1VYKA

Crystal structure of psbq protein of photosystem ii from higher plants
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
149
structure length
129
Chain Sequence
EARPIVVGPPPPLTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.49 A Resolution Crystal Structure of Psbq from Photosystem II of Spinacia Oleracea Reveals a Ppii Structure in the N-Terminal Region.
pubmed doi rcsb
molecule tags Photosystem ii
molecule keywords OXYGEN-EVOLVING ENHANCER PROTEIN 3
total genus 56
structure length 129
sequence length 149
ec nomenclature
pdb deposition date 2004-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1vykA00
2MWQA 3LS0A 3RFYA 1VYKA 1NZEA 3ZSUA 3LS1A 3JCUQ
chains in the Genus database with same CATH superfamily
3ITFA 2XLEA 4J7TA 3TULA 1JPNA 1Y6DA 3TQOA 4KNWA 3KKBA 5B1BC 3LAYA 2IBFA 3U5SA 1OXKA 2XL8A 1S05A 2OEVA 4LDKA 2XM0A 3SYNA 3V5XA 2LSEA 3VRCA 3TOLA 3ZDLA 4C3EA 1FMVA 2J9BA 2WVNA 3PHF2 3GWNA 2W4BA 3FAJA 4O6MA 3DZAA 1M6TA 1Z63A 2LK4A 2Y3DA 3GM1A 1OW7A 1D1AA 3K6BA 3ZTZA 4U9EA 3T6JA 4N06A 2NPUA 2PFDA 1NG1A 1MMDA 2CDQA 5JVEA 3FOOA 2HMQA 3DM9B 4XEVA 2AP3A 3EG9B 3SNHA 2XS8A 2L6FA 1XWJA 2A6HF 4MVQA 1OKKD 4G0HA 4JRZA 1Q0MA 4N6HA 3H65A 1KNYA 1OCCC 1YA7O 3A11A 3U9MA 2ASRA 3I5PA 3KYIA 4LACB 3NMIA 3QVYA 5COGA 1EA8A 4BJ1A 3ASOC 4DRJB 1T6IA 4LERA 2B0JA 2NSGA 4NY3A 2H7VC 1AVOB 4BJ6A 5EGYA 2V3CC 1K05A 2OG2A 1LPEA 1WWPA 3AG2C 3O10A 4EBBA 2ZXWC 1OKKA 2R7OA 2VCAA 4JIOA 2WZGA 3W4YA 2Q00A 5F5FA 2UUIA 3GODA 3U8PA 5A6BA 3DE8A 3RF3A 2QY9A 1VB5A 4PJLA 1RCPA 2HSQA 2PP4A 4YL0A 4YT4A 1LE4A 2NUPA 4JTAB 4JVSA 2Y3GA 1ZHTA 4XLNF 4E0IA 4C3DA 5KYWB 4IB4A 3MYFA 1F1MA 1YAUO 2DGJA 3JZ0A 3IQ5A 4HE8D 1D1CA 4CJGA 1J8MF 4QI0A 1FFHA 3RVZA 4KBLA 3R2PA 1A7EA 1OCRC 2LCHA 1BBHA 2EPOA 3SZRA 2L81A 3DE9A 3US6A 2XXAA 4LLCA 2A69F 2KNHA 2NSFA 3JSZA 1H7IA 5COFA 5A6BD 3MYIA 4O6YA 2IXOA 2VH3A 2AWCA 2XLHA 2RD9A 1FTSA 2FFHA 3C8GA 3BRJA 3LEOA 4IJJA 3S0XA 1YDIA 3AGTA 1A41A 3PMRA 5JLIA 4MVRA 3SP1A 5E3AA 2BE5F 1JRAA 1QQ3A 2W4MA 3AJMA 3EFOA 4NCQA 5TJ5E 5B3IA 3HNJA 4BJ6C 1FMWA 1I4ZA 2YEVA 1HMDA 1RKCA 2XLOA 2M4EA 2YL0A 1Q0GA 1D0XA 4WABA 5JT4A 2HMZA 1DOWA 2XM4A 2R7SA 1ZZPA 2RSEB 2XLVA 2R7TA 1EI7A 2ZPAA 2JPUA 2PBEA 3TOMA 1HW1A 1TWGA 1O3UA 4OIRF 4XPWA 2EPMX 1BR2A 1S7ZA 1CPQA 1YZCA 1PD1A 2J8WA 2LIGA 2VB6A 4JEBA 1ORSC 3SEOA 4BJTA 4NC3A 4O6NA 4NTBA 1B68A 2XSEA 4C7OB 3AG4C 1H9GA 5DQZA 1T5OA 4MVUA 3N0TA 3RH3A 3VM6A 2HJ3A 3MBGA 2HJMA 1PD0A 2DI3A 1Q0KA 1L7CA 4Q7CA 1YJGA 4MTOA 2C04A 4CS8A 3IQCA 1BZ4A 2CNWD 1TQGA 3LJBA 4MQ9F 4CDAA 2J9UA 1RJ9A 4WJ0A 3RW0A 2IXNA 4BPMA 2YVKA 3DWWA 3T6BA 4O7GA 3B0UX 4FWVA 2XLWA 1FNTc 4ONSA 1Z3IX 1RKEA 3S28A 1G4US 1NLXA 1SR2A 1U6HA 5E33A 4A2NB 1HW2A 3VYWA 3DAGA 1VOMA 3AQCA 3C63A 3NMJA 3QZCA 1LM3B 5A6JA 1IZMA 1Y4CA 2YLGA 3PCVA 4BEMJ 4XPYA 3RQEA 4AL1A 5IY5C 4EBKA 3L1MA 3UGOA 3OWTA 3DI5A 1XZQA 1QLEC 4E17A 5DVWA 3K66A 1OCZC 5KYXB 3B0PA 4MVMA 1JAFA 4RD9A 4JEAA 3EH1A 4Z9IA 4YWQA 3DD7A 3M15A 5JP7A 3ZSUA 3I4UA 1QVXA 3FDQA 3GEHA 3NKEA 1GM5A 4PK4A 2ZD9A 2KC3A 2QTVA 4XEFA 3Q7LA 2A6EF 4CS8C 1YARO 4CS7A 1DOVA 2HFIA 2XXAB 5AGFA 5EK0A 4CX9A 256BA 3A9CA 1TWCA 5F28E 1NFOA 2P61A 3HLZA 4I1MA 1N1CA 1YA9A 2OJED 2R02A 4YT2A 2R05A 1JMWA 2JX0A 3ZWIA 4DJ9A 3AOUA 2Q7RA 2AVKA 2WL8A 1KTMA 3E70C 3T4RA 1NZEA 1V54C 1ZHWA 5HV9A 2GDCA 4JCZA 3AQBA 3JYYA 5AC4A 2GFHA 3S9OA 3UMKA 3U0CA 2LFDA 3EGDA 2Q9BA 4JKVA 4MW8A 2L9JA 1OR2A 3F47A 1IW7F 4W8PA 3UMIA 3UMHA 3IEEA 4BEJA 4Q5SF 1RKEB 2B0HA 2EIMC 1QPUA 2PF4E 3L8JA 3EPVA 4PJJA 5L0GA 3M79A 