2XM4A

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124e variant
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
127
structure length
127
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYEKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 50
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xm4A00
1BBHA 2YL0A 3IQ6A 2J8WA 3ZQYA 1E84A 4ULVA 1YZAA 256BA 2YLIA 3ZWIA 5JLIA 4CDAA 1QQ3A 2XLEA 1APCA 2XLMA 4JEAA 5JT4A 4CX9A 5JSLA 3M4CA 4WGYA 2XLDA 2BC5A 1S05A 4N4WA 2XM4A 4CDVA 4JE9A 4NC3A 3FOOA 5JUAA 3HNLA 3HNKA 1E85A 4JEBA 1JAFA 3C62A 2XLOA 2YL3A 4CJOA 3M79A 4ER9A 1E86A 1QPUA 4U9EA 1A7VA 1CGNA 1CPRA 3L1MA 3QW1A 1RCPA 4N6HA 2XLVA 1LM3B 1EKYA 4CIPA 3HNIA 2XLHA 3DE8A 3QW0A 5JP7A 3M15A 2XL8A 3ZQVA 2XLWA 3NMJA 3DE9A 1E83A 2YL1A 3TOMA 4JKVA 1YZCA 3VRCA 3ZTMA 4IARA 3ZTZA 1NBBA 1CPQA 3C63A 1CGOA 3QVZA 4D4XA 3M4BA 5AGFA 1YYJA 3NMIA 2XM0A 4L6RA 4IB4A 2XL6A 1M6TA 4IAQA 1GQAA 2YKZA 4U9DA 3QVYA 5JRAA 3HNJA 3IQ5A 2J9BA 2QLAA 3U8PA 5JVEA 1MQVA 1YYXA 4CDYA 5B3IA 2YLDA 3TOLA 4D4NA 2YLGA 4CJGA 3FOPA 3NMKA 4WGZA 2CCYA 2YL7A 5JS5A 4EIYA
chains in the Genus database with same CATH superfamily
1BBHA 1OCRC 2IYLD 4G78A 1V55C 3OEOA 1M2VA 2OCCC 4YL0A 3AG4C 4HFFB 2Q7RA 3ZQYA 1I4ZA 1AVOB 1VLSA 4ULVA 1Z5ZA 2R7OA 4A2NB 3LNRA 2OOCA 3OWTA 5JLIA 3G4XA 2B0JA 4JCZA 3POVA 3NRHA 1LS1A 2WZFA 1RKEB 2DYRC 1ZW3A 2X0CA 2ASRA 1MMDA 2XLEA 3K7DA 2W9YA 4BG0A 5A6AA 1SF8A 1U6HA 3VYWA 3L8IA 4YT8A 3S0XA 3L0IA 1HY5A 3C8GA 3W2VA 3O10A 3B0UX 5A6JA 1GS9A 3C18A 2LSEA 4ANJA 3R2PA 2MYSA 5B1BC 3U3BA 2P1AA 3C8GD 1MMNA 1Q0DA 1ZHYA 4K0DA 1Y4CA 4MVMA 3RQGA 4MW3A 5JUAA 4P9FA 2PX3A 1TR2A 1LS4A 1XZPA 4JTDB 3O55A 1OW6A 3VM6A 3HKKA 3C62A 2KC3A 3NYLA 1JR8A 5EK0A 1PD1A 1BDJB 4MVOA 2CDQA 2GAQA 4OINF 3TD7A 2OEXA 4ER9A 2ICWG 3IPMO 5E3AA 1FMVA 1QPUA 4U9EA 2CYDA 1QSPA 4XLNF 4EBBA 3KYIA 3V5ZA 4ZLDA 1BR1A 4LACB 4U5BE 2V3CC 2VH3A 1PV3A 3JCUQ 4IJJA 3FMSA 4JJFA 1WWPA 1H9TA 1EKYA 4BJ5C 3HNIA 3EZHA 2CGEA 2KYHA 4IRUA 3LLIA 1OCOC 2E87A 5L0IA 5EGYA 2A69F 2C03A 2A6EF 3EHMA 2WL8A 3NKDA 5F28E 5KYWB 1RMVA 1M2OA 3EZIA 3H2UA 2XS1A 3TULA 1NZEA 2LD6A 5AC5A 5L3VA 2XL8A 1VOMA 2IXOA 4EKWA 3Q7LA 1LIHA 1E83A 2YL1A 2Q9AA 1OR3A 3C8ZA 4NY3A 3TOMA 3U9MA 3S27A 1TWGA 2QNLA 2HSQA 1WOLA 4PFOA 5BQIA 2I8BA 4MS2A 3SXZA 3UMHA 5L0DA 1OR2A 1H6GA 1MNEA 1YA7O 3ZC4A 2B0HA 2OJQA 3K1HA 3KH2A 3ZDLA 3S90A 3H65A 1FAPB 4G7HF 4G7ZF 4J7TA 3DM9B 3C63A 4H4KC 4MTFA 4J32B 2R7UA 3DXJF 3U2MA 3MBGA 3W2WA 3Q6MA 1A41A 3LS1A 5AGFA 3T9OA 2R02A 3LJBA 5HSWA 1FNTc 3EGXB 3FAPB 2IXPA 2PF4E 1RXQA 4MTGA 1XZQA 2AWYA 1VK5A 1ZHXA 2PX0A 2G3KA 4NTBA 2EPMX 1CGME 2PFDA 5KYUA 1IW7F 4X0RA 2W4MA 1ZHWA 3V7OA 4IAQA 1WN0A 4ULWA 1K04A 1GQAA 2YKZA 3G50A 4XPXA 3Q7GA 4E17A 1S7ZA 2OQMA 1TFOB 1ZHZA 2QLAA 1MQVA 2MHRA 2NUTA 3U8PA 5JVEA 5KYYB 2ZXOA 1EI7A 2EINC 4OIPF 1RJ9B 