1VYKA

Crystal structure of psbq protein of photosystem ii from higher plants
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
149
structure length
129
Chain Sequence
EARPIVVGPPPPLTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosystem ii
molecule keywords OXYGEN-EVOLVING ENHANCER PROTEIN 3
publication title The 1.49 A Resolution Crystal Structure of Psbq from Photosystem II of Spinacia Oleracea Reveals a Ppii Structure in the N-Terminal Region.
pubmed doi rcsb
total genus 56
structure length 129
sequence length 149
ec nomenclature
pdb deposition date 2004-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1vykA00
3JCUQ 2MWQA 3LS0A 1VYKA 1NZEA 3LS1A 3RFYA 3ZSUA
chains in the Genus database with same CATH superfamily
1G4WR 2RD9A 2Q4FA 1OR3A 3MX3A 3NYLA 4RD9A 2NUTA 1VLTA 3GANA 3QVZA 4MTOA 3TJ6A 5DS6A 2LSEA 1T6QA 2EPKX 2OCCC 2P1AA 2ZXRA 2PP4A 3NMKA 3AQCA 4JEBA 5B1BC 5F5HA 4C3BA 4IWBA 3JSEO 4B6IA 1XZPA 2UUHA 3W8HA 3JYHA 3T6GB 2G3KA 2R7UA 1LI7A 1YARO 1YVIA 1YZCA 4BJ1A 3M1CB 4JURI 3ZG1A 4P6IC 4CS9C 3NRHA 1VYIA 2HJ3A 4OD4A 1ST6A 1V74B 3TK0A 4OD5A 3EHNA 3FOPA 2XM0A 4ER9A 4QI2A 4Q7CA 2PFDA 4PJNA 1IZMA 2EIJC 2CYDA 3GEEA 4JTDB 5KYXB 2LP4A 1Z5ZA 2HKVA 3L34A 3SP1A 3G4ZA 2Q9AA 4YT2A 2FAPB 2XL4A 3VYWA 4CX9A 4I3MA 3SXZA 1Z6AA 2ASRA 3LJBA 1CPRA 1PD1A 1JMWA 4U9EA 3ZIBA 3S9OA 3EZIA 3TULA 4YL3A 5E3CA 3V5XA 4GEHA 4K0DA 4BJ5A 4K7BA 1NG1A 2FFHA 5AC4A 2QNLA 4XEKA 1PV3A 3U8VA 4CSAA 2ZXOA 2Q9BA 1NBBA 2AWYA 2W9YA 4HFFB 3Q7GA 2DGJA 3W2VA 2A6EF 3C62A 1I5NA 1WATA 2OQMA 3PMRA 1SF8A 2Y3BA 4XPWA 3BEHA 4YK5A 5KYXA 3NG1A 4MVRA 1Q0MA 2LQGA 2KNHA 3GM3A 3K1IA 3U2LA 3C18A 3HTKC 1HE1A 1W2WA 3B0PA 1LI5A 2PNOA 1NSGB 3N2ZB 2Q9CA 2XSEA 4CJOA 3EPVA 2VCCA 1JAFA 2J7PA 4DRJB 1UG7A 5DQTA 4YWQA 3VAYA 3LEOA 2VC9A 5KYNA 4LDQA 4E0HA 1E83A 3IPMO 4MVQA 1QZXA 5CI9A 4LLCA 4O7GA 2DB4A 3ZVRA 4MW3A 5L0CA 1TKNA 2YWAA 1OCCC 5BUOA 2KQ9A 3FMSA 4MW8A 2A6HF 3NYJA 2YL3A 4U5GA 1LM3B 1BBHA 2XL6A 1MMDA 4L6RA 3ITFA 4XTKA 4XLNF 1SR2A 4O79A 1E85A 1I4ZA 1JOGA 1WASA 4N6HA 4BPMA 2AU5A 2BE5F 2ICWG 2Y39A 5COMA 5A6BA 1LE2A 3RF3A 3HNIA 4FX5A 1MMAA 1ORSC 2A0UA 