1G8XA 2IOQA 3QW1A 2YL3A 3B71A 4P9FA 1RJ9B 1G4WR 1APCA 3ASNC 3TK0A 5JRAA 4DVYP 3S29A 5DS4A 1KU2A 1VYIA 1TKNA 2IYLD 4KI2A 4HFKB 4YJWA 2R7QA 3EHNA 3H2VA 4H4KC 4OIPF 3K1IA 1M2VA 1BR1A 1NU9C 1YYJA 4XPXA 5COMA 4DVZA 5A6KA 5BQIA 2R7RA 1JPJA 3EJNA 1Q0DA 3SXKA 4AE4A 3LUTB 2XRHA 1VTMP 4C7OA 1FR0A 4MS2A 2VCBA 4K0DA 5T3WA 1E2XA 1OCOC 2H7OA 4NTFA 4NQFA 2LD6A 1TWAA 1CGOA 4U5GA 3HNLA 2EINC 4JE9A 2OEXA 4U5DE 3RVYA 4CDYA 5F5HA 3N2ZB 2Q4FA 1WATA 5L0CA 1OW6A 2P7VA 3K33A 4YL3A 3R7CA 4L6RA 2V26A 1ZVZA 4JJFA 3UR3C 1CGNA 5EHHA 2M64A 3N24A 4X0RA 4YT5A 4EUKB 4GEHA 1U89A 3CZ6A 1ZHXA 4W8KA 3JRTA 4LDQA 4AE4B 3H2UA 3O6XA 3C62A 3C8GB 3CQZA 3IQ6A 5DLJA 4BG0A 2TMVP 3OEOA 1M2VB 5L0HA 1E86A 4G7OF 2J9VA 2KQ9A 1LE2A 2WZFA 4JCHA 4QDLA 1K04A 4J7YA 3RKOF 1WN0A 2QNLA 4GQHA 2DB4A 1TR2A 5B1AC 4ZLCA 3U3FA 4EWCA 1UFBA 3NYJA 2Q9CA 3Q7GA 2KSFA 5K0IA 2KGOA 4JJGA 3MLGA 1C02A 1LS1A 2J45A 3O39A 2OKUA 1Z5ZA 4IGGA 5KYWA 2R7UA 4CJOA 4JURI 2C03A 2WZLA 2YRFA 3SXZA 3TD7A 3B29A 2UUHA 3WAQA 1HE1A 1VYKA 3EGDB 2J0XA 3LS1A 4YN0B 1Q0FA 3V5ZA 3FMSA 4RBNA 3NRHA 2BL2A 3C8GD 2CGEA 2Y3BA 3M1CB 3NYLA 1C03A 4RDAA 3QMKA 4IAQA 2L7AA 3CSKA 1SZIA 3FVYA 3L34A 4G7HF 1GS9A 3LNRA 4XQ1A 2NUTB 3W8IA 1MMGA 3EFOB 4EKWA 2ZXOA 3IPMO 3PDMP 1R5ID 1ZW2A 1FAPB 2R03A 4J32B 3LLIA 3TJ5A 4DRIB 2VC9A 3HNKA 1YLMA 3EG9A 2OCCC 1I5NA 1T6QA 2LQGA 4A4AA 5L3VA 1V74B 1TFOB 4EHPA 2EPLX 1T9KA 4MW3A 4DBRA 1PCXA 1LS4A 3E9VA 3EQLF 2P0NA 2X0CA 5KYXA 1LI7A 4DRHB 2A68F 3QVZA 2X51A 1K40A 3DJNB 5HSWA 1Z7Qc 1V55C 4ANJA 1ZU4A 3HTKC 4CS9C 1QZXA 2OQMA 2WB7A 1NU7D 5CI8A 4PJMA 2O9XA 2IM8A 4BJ5A 2DYSC 2LP4A 2NUPB 1CGME 1MQVA 3EH2A 3KPHA 5E3CA 3ZQYA 3FHDA 2W45A 1E83A 4IRUA 3U9JA 3K1IC 3BEHA 2I8BA 3UGPA 1R4TA 2QUPA 2Y3HA 1JOGA 4CSAC 4CIHA 3ECSA 3UNGC 3DKAA 3W2WA 3V7OA 3IQTA 2MHRA 5FCLA 5D92A 3MFNA 2ZXRA 3QTHA 4U5FE 1SYQA 3DMDA 1ZU5A 5KYUA 5A6AA 5T1DB 3G4XA 3LS0A 2EPNA 4DBQA 3X2QC 3T9OA 1ST6A 1AUEA 1MMNA 2EPKX 1QSPA 2YHSA 3C7JA 4MVZA 1OXBA 4ULWA 1M57C 2Z15A 3JCUQ 5L3QA 4F4BA 2BC5A 3Q6NA 1PV3A 3K1HA 3G4ZA 2R9RB 5FZTA 2GWWA 2R7WA 1H6GA 1FFTC 3TJ6A 3U3BA 4ER9A 5BQGA 2NG1A 3QW0A 4FAPB 5L0FA 3FAPB 4U5EE 3S90A 4G7ZF 2XL6A 5AC5A 2WVOA 2CCYA 1D0YA 3EZIA 1LKXA 3GEEA 1GGQA 2FGYA 1VMAA 2P6VA 2WVQA 4BJ5C 4D4XA 4DOZA 3EZHA 4ULVA 3FXHA 3KYJA 4YK5A 3ZTMA 5DQTA 4QI2A 3G50A 2IXMA 2YLDA 4K7BA 2D5RB 3AG3C 2YQYA 2XL4A 3HNIA 5GPGB 3W8HA 4DXWA 5CI9A 2LFFA 4XWJA 2EILC 1OW8A 3RYLA 1ORYA 2AWYA 2PNOA 1WOLA 4KC9A 4PFOA 3KMIA 4I44A 4GYTA 3S27A 3ABKC 3NKDA 4MVSA 4YT8A 1HY5A 1ZYRF 4OD5A 4UDVA 2R7VA 4KNVA 1RXQA 4EBJA 3LEVA 3LNMB 4OD4A 4OIQF 2I15A 1NSGB 4N6CA 4AL0A 4OINF 4CDVA 2J0WA 2W9YA 5CIVA 4CIPA 2CNWA 2HSBA 3EGXB 3K7DA 2R25A 5KYNA 2IXPA 4IWBA 1A7DA 5E2QA 1RMVA 1MNEA 3MX3A 3RQGA 4MTFA 2PX3A 1D1BA 2DYRC 1XZPA 3I5QA 2GA0A 3C8ZA 5JSLA 1NBBA 3WHNA 2OOCA 4E7ZA 4PACA 1D0ZA 4U9DA 1WTYA 5BQHA 3M4BA 3M4CA 1O87A 4MVOA 1YZAA 3GORA 4HEAJ 1I4YA 2Q3TA 4U5BE 3LESA 3RIPA 1VLSA 4HFFB 4P9TA 1LI5A 4Q4ZF 2QE9A 1BDJB 3C18A 4JW1A 1TWHA 2J7PD 5A69A 2L6GA 1WASA 4C3BA 2PX0A 1TFKB 4R32A 2E87A 2D4UA 2KW3C 4JTDB 4WGZA 1ZHYA 2MYSA 5T3TA 1W2WA 3OA1A 4FESA 3W2VA 5L0DA 5L0IA 1BR4A 5DS5A 3NG1A 2KK1A 4AK9A 1Z23A 1ORJA 3ZG1A 2OJQA 3KH2A 1Z6AA 3JRMO 3SXYA 4MNDA 4H54A 2ETSA 1L3PA 5JUAA 1JR8A 2A0UA 3ZIBA 1QKRA 2KJGA 3L0IA 2HZ8A 2EIKC 3HJCA 4J30B 2VCCA 5KYUB 3VF0A 1T6UA 2EIJC 2HV7A 1ZW3A 2QLAA 4PJNA 3ZC4A 3GM3A 1V4AA 4Z9JA 3VAYA 3O55A 4M63A 4P6IC 3WG7C 2G3VA 3AG1C 4EIYA 3DXJF 2Q9AA 1GQAA 3GANA 5B3SC 2AU5A 3ABLC 5BUOA 4WGYA 3ATPA 2P1AA 2F22A 3ZVRA 1EQ1A 