4O6MA 2YEVA 4CS9A 1HE9A 3AG1C 3NYMA 4XWJA 2AU5A 2A6HF 3TOLA 5L0HA 1A7EA 2EILC 4CJGA 1K40A 4JTCB 2OG2A 1YARO 2L9JA 4IWBA 3TJ5A 2EIMC 1C17M 2ZXRA 2HV6A 1HMOA 2A0BA 4B6IA 4BJTA 1U89A 4EIYA 1R4TA 3US6A 2EPOA 3CEXA 2YQYA 2IXMA 1WTYA 2QY9A 1C02A 3ABLC 1T6IA 3TK0A 2CW0F 1E84A 4LERA 1NG1A 4K1OA 2ZPAA 2NUPB 2YLIA 2Z15A 1HW2A 3JSEO 4C3EA 1QQ3A 2R05A 4YJWA 5TJ5E 4NTAA 1BZ4A 1ZVZA 4CX9A 2HJMA 3FVYA 4JRZA 3EPVA 3KPHA 1UFBA 1YJGA 2P6VA 2WVQA 4U5EE 5BQGA 4MQ9F 4WGYA 4I1OB 5CIVA 2Y3BA 1S05A 2VCBA 1J8YF 1C03A 4N4WA 4O6YA 5AC4A 5L0JA 3A9CA 2L7AA 4HE8D 4CDVA 2H8AA 1ZHTA 2KJGA 2L6GA 3RW0A 3RFYA 1SYQA 4Q5SF 1I5NA 3HNLA 3UNGC 4JEBA 4JTAB 1E2XA 1F1MA 1OCZC 5F5FA 4WABA 2WVOA 1YVIA 1V54C 1DOVA 3HLZA 4XEFA 3GODA 1HMDA 2QUPA 2F22A 3U8VA 3ZVRA 4BJ5A 5L0GA 3B0VC 1TWHA 1XWJA 2Q00A 1NFOA 1Z7Qc 1GM5A 1JMWA 2AWCA 2L6FA 1A7VA 4AE4A 1CGNA 2HSBA 1D1CA 3AQCA 1CPRA 3VF0A 3L1MA 3QW1A 4K7BA 4BEMJ 5KYNA 3AOUA 1T6UA 4PK4A 1O3UA 1LM3B 2Y39A 4MNDA 1QZXA 2I15A 4P6IC 3R7CA 1DOWA 4CIPA 3E9VA 3S28A 1H7IA 2NSFA 2GFHA 3T6GB 1N1CA 3X1OA 4EHPA 1VTMP 3QW0A 2CNWA 3MYFA 2LFDA 1QVXA 2J45A 4FESA 3DJUB 3M15A 4G0HA 5JP7A 2UUIA 2DI3A 2EIJC 2FGYA 2LK4A 4AL0A 2CNWD 1L3PA 1K05A 2HFIA 2J9UA 1ORYA 3NMJA 4Z9HA 3U0CA 3C7JA 2HUJA 4A4AA 2RSEB 3WAQA 3PHF2 4DBQA 3VRCA 1LVKA 3EFOB 3UGOA 3BRJA 3RQEA 2G62A 3U2LA 4I3MA 4JJGA 1A7DA 4PJLA 4KI2A 2VCCA 2W45A 2D4UA 1D0ZA 4YWQA 3GEHA 3QVZA 4DRIB 3CZ6A 1FR0A 1NFNA 5D92A 4OIOF 1M2VB 1QKRA 3B29A 3U9JA 5L0FA 5A6BA 3GWNA 2M64A 2YHSA 4L6RA 4IB4A 1D0XA 5A6BD 2XL6A 5FCLA 1A0BA 1BR2A 1LI5A 3UR3C 2WVNA 4U9DA 1WATA 4CSAA 2W4BA 3HNJA 2P61A 3IQ5A 2J9BA 3C8GB 5T3WA 2Y3GA 5BQHA 4CDYA 4MVZA 2DYSC 2PNOA 4YN0B 1T5OA 2ZD9A 3F46A 5KYYA 4OIQF 2O9XA 4KNVA 1T9KA 4NQFA 3U3FA 4D4NA 4EBJA 4RD9A 4QI2A 2RD9A 3FOPA 4MVRA 3SNHA 5EHHA 2LIGA 2WZLA 3S29A 2R03A 4XTKA 2QE9A 1HW1A 2EIKC 4LDRA 3Q6NA 4DJ9A 2DB4A 3G4ZA 2OEVA 3JZ0A 4DOZA 5DS4A 4DRJB 1G8XA 4WJ0A 3IQ6A 2J8WA 1RKCA 5A69A 1SMYF 2Q9BA 1IZMA 4M63A 1OXBA 1YZAA 256BA 2PBEA 2YVKA 1PD0A 3GM3A 4HFKB 4J30B 3WODF 3ZWIA 4AK9A 1JOGA 5B3SC 4CIHA 1Z3IX 2KW3C 5KYXA 4Q4ZF 1UG7A 2R7WA 3ASOC 3FXHA 4JEAA 4PFPA 4MVUA 3LUTB 5T3TA 3T6JA 2IBFA 5JT4A 4Z9IA 3DM5A 2PP4A 1VYKA 2L6HA 3B9QA 4MW8A 5COFA 5JSLA 3UGPA 3M4CA 4MTOA 4FWVA 2Y69C 4XQ1A 3ZIBA 2JX0A 1V4AA 3AG2C 3GWLA 1M57C 3T4RA 4C7OA 2EPLX 3CSKA 3JRMO 4XPYA 5CI8A 4JE9A 3AQBA 4CSAC 2Q4FA 3MX3A 3FOOA 3SEOA 2FFHA 4I44A 2A0UA 3MFNA 3K6BA 2LP4A 2WZGA 2J9WA 1J8MF 1D1AA 1FFTC 3SXMA 3W8IA 5A6KA 4N6CA 3W8HA 1BR4A 2DGJA 2XLOA 4XLPF 3B71A 1WASA 2BE5F 3SP1A 3N0TA 3AJMA 3EQLF 4BJ6A 3SXYA 4OIRF 4E0IA 1G4WR 2XXAB 3DKAA 4KNWA 1MMGA 4CS7A 5COMA 1KU2A 4UDVA 3MYIA 2XXAA 1Q0MA 1NLXA 4IAOA 1RKEA 4NCQA 1SR2A 4EBKA 3EH1A 1RCPA 4U5HA 4N6HA 4F4BA 4CS9C 2BL2A 2HJ3A 3U5SA 1OXKA 2R25A 1TQGA 2XLHA 3M1CB 5DS5A 5GPGB 3IHUA 4YT5A 3FAJA 