256BA

Improvement of the 2.5 angstroms resolution model of cytochrome b562 by redetermining the primary structure and using molecular graphics
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B562
publication title Improvement of the 2.5 A resolution model of cytochrome b562 by redetermining the primary structure and using molecular graphics.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 49
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 256bA00
3NMJA 3DE8A 1CPRA 4D4XA 1EKYA 4JE9A 1APCA 4IARA 5JSLA 4CJGA 4CX9A 1BBHA 2YLGA 4CJOA 2XLHA 2XLDA 3VRCA 4D4NA 4U9DA 3ZQYA 4IB4A 3QVYA 3ZTMA 2YL7A 3QW0A 3HNLA 3L1MA 2YL1A 3NMIA 4ULVA 5JP7A 4WGYA 3M79A 1GQAA 1QQ3A 1A7VA 1YYXA 3IQ6A 2XLMA 1CPQA 4N4WA 4CIPA 1YYJA 2XL6A 2YLIA 1M6TA 5AGFA 4IAQA 2QLAA 1MQVA 2XLWA 1S05A 3HNJA 4JEBA 1CGOA 3M15A 3QW1A 2YL3A 4N6HA 3TOLA 4CDYA 1NBBA 3M4BA 1YZAA 2XLOA 1CGNA 2XLEA 2J9BA 1E86A 4CDVA 5JVEA 1QPUA 3U8PA 5JUAA 4ER9A 3C62A 3TOMA 256BA 4WGZA 4NC3A 4L6RA 1E85A 2YKZA 3C63A 3QVZA 3ZQVA 5JT4A 1YZCA 2BC5A 1JAFA 1LM3B 3FOOA 3ZWIA 3HNKA 5JS5A 1RCPA 2J8WA 4U9EA 2YLDA 3DE9A 4CDAA 4JKVA 4EIYA 3FOPA 4JEAA 3M4CA 2XM4A 1E83A 3HNIA 2YL0A 5B3IA 3ZTZA 1E84A 5JRAA 3NMKA 5JLIA 2XL8A 3IQ5A 2XLVA 2XM0A 2CCYA
chains in the Genus database with same CATH superfamily
1WATA 3NYJA 3DZAA 2XRHA 3MLGA 2I8BA 3I5QA 2J9UA 1YA7O 3C18A 1APCA 2HV7A 3MYIA 1MNDA 3N2ZB 4IARA 3B71A 3FAJA 3SP1A 3ATPA 4U5HA 5KYWA 5JSLA 1NLXA 4E0HA 2WVQA 5F5FA 1FNTc 3SXMA 3SZRA 2NPUA 3OEOA 4YWQA 1S7ZA 2XLHA 2YHSA 4DRIB 5L3QA 4OINF 4F4BA 3X1OA 2HUJA 3L34A 4M63A 1T6UA 3QVYA 2XL4A 4MW8A 1VB5A 3LEOA 2J0XA 4E0IA 1O3UA 3WAQA 3DWWA 2YL1A 3EGDA 4ULVA 5JP7A 1SMYF 2Y39A 3PMRA 3EZIA 3T6BA 2VC9A 3AOUA 4J7YA 1O5HA 2WL8A 4XPWA 5K0IA 3O10A 2HZ8A 4IJJA 2J9VA 1K04A 1V4AA 2KSFA 5D92A 4E7SA 2E87A 2QNLA 1CGME 1D1CA 1T6IA 4NQFA 4OD5A 1I4ZA 1OCRC 1WGWA 3C8ZA 2EIMC 1CPQA 1JPJA 3JRMO 2R7RA 2OKUA 2IOQA 3RYLA 2XXAB 1YYJA 3BRJA 4A2NB 2R7SA 3FHDA 4MVMA 3ZC4A 1D1AA 2YLIA 5L0GA 1RJ9A 2B0HA 4PR9A 1ST6A 1BZ4A 4IAQA 3GM1A 4G78A 1F1MA 1S05A 1YLMA 2XLWA 4JEBA 3EHNA 3GEEA 4U5BE 4X0RA 4B6IA 1H7IA 2YZSA 2RSEB 2YL3A 4PFPA 3HKKA 4CDYA 3CAXA 4U5FE 1JPNA 3O39A 5KYNA 2HJ3A 3KL4A 4MVZA 4DVYP 4XQ1A 1YZAA 2R7TA 2R7VA 2V3CC 3NRHA 1FFTC 2XS8A 1G4WR 2B0JA 4WABA 4C7OA 4NTFA 2PFDA 3MX3A 3AG2C 3DD7A 1E86A 1SF8A 2M64A 1NG1A 4CDVA 4RBNA 1QPUA 2LFDA 2Q00A 2CW0F 2RD9A 4JCHA 4XPXA 2Q9AA 4LDKA 1MNEA 4LLEA 4MVSA 1XZQA 5CI8A 4ULWA 3RKOF 1ZW3A 4BJ5A 2OEXA 3ASOC 5B1BC 2GWWA 2Q9CA 5E33A 1ZHXA 2YKZA 1H9TA 1KTMA 1SR2A 5FCLA 4GQHA 2M4EA 3U9JA 1ZU4A 1IW7F 4BJ6C 3GM3A 3QMKA 1YVIA 4ZLDA 1TFOB 4MTOA 1M56C 1JAFA 5COMA 4N06A 1ZHTA 3F46A 4JTAB 4XWJA 2QE9A 3V7OA 4PK4A 3HNKA 2NSFA 3DM9B 3VF0A 2WZLA 1RCPA 3GANA 4MVRA 4MQ9F 1FFHA 1TWHA 1T6QA 1Z3IX 1MMGA 1TWCA 2GAQA 3F47A 4JKVA 4YJWA 4YT4A 4EIYA 