4K1OA 1LVKA 1YYXA 4JZAA 4LDRA 3X1OA 2YZSA 3FOPA 1T01A 1CPRA 1OR3A 2A1DD 3U8VA 2HUJA 4LLEA 3RFYA 3NDBB 1VK5A 2XS1A 1AEPA 3ZQVA 4AX2A 4E18A 3T6GB 1A7VA 3HKKA 4CBEA 2FAPB 3AGUA 5JS5A 3CAXA 3JT1A 4YL1A 4MTGA 1NFNA 1O5HA 1ZHZA 2Y69C 3EHMA 2YL1A 4XLPF 2GAQA 1OQCA 4ZLDA 1LIHA 3JTLO 2HS5A 2KYHA 3ABMC 2L6HA 4E7SA 3KL4A 2YLIA 3GWLA 4IARA 2G62A 1A0BA 2ICWG 1E85A 1EKYA 2NUTA 4CS9A 5KYYA 2JD3A 4O79A 5D91A 4PFPA 4B6IA 2H7BA 1J8YF 1MNDA 2ZXPA 2YKZA 4I3MA 1HE9A 3JYHA 3U2LA 2G3KA 5L0JA 3GM2A 4JC7A 2HKVA 4D4NA 2MWQA 1E84A 4JTCB 4U5CE 4OIOF 2R7XA 2YL7A 1C17M 3NMKA 3CEXA 1M2OA 4XTKA 5KYYB 1UG7A 1YVIA 3F46A 2OU6A 1SF8A 2CYDA 2XLMA 3B0VC 4CSAA 3SXMA 3DM5A 2H8AA 3V5YA 1WGWA 3GEIA 2J9WA 4PR9A 4NTAA 4U5HA 2HV6A 4I1OB 4E0HA 1M56C 1U0BB 2Y39A 3U2MA 3DJUB 4N4WA 3IHUA 1SMYF 3RQFA 2A0BA 3B9QA 3DAFA 4Z9HA 3S84A 3EGXA 3POVA 1G5ZA 1H9TA 3L8IA 3LLKA 3Q6MA 4FX5A 2J46A 2CW0F 2XLDA 2J7PA 1MMAA 3NYMA 4IAOA 4XEKA 1VLTA 4G78A 2YWAA 3WODF 1HMOA 3JSEO 3J06A 2VASA 5DS6A
chains in the Genus database with same CATH topology
3ITFA 1JPNA 4KNWA 3KKBA 5B1BC 3LAYA 3SYNA 2LSEA 4C3EA 1FMVA 2WVNA 3PHF2 2W4BA 3FAJA 4O6MA 3DZAA 1Z63A 2Y3DA 1D1AA 3K6BA 3T6JA 4N06A 2PFDA 1NG1A 1MMDA 2CDQA 3DM9B 3EG9B 3SNHA 2A6HF 1OKKD 4G0HA 3H65A 1OCCC 3I5PA 4LACB 4BJ1A 3ASOC 4LERA 2B0JA 4NY3A 5EGYA 2H7VC 4BJ6A 2V3CC 2OG2A 3AG2C 4EBBA 2ZXWC 1OKKA 2R7OA 2WZGA 5F5FA 3GODA 2QY9A 4PJLA 2PP4A 4YT4A 2NUPA 4JVSA 2Y3GA 1ZHTA 4XLNF 4C3DA 5KYWB 2DGJA 4HE8D 1D1CA 1J8MF 4QI0A 1FFHA 4KBLA 1OCRC 3SZRA 2L81A 2XXAA 4LLCA 2A69F 2KNHA 3JSZA 4O6YA 2IXOA 2VH3A 1FTSA 2FFHA 4IJJA 3S0XA 3PMRA 3SP1A 5E3AA 2BE5F 2W4MA 3EFOA 4BJ6C 1FMWA 2YEVA 2M4EA 1D0XA 2R7SA 2ZPAA 1TWGA 4OIRF 1BR2A 1S7ZA 2VB6A 1PD1A 3SEOA 4BJTA 4O6NA 2XSEA 4C7OB 3AG4C 5DQZA 3N0TA 3RH3A 1PD0A 4Q7CA 2C04A 4CS8A 2CNWD 3LJBA 4MQ9F 2J9UA 1RJ9A 4WJ0A 2IXNA 3T6BA 4O7GA 3B0UX 4FWVA 1Z3IX 3S28A 5E33A 4A2NB 3VYWA 3DAGA 1VOMA 3AQCA 3QZCA 1IZMA 5IY5C 3UGOA 3OWTA 1QLEC 5DVWA 3K66A 1OCZC 5KYXB 3B0PA 4RD9A 3EH1A 4YWQA 3DD7A 3ZSUA 3I4UA 3FDQA 3NKEA 4PK4A 2QTVA 3Q7LA 2A6EF 4CS8C 4CS7A 2XXAB 1TWCA 3HLZA 4I1MA 1N1CA 4YT2A 2WL8A 3E70C 3T4RA 1NZEA 1V54C 1ZHWA 3AQBA 2GFHA 3UMKA 3EGDA 2Q9BA 2L9JA 3F47A 1IW7F 3UMIA 3UMHA 3IEEA 4BEJA 4Q5SF 2EIMC 2PF4E 3EPVA 4PJJA 1G8XA 2IOQA 1RJ9B 3ASNC 4DVYP 3S29A 5DS4A 1KU2A 1VYIA 1TKNA 2IYLD 4KI2A 4HFKB 4YJWA 2R7QA 3EHNA 4OIPF 4H4KC 1M2VA 1BR1A 1NU9C 2R7RA 4DVZA 1JPJA 3EJNA 4AE4A 2XRHA 4C7OA 4K0DA 5T3WA 1OCOC 2H7OA 1TWAA 4U5GA 2EINC 4U5DE 5F5HA 3N2ZB 3K33A 2P7VA 2V26A 4JJFA 3UR3C 5EHHA 3N24A 4X0RA 4YT5A 4GEHA 3CZ6A 1ZHXA 4W8KA 3JRTA 4AE4B 3O6XA 3CQZA 4BG0A 5DLJA 3OEOA 1M2VB 4G7OF 2J9VA 2KQ9A 2WZFA 4JCHA 4QDLA 3RKOF 1TR2A 5B1AC 4ZLCA 4EWCA 3NYJA 2Q9CA 3Q7GA 2KGOA 4JJGA 3MLGA 1LS1A 2J45A 3O39A 5KYWA 1Z5ZA 2R7UA 4JURI 2C03A 2WZLA 3TD7A 1VYKA 3EGDB 2J0XA 3LS1A 4YN0B 4RBNA 3NRHA 2CGEA 2Y3BA 3M1CB 3NYLA 4RDAA 3QMKA 3CSKA 1SZIA 3FVYA 3L34A 4G7HF 3LNRA 2NUTB 3W8IA 1MMGA 3EFOB 2ZXOA 4J32B 3LLIA 3EG9A 2OCCC 5L3VA 1PCXA 3E9VA 3EQLF 5KYXA 2A68F 5HSWA 2X51A 3DJNB 4ANJA 1V55C 1ZU4A 3HTKC 4CS9C 1QZXA 2WB7A 5CI8A 1NU7D 4PJMA 2O9XA 4BJ5A 2DYSC 2NUPB 3EH2A 5E3CA 3FHDA 2W45A 4IRUA 3K1IC 3UGPA 2I8BA 2Y3HA 4CSAC 4CIHA 3ECSA 3UNGC 3W2WA 3V7OA 5FCLA 5D92A 4U5FE 2ZXRA 5KYUA 3DMDA 1ZU5A 5T1DB 3LS0A 4DBQA 3X2QC 1ST6A 1MMNA 4ULWA 4DBRA 2YHSA 1M57C 2Z15A 3JCUQ 5L3QA 4F4BA 3Q6NA 3K1HA 2R7WA 1FFTC 2NG1A 4U5EE 4G7ZF 2WVOA 3EZIA 1D0YA 1LKXA 2FGYA 2WVQA 1VMAA 2P6VA 4BJ5C 4DOZA 3EZHA 4QI2A 5DQTA 2IXMA 4K7BA 2D5RB 