1JRAA 3KKBA 3DE8A 3EH2A 3DD7A 4LDQA 2VCAA 1FTSA 5KYUB 3GEEA 2XSEA 3I5PA 1LE2A 1ZW2A 3EG9B 3KL4A 4C3BA 2J7PA 2VC9A 4PJMA 4FX5A 3ZQVA 2R7XA 2XLWA 3T6BA 2NUTB 3EGDB 2HS5A 3NYJA 1ORSC 1ZU5A 3J06A 2J7PD 4JKVA 4NTFA 3RH3A 3RIPA 5IY5C 1ORJA 1LE4A 4O79A 4U5CE 2XS8A 2YWAA 1YA9A 1SZIA 3ZTMA 1I4YA 2J9VA 2XL4A 4I1MA 1NSGB 1VLTA 4KBLA 3H2VA 2Q3TA 4R32A 1KTMA 2Y3DA 1CPQA 4RDAA 3RF3A 1GGQA 3K33A 4KC9A 1VYIA 1TWAA 2P7VA 3DAFA 3TJ6A 3SYNA 2UUHA 3RYLA 4G7OF 3WHNA 4BJ1A 1YYJA 2J0XA 3NMIA 1O5HA 1T01A 1OCCC 2LCHA 4J7YA 5D91A 4BJ6C 1ZYRF 4YL1A 3NDBB 2AP3A 1Q0GA 2IXNA 2OJED 2VASA 3ABKC 3N2ZB 3PDMP 3V5XA 4PR9A 1M6TA 3CAXA 1ZZPA 3LEVA 5KYWA 4MVSA 5E33A 4YT2A 4W8KA 4AL1A 2KQ9A 3HJCA 4GYTA 4U5GA 3ZG1A 1T6QA 5JRAA 2G3VA 2KSFA 2YRFA 4GEHA 3DMDA 1YLMA 3LAYA 4LLCA 3GORA 4CBEA 2R7TA 3LS0A 3SXKA 4P9TA 4GQHA 3JRTA 5E3CA 4DVZA 2OKUA 2YLGA 3ECSA 1NU7D 1QLEC 2X51A 1TKNA 2A68F 3NMKA 2XRHA 4WGZA 5E2QA 2CCYA 3AG3C 2C04A 1D1BA 3EJNA 3PMRA 4OD5A 4AX2A 5JS5A 2EPNA 3GEIA 2YL0A 1NU9C 3V5YA 5DS6A 3B0PA 3L8JA 4H54A 2IM8A 5COGA 2J0WA 4EWCA 3EGXA 5K0IA 3RKOF 1Z63A 4LLEA 1OW7A 2KK1A 5L3QA 1TWCA 3K1IA 3K66A 3BEHA 1B68A 3A11A 4PJNA 4W8PA 3OA1A 2R9RB 1OW8A 4XPWA 4AE4B 4CDAA 3I4UA 3JYHA 1APCA 1V74B 2XLMA 1OQCA 2R7SA 1YDIA 3EHNA 1PCXA 1Q0FA 2J46A 1H9GA 2NSGA 2VB6A 3O6XA 1MMAA 3LNMB 5T1DB 4E18A 2XLDA 2BC5A 2ZXPA 2NPUA 3F47A 4YK5A 1M56C 4E7SA 2EPKX 4JZAA 2HKVA 1RJ9A 3TQOA 1AUEA 2XM4A 3SZRA 1JPJA 5DQZA 1ZU4A 4RBNA 5CI9A 4ZLCA 1KNYA 2L81A 4NC3A 2KNHA 4YT4A 2P0NA 3HNKA 3E70C 3IQTA 3QTHA 1E85A 1JAFA 2Q9CA 3W4YA 1AEPA 3JSZA 3I5QA 3JTLO 3IEEA 2YL3A 4IGGA 4DRHB 4JVSA 1W2WA 4Q7CA 3LESA 1R5ID 4HEAJ 4CJOA 3RVZA 5F5HA 3M79A 2HZ8A 2NUPA 3DI5A 1E86A 2AVKA 4E7ZA 3IQCA 2NG1A 1G5ZA 3AGUA 3MLGA 4YL3A 2GDCA 3NKEA 3RQFA 2QTVA 4PJJA 4JW1A 5DLJA 3NG1A 4DVYP 2ETSA 1LI7A 2XLVA 1Y6DA 3DAGA 4EUKB 4QDLA 4DBRA 4N06A 3S84A 4LDKA 3K1IC 3KYJA 1FFHA 2HMQA 4JURI 1Q0KA 1WGWA 2GWWA 1YAUO 2LFFA 3GM1A 1LPEA 1L7CA 2MWQA 5BUOA 2R7VA 2GA0A 3N24A 3ZSUA 2H7BA 3EG9A 4JCHA 1FMWA 3DE9A 4XEKA 4CS8A 3DZAA 3HTKC 5DVWA 4C3DA 1OKKA 3JT1A 1YZCA 3EGDA 4JC7A 3JYYA 4QI0A 1JPNA 1TFKB 3ATPA 4Z9JA 2M4EA 4U5DE 2V26A 4MVQA 1LKXA 1EA8A 1OKKD 2LQGA 5L0CA 1VB5A 3DJNB 1O87A 3UMKA 4IARA 1Z23A 5HV9A 3ABMC 3ZTZA 1NBBA 1EQ1A 4DXWA 1CGOA 1D0YA 3RVYA 1VMAA 4D4XA 1Z6AA 3FDQA 4O7GA 3L34A 1HE1A 3M4BA 2WB7A 3WG7C 2Y3HA 3LLKA 4U5FE 3DWWA 2XM0A 3CQZA 2YZSA 5KYXB 2A1DD 2HMZA 4PACA 4JIOA 4O6NA 1U0BB 1G4US 3FHDA 2OU6A 3S9OA 1ST6A 3QVYA 4BPMA 3KMIA 1YYXA 2HV7A 2R7QA 3QMKA 3GM2A 3VAYA 2D5RB 3QZCA 2YLDA 5FZTA 5B1AC 3ITFA 5B3IA 2H7VC 3O39A 2H7OA 3ASNC 3X2QC 3LEOA 3AGTA 4C7OB 3EFOA 1MNDA 2JD3A 4BEJA 2ZXWC 5DQTA 2IOQA 3PCVA 4FAPB 4XEVA 4E0HA 3UMIA 4OD4A 2TMVP 2FAPB 2YL7A 4ONSA 3GANA 4CS8C 2KGOA 2R7RA 2JPUA
chains in the Genus database with same CATH topology