3M4CA 1LIHA 3G50A 5DQZA 2A0BA 2D4UA 2HSBA 1LS1A 2LK4A 2PX3A 5DS6A 4HEAJ 3POVA 2WZGA 4CS9C 4EWCA 3KYIA 5A6KA 2YL0A 2AVKA 3ZTZA 4O6YA 3I4UA 4R32A 3TK0A 2ZXWC 4IRUA 2PX0A 1Q0GA 2QTVA 2XL8A 3RVYA 2V26A 2XLVA 2WVOA 4BPMA 1YJGA 1XWJA 3Q6MA 3S90A 4FESA 2OOCA 3AG4C 2CYDA 2W45A 3NMJA 2YVKA 1CPRA 1U89A 3T4RA 4XLNF 1T01A 4K1OA 3SXKA 4RDAA 5DS4A 1EKYA 4HFKB 5KYXA 1Y4CA 3AJMA 5L0CA 4I44A 2LD6A 4O6NA 1WTYA 1UG7A 1A0BA 3JYHA 4CJGA 4HE8D 3GWNA 3MFNA 2Y69C 1W2WA 3Q7LA 1OW6A 3DMDA 2A6EF 2X0CA 2XLDA 3RVZA 3EGXB 3OA1A 4JVSA 4NY3A 4CJOA 4YL3A 3VRCA 4DVZA 4AE4A 4HFFB 4U9DA 3FMSA 3T6JA 3LEVA 1AVOB 2YL7A 1OCOC 4CIHA 4QI2A 1PD1A 2MYSA 1L7CA 3NMIA 3DKAA 1ZHWA 2Y3DA 3IQTA 4I1MA 4NCQA 1A41A 4KBLA 4G0HA 1K40A 4U5DE 4WGYA 3EHMA 4YL1A 1NFNA 4CS7A 1ZU5A 2BE5F 4BJ1A 1QQ3A 1A7VA 1I5NA 2HMQA 3QTHA 1OR3A 4JIOA 4RD9A 3IQ6A 4WJ0A 5T1DB 2ZXOA 5BQHA 3B0VC 2OJQA 1VLSA 2EPNA 1JR8A 3HJCA 2ETSA 3US6A 2ZXRA 3LESA 3W4YA 2OEVA 1E85A 1K05A 1C03A 5BQIA 2XL6A 3HLZA 2IXNA 3NYLA 5GPGB 5TJ5E 5KYUB 2VB6A 4J30B 4JRZA 1JOGA 3PDMP 1V55C 2HJMA 4KNWA 2YQYA 3EFOB 3M1CB 3O55A 5E3CA 4PJMA 3SEOA 4FAPB 1Q0FA 3TJ5A 3M15A 2A1DD 4DBRA 3ABMC 5AC5A 3EG9B 4YT8A 3KH2A 5T3WA 1B68A 2TMVP 1VLTA 1EA8A 3TULA 3JSZA 3S27A 2FFHA 3DM5A 3DJNB 2XLEA 3K1IC 3K66A 1H9GA 2O9XA 1J8MF 3TJ6A 1A7DA 3ZSUA 2XXAA 4EUKB 1ZW2A 5BQGA 4DJ9A 3W2VA 2OCCC 3W2WA 3ZG1A 1Q0DA 2Q3TA 5COGA 3AQCA 2R7WA 2I15A 3A11A 5JVEA 2F22A 2L81A 1HMOA 1ORSC 1MMDA 3HTKC 4ER9A 2NUPB 1GM5A 3H2VA 1N1CA 3RIPA 4E17A 5KYYA 1I4YA 1VMAA 2FAPB 1TWGA 3G4ZA 4U5GA 3H2UA 2J9WA 2DI3A 4I3MA 5B3SC 2PP4A 2R7XA 1Z23A 3GEHA 3DI5A 3B0UX 1NU7D 3B0PA 3EH1A 3GODA 1D0YA 3RFYA 3ZQVA 3WHNA 4DXWA 1Z6AA 4G7HF 1FR0A 2R7UA 1MMAA 2BC5A 3S29A 3NKEA 3FOOA 3DAFA 1T5OA 2P6VA 4FX5A 3U3BA 2PF4E 2VH3A 2KYHA 2J8WA 2YWAA 1Y6DA 3ECSA 4YK5A 4OIRF 2YLDA 3U2LA 3V5ZA 3RQEA 3L8JA 3AG3C 4JEAA 2UUIA 3IQCA 2Y3GA 1HMDA 2QUPA 2IXMA 2G3VA 3K1HA 1OKKA 3JCUQ 3JTLO 4BJ5C 3W8IA 2HFIA 2PNOA 1E83A 3UGPA 2H8AA 5JRAA 1D0ZA 1O87A 1IZMA 1VYIA 3MYFA 1HE9A 2J0WA 1LPEA 2LP4A 2A68F 1OKKD 1VYKA 1J8YF 4UDVA 4CSAA 1ZYRF 3I5PA 1LKXA 1ZHYA 3LS1A 2KK1A 3ABKC 2NUTB 2XSEA 4D4XA 3EZHA 1BR4A 1RMVA 3J06A 3L0IA 3LNRA 4Z9IA 3S9OA 3ZIBA 1RXQA 3ZDLA 2HSQA 4DBQA 3TD7A 3SXYA 2W4MA 3R2PA 4PJLA 1VK5A 2YEVA 5T3TA 4AX2A 1LVKA 3K6BA 3NG1A 4NTAA 5A6BA 4EBBA 1M2VA 2X51A 4YT5A 4D4NA 4EBJA 1A7EA 3C7JA 3ZTMA 5A6AA 1NU9C 3GWLA 3U2MA 3QW0A 4MTFA 4H4KC 4DRHB 1BR2A 5A6BD 3L1MA 2W9YA 5E3AA 1LE2A 2J7PA 2Q4FA 4ONSA 3PHF2 1ZVZA 2HKVA 4OIPF 3LAYA 4JTDB 1ZHZA 1GGQA 3SYNA 3T9OA 5DLJA 2L9JA 5L0HA 5L0DA 4OIQF 4MVQA 3S84A 2R02A 2A6HF 2J7PD 2Y3HA 4YN0B 2JD3A 3ZVRA 1YYXA 4JC7A 2R9RB 3UMHA 4XTKA 1U0BB 1TFKB 3EPVA 5A6JA 3KYJA 5IY5C 3EGXA 3N0TA 4H54A 2IM8A 4DOZA 1UFBA 1ORJA 4LACB 4CIPA 2IBFA 3R7CA 3FDQA 3JZ0A 3Q6NA 1QLEC 1RKEA 4JW1A 5AGFA 5BUOA 1OCZC 2EIJC 2QLAA 3GM2A 1MQVA 2VCAA 