3AG3C 2XL4A 3W8HA 5CI9A 4XWJA 2EILC 3RYLA 2R7TA 4PFOA 4KC9A 4YT8A 3KMIA 4I44A 4GYTA 3S27A 3ABKC 3NKDA 1ZYRF 4OD5A 2R7VA 4KNVA 3LEVA 4OD4A 4OIQF 4OINF 2J0WA 2W9YA 2CNWA 3EGXB 3K7DA 5KYNA 2IXPA 4IWBA 5E2QA 1MNEA 3MX3A 2PX3A 1D1BA 2DYRC 3I5QA 4E7ZA 1D0ZA 1O87A 4HEAJ 4U5BE 2Q3TA 3RIPA 3LESA 4HFFB 4Q4ZF 4JW1A 1TWHA 2J7PD 4C3BA 2PX0A 2E87A 2KW3C 1ZHYA 2MYSA 5T3TA 1W2WA 3OA1A 4FESA 3W2VA 1BR4A 5DS5A 3NG1A 4AK9A 1Z23A 3ZG1A 3KH2A 1Z6AA 4MNDA 3ZIBA 2KJGA 3L0IA 4J30B 2EIKC 3HJCA 5KYUB 2EIJC 2HV7A 4PJNA 3ZC4A 3VAYA 4M63A 4P6IC 3WG7C 2G3VA 3AG1C 3DXJF 2Q9AA 3GANA 5B3SC 3ABLC 5BUOA 3ZVRA 1LVKA 4JZAA 3X1OA 2YZSA 2A1DD 4LLEA 3RFYA 3NDBB 1VK5A 4AX2A 4CBEA 3JT1A 2Y69C 1O5HA 1ZHZA 3EHMA 4XLPF 4ZLDA 3ABMC 4E7SA 3KL4A 2G62A 2NUTA 4CS9A 5KYYA 2JD3A 4O79A 5D91A 4PFPA 4B6IA 1J8YF 2H7BA 2ZXPA 1MNDA 4I3MA 3JYHA 2G3KA 2MWQA 4U5CE 4OIOF 2R7XA 1M2OA 4XTKA 5KYYB 3F46A 3B0VC 1SF8A 4CSAA 3DM5A 1WGWA 2J9WA 4U5HA 2HV6A 4I1OB 1M56C 2Y39A 3DJUB 1SMYF 3B9QA 3DAFA 3POVA 3EGXA 3LLKA 4FX5A 3Q6MA 2J46A 2CW0F 3NYMA 2J7PA 1MMAA 4IAOA 3WODF 2VASA 5DS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MWQ A;  3LS0 A;  3RFY A;  1VYK A;  1NZE A;  3ZSU A;  3LS1 A;  3JCU Q; 
#chains in the Genus database with same CATH topology
 3ITF A;  2XLE A;  4J7T A;  3TUL A;  1JPN A;  1Y6D A;  3TQO A;  4KNW A;  3KKB A;  5B1B C;  3LAY A;  2IBF A;  3U5S A;  1OXK A;  2XL8 A;  1S05 A;  2OEV A;  4LDK A;  2XM0 A;  3SYN A;  3V5X A;  2LSE A;  3VRC A;  3TOL A;  3ZDL A;  4C3E A;  1FMV A;  2J9B A;  2WVN A;  3PHF 2;  3GWN A;  2W4B A;  3FAJ A;  4O6M A;  3DZA A;  1M6T A;  1Z63 A;  2LK4 A;  2Y3D A;  3GM1 A;  1OW7 A;  1D1A A;  3K6B A;  3ZTZ A;  4U9E A;  3T6J A;  4N06 A;  2NPU A;  2PFD A;  1NG1 A;  1MMD A;  2CDQ A;  5JVE A;  3FOO A;  2HMQ A;  3DM9 B;  4XEV A;  2AP3 A;  3EG9 B;  3SNH A;  2XS8 A;  2L6F A;  1XWJ A;  2A6H F;  4MVQ A;  1OKK D;  4G0H A;  4JRZ A;  1Q0M A;  4N6H A;  3H65 A;  1KNY A;  1OCC C;  1YA7 O;  3A11 A;  3U9M A;  2ASR A;  3I5P A;  3KYI A;  4LAC B;  3NMI A;  3QVY A;  5COG A;  1EA8 A;  4BJ1 A;  3ASO C;  4DRJ B;  1T6I A;  4LER A;  2B0J A;  2NSG A;  4NY3 A;  2H7V C;  1AVO B;  4BJ6 A;  5EGY A;  2V3C C;  1K05 A;  2OG2 A;  1LPE A;  1WWP A;  3AG2 C;  3O10 A;  4EBB A;  2ZXW C;  1OKK A;  2R7O A;  2VCA A;  4JIO A;  2WZG A;  3W4Y A;  2Q00 A;  5F5F A;  2UUI A;  3GOD A;  3U8P A;  5A6B A;  3DE8 A;  3RF3 A;  2QY9 A;  1VB5 A;  4PJL A;  1RCP A;  2HSQ A;  2PP4 A;  4YL0 A;  4YT4 A;  1LE4 A;  2NUP A;  4JTA B;  4JVS A;  2Y3G A;  1ZHT A;  4XLN F;  4E0I A;  4C3D A;  5KYW B;  4IB4 A;  3MYF A;  1F1M A;  1YAU O;  2DGJ A;  3JZ0 A;  3IQ5 A;  4HE8 D;  1D1C A;  4CJG A;  1J8M F;  4QI0 A;  1FFH A;  3RVZ A;  4KBL A;  3R2P A;  1A7E A;  1OCR C;  2LCH A;  1BBH A;  2EPO A;  3SZR A;  2L81 A;  3DE9 A;  3US6 A;  2XXA A;  4LLC A;  2A69 F;  2KNH A;  2NSF A;  3JSZ A;  1H7I A;  5COF A;  5A6B D;  3MYI A;  4O6Y A;  2IXO A;  2VH3 A;  2AWC A;  2XLH A;  2RD9 A;  1FTS A;  2FFH A;  3C8G A;  3BRJ A;  3LEO A;  4IJJ A;  3S0X A;  1YDI A;  3AGT A;  1A41 A;  3PMR A;  5JLI A;  4MVR A;  3SP1 A;  5E3A A;  2BE5 F;  1JRA A;  1QQ3 A;  2W4M A;  3AJM A;  3EFO A;  4NCQ A;  5TJ5 E;  5B3I A;  3HNJ A;  4BJ6 C;  1FMW A;  1I4Z A;  2YEV A;  1HMD A;  1RKC A;  2XLO A;  2M4E A;  2YL0 A;  1Q0G A;  1D0X A;  4WAB A;  5JT4 A;  2HMZ A;  1DOW A;  2XM4 A;  2R7S A;  1ZZP A;  2RSE B;  2XLV A;  2R7T A;  1EI7 A;  2ZPA A;  2JPU A;  2PBE A;  3TOM A;  1HW1 A;  1TWG A;  1O3U A;  4OIR F;  4XPW A;  2EPM X;  1BR2 A;  