1BBHA 2YL0A 3IQ6A 2J8WA 3ZQYA 1E84A 4ULVA 1YZAA 256BA 2YLIA 3ZWIA 5JLIA 4CDAA 1QQ3A 2XLEA 1APCA 2XLMA 4JEAA 5JT4A 4CX9A 5JSLA 3M4CA 4WGYA 2XLDA 2BC5A 1S05A 4N4WA 2XM4A 4CDVA 4JE9A 4NC3A 3FOOA 5JUAA 3HNLA 3HNKA 1E85A 4JEBA 1JAFA 3C62A 2XLOA 2YL3A 4CJOA 3M79A 4ER9A 1E86A 1QPUA 4U9EA 1A7VA 1CGNA 1CPRA 3L1MA 3QW1A 1RCPA 4N6HA 2XLVA 1LM3B 1EKYA 4CIPA 3HNIA 2XLHA 3DE8A 3QW0A 5JP7A 3M15A 2XL8A 3ZQVA 2XLWA 3NMJA 3DE9A 1E83A 2YL1A 3TOMA 4JKVA 1YZCA 3VRCA 3ZTMA 4IARA 3ZTZA 1NBBA 1CPQA 3C63A 1CGOA 3QVZA 4D4XA 3M4BA 5AGFA 1YYJA 3NMIA 2XM0A 4L6RA 4IB4A 2XL6A 1M6TA 4IAQA 1GQAA 2YKZA 4U9DA 3QVYA 5JRAA 3HNJA 3IQ5A 2J9BA 2QLAA 3U8PA 5JVEA 1MQVA 1YYXA 4CDYA 5B3IA 2YLDA 3TOLA 4D4NA 2YLGA 4CJGA 3FOPA 3NMKA 4WGZA 2CCYA 2YL7A 5JS5A 4EIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBH A;  2YL0 A;  3IQ6 A;  2J8W A;  3ZQY A;  1E84 A;  4ULV A;  1YZA A;  256B A;  2YLI A;  3ZWI A;  5JLI A;  4CDA A;  1QQ3 A;  2XLE A;  1APC A;  2XLM A;  4JEA A;  5JT4 A;  4CX9 A;  5JSL A;  3M4C A;  4WGY A;  2XLD A;  2BC5 A;  1S05 A;  4N4W A;  2XM4 A;  4CDV A;  4JE9 A;  4NC3 A;  3FOO A;  5JUA A;  3HNL A;  3HNK A;  1E85 A;  4JEB A;  1JAF A;  3C62 A;  2XLO A;  2YL3 A;  4CJO A;  3M79 A;  4ER9 A;  1E86 A;  1QPU A;  4U9E A;  1A7V A;  1CGN A;  1CPR A;  3L1M A;  3QW1 A;  1RCP A;  4N6H A;  2XLV A;  1LM3 B;  1EKY A;  4CIP A;  3HNI A;  2XLH A;  3DE8 A;  3QW0 A;  5JP7 A;  3M15 A;  2XL8 A;  3ZQV A;  2XLW A;  3NMJ A;  3DE9 A;  1E83 A;  2YL1 A;  3TOM A;  4JKV A;  1YZC A;  3VRC A;  3ZTM A;  4IAR A;  3ZTZ A;  1NBB A;  1CPQ A;  3C63 A;  1CGO A;  3QVZ A;  4D4X A;  3M4B A;  5AGF A;  1YYJ A;  3NMI A;  2XM0 A;  4L6R A;  4IB4 A;  2XL6 A;  1M6T A;  4IAQ A;  1GQA A;  2YKZ A;  4U9D A;  3QVY A;  5JRA A;  3HNJ A;  3IQ5 A;  2J9B A;  2QLA A;  3U8P A;  5JVE A;  1MQV A;  1YYX A;  4CDY A;  5B3I A;  2YLD A;  3TOL A;  4D4N A;  2YLG A;  4CJG A;  3FOP A;  3NMK A;  4WGZ A;  2CCY A;  2YL7 A;  5JS5 A;  4EIY A; 
#chains in the Genus database with same CATH topology
 1BBH A;  1OCR C;  2IYL D;  4G78 A;  1V55 C;  3OEO A;  1M2V A;  2OCC C;  4YL0 A;  3AG4 C;  4HFF B;  2Q7R A;  3ZQY A;  1I4Z A;  1AVO B;  1VLS A;  4ULV A;  1Z5Z A;  2R7O A;  4A2N B;  3LNR A;  2OOC A;  3OWT A;  5JLI A;  3G4X A;  2B0J A;  4JCZ A;  3POV A;  3NRH A;  1LS1 A;  2WZF A;  1RKE B;  2DYR C;  1ZW3 A;  2X0C A;  2ASR A;  1MMD A;  2XLE A;  3K7D A;  2W9Y A;  4BG0 A;  5A6A A;  1SF8 A;  1U6H A;  3VYW A;  3L8I A;  4YT8 A;  3S0X A;  3L0I A;  1HY5 A;  3C8G A;  3W2V A;  3O10 A;  3B0U X;  5A6J A;  1GS9 A;  3C18 A;  2LSE A;  4ANJ A;  3R2P A;  2MYS A;  5B1B C;  3U3B A;  2P1A A;  3C8G D;  1MMN A;  1Q0D A;  1ZHY A;  4K0D A;  1Y4C A;  4MVM A;  3RQG A;  4MW3 A;  5JUA A;  4P9F A;  2PX3 A;  1TR2 A;  1LS4 A;  1XZP A;  4JTD B;  3O55 A;  1OW6 A;  3VM6 A;  3HKK A;  3C62 A;  2KC3 A;  