3HNJA 1VTMP 4Q7CA 1V74B 2WB7A 4C3DA 4P9TA 2D5RB 1KNYA 2HMZA 2ZPAA 3QW1A 3AQBA 4O79A 1XZPA 4N6HA 4AK9A 3AGUA 3AG1C 5AC4A 2HV6A 3DJUB 1NBBA 3KPHA 4XEFA 3M4BA 1JRAA 1Z7Qc 4C3EA 3LUTB 1CGNA 4CS8A 2OG2A 3LJBA 1OCCC 1SYQA 2R05A 1NFOA 5F28E 3C8GB 1G4US 4MNDA 2ASRA 2Q7RA 1ZZPA 4KNVA 2CDQA 2LIGA 3JSEO 3W8HA 3GORA 4FWVA 1QKRA 2ZD9A 1OW8A 4W8KA 5FZTA 4LLCA 1ORYA 2ICWG 3U5SA 4BEJA 2KQ9A 3U8PA 2P0NA 4PFOA 2R7QA 1D1BA 5KYUA 3C62A 3IPMO 2VCBA 3AGTA 3TOMA 3EFOA 256BA 4N6CA 3IEEA 1EI7A 1WASA 2L7AA 1OQCA 5L0IA 4AL1A 4NC3A 4L6RA 3GEIA 2AWYA 1V54C 3DAGA 3EG9A 3NYMA 2WVNA 3FVYA 4IAOA 3TQOA 4QI0A 5HV9A 2H7OA 3C63A 1C17M 2AWCA 3JYYA 3NKDA 4PACA 2L6HA 3UNGC 1HW1A 5A69A 2KNHA 3KKBA 4JZAA 4LERA 1YZCA 2A69F 5EK0A 4JTCB 1OW7A 3N24A 2J45A 2G3KA 3ZWIA 2W4BA 4AL0A 1PCXA 4YL0A 2JX0A 1R5ID 4U9EA 3V5YA 2LFFA 5KYWB 3OWTA 4G7ZF 2QY9A 3ASNC 2NUPA 4LDRA 3RQGA 1Q0KA 2XM4A 4XPYA 4Z9HA 1M57C 1C02A 3EQLF 1VOMA 2IXOA 3K7DA 4YT2A 5CIVA 4I1OB 3B29A 3NDBB 1G8XA 5B3IA 4IWBA 1FMWA 2XS1A 4KI2A 3UMKA 3NMKA 2EPMX 2KGOA 4BJTA 4P6IC 5JLIA 2MWQA 2VCCA 4MVOA 2Y3BA 3U8VA 1QSPA 2GFHA 4OIOF 4G7OF 1DOVA 2CCYA 4EKWA 3EGDB 2DYSC 1WOLA 1Z63A 1T9KA 3E9VA 3CSKA 3DE8A 1M2OA 1GS9A 3BEHA 3UR3C 4XEVA 1EQ1A 4DRJB 4JE9A 4A4AA 1Z5ZA 2EIKC 5D91A 3K1IA 3EJNA 2EPLX 2WZFA 1H6GA 3SNHA 2CGEA 3L8IA 4U5EE 1BR1A 2GDCA 4CX9A 1BBHA 2YLGA 2GA0A 2BL2A 5L3VA 2R03A 3DXJF 3LNMB 1HY5A 2C04A 4KC9A 1HE1A 2R25A 2P61A 2YRFA 4JCZA 4NTBA 3ZQYA 4IB4A 4PJNA 4OD4A 5DQTA 1RJ9B 3MBGA 4Q5SF 1RKCA 3HNLA 5KYYB 4XEKA 2R7OA 4CSAC 4U5CE 2P1AA 3KMIA 3LS0A 3ITFA 1L3PA 3B9QA 2NUTA 2FGYA 4O7GA 3U3FA 1OXBA 1WN0A 4J32B 3M79A 2MHRA 1OR2A 5F5HA 5HSWA 1GQAA 2P7VA 5COFA 3FAPB 1TWAA 1Q0MA 1NSGB 2DB4A 1FMVA 3SXZA 4C7OB 2CNWA 4K0DA 1R4TA 4EBKA 2KJGA 2XLMA 2Z15A 4P9FA 1AUEA 4N4WA 5L0JA 3WODF 4GEHA 3CQZA 2AU5A 2CNWD 1YDIA 2A0UA 2G62A 2HS5A 2KC3A 1M6TA 3UGOA 3G4XA 5L0FA 4BG0A 1JMWA 1YARO 2J46A 4W8PA 2OJED 4EHPA 1CGOA 1LI5A 1NZEA 2EPKX 1MMNA 4JURI 3TOLA 4QDLA 3X2QC 4BEMJ 1QZXA 1TKNA 2JPUA 2IYLD 3K33A 4ANJA 3IHUA 1YAUO 2EINC 2AP3A 2XLOA 1YA9A 4LDQA 4XLPF 2EILC 1BDJB 4K7BA 4BJ6A 1OXKA 1LE4A 1U6HA 2J9BA 3JRTA 2C03A 4C3BA 2ZXPA 1DOWA 3LLKA 3Q7GA 3H65A 4JJFA 3VYWA 1D0XA 3VAYA 2LCHA 2L6GA 5DVWA 3LLIA 3V5XA 3S28A 4O6MA 3S0XA 3JT1A 1SZIA 3EH2A 5JUAA 4E18A 2PBEA 3RH3A 1G5ZA 2OU6A 5E2QA 1QVXA 1PV3A 1M2VB 4WGZA 4MTGA 3A9CA 3UMIA 3ABLC 4JJGA 3CEXA 2Q9BA 4CS9A 2H7BA 3PCVA 5DS5A 1AEPA 4PJJA 4CBEA 2VASA 2IXPA 4J7TA 2L6FA 3U9MA 4GYTA 2NG1A 3QVZA 4ZLCA 1LS4A 1FTSA 4CS8C 1KU2A 5JT4A 3C8GA 3FXHA 2LSEA 2NSGA 1LM3B 3U0CA 5KYXB 5JS5A 2OQMA 3RQFA 1TR2A 2KW3C 4Q4ZF 3CZ6A 3DE9A 1TQGA 2H7VC 3C8GD 3VM6A 4CDAA 1E2XA 4E7ZA 2UUHA 2DGJA 3FOPA 3WG7C 3E70C 4MVUA 5EHHA 2DYRC 3T6GB 3RF3A 4IGGA 3HNIA 1FAPB 1RKEB 1WWPA 2EPOA 5B1AC 4AE4B 1E84A 1LI7A 1HW2A 3QZCA 4MS2A 3RW0A 5EGYA 2LQGA 3IQ5A 4MW3A 4Z9JA 1PD0A 2XM0A 3O6XA 5CI9A