1S7Z A;  1CPQ A;  1YZC A;  1PD1 A;  2J8W A;  2LIG A;  2VB6 A;  4JEB A;  1ORS C;  3SEO A;  4BJT A;  4NC3 A;  4O6N A;  4NTB A;  1B68 A;  2XSE A;  4C7O B;  3AG4 C;  1H9G A;  5DQZ A;  1T5O A;  4MVU A;  3N0T A;  3RH3 A;  3VM6 A;  2HJ3 A;  3MBG A;  2HJM A;  1PD0 A;  2DI3 A;  1Q0K A;  1L7C A;  4Q7C A;  1YJG A;  4MTO A;  2C04 A;  4CS8 A;  3IQC A;  1BZ4 A;  2CNW D;  1TQG A;  3LJB A;  4MQ9 F;  4CDA A;  2J9U A;  1RJ9 A;  4WJ0 A;  3RW0 A;  2IXN A;  4BPM A;  2YVK A;  3DWW A;  3T6B A;  4O7G A;  3B0U X;  4FWV A;  2XLW A;  1FNT c;  4ONS A;  1Z3I X;  1RKE A;  3S28 A;  1G4U S;  1NLX A;  1SR2 A;  1U6H A;  5E33 A;  4A2N B;  1HW2 A;  3VYW A;  3DAG A;  1VOM A;  3AQC A;  3C63 A;  3NMJ A;  3QZC A;  1LM3 B;  5A6J A;  1IZM A;  1Y4C A;  2YLG A;  3PCV A;  4BEM J;  4XPY A;  3RQE A;  4AL1 A;  5IY5 C;  4EBK A;  3L1M A;  3UGO A;  3OWT A;  3DI5 A;  1XZQ A;  1QLE C;  4E17 A;  5DVW A;  3K66 A;  1OCZ C;  5KYX B;  3B0P A;  4MVM A;  1JAF A;  4RD9 A;  4JEA A;  3EH1 A;  4Z9I A;  4YWQ A;  3DD7 A;  3M15 A;  5JP7 A;  3ZSU A;  3I4U A;  1QVX A;  3FDQ A;  3GEH A;  3NKE A;  1GM5 A;  4PK4 A;  2ZD9 A;  2KC3 A;  2QTV A;  4XEF A;  3Q7L A;  2A6E F;  4CS8 C;  1YAR O;  4CS7 A;  1DOV A;  2HFI A;  2XXA B;  5AGF A;  5EK0 A;  4CX9 A;  256B A;  3A9C A;  1TWC A;  5F28 E;  1NFO A;  2P61 A;  3HLZ A;  4I1M A;  1N1C A;  1YA9 A;  2OJE D;  2R02 A;  4YT2 A;  2R05 A;  1JMW A;  2JX0 A;  3ZWI A;  4DJ9 A;  3AOU A;  2Q7R A;  2AVK A;  2WL8 A;  1KTM A;  3E70 C;  3T4R A;  1NZE A;  1V54 C;  1ZHW A;  5HV9 A;  2GDC A;  4JCZ A;  3AQB A;  3JYY A;  5AC4 A;  2GFH A;  3S9O A;  3UMK A;  3U0C A;  2LFD A;  3EGD A;  2Q9B A;  4JKV A;  4MW8 A;  2L9J A;  1OR2 A;  3F47 A;  1IW7 F;  4W8P A;  3UMI A;  3UMH A;  3IEE A;  4BEJ A;  4Q5S F;  1RKE B;  2B0H A;  2EIM C;  1QPU A;  2PF4 E;  3L8J A;  3EPV A;  4PJJ A;  5L0G A;  3M79 A;  1G8X A;  2IOQ A;  3QW1 A;  2YL3 A;  3B71 A;  4P9F A;  1RJ9 B;  1G4W R;  1APC A;  3ASN C;  3TK0 A;  5JRA A;  4DVY P;  3S29 A;  5DS4 A;  1KU2 A;  1VYI A;  1TKN A;  2IYL D;  4KI2 A;  4HFK B;  4YJW A;  2R7Q A;  3EHN A;  3H2V A;  4H4K C;  4OIP F;  3K1I A;  1M2V A;  1BR1 A;  1NU9 C;  1YYJ A;  4XPX A;  5COM A;  4DVZ A;  5A6K A;  5BQI A;  2R7R A;  1JPJ A;  3EJN A;  1Q0D A;  3SXK A;  4AE4 A;  3LUT B;  2XRH A;  1VTM P;  4C7O A;  1FR0 A;  4MS2 A;  2VCB A;  4K0D A;  5T3W A;  1E2X A;  1OCO C;  2H7O A;  4NTF A;  4NQF A;  2LD6 A;  1TWA A;  1CGO A;  4U5G A;  3HNL A;  2EIN C;  4JE9 A;  2OEX A;  4U5D E;  3RVY A;  4CDY A;  5F5H A;  3N2Z B;  2Q4F A;  1WAT A;  5L0C A;  1OW6 A;  2P7V A;  3K33 A;  4YL3 A;  3R7C A;  4L6R A;  2V26 A;  1ZVZ A;  4JJF A;  3UR3 C;  1CGN A;  5EHH A;  2M64 A;  3N24 A;  4X0R A;  4YT5 A;  4EUK B;  4GEH A;  1U89 A;  3CZ6 A;  1ZHX A;  4W8K A;  3JRT A;  4LDQ A;  4AE4 B;  3H2U A;  3O6X A;  3C62 A;  3C8G B;  3CQZ A;  3IQ6 A;  5DLJ A;  4BG0 A;  2TMV P;  3OEO A;  1M2V B;  5L0H A;  1E86 A;  4G7O F;  2J9V A;  2KQ9 A;  1LE2 A;  2WZF A;  4JCH A;  4QDL A;  1K04 A;  4J7Y A;  3RKO F;  1WN0 A;  2QNL A;  4GQH A;  2DB4 A;  1TR2 A;  5B1A C;  4ZLC A;  3U3F A;  4EWC A;  1UFB A;  3NYJ A;  2Q9C A;  3Q7G A;  2KSF A;  5K0I A;  2KGO A;  4JJG A;  3MLG A;  1C02 A;  1LS1 A;  2J45 A;  3O39 A;  2OKU A;  1Z5Z A;  4IGG A;  5KYW A;  2R7U A;  4CJO A;  4JUR I;  2C03 A;  2WZL A;  2YRF A;  3SXZ A;  3TD7 A;  3B29 A;  2UUH A;  3WAQ A;  1HE1 A;  1VYK A;  3EGD B;  2J0X A;  3LS1 A;  4YN0 B;  1Q0F A;  3V5Z A;  3FMS A;  4RBN A;  3NRH A;  2BL2 A;  3C8G D;  2CGE A;  2Y3B A;  3M1C B;  