3NYL A;  1JR8 A;  5EK0 A;  1PD1 A;  1BDJ B;  4MVO A;  2CDQ A;  2GAQ A;  4OIN F;  3TD7 A;  2OEX A;  4ER9 A;  2ICW G;  3IPM O;  5E3A A;  1FMV A;  1QPU A;  4U9E A;  2CYD A;  1QSP A;  4XLN F;  4EBB A;  3KYI A;  3V5Z A;  4ZLD A;  1BR1 A;  4LAC B;  4U5B E;  2V3C C;  2VH3 A;  1PV3 A;  3JCU Q;  4IJJ A;  3FMS A;  4JJF A;  1WWP A;  1H9T A;  1EKY A;  4BJ5 C;  3HNI A;  3EZH A;  2CGE A;  2KYH A;  4IRU A;  3LLI A;  1OCO C;  2E87 A;  5L0I A;  5EGY A;  2A69 F;  2C03 A;  2A6E F;  3EHM A;  2WL8 A;  3NKD A;  5F28 E;  5KYW B;  1RMV A;  1M2O A;  3EZI A;  3H2U A;  2XS1 A;  3TUL A;  1NZE A;  2LD6 A;  5AC5 A;  5L3V A;  2XL8 A;  1VOM A;  2IXO A;  4EKW A;  3Q7L A;  1LIH A;  1E83 A;  2YL1 A;  2Q9A A;  1OR3 A;  3C8Z A;  4NY3 A;  3TOM A;  3U9M A;  3S27 A;  1TWG A;  2QNL A;  2HSQ A;  1WOL A;  4PFO A;  5BQI A;  2I8B A;  4MS2 A;  3SXZ A;  3UMH A;  5L0D A;  1OR2 A;  1H6G A;  1MNE A;  1YA7 O;  3ZC4 A;  2B0H A;  2OJQ A;  3K1H A;  3KH2 A;  3ZDL A;  3S90 A;  3H65 A;  1FAP B;  4G7H F;  4G7Z F;  4J7T A;  3DM9 B;  3C63 A;  4H4K C;  4MTF A;  4J32 B;  2R7U A;  3DXJ F;  3U2M A;  3MBG A;  3W2W A;  3Q6M A;  1A41 A;  3LS1 A;  5AGF A;  3T9O A;  2R02 A;  3LJB A;  5HSW A;  1FNT c;  3EGX B;  3FAP B;  2IXP A;  2PF4 E;  1RXQ A;  4MTG A;  1XZQ A;  2AWY A;  1VK5 A;  1ZHX A;  2PX0 A;  2G3K A;  4NTB A;  2EPM X;  1CGM E;  2PFD A;  5KYU A;  1IW7 F;  4X0R A;  2W4M A;  1ZHW A;  3V7O A;  4IAQ A;  1WN0 A;  4ULW A;  1K04 A;  1GQA A;  2YKZ A;  3G50 A;  4XPX A;  3Q7G A;  4E17 A;  1S7Z A;  2OQM A;  1TFO B;  1ZHZ A;  2QLA A;  1MQV A;  2MHR A;  2NUT A;  3U8P A;  5JVE A;  5KYY B;  2ZXO A;  1EI7 A;  2EIN C;  4OIP F;  1RJ9 B;  4O6M A;  2YEV A;  4CS9 A;  1HE9 A;  3AG1 C;  3NYM A;  4XWJ A;  2AU5 A;  2A6H F;  3TOL A;  5L0H A;  1A7E A;  2EIL C;  4CJG A;  1K40 A;  4JTC B;  2OG2 A;  1YAR O;  2L9J A;  4IWB A;  3TJ5 A;  2EIM C;  1C17 M;  2ZXR A;  2HV6 A;  1HMO A;  2A0B A;  4B6I A;  4BJT A;  1U89 A;  4EIY A;  1R4T A;  3US6 A;  2EPO A;  3CEX A;  2YQY A;  2IXM A;  1WTY A;  2QY9 A;  1C02 A;  3ABL C;  1T6I A;  3TK0 A;  2CW0 F;  1E84 A;  4LER A;  1NG1 A;  4K1O A;  2ZPA A;  2NUP B;  2YLI A;  2Z15 A;  1HW2 A;  3JSE O;  4C3E A;  1QQ3 A;  2R05 A;  4YJW A;  5TJ5 E;  4NTA A;  1BZ4 A;  1ZVZ A;  4CX9 A;  2HJM A;  3FVY A;  4JRZ A;  3EPV A;  3KPH A;  1UFB A;  1YJG A;  2P6V A;  2WVQ A;  4U5E E;  5BQG A;  4MQ9 F;  4WGY A;  4I1O B;  5CIV A;  2Y3B A;  1S05 A;  2VCB A;  1J8Y F;  1C03 A;  4N4W A;  4O6Y A;  5AC4 A;  5L0J A;  3A9C A;  2L7A A;  4HE8 D;  4CDV A;  2H8A A;  1ZHT A;  2KJG A;  2L6G A;  3RW0 A;  3RFY A;  1SYQ A;  4Q5S F;  1I5N A;  3HNL A;  3UNG C;  4JEB A;  4JTA B;  1E2X A;  1F1M A;  1OCZ C;  5F5F A;  4WAB A;  2WVO A;  1YVI A;  1V54 C;  1DOV A;  3HLZ A;  4XEF A;  3GOD A;  1HMD A;  2QUP A;  2F22 A;  3U8V A;  3ZVR A;  4BJ5 