chains in the Genus database with same CATH topology
3NMJA 3DE8A 1CPRA 4D4XA 1EKYA 4JE9A 1APCA 4IARA 5JSLA 4CJGA 4CX9A 1BBHA 2YLGA 4CJOA 2XLHA 2XLDA 3VRCA 4D4NA 4U9DA 3ZQYA 4IB4A 3QVYA 3ZTMA 2YL7A 3QW0A 3HNLA 3L1MA 2YL1A 3NMIA 4ULVA 5JP7A 4WGYA 3M79A 1GQAA 1QQ3A 1A7VA 1YYXA 3IQ6A 2XLMA 1CPQA 4N4WA 4CIPA 1YYJA 2XL6A 2YLIA 1M6TA 5AGFA 4IAQA 2QLAA 1MQVA 2XLWA 1S05A 3HNJA 4JEBA 1CGOA 3M15A 3QW1A 2YL3A 4N6HA 3TOLA 4CDYA 1NBBA 3M4BA 1YZAA 2XLOA 1CGNA 2XLEA 2J9BA 1E86A 4CDVA 5JVEA 1QPUA 3U8PA 5JUAA 4ER9A 3C62A 3TOMA 256BA 4WGZA 4NC3A 4L6RA 1E85A 2YKZA 3C63A 3QVZA 3ZQVA 5JT4A 1YZCA 2BC5A 1JAFA 1LM3B 3FOOA 3ZWIA 3HNKA 5JS5A 1RCPA 2J8WA 4U9EA 2YLDA 3DE9A 4CDAA 4JKVA 4EIYA 3FOPA 4JEAA 3M4CA 2XM4A 1E83A 3HNIA 2YL0A 5B3IA 3ZTZA 1E84A 5JRAA 3NMKA 5JLIA 2XL8A 3IQ5A 2XLVA 2XM0A 2CCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NMJ A;  3DE8 A;  1CPR A;  4D4X A;  1EKY A;  4JE9 A;  1APC A;  4IAR A;  5JSL A;  4CJG A;  4CX9 A;  1BBH A;  2YLG A;  4CJO A;  2XLH A;  2XLD A;  3VRC A;  4D4N A;  4U9D A;  3ZQY A;  4IB4 A;  3QVY A;  3ZTM A;  2YL7 A;  3QW0 A;  3HNL A;  3L1M A;  2YL1 A;  3NMI A;  4ULV A;  5JP7 A;  4WGY A;  3M79 A;  1GQA A;  1QQ3 A;  1A7V A;  1YYX A;  3IQ6 A;  2XLM A;  1CPQ A;  4N4W A;  4CIP A;  1YYJ A;  2XL6 A;  2YLI A;  1M6T A;  5AGF A;  4IAQ A;  2QLA A;  1MQV A;  2XLW A;  1S05 A;  3HNJ A;  4JEB A;  1CGO A;  3M15 A;  3QW1 A;  2YL3 A;  4N6H A;  3TOL A;  4CDY A;  1NBB A;  3M4B A;  1YZA A;  2XLO A;  1CGN A;  2XLE A;  2J9B A;  1E86 A;  4CDV A;  5JVE A;  1QPU A;  3U8P A;  5JUA A;  4ER9 A;  3C62 A;  3TOM A;  256B A;  4WGZ A;  4NC3 A;  4L6R A;  1E85 A;  2YKZ A;  3C63 A;  3QVZ A;  3ZQV A;  5JT4 A;  1YZC A;  2BC5 A;  1JAF A;  1LM3 B;  3FOO A;  3ZWI A;  3HNK A;  5JS5 A;  1RCP A;  2J8W A;  4U9E A;  2YLD A;  3DE9 A;  4CDA A;  4JKV A;  4EIY A;  3FOP A;  4JEA A;  3M4C A;  2XM4 A;  1E83 A;  3HNI A;  2YL0 A;  5B3I A;  3ZTZ A;  1E84 A;  5JRA A;  3NMK A;  5JLI A;  2XL8 A;  3IQ5 A;  2XLV A;  2XM0 A;  2CCY A; 
#chains in the Genus database with same CATH topology
 1WAT A;  3NYJ A;  3DZA A;  2XRH A;  3MLG A;  2I8B A;  3I5Q A;  2J9U A;  1YA7 O;  3C18 A;  1APC A;  2HV7 A;  3MYI A;  1MND A;  3N2Z B;  4IAR A;  3B71 A;  3FAJ A;  3SP1 A;  3ATP A;  4U5H A;  5KYW A;  5JSL A;  1NLX A;  4E0H A;  2WVQ A;  5F5F A;  1FNT c;  3SXM A;  3SZR A;  2NPU A;  3OEO A;  4YWQ A;  1S7Z A;  2XLH A;  2YHS A;  4DRI B;  5L3Q A;  4OIN F;  4F4B A;  3X1O A;  2HUJ A;  3L34 A;  4M63 A;  1T6U A;  3QVY A;  2XL4 A;  4MW8 A;  1VB5 A;  3LEO A;  2J0X A;  4E0I A;  1O3U A;  3WAQ A;  3DWW A;  2YL1 A;  3EGD A;  4ULV A;  5JP7 A;  1SMY F;  2Y39 A;  3PMR A;  3EZI A;  3T6B A;  2VC9 A;  3AOU A;  4J7Y A;  1O5H A;  2WL8 A;  4XPW A;  5K0I A;  3O10 A;  2HZ8 A;  4IJJ A;  2J9V A;  1K04 A;  1V4A A;  2KSF A;  