4DRH B;  1YA9 A;  2AWC A;  4A4A A;  3UMK A;  1RXQ A;  1FMW A;  2IXP A;  2XL6 A;  2CW0 F;  3QMK A;  3NDB B;  3KPH A;  1LE2 A;  2WL8 A;  4JEB A;  4Q4Z F;  1ORY A;  5BQH A;  3AGU A;  1WN0 A;  2EPO A;  3EZI A;  1JRA A;  1LVK A;  1QQ3 A;  1TKN A;  2XRH A;  4EWC A;  3G4X A;  1MMD A;  2YHS A;  4MW8 A;  3LS0 A;  2F22 A;  1ZHX A;  3Q6N A;  4XPX A;  3EH1 A;  3B0U X;  2CDQ A;  4W8K A;  3B0V C;  4U9D A;  2OCC C;  4C3D A;  2WVQ A;  3NMK A;  2YRF A;  4PFO A;  5KYU A;  5CI8 A;  2R9R B;  3U5S A;  4AL1 A;  4OD4 A;  2GDC A;  4GQH A;  3WHN A;  5JUA A;  4PFP A;  2R7X A;  3UGP A;  1E2X A;  3JYH A;  2P0N A;  3HNJ A;  1B68 A;  4ZLC A;  2I15 A;  4QDL A;  1KU2 A;  3ZVR A;  1SZI A;  4DRI B;  3QZC A;  2XLW A;  3O39 A;  1BZ4 A;  3EHN A;  1E86 A;  4XPY A;  1D0X A;  1FNT c;  1ZZP A;  2J7P A;  4IB4 A;  4EUK B;  4JTC B;  4G7O F;  3MLG A;  5L3Q A;  4QI0 A;  4H4K C;  3SP1 A; 
#chains in the Genus database with same CATH homology
 1APC A;  4JEA A;  4ULV A;  2YL1 A;  1EKY A;  4EIY A;  4ER9 A;  2XLE A;  5B3I A;  2XLO A;  3ZTM A;  2BC5 A;  1BBH A;  1A7V A;  3HNK A;  3M4B A;  3ZTZ A;  4CJG A;  4NC3 A;  1YZC A;  5JVE A;  2YL3 A;  5AGF A;  1NBB A;  3U8P A;  5JRA A;  4N6H A;  2XL8 A;  1M6T A;  4IAQ A;  256B A;  1CGN A;  4D4X A;  2YLG A;  4CDY A;  4CIP A;  4IAR A;  2CCY A;  4L6R A;  1LM3 B;  3M4C A;  5JLI A;  2YLD A;  3TOM A;  5JT4 A;  4CDV A;  3C63 A;  1CPQ A;  3M15 A;  1CGO A;  2YL7 A;  4CX9 A;  1E85 A;  3FOP A;  2QLA A;  4CJO A;  3DE9 A;  3M79 A;  4CDA A;  1YZA A;  3QW0 A;  4JKV A;  1JAF A;  3ZQV A;  2XLM A;  3DE8 A;  1GQA A;  3TOL A;  1E83 A;  3HNL A;  2XL6 A;  1E84 A;  3QVZ A;  3ZQY A;  4JEB A;  3NMI A;  5JS5 A;  4U9E A;  1YYJ A;  1QQ3 A;  3HNI A;  2XLH A;  2YL0 A;  3L1M A;  1CPR A;  4WGY A;  4WGZ A;  4D4N A;  3QVY A;  1YYX A;  4U9D A;  3NMK A;  1QPU A;  5JP7 A;  1RCP A;  2J9B A;  3C62 A;  5JSL A;  2XM4 A;  1MQV A;  3VRC A;  4JE9 A;  5JUA A;  3ZWI A;  3QW1 A;  4N4W A;  3FOO A;  3HNJ A;  2XM0 A;  2YKZ A;  1S05 A;  2XLW A;  3IQ5 A;  1E86 A;  4IB4 A;  2J8W A;  3NMJ A;  3IQ6 A;  2XLD A;  2XLV A;  2YLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...