A;  5L0G A;  3B0V C;  1TWH A;  1XWJ A;  2Q00 A;  1NFO A;  1Z7Q c;  1GM5 A;  1JMW A;  2AWC A;  2L6F A;  1A7V A;  4AE4 A;  1CGN A;  2HSB A;  1D1C A;  3AQC A;  1CPR A;  3VF0 A;  3L1M A;  3QW1 A;  4K7B A;  4BEM J;  5KYN A;  3AOU A;  1T6U A;  4PK4 A;  1O3U A;  1LM3 B;  2Y39 A;  4MND A;  1QZX A;  2I15 A;  4P6I C;  3R7C A;  1DOW A;  4CIP A;  3E9V A;  3S28 A;  1H7I A;  2NSF A;  2GFH A;  3T6G B;  1N1C A;  3X1O A;  4EHP A;  1VTM P;  3QW0 A;  2CNW A;  3MYF A;  2LFD A;  1QVX A;  2J45 A;  4FES A;  3DJU B;  3M15 A;  4G0H A;  5JP7 A;  2UUI A;  2DI3 A;  2EIJ C;  2FGY A;  2LK4 A;  4AL0 A;  2CNW D;  1L3P A;  1K05 A;  2HFI A;  2J9U A;  1ORY A;  3NMJ A;  4Z9H A;  3U0C A;  3C7J A;  2HUJ A;  4A4A A;  2RSE B;  3WAQ A;  3PHF 2;  4DBQ A;  3VRC A;  1LVK A;  3EFO B;  3UGO A;  3BRJ A;  3RQE A;  2G62 A;  3U2L A;  4I3M A;  4JJG A;  1A7D A;  4PJL A;  4KI2 A;  2VCC A;  2W45 A;  2D4U A;  1D0Z A;  4YWQ A;  3GEH A;  3QVZ A;  4DRI B;  3CZ6 A;  1FR0 A;  1NFN A;  5D92 A;  4OIO F;  1M2V B;  1QKR A;  3B29 A;  3U9J A;  5L0F A;  5A6B A;  3GWN A;  2M64 A;  2YHS A;  4L6R A;  4IB4 A;  1D0X A;  5A6B D;  2XL6 A;  5FCL A;  1A0B A;  1BR2 A;  1LI5 A;  3UR3 C;  2WVN A;  4U9D A;  1WAT A;  4CSA A;  2W4B A;  3HNJ A;  2P61 A;  3IQ5 A;  2J9B A;  3C8G B;  5T3W A;  2Y3G A;  5BQH A;  4CDY A;  4MVZ A;  2DYS C;  2PNO A;  4YN0 B;  1T5O A;  2ZD9 A;  3F46 A;  5KYY A;  4OIQ F;  2O9X A;  4KNV A;  1T9K A;  4NQF A;  3U3F A;  4D4N A;  4EBJ A;  4RD9 A;  4QI2 A;  2RD9 A;  3FOP A;  4MVR A;  3SNH A;  5EHH A;  2LIG A;  2WZL A;  3S29 A;  2R03 A;  4XTK A;  2QE9 A;  1HW1 A;  2EIK C;  4LDR A;  3Q6N A;  4DJ9 A;  2DB4 A;  3G4Z A;  2OEV A;  3JZ0 A;  4DOZ A;  5DS4 A;  4DRJ B;  1G8X A;  4WJ0 A;  3IQ6 A;  2J8W A;  1RKC A;  5A69 A;  1SMY F;  2Q9B A;  1IZM A;  4M63 A;  1OXB A;  1YZA A;  256B A;  2PBE A;  2YVK A;  1PD0 A;  3GM3 A;  4HFK B;  4J30 B;  3WOD F;  3ZWI A;  4AK9 A;  1JOG A;  5B3S C;  4CIH A;  1Z3I X;  2KW3 C;  5KYX A;  4Q4Z F;  1UG7 A;  2R7W A;  3ASO C;  3FXH A;  4JEA A;  4PFP A;  4MVU A;  3LUT B;  5T3T A;  3T6J A;  2IBF A;  5JT4 A;  4Z9I A;  3DM5 A;  2PP4 A;  1VYK A;  2L6H A;  3B9Q A;  4MW8 A;  5COF A;  5JSL A;  3UGP A;  3M4C A;  4MTO A;  4FWV A;  2Y69 C;  4XQ1 A;  3ZIB A;  2JX0 A;  1V4A A;  3AG2 C;  3GWL A;  1M57 C;  3T4R A;  4C7O A;  2EPL X;  3CSK A;  3JRM O;  4XPY A;  5CI8 A;  4JE9 A;  3AQB A;  4CSA C;  2Q4F A;  3MX3 A;  3FOO A;  3SEO A;  2FFH A;  4I44 A;  2A0U A;  3MFN A;  3K6B A;  2LP4 A;  2WZG A;  2J9W A;  1J8M F;  1D1A A;  1FFT C;  3SXM A;  3W8I A;  5A6K A;  4N6C A;  3W8H A;  1BR4 A;  2DGJ A;  2XLO A;  4XLP F;  3B71 A;  1WAS A;  2BE5 F;  3SP1 A;  3N0T A;  3AJM A;  3EQL F;  4BJ6 A;  3SXY A;  4OIR F;  4E0I A;  1G4W R;  2XXA B;  3DKA A;  4KNW A;  1MMG A;  4CS7 A;  5COM A;  1KU2 A;  4UDV A;  3MYI A;  2XXA