5D92 A;  4E7S A;  2E87 A;  2QNL A;  1CGM E;  1D1C A;  1T6I A;  4NQF A;  4OD5 A;  1I4Z A;  1OCR C;  1WGW A;  3C8Z A;  2EIM C;  1CPQ A;  1JPJ A;  3JRM O;  2R7R A;  2OKU A;  2IOQ A;  3RYL A;  2XXA B;  1YYJ A;  3BRJ A;  4A2N B;  2R7S A;  3FHD A;  4MVM A;  3ZC4 A;  1D1A A;  2YLI A;  5L0G A;  1RJ9 A;  2B0H A;  4PR9 A;  1ST6 A;  1BZ4 A;  4IAQ A;  3GM1 A;  4G78 A;  1F1M A;  1S05 A;  1YLM A;  2XLW A;  4JEB A;  3EHN A;  3GEE A;  4U5B E;  4X0R A;  4B6I A;  1H7I A;  2YZS A;  2RSE B;  2YL3 A;  4PFP A;  3HKK A;  4CDY A;  3CAX A;  4U5F E;  1JPN A;  3O39 A;  5KYN A;  2HJ3 A;  3KL4 A;  4MVZ A;  4DVY P;  4XQ1 A;  1YZA A;  2R7T A;  2R7V A;  2V3C C;  3NRH A;  1FFT C;  2XS8 A;  1G4W R;  2B0J A;  4WAB A;  4C7O A;  4NTF A;  2PFD A;  3MX3 A;  3AG2 C;  3DD7 A;  1E86 A;  1SF8 A;  2M64 A;  1NG1 A;  4CDV A;  4RBN A;  1QPU A;  2LFD A;  2Q00 A;  2CW0 F;  2RD9 A;  4JCH A;  4XPX A;  2Q9A A;  4LDK A;  1MNE A;  4LLE A;  4MVS A;  1XZQ A;  5CI8 A;  4ULW A;  3RKO F;  1ZW3 A;  4BJ5 A;  2OEX A;  3ASO C;  5B1B C;  2GWW A;  2Q9C A;  5E33 A;  1ZHX A;  2YKZ A;  1H9T A;  1KTM A;  1SR2 A;  5FCL A;  4GQH A;  2M4E A;  3U9J A;  1ZU4 A;  1IW7 F;  4BJ6 C;  3GM3 A;  3QMK A;  1YVI A;  4ZLD A;  1TFO B;  4MTO A;  1M56 C;  1JAF A;  5COM A;  4N06 A;  1ZHT A;  3F46 A;  4JTA B;  4XWJ A;  2QE9 A;  3V7O A;  4PK4 A;  3HNK A;  2NSF A;  3DM9 B;  3VF0 A;  2WZL A;  1RCP A;  3GAN A;  4MVR A;  4MQ9 F;  1FFH A;  1TWH A;  1T6Q A;  1Z3I X;  1MMG A;  1TWC A;  2GAQ A;  3F47 A;  4JKV A;  4YJW A;  4YT4 A;  4EIY A;  3M4C A;  1LIH A;  3G50 A;  5DQZ A;  2A0B A;  2D4U A;  2HSB A;  1LS1 A;  2LK4 A;  2PX3 A;  5DS6 A;  4HEA J;  3POV A;  2WZG A;  4CS9 C;  4EWC A;  3KYI A;  5A6K A;  2YL0 A;  2AVK A;  3ZTZ A;  4O6Y A;  3I4U A;  4R32 A;  3TK0 A;  2ZXW C;  4IRU A;  2PX0 A;  1Q0G A;  2QTV A;  2XL8 A;  3RVY A;  2V26 A;  2XLV A;  2WVO A;  4BPM A;  1YJG A;  1XWJ A;  3Q6M A;  3S90 A;  4FES A;  2OOC A;  3AG4 C;  2CYD A;  2W45 A;  3NMJ A;  2YVK A;  1CPR A;  1U89 A;  3T4R A;  4XLN F;  1T01 A;  4K1O A;  3SXK A;  4RDA A;  5DS4 A;  1EKY A;  4HFK B;  5KYX A;  1Y4C A;  3AJM A;  5L0C A;  4I44 A;  2LD6 A;  4O6N A;  1WTY A;  1UG7 A;  1A0B A;  3JYH A;  4CJG A;  4HE8 D;  3GWN A;  3MFN A;  2Y69 C;  1W2W A;  3Q7L A;  1OW6 A;  3DMD A;  2A6E F;  2X0C A;  2XLD A;  3RVZ A;  3EGX B;  3OA1 A;  4JVS A;  4NY3 A;  4CJO A;  4YL3 A;  3VRC A;  4DVZ A;  4AE4 A;  4HFF B;  4U9D A;  3FMS A;  3T6J A;  3LEV A;  1AVO B;  2YL7 A;  1OCO C;  4CIH A;  4QI2 A;  1PD1 A;  2MYS A;  1L7C A;  3NMI A;  3DKA A;  1ZHW A;  2Y3D A;  3IQT A;  4I1M A;  4NCQ A;  1A41 A;  4KBL A;  4G0H A;  1K40 A;  4U5D E;  4WGY A;  3EHM A;  4YL1 A;  1NFN A;  4CS7 A;  1ZU5 A;  2BE5 F;  4BJ1 A;  1QQ3 A;  1A7V A;  1I5N A;  2HMQ A;  3QTH A;  1OR3 A;  4JIO A;  4RD9 A;  3IQ6 A;  4WJ0 A;  5T1D B;  2ZXO A;  5BQH