3NYL A;  1C03 A;  4RDA A;  3QMK A;  4IAQ A;  2L7A A;  3CSK A;  1SZI A;  3FVY A;  3L34 A;  4G7H F;  1GS9 A;  3LNR A;  4XQ1 A;  2NUT B;  3W8I A;  1MMG A;  3EFO B;  4EKW A;  2ZXO A;  3IPM O;  3PDM P;  1R5I D;  1ZW2 A;  1FAP B;  2R03 A;  4J32 B;  3LLI A;  3TJ5 A;  4DRI B;  2VC9 A;  3HNK A;  1YLM A;  3EG9 A;  2OCC C;  1I5N A;  1T6Q A;  2LQG A;  4A4A A;  5L3V A;  1V74 B;  1TFO B;  4EHP A;  2EPL X;  1T9K A;  4MW3 A;  4DBR A;  1PCX A;  1LS4 A;  3E9V A;  3EQL F;  2P0N A;  2X0C A;  5KYX A;  1LI7 A;  4DRH B;  2A68 F;  3QVZ A;  2X51 A;  1K40 A;  3DJN B;  5HSW A;  1Z7Q c;  1V55 C;  4ANJ A;  1ZU4 A;  3HTK C;  4CS9 C;  1QZX A;  2OQM A;  2WB7 A;  1NU7 D;  5CI8 A;  4PJM A;  2O9X A;  2IM8 A;  4BJ5 A;  2DYS C;  2LP4 A;  2NUP B;  1CGM E;  1MQV A;  3EH2 A;  3KPH A;  5E3C A;  3ZQY A;  3FHD A;  2W45 A;  1E83 A;  4IRU A;  3U9J A;  3K1I C;  3BEH A;  2I8B A;  3UGP A;  1R4T A;  2QUP A;  2Y3H A;  1JOG A;  4CSA C;  4CIH A;  3ECS A;  3UNG C;  3DKA A;  3W2W A;  3V7O A;  3IQT A;  2MHR A;  5FCL A;  5D92 A;  3MFN A;  2ZXR A;  3QTH A;  4U5F E;  1SYQ A;  3DMD A;  1ZU5 A;  5KYU A;  5A6A A;  5T1D B;  3G4X A;  3LS0 A;  2EPN A;  4DBQ A;  3X2Q C;  3T9O A;  1ST6 A;  1AUE A;  1MMN A;  2EPK X;  1QSP A;  2YHS A;  3C7J A;  4MVZ A;  1OXB A;  4ULW A;  1M57 C;  2Z15 A;  3JCU Q;  5L3Q A;  4F4B A;  2BC5 A;  3Q6N A;  1PV3 A;  3K1H A;  3G4Z A;  2R9R B;  5FZT A;  2GWW A;  2R7W A;  1H6G A;  1FFT C;  3TJ6 A;  3U3B A;  4ER9 A;  5BQG A;  2NG1 A;  3QW0 A;  4FAP B;  5L0F A;  3FAP B;  4U5E E;  3S90 A;  4G7Z F;  2XL6 A;  5AC5 A;  2WVO A;  2CCY A;  1D0Y A;  3EZI A;  1LKX A;  3GEE A;  1GGQ A;  2FGY A;  1VMA A;  2P6V A;  2WVQ A;  4BJ5 C;  4D4X A;  4DOZ A;  3EZH A;  4ULV A;  3FXH A;  3KYJ A;  4YK5 A;  3ZTM A;  5DQT A;  4QI2 A;  3G50 A;  2IXM A;  2YLD A;  4K7B A;  2D5R B;  3AG3 C;  2YQY A;  2XL4 A;  3HNI A;  5GPG B;  3W8H A;  4DXW A;  5CI9 A;  2LFF A;  4XWJ A;  2EIL C;  1OW8 A;  3RYL A;  1ORY A;  2AWY A;  2PNO A;  1WOL A;  4KC9 A;  4PFO A;  3KMI A;  4I44 A;  4GYT A;  3S27 A;  3ABK C;  3NKD A;  4MVS A;  4YT8 A;  1HY5 A;  1ZYR F;  4OD5 A;  4UDV A;  2R7V A;  4KNV A;  1RXQ A;  4EBJ A;  3LEV A;  3LNM B;  4OD4 A;  4OIQ F;  2I15 A;  1NSG B;  4N6C A;  4AL0 A;  4OIN F;  4CDV A;  2J0W A;  2W9Y A;  5CIV A;  4CIP A;  2CNW A;  2HSB A;  3EGX B;  3K7D A;  2R25 A;  5KYN A;  2IXP A;  4IWB A;  1A7D A;  5E2Q A;  1RMV A;  1MNE A;  3MX3 A;  3RQG A;  4MTF A;  2PX3 A;  1D1B A;  2DYR C;  1XZP A;  3I5Q A;  2GA0 A;  3C8Z A;  5JSL A;  1NBB A;  3WHN A;  2OOC A;  4E7Z A;  4PAC A;  1D0Z A;  4U9D A;  1WTY A;  5BQH A;  3M4B A;  3M4C A;  1O87 A;  4MVO A;  1YZA A;  3GOR A;  4HEA J;  1I4Y A;  2Q3T A;  4U5B E;  3LES A;  3RIP A;  1VLS A;  4HFF B;  4P9T A;  1LI5 A;  4Q4Z F;  2QE9 A;  1BDJ B;  3C18 A;  4JW1 A;  1TWH A;  2J7P D;  5A69 A;  2L6G A;  1WAS A;  4C3B A;  2PX0 A;  1TFK B;  4R32 A;  2E87 A;  2D4U A;  2KW3 C;  4JTD B;  4WGZ A;  1ZHY A;  2MYS A;  5T3T A;  1W2W A;  3OA1 A;  4FES A;  3W2V A;  5L0D A;  5L0I A;  1BR4 A;  5DS5 A;  3NG1 A;  2KK1 A;  4AK9 A;  1Z23 A;  1ORJ A;  3ZG1 A;  2OJQ A;  3KH2 A;  1Z6A A;  3JRM O;  3SXY A;  4MND A;  4H54 A;  2ETS A;  1L3P A;  5JUA A;  1JR8 A;  2A0U A;  3ZIB A;  1QKR A;  2KJG A;  3L0I A;  2HZ8 A;  2EIK C;  3HJC A;  4J30 B;  2VCC A;  5KYU B;  3VF0 A;  1T6U A;  2EIJ C;  2HV7 A;  1ZW3 A;  2QLA A;  4PJN A;  3ZC4 A;  3GM3 A;  1V4A A;  4Z9J A;  3VAY A;  3O55 A;  4M63 A;  4P6I C;  3WG7 C;  2G3V A;  3AG1 C;  4EIY A;  3DXJ F;  2Q9A A;  1GQA