A;  1Q0M A;  1NLX A;  4IAO A;  1RKE A;  4NCQ A;  1SR2 A;  4EBK A;  3EH1 A;  1RCP A;  4U5H A;  4N6H A;  4F4B A;  4CS9 C;  2BL2 A;  2HJ3 A;  3U5S A;  1OXK A;  2R25 A;  1TQG A;  2XLH A;  3M1C B;  5DS5 A;  5GPG B;  3IHU A;  4YT5 A;  3FAJ A;  1JRA A;  3KKB A;  3DE8 A;  3EH2 A;  3DD7 A;  4LDQ A;  2VCA A;  1FTS A;  5KYU B;  3GEE A;  2XSE A;  3I5P A;  1LE2 A;  1ZW2 A;  3EG9 B;  3KL4 A;  4C3B A;  2J7P A;  2VC9 A;  4PJM A;  4FX5 A;  3ZQV A;  2R7X A;  2XLW A;  3T6B A;  2NUT B;  3EGD B;  2HS5 A;  3NYJ A;  1ORS C;  1ZU5 A;  3J06 A;  2J7P D;  4JKV A;  4NTF A;  3RH3 A;  3RIP A;  5IY5 C;  1ORJ A;  1LE4 A;  4O79 A;  4U5C E;  2XS8 A;  2YWA A;  1YA9 A;  1SZI A;  3ZTM A;  1I4Y A;  2J9V A;  2XL4 A;  4I1M A;  1NSG B;  1VLT A;  4KBL A;  3H2V A;  2Q3T A;  4R32 A;  1KTM A;  2Y3D A;  1CPQ A;  4RDA A;  3RF3 A;  1GGQ A;  3K33 A;  4KC9 A;  1VYI A;  1TWA A;  2P7V A;  3DAF A;  3TJ6 A;  3SYN A;  2UUH A;  3RYL A;  4G7O F;  3WHN A;  4BJ1 A;  1YYJ A;  2J0X A;  3NMI A;  1O5H A;  1T01 A;  1OCC C;  2LCH A;  4J7Y A;  5D91 A;  4BJ6 C;  1ZYR F;  4YL1 A;  3NDB B;  2AP3 A;  1Q0G A;  2IXN A;  2OJE D;  2VAS A;  3ABK C;  3N2Z B;  3PDM P;  3V5X A;  4PR9 A;  1M6T A;  3CAX A;  1ZZP A;  3LEV A;  5KYW A;  4MVS A;  5E33 A;  4YT2 A;  4W8K A;  4AL1 A;  2KQ9 A;  3HJC A;  4GYT A;  4U5G A;  3ZG1 A;  1T6Q A;  5JRA A;  2G3V A;  2KSF A;  2YRF A;  4GEH A;  3DMD A;  1YLM A;  3LAY A;  4LLC A;  3GOR A;  4CBE A;  2R7T A;  3LS0 A;  3SXK A;  4P9T A;  4GQH A;  3JRT A;  5E3C A;  4DVZ A;  2OKU A;  2YLG A;  3ECS A;  1NU7 D;  1QLE C;  2X51 A;  1TKN A;  2A68 F;  3NMK A;  2XRH A;  4WGZ A;  5E2Q A;  2CCY A;  3AG3 C;  2C04 A;  1D1B A;  3EJN A;  3PMR A;  4OD5 A;  4AX2 A;  5JS5 A;  2EPN A;  3GEI A;  2YL0 A;  1NU9 C;  3V5Y A;  5DS6 A;  3B0P A;  3L8J A;  4H54 A;  2IM8 A;  5COG A;  2J0W A;  4EWC A;  3EGX A;  5K0I A;  3RKO F;  1Z63 A;  4LLE A;  1OW7 A;  2KK1 A;  5L3Q A;  1TWC A;  3K1I A;  3K66 A;  3BEH A;  1B68 A;  3A11 A;  4PJN A;  4W8P A;  3OA1 A;  2R9R B;  1OW8 A;  4XPW A;  4AE4 B;  4CDA A;  3I4U A;  3JYH A;  1APC A;  1V74 B;  2XLM A;  1OQC A;  2R7S A;  1YDI A;  3EHN A;  1PCX A;  1Q0F A;  2J46 A;  1H9G A;  2NSG A;  2VB6 A;  3O6X A;  1MMA A;  3LNM B;  5T1D B;  4E18 A;  2XLD A;  2BC5 A;  2ZXP A;  2NPU A;  3F47 A;  4YK5 A;  1M56 C;  4E7S A;  2EPK X;  4JZA A;  2HKV A;  1RJ9 A;  3TQO A;  1AUE A;  2XM4 A;  3SZR A;  1JPJ A;  5DQZ A;  1ZU4 A;  4RBN A;  5CI9 A;  4ZLC A;  1KNY A;  2L81 A;  4NC3 A;  2KNH A;  4YT4 A;  2P0N A;  3HNK A;  3E70 C;  3IQT A;  3QTH A;  1E85 A;  1JAF A;  2Q9C A;  3W4Y A;  1AEP A;  3JSZ A;  3I5Q A;  3JTL O;  3IEE A;  2YL3 A;  4IGG A;  4DRH B;  4JVS A;  1W2W A;  4Q7C A;  3LES A;  1R5I D;  4HEA J;  4CJO A;  3RVZ A;  5F5H A;  3M79 A;  2HZ8 A;  2NUP A;  3DI5 A;  1E86 A;  2AVK A;  4E7Z A;  3IQC A;  