A;  3B0V C;  2OJQ A;  1VLS A;  2EPN A;  1JR8 A;  3HJC A;  2ETS A;  3US6 A;  2ZXR A;  3LES A;  3W4Y A;  2OEV A;  1E85 A;  1K05 A;  1C03 A;  5BQI A;  2XL6 A;  3HLZ A;  2IXN A;  3NYL A;  5GPG B;  5TJ5 E;  5KYU B;  2VB6 A;  4J30 B;  4JRZ A;  1JOG A;  3PDM P;  1V55 C;  2HJM A;  4KNW A;  2YQY A;  3EFO B;  3M1C B;  3O55 A;  5E3C A;  4PJM A;  3SEO A;  4FAP B;  1Q0F A;  3TJ5 A;  3M15 A;  2A1D D;  4DBR A;  3ABM C;  5AC5 A;  3EG9 B;  4YT8 A;  3KH2 A;  5T3W A;  1B68 A;  2TMV P;  1VLT A;  1EA8 A;  3TUL A;  3JSZ A;  3S27 A;  2FFH A;  3DM5 A;  3DJN B;  2XLE A;  3K1I C;  3K66 A;  1H9G A;  2O9X A;  1J8M F;  3TJ6 A;  1A7D A;  3ZSU A;  2XXA A;  4EUK B;  1ZW2 A;  5BQG A;  4DJ9 A;  3W2V A;  2OCC C;  3W2W A;  3ZG1 A;  1Q0D A;  2Q3T A;  5COG A;  3AQC A;  2R7W A;  2I15 A;  3A11 A;  5JVE A;  2F22 A;  2L81 A;  1HMO A;  1ORS C;  1MMD A;  3HTK C;  4ER9 A;  2NUP B;  1GM5 A;  3H2V A;  1N1C A;  3RIP A;  4E17 A;  5KYY A;  1I4Y A;  1VMA A;  2FAP B;  1TWG A;  3G4Z A;  4U5G A;  3H2U A;  2J9W A;  2DI3 A;  4I3M A;  5B3S C;  2PP4 A;  2R7X A;  1Z23 A;  3GEH A;  3DI5 A;  3B0U X;  1NU7 D;  3B0P A;  3EH1 A;  3GOD A;  1D0Y A;  3RFY A;  3ZQV A;  3WHN A;  4DXW A;  1Z6A A;  4G7H F;  1FR0 A;  2R7U A;  1MMA A;  2BC5 A;  3S29 A;  3NKE A;  3FOO A;  3DAF A;  1T5O A;  2P6V A;  4FX5 A;  3U3B A;  2PF4 E;  2VH3 A;  2KYH A;  2J8W A;  2YWA A;  1Y6D A;  3ECS A;  4YK5 A;  4OIR F;  2YLD A;  3U2L A;  3V5Z A;  3RQE A;  3L8J A;  3AG3 C;  4JEA A;  2UUI A;  3IQC A;  2Y3G A;  1HMD A;  2QUP A;  2IXM A;  2G3V A;  3K1H A;  1OKK A;  3JCU Q;  3JTL O;  4BJ5 C;  3W8I A;  2HFI A;  2PNO A;  1E83 A;  3UGP A;  2H8A A;  5JRA A;  1D0Z A;  1O87 A;  1IZM A;  1VYI A;  3MYF A;  1HE9 A;  2J0W A;  1LPE A;  2LP4 A;  2A68 F;  1OKK D;  1VYK A;  1J8Y F;  4UDV A;  4CSA A;  1ZYR F;  3I5P A;  1LKX A;  1ZHY A;  3LS1 A;  2KK1 A;  3ABK C;  2NUT B;  2XSE A;  4D4X A;  3EZH A;  1BR4 A;  1RMV A;  3J06 A;  3L0I A;  3LNR A;  4Z9I A;  3S9O A;  3ZIB A;  1RXQ A;  3ZDL A;  2HSQ A;  4DBQ A;  3TD7 A;  3SXY A;  2W4M A;  3R2P A;  4PJL A;  1VK5 A;  2YEV A;  5T3T A;  4AX2 A;  1LVK A;  3K6B A;  3NG1 A;  4NTA A;  5A6B A;  4EBB A;  1M2V A;  2X51 A;  4YT5 A;  4D4N A;  4EBJ A;  1A7E A;  3C7J A;  3ZTM A;  5A6A A;  1NU9 C;  3GWL A;  3U2M A;  3QW0 A;  4MTF A;  4H4K C;  4DRH B;  1BR2 A;  5A6B D;  3L1M A;  2W9Y A;  5E3A A;  1LE2 A;  2J7P A;  2Q4F A;  4ONS A;  3PHF 2;  1ZVZ A;  2HKV A;  4OIP F;  3LAY A;  4JTD B;  1ZHZ A;  1GGQ A;  3SYN A;  3T9O A;  5DLJ A;  2L9J A;  5L0H A;  5L0D A;  4OIQ F;  4MVQ A;  3S84 A;  2R02 A;  2A6H F;  2J7P D;  2Y3H A;  4YN0 B;  2JD3 A;  3ZVR A;  1YYX A;  4JC7 A;  2R9R B;  3UMH A;  4XTK A;  1U0B B;  1TFK B;  3EPV A;  5A6J A;  3KYJ A;  5IY5 C;  3EGX A;  3N0T A;  4H54 A;  2IM8 A;  4DOZ A;  1UFB A;  1ORJ A;  4LAC B;  4CIP A;  2IBF A;  3R7C A;  3FDQ A;  3JZ0 A;  3Q6N A;  1QLE C;  1RKE A;  4JW1 A;  5AGF A;  5BUO A;  1OCZ C;  2EIJ C;  2QLA A;  3GM2 A;  1MQV A;  2VCA A;  3HNJ A;  1VTM P;  4Q7C A;  1V74 B;  2WB7 A;  4C3D A;  4P9T A;  2D5R B;  1KNY A;  2HMZ A;  2ZPA A;  3QW1 A;  3AQB A;  4O79 A;  1XZP A;  4N6H A;  4AK9 A;  3AGU A;  3AG1 C;  5AC4 A;  2HV6 A;  3DJU B;  1NBB A;  3KPH A;  4XEF A;  3M4B A;  1JRA A;  1Z7Q c;  4C3E A;  3LUT B;  1CGN A;  4CS8 A;  2OG2 A;  3LJB A;  1OCC C;  1SYQ A;  2R05 A;  1NFO A;  5F28 E;  3C8G B;  1G4U S;  4MND A;  2ASR A;  2Q7R A;  1ZZP A;  4KNV A;  2CDQ A;  2LIG A;  3JSE O;  3W8H A;  3GOR A;  4FWV A;  1QKR A;  2ZD9 A;  1OW8 A;  4W8K A;  5FZT A;  4LLC A;  1ORY A;  2ICW G;  3U5S A;  4BEJ A;  2KQ9 A;  3U8P A;  2P0N A;  4PFO A;  2R7Q A;  1D1B A;  5KYU A;  3C62 A;  3IPM O;  2VCB A;  3AGT A;  3TOM A;  3EFO A;  256B A;  4N6C A;  3IEE A;  1EI7 A;  1WAS A;  2L7A A;  1OQC A;  5L0I A;  4AL1 A;  4NC3 A;  4L6R A;  3GEI A;  2AWY A;  1V54 C;  3DAG A;  3EG9 A;  3NYM A;  2WVN A;  3FVY A;  4IAO A;  3TQO A;  4QI0 A;  5HV9 A;  2H7O A;  3C63 A;  1C17 M;  2AWC A;  3JYY A;  3NKD A;  4PAC A;  2L6H A;  3UNG C;  1HW1 A;  5A69 A;  2KNH A;  3KKB A;  4JZA A;  4LER A;  1YZC A;  2A69 F;  5EK0 A;  4JTC B;  1OW7 A;  3N24 A;  2J45 A;  2G3K A;  3ZWI A;  2W4B A;  4AL0 A;  1PCX A;  4YL0 A;  2JX0 A;  1R5I D;  4U9E A;  3V5Y A;  2LFF A;  5KYW B;  3OWT A;  4G7Z F;  2QY9 A;  3ASN C;  2NUP A;  4LDR A;  3RQG A;  1Q0K A;  2XM4 A;  4XPY A;  4Z9H A;  1M57 C;  1C02 A;  3EQL F;  1VOM A;  2IXO A;  3K7D A;  4YT2 A;  5CIV A;  4I1O B;  3B29 A;  3NDB B;  1G8X A;  5B3I A;  4IWB A;  1FMW A;  2XS1 A;  4KI2 A;  3UMK A;  3NMK A;  2EPM X;  2KGO A;  4BJT A;  4P6I C;  5JLI A;  2MWQ A;  2VCC A;  4MVO A;  2Y3B A;  3U8V A;  1QSP A;  2GFH A;  4OIO F;  4G7O F;  1DOV A;  2CCY A;  4EKW A;  3EGD B;  2DYS C;  1WOL A;  1Z63 A;  1T9K A;  3E9V A;  3CSK A;  3DE8 A;  1M2O A;  1GS9 A;  3BEH A;  3UR3 C;  4XEV A;  1EQ1 A;  4DRJ B;  4JE9 A;  4A4A A;  1Z5Z A;  2EIK C;  5D91 A;  3K1I A;  3EJN A;  2EPL X;  2WZF A;  1H6G A;  3SNH A;  2CGE A;  3L8I A;  4U5E E;  1BR1 A;  2GDC A;  4CX9 A;  1BBH A;  2YLG A;  2GA0 A;  2BL2 A;  5L3V A;  2R03 A;  3DXJ F;  3LNM B;  1HY5 A;  2C04 A;  4KC9 A;  1HE1 A;  2R25 A;  2P61 A;  2YRF A;  4JCZ A;  4NTB A;  3ZQY A;  4IB4 A;  4PJN A;  4OD4 A;  5DQT A;  1RJ9 B;  3MBG A;  4Q5S F;  1RKC A;  3HNL A;  5KYY B;  4XEK A;  2R7O A;  4CSA C;  4U5C E;  2P1A A;  3KMI A;  3LS0 A;  3ITF A;  1L3P A;  3B9Q A;  2NUT A;  2FGY A;  4O7G A;  3U3F A;  1OXB A;  1WN0 A;  4J32 B;  3M79 A;  2MHR A;  1OR2 A;  5F5H A;  5HSW A;  1GQA A;  2P7V A;  5COF A;  3FAP B;  1TWA A;  1Q0M A;  1NSG B;  2DB4 A;  1FMV A;  3SXZ A;  4C7O B;  2CNW A;  4K0D A;  1R4T A;  4EBK A;  2KJG A;  2XLM A;  2Z15 A;  4P9F A;  1AUE A;  4N4W A;  5L0J A;  3WOD F;  4GEH A;  3CQZ A;  