A;  3GAN A;  5B3S C;  2AU5 A;  3ABL C;  5BUO A;  4WGY A;  3ATP A;  2P1A A;  2F22 A;  3ZVR A;  1EQ1 A;  4K1O A;  1LVK A;  1YYX A;  4JZA A;  4LDR A;  3X1O A;  2YZS A;  3FOP A;  1T01 A;  1CPR A;  1OR3 A;  2A1D D;  3U8V A;  2HUJ A;  4LLE A;  3RFY A;  3NDB B;  1VK5 A;  2XS1 A;  1AEP A;  3ZQV A;  4AX2 A;  4E18 A;  3T6G B;  1A7V A;  3HKK A;  4CBE A;  2FAP B;  3AGU A;  5JS5 A;  3CAX A;  3JT1 A;  4YL1 A;  4MTG A;  1NFN A;  1O5H A;  1ZHZ A;  2Y69 C;  3EHM A;  2YL1 A;  4XLP F;  2GAQ A;  1OQC A;  4ZLD A;  1LIH A;  3JTL O;  2HS5 A;  2KYH A;  3ABM C;  2L6H A;  4E7S A;  3KL4 A;  2YLI A;  3GWL A;  4IAR A;  2G62 A;  1A0B A;  2ICW G;  1E85 A;  1EKY A;  2NUT A;  4CS9 A;  5KYY A;  2JD3 A;  4O79 A;  5D91 A;  4PFP A;  4B6I A;  2H7B A;  1J8Y F;  1MND A;  2ZXP A;  2YKZ A;  4I3M A;  1HE9 A;  3JYH A;  3U2L A;  2G3K A;  5L0J A;  3GM2 A;  4JC7 A;  2HKV A;  4D4N A;  2MWQ A;  1E84 A;  4JTC B;  4U5C E;  4OIO F;  2R7X A;  2YL7 A;  1C17 M;  3NMK A;  3CEX A;  1M2O A;  4XTK A;  5KYY B;  1UG7 A;  1YVI A;  3F46 A;  2OU6 A;  1SF8 A;  2CYD A;  2XLM A;  3B0V C;  4CSA A;  3SXM A;  3DM5 A;  2H8A A;  3V5Y A;  1WGW A;  3GEI A;  2J9W A;  4PR9 A;  4NTA A;  4U5H A;  2HV6 A;  4I1O B;  4E0H A;  1M56 C;  1U0B B;  2Y39 A;  3U2M A;  3DJU B;  4N4W A;  3IHU A;  1SMY F;  3RQF A;  2A0B A;  3B9Q A;  3DAF A;  4Z9H A;  3S84 A;  3EGX A;  3POV A;  1G5Z A;  1H9T A;  3L8I A;  3LLK A;  3Q6M A;  4FX5 A;  2J46 A;  2CW0 F;  2XLD A;  2J7P A;  1MMA A;  3NYM A;  4IAO A;  4XEK A;  1VLT A;  4G78 A;  2YWA A;  3WOD F;  1HMO A;  3JSE O;  3J06 A;  2VAS A;  5DS6 A; 
#chains in the Genus database with same CATH homology
 3ITF A;  1JPN A;  4KNW A;  3KKB A;  5B1B C;  3LAY A;  3SYN A;  2LSE A;  4C3E A;  1FMV A;  2WVN A;  3PHF 2;  2W4B A;  3FAJ A;  4O6M A;  3DZA A;  1Z63 A;  2Y3D A;  1D1A A;  3K6B A;  3T6J A;  4N06 A;  2PFD A;  1NG1 A;  1MMD A;  2CDQ A;  3DM9 B;  3EG9 B;  3SNH A;  2A6H F;  1OKK D;  4G0H A;  3H65 A;  1OCC C;  3I5P A;  4LAC B;  4BJ1 A;  3ASO C;  4LER A;  2B0J A;  4NY3 A;  5EGY A;  2H7V C;  4BJ6 A;  2V3C C;  2OG2 A;  3AG2 C;  4EBB A;  2ZXW C;  1OKK A;  2R7O A;  2WZG A;  5F5F A;  3GOD A;  2QY9 A;  4PJL A;  2PP4 A;  4YT4 A;  2NUP A;  4JVS A;  2Y3G A;  1ZHT A;  4XLN F;  4C3D A;  5KYW B;  2DGJ A;  4HE8 D;  1D1C A;  1J8M F;  4QI0 A;  1FFH A;  4KBL A;  1OCR C;  3SZR A;  2L81 A;  2XXA A;  4LLC A;  2A69 F;  2KNH A;  3JSZ A;  4O6Y A;  2IXO A;  2VH3 A;  1FTS A;  2FFH A;  4IJJ A;  3S0X A;  3PMR A;  3SP1 A;  5E3A A;  2BE5 F;  2W4M A;  3EFO A;  4BJ6 C;  1FMW A;  2YEV A;  2M4E A;  1D0X A;  2R7S A;  2ZPA A;  1TWG A;  4OIR F;  1BR2 A;  1S7Z A;  2VB6 A;  1PD1 A;  3SEO A;  4BJT A;  4O6N A;  2XSE A;  4C7O B;  3AG4 C;  5DQZ A;  3N0T A;  3RH3 A;  1PD0 A;  4Q7C A;  2C04 A;  4CS8 A;  2CNW D;  3LJB A;  4MQ9 F;  2J9U A;  1RJ9 A;  4WJ0 A;  2IXN A;  3T6B A;  4O7G A;  3B0U X;  4FWV A;  1Z3I X;  3S28 A;  5E33 A;  4A2N B;  3VYW A;  3DAG A;  1VOM A;  3AQC A;  3QZC A;  1IZM A;  5IY5 C;  3UGO A;  3OWT A;  1QLE C;  5DVW A;  3K66 A;  1OCZ C;  5KYX B;  3B0P A;  4RD9 A;  3EH1 A;  4YWQ A;  3DD7 A;  3ZSU A;  3I4U A;  3FDQ A;  3NKE A;  4PK4 A;  2QTV A;  3Q7L A;  2A6E F;  4CS8 C;  4CS7 A;  2XXA B;  1TWC A;  3HLZ A;  4I1M A;  1N1C A;  4YT2 A;  2WL8 A;  3E70 C;  3T4R A;  1NZE A;  1V54 C;  1ZHW A;  3AQB A;  2GFH A;  3UMK A;  3EGD A;  2Q9B A;  2L9J A;  3F47 A;  1IW7 F;  3UMI A;  3UMH A;  3IEE A;  4BEJ A;  4Q5S F;  2EIM C;  2PF4 E;  3EPV A;  4PJJ A;  1G8X A;  2IOQ A;  1RJ9 B;  