2NG1 A;  1G5Z A;  3AGU A;  3MLG A;  4YL3 A;  2GDC A;  3NKE A;  3RQF A;  2QTV A;  4PJJ A;  4JW1 A;  5DLJ A;  3NG1 A;  4DVY P;  2ETS A;  1LI7 A;  2XLV A;  1Y6D A;  3DAG A;  4EUK B;  4QDL A;  4DBR A;  4N06 A;  3S84 A;  4LDK A;  3K1I C;  3KYJ A;  1FFH A;  2HMQ A;  4JUR I;  1Q0K A;  1WGW A;  2GWW A;  1YAU O;  2LFF A;  3GM1 A;  1LPE A;  1L7C A;  2MWQ A;  5BUO A;  2R7V A;  2GA0 A;  3N24 A;  3ZSU A;  2H7B A;  3EG9 A;  4JCH A;  1FMW A;  3DE9 A;  4XEK A;  4CS8 A;  3DZA A;  3HTK C;  5DVW A;  4C3D A;  1OKK A;  3JT1 A;  1YZC A;  3EGD A;  4JC7 A;  3JYY A;  4QI0 A;  1JPN A;  1TFK B;  3ATP A;  4Z9J A;  2M4E A;  4U5D E;  2V26 A;  4MVQ A;  1LKX A;  1EA8 A;  1OKK D;  2LQG A;  5L0C A;  1VB5 A;  3DJN B;  1O87 A;  3UMK A;  4IAR A;  1Z23 A;  5HV9 A;  3ABM C;  3ZTZ A;  1NBB A;  1EQ1 A;  4DXW A;  1CGO A;  1D0Y A;  3RVY A;  1VMA A;  4D4X A;  1Z6A A;  3FDQ A;  4O7G A;  3L34 A;  1HE1 A;  3M4B A;  2WB7 A;  3WG7 C;  2Y3H A;  3LLK A;  4U5F E;  3DWW A;  2XM0 A;  3CQZ A;  2YZS A;  5KYX B;  2A1D D;  2HMZ A;  4PAC A;  4JIO A;  4O6N A;  1U0B B;  1G4U S;  3FHD A;  2OU6 A;  3S9O A;  1ST6 A;  3QVY A;  4BPM A;  3KMI A;  1YYX A;  2HV7 A;  2R7Q A;  3QMK A;  3GM2 A;  3VAY A;  2D5R B;  3QZC A;  2YLD A;  5FZT A;  5B1A C;  3ITF A;  5B3I A;  2H7V C;  3O39 A;  2H7O A;  3ASN C;  3X2Q C;  3LEO A;  3AGT A;  4C7O B;  3EFO A;  1MND A;  2JD3 A;  4BEJ A;  2ZXW C;  5DQT A;  2IOQ A;  3PCV A;  4FAP B;  4XEV A;  4E0H A;  3UMI A;  4OD4 A;  2TMV P;  2FAP B;  2YL7 A;  4ONS A;  3GAN A;  4CS8 C;  2KGO A;  2R7R A;  2JPU A; 
#chains in the Genus database with same CATH homology
 1BBH A;  2YL0 A;  3IQ6 A;  2J8W A;  3ZQY A;  1E84 A;  4ULV A;  1YZA A;  256B A;  2YLI A;  3ZWI A;  5JLI A;  4CDA A;  1QQ3 A;  2XLE A;  1APC A;  2XLM A;  4JEA A;  5JT4 A;  4CX9 A;  5JSL A;  3M4C A;  4WGY A;  2XLD A;  2BC5 A;  1S05 A;  4N4W A;  2XM4 A;  4CDV A;  4JE9 A;  4NC3 A;  3FOO A;  5JUA A;  3HNL A;  3HNK A;  1E85 A;  4JEB A;  1JAF A;  3C62 A;  2XLO A;  2YL3 A;  4CJO A;  3M79 A;  4ER9 A;  1E86 A;  1QPU A;  4U9E A;  1A7V A;  1CGN A;  1CPR A;  3L1M A;  3QW1 A;  1RCP A;  4N6H A;  2XLV A;  1LM3 B;  1EKY A;  4CIP A;  3HNI A;  2XLH A;  3DE8 A;  3QW0 A;  5JP7 A;  3M15 A;  2XL8 A;  3ZQV A;  2XLW A;  3NMJ A;  3DE9 A;  1E83 A;  2YL1 A;  3TOM A;  4JKV A;  1YZC A;  3VRC A;  3ZTM A;  4IAR A;  3ZTZ A;  1NBB A;  1CPQ A;  3C63 A;  1CGO A;  3QVZ A;  4D4X A;  3M4B A;  5AGF A;  1YYJ A;  3NMI A;  2XM0 A;  4L6R A;  4IB4 A;  2XL6 A;  1M6T A;  4IAQ A;  1GQA A;  2YKZ A;  4U9D A;  3QVY A;  5JRA A;  3HNJ A;  3IQ5 A;  2J9B A;  2QLA A;  3U8P A;  5JVE A;  1MQV A;  1YYX A;  4CDY A;  5B3I A;  2YLD A;  3TOL A;  4D4N A;  2YLG A;  4CJG A;  3FOP A;  3NMK A;  4WGZ A;  2CCY A;  2YL7 A;  5JS5 A;  4EIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...