2AU5 A;  2CNW D;  1YDI A;  2A0U A;  2G62 A;  2HS5 A;  2KC3 A;  1M6T A;  3UGO A;  3G4X A;  5L0F A;  4BG0 A;  1JMW A;  1YAR O;  2J46 A;  4W8P A;  2OJE D;  4EHP A;  1CGO A;  1LI5 A;  1NZE A;  2EPK X;  1MMN A;  4JUR I;  3TOL A;  4QDL A;  3X2Q C;  4BEM J;  1QZX A;  1TKN A;  2JPU A;  2IYL D;  3K33 A;  4ANJ A;  3IHU A;  1YAU O;  2EIN C;  2AP3 A;  2XLO A;  1YA9 A;  4LDQ A;  4XLP F;  2EIL C;  1BDJ B;  4K7B A;  4BJ6 A;  1OXK A;  1LE4 A;  1U6H A;  2J9B A;  3JRT A;  2C03 A;  4C3B A;  2ZXP A;  1DOW A;  3LLK A;  3Q7G A;  3H65 A;  4JJF A;  3VYW A;  1D0X A;  3VAY A;  2LCH A;  2L6G A;  5DVW A;  3LLI A;  3V5X A;  3S28 A;  4O6M A;  3S0X A;  3JT1 A;  1SZI A;  3EH2 A;  5JUA A;  4E18 A;  2PBE A;  3RH3 A;  1G5Z A;  2OU6 A;  5E2Q A;  1QVX A;  1PV3 A;  1M2V B;  4WGZ A;  4MTG A;  3A9C A;  3UMI A;  3ABL C;  4JJG A;  3CEX A;  2Q9B A;  4CS9 A;  2H7B A;  3PCV A;  5DS5 A;  1AEP A;  4PJJ A;  4CBE A;  2VAS A;  2IXP A;  4J7T A;  2L6F A;  3U9M A;  4GYT A;  2NG1 A;  3QVZ A;  4ZLC A;  1LS4 A;  1FTS A;  4CS8 C;  1KU2 A;  5JT4 A;  3C8G A;  3FXH A;  2LSE A;  2NSG A;  1LM3 B;  3U0C A;  5KYX B;  5JS5 A;  2OQM A;  3RQF A;  1TR2 A;  2KW3 C;  4Q4Z F;  3CZ6 A;  3DE9 A;  1TQG A;  2H7V C;  3C8G D;  3VM6 A;  4CDA A;  1E2X A;  4E7Z A;  2UUH A;  2DGJ A;  3FOP A;  3WG7 C;  3E70 C;  4MVU A;  5EHH A;  2DYR C;  3T6G B;  3RF3 A;  4IGG A;  3HNI A;  1FAP B;  1RKE B;  1WWP A;  2EPO A;  5B1A C;  4AE4 B;  1E84 A;  1LI7 A;  1HW2 A;  3QZC A;  4MS2 A;  3RW0 A;  5EGY A;  2LQG A;  3IQ5 A;  4MW3 A;  4Z9J A;  1PD0 A;  2XM0 A;  3O6X A;  5CI9 A; 
#chains in the Genus database with same CATH homology
 3NMJ A;  3DE8 A;  1CPR A;  4D4X A;  1EKY A;  4JE9 A;  1APC A;  4IAR A;  5JSL A;  4CJG A;  4CX9 A;  1BBH A;  2YLG A;  4CJO A;  2XLH A;  2XLD A;  3VRC A;  4D4N A;  4U9D A;  3ZQY A;  4IB4 A;  3QVY A;  3ZTM A;  2YL7 A;  3QW0 A;  3HNL A;  3L1M A;  2YL1 A;  3NMI A;  4ULV A;  5JP7 A;  4WGY A;  3M79 A;  1GQA A;  1QQ3 A;  1A7V A;  1YYX A;  3IQ6 A;  2XLM A;  1CPQ A;  4N4W A;  4CIP A;  1YYJ A;  2XL6 A;  2YLI A;  1M6T A;  5AGF A;  4IAQ A;  2QLA A;  1MQV A;  2XLW A;  1S05 A;  3HNJ A;  4JEB A;  1CGO A;  3M15 A;  3QW1 A;  2YL3 A;  4N6H A;  3TOL A;  4CDY A;  1NBB A;  3M4B A;  1YZA A;  2XLO A;  1CGN A;  2XLE A;  2J9B A;  1E86 A;  4CDV A;  5JVE A;  1QPU A;  3U8P A;  5JUA A;  4ER9 A;  3C62 A;  3TOM A;  256B A;  4WGZ A;  4NC3 A;  4L6R A;  1E85 A;  2YKZ A;  3C63 A;  3QVZ A;  3ZQV A;  5JT4 A;  1YZC A;  2BC5 A;  1JAF A;  1LM3 B;  3FOO A;  3ZWI A;  3HNK A;  5JS5 A;  1RCP A;  2J8W A;  4U9E A;  2YLD A;  3DE9 A;  4CDA A;  4JKV A;  4EIY A;  3FOP A;  4JEA A;  3M4C A;  2XM4 A;  1E83 A;  3HNI A;  2YL0 A;  5B3I A;  3ZTZ A;  1E84 A;  5JRA A;  3NMK A;  5JLI A;  2XL8 A;  3IQ5 A;  2XLV A;  2XM0 A;  2CCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...