3ASN C;  4DVY P;  3S29 A;  5DS4 A;  1KU2 A;  1VYI A;  1TKN A;  2IYL D;  4KI2 A;  4HFK B;  4YJW A;  2R7Q A;  3EHN A;  4OIP F;  4H4K C;  1M2V A;  1BR1 A;  1NU9 C;  2R7R A;  4DVZ A;  1JPJ A;  3EJN A;  4AE4 A;  2XRH A;  4C7O A;  4K0D A;  5T3W A;  1OCO C;  2H7O A;  1TWA A;  4U5G A;  2EIN C;  4U5D E;  5F5H A;  3N2Z B;  3K33 A;  2P7V A;  2V26 A;  4JJF A;  3UR3 C;  5EHH A;  3N24 A;  4X0R A;  4YT5 A;  4GEH A;  3CZ6 A;  1ZHX A;  4W8K A;  3JRT A;  4AE4 B;  3O6X A;  3CQZ A;  4BG0 A;  5DLJ A;  3OEO A;  1M2V B;  4G7O F;  2J9V A;  2KQ9 A;  2WZF A;  4JCH A;  4QDL A;  3RKO F;  1TR2 A;  5B1A C;  4ZLC A;  4EWC A;  3NYJ A;  2Q9C A;  3Q7G A;  2KGO A;  4JJG A;  3MLG A;  1LS1 A;  2J45 A;  3O39 A;  5KYW A;  1Z5Z A;  2R7U A;  4JUR I;  2C03 A;  2WZL A;  3TD7 A;  1VYK A;  3EGD B;  2J0X A;  3LS1 A;  4YN0 B;  4RBN A;  3NRH A;  2CGE A;  2Y3B A;  3M1C B;  3NYL A;  4RDA A;  3QMK A;  3CSK A;  1SZI A;  3FVY A;  3L34 A;  4G7H F;  3LNR A;  2NUT B;  3W8I A;  1MMG A;  3EFO B;  2ZXO A;  4J32 B;  3LLI A;  3EG9 A;  2OCC C;  5L3V A;  1PCX A;  3E9V A;  3EQL F;  5KYX A;  2A68 F;  5HSW A;  2X51 A;  3DJN B;  4ANJ A;  1V55 C;  1ZU4 A;  3HTK C;  4CS9 C;  1QZX A;  2WB7 A;  5CI8 A;  1NU7 D;  4PJM A;  2O9X A;  4BJ5 A;  2DYS C;  2NUP B;  3EH2 A;  5E3C A;  3FHD A;  2W45 A;  4IRU A;  3K1I C;  3UGP A;  2I8B A;  2Y3H A;  4CSA C;  4CIH A;  3ECS A;  3UNG C;  3W2W A;  3V7O A;  5FCL A;  5D92 A;  4U5F E;  2ZXR A;  5KYU A;  3DMD A;  1ZU5 A;  5T1D B;  3LS0 A;  4DBQ A;  3X2Q C;  1ST6 A;  1MMN A;  4ULW A;  4DBR A;  2YHS A;  1M57 C;  2Z15 A;  3JCU Q;  5L3Q A;  4F4B A;  3Q6N A;  3K1H A;  2R7W A;  1FFT C;  2NG1 A;  4U5E E;  4G7Z F;  2WVO A;  3EZI A;  1D0Y A;  1LKX A;  2FGY A;  2WVQ A;  1VMA A;  2P6V A;  4BJ5 C;  4DOZ A;  3EZH A;  4QI2 A;  5DQT A;  2IXM A;  4K7B A;  2D5R B;  3AG3 C;  2XL4 A;  3W8H A;  5CI9 A;  4XWJ A;  2EIL C;  3RYL A;  2R7T A;  4PFO A;  4KC9 A;  4YT8 A;  3KMI A;  4I44 A;  4GYT A;  3S27 A;  3ABK C;  3NKD A;  1ZYR F;  4OD5 A;  2R7V A;  4KNV A;  3LEV A;  4OD4 A;  4OIQ F;  4OIN F;  2J0W A;  2W9Y A;  2CNW A;  3EGX B;  3K7D A;  5KYN A;  2IXP A;  4IWB A;  5E2Q A;  1MNE A;  3MX3 A;  2PX3 A;  1D1B A;  2DYR C;  3I5Q A;  4E7Z A;  1D0Z A;  1O87 A;  4HEA J;  4U5B E;  2Q3T A;  3RIP A;  3LES A;  4HFF B;  4Q4Z F;  4JW1 A;  1TWH A;  2J7P D;  4C3B A;  2PX0 A;  2E87 A;  2KW3 C;  1ZHY A;  2MYS A;  5T3T A;  1W2W A;  3OA1 A;  4FES A;  3W2V A;  1BR4 A;  5DS5 A;  3NG1 A;  4AK9 A;  1Z23 A;  3ZG1 A;  3KH2 A;  1Z6A A;  4MND A;  3ZIB A;  2KJG A;  3L0I A;  4J30 B;  2EIK C;  3HJC A;  5KYU B;  2EIJ C;  2HV7 A;  4PJN A;  3ZC4 A;  3VAY A;  4M63 A;  4P6I C;  3WG7 C;  2G3V A;  3AG1 C;  3DXJ F;  2Q9A A;  3GAN A;  5B3S C;  3ABL C;  5BUO A;  3ZVR A;  1LVK A;  4JZA A;  3X1O A;  2YZS A;  2A1D D;  4LLE A;  3RFY A;  3NDB B;  1VK5 A;  4AX2 A;  4CBE A;  3JT1 A;  2Y69 C;  1O5H A;  1ZHZ A;  3EHM A;  4XLP F;  4ZLD A;  3ABM C;  4E7S A;  3KL4 A;  2G62 A;  2NUT A;  4CS9 A;  5KYY A;  2JD3 A;  4O79 A;  5D91 A;  4PFP A;  4B6I A;  1J8Y F;  2H7B A;  2ZXP A;  1MND A;  4I3M A;  3JYH A;  2G3K A;  2MWQ A;  4U5C E;  4OIO F;  2R7X A;  1M2O A;  4XTK A;  5KYY B;  3F46 A;  3B0V C;  1SF8 A;  4CSA A;  3DM5 A;  1WGW A;  2J9W A;  4U5H A;  2HV6 A;  4I1O B;  1M56 C;  2Y39 A;  3DJU B;  1SMY F;  3B9Q A;  3DAF A;  3POV A;  3EGX A;  3LLK A;  4FX5 A;  3Q6M A;  2J46 A;  2CW0 F;  3NYM A;  2J7P A;  1MMA A;  4IAO A;  3WOD F;  2VAS A;  5DS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...