1IW7F 2XLOA 4AK9A 2OKUA 4XPXA 4JE9A 2J46A 4DOZA 4LERA 5JUAA 4KI2A 1NU9C 4AX2A 2IXPA 5B1AC 3ZC4A 2GDCA 2WZFA 5E2QA 4YT8A 4PACA 5JP7A 2CNWA 2WVQA 2YL7A 4H54A 3MBGA 1D1AA 2LFFA 2PF4E 3A9CA 2R7RA 2XS1A 2VASA 2YLDA 5L0FA 2JPUA 3PDMP 3KYIA 1A7VA 3L0IA 2EINC 4NC3A 1M2VB 3OWTA 2TMVP 3GEIA 1S05A 4U5HA 3QZCA 1T6UA 1M6TA 4BJ6A 4MVZA 4P9TA 3S84A 3T9OA 4PK4A 1TR2A 4ULVA 3POVA 3ASNC 4U5EE 4NY3A 3W8IA 1M56C 1RKEB 1Z3IX 4DRHB 3QMKA 1OCOC 1OKKD 3DXJF 3IQ5A 3L1MA 4MVUA 3EHMA 1M2OA 2LCHA 1LPEA 2DYSC 2AWCA 2R03A 3LNMB 1FTSA 2KSFA 3T4RA 1ZW2A 3GWLA 3RFYA 1D0YA 4DXWA 2YEVA 1BR2A 3L8JA 1T5OA 3CAXA 4N6CA 1Q0DA 1JPJA 2R7OA 4G7OF 3RQGA 3QW0A 2M4EA 2YQYA 4NQFA 3NMIA 2J45A 1ZHYA 5JT4A 1E86A 3ABKC 2B0JA 4O6NA 3TD7A 1M2VA 4AL1A 4N06A 2YL0A 2Y3HA 4D4NA 1HW2A 4Q5SF 1H9GA 1J8MF 1YAUO 3GM1A 2R7SA 2LIGA 4JJGA 1R5ID 3DAGA 1JRAA 1OQCA 1RKEA 2JD3A 2A69F 1S7ZA 1JR8A 3WHNA 1MMNA 2R9RB 4OIQF 4BJTA 4PJLA 1B68A 5JSLA 3AQBA 3T6BA 1Y6DA 3QVYA 1TWAA 4CS9A 4EUKB 5BQHA 1CGOA 3V5ZA 3ZSUA 3WODF 5CIVA 4W8PA 4OINF 4CBEA 1Q0FA 1OCRC 4IGGA 256BA 4HFKB 1PD0A 1QVXA 4R32A 4E18A 4UDVA 4GYTA 5L0DA 1L3PA 1SYQA 4YL1A 2J9UA 3JZ0A 1HY5A 4OIOF 2R7QA 4WGZA 4I1MA 3Q6MA 2ETSA 1QSPA 4FWVA 4IARA 2P7VA 4JTCB 3HNJA 4DVYP 1FFHA 3N0TA 4JW1A 2P0NA 3SXMA 2VH3A 4HE8D 2L9JA 3UMIA 2WVOA 1U89A 2YLIA 3LS0A 3NDBB 1KNYA 1OR2A 4CDVA 1KTMA 4QDLA 1M57C 4CS8A 3I5QA 2EILC 1QLEC 3TJ5A 4Q4ZF 3O10A 4YJWA 3H2VA 4K1OA 3X2QC 4XLPF 1OXKA 1Q0GA 2J0WA 2XLDA 3KPHA 4PFPA 3DWWA 2F22A 4KBLA 3AOUA 2W45A 5DQZA 2X0CA 3DKAA 4BEJA 3RKOF 1K04A 4BG0A 1G4US 1WGWA 2AP3A 2KC3A 4LDKA 2KK1A 3LEVA 1VB5A 2H7OA 2XL8A 4YT4A 4YN0B 5TJ5E 5A69A 5EHHA 1E2XA 4E0IA 3G50A 5KYWB 4MS2A 3EGDB 4D4XA 4A4AA 3KL4A 4ANJA 2A0BA 3X1OA 3EH1A 1RJ9B 4LLEA 4XWJA 3KMIA 4JCHA 1DOVA 2XS8A 2QUPA 4RBNA 3S90A 1CGME 2YRFA 1NLXA 3FXHA 4DJ9A 4C3EA 4LACB 4PJJA 3R7CA 4J7YA 3U0CA 1T01A 3RQEA 4YT5A 2HJMA 3U5SA 4CS7A 5KYYA 1D1CA 2IXMA 4U5DE 1WOLA 3I4UA 4MQ9F 3C8GB 1CPQA 2Y69C 3EJNA 1OXBA 4GQHA 5COGA 4JIOA 4MVMA 2R7VA 2FGYA 4YL0A 1V54C 1BZ4A 1V4AA 2CCYA 5T1DB 2HSBA 1DOWA 2G3VA 4J7TA 1LKXA 1VMAA 2Q00A 3LS1A 4A2NB 2HFIA 4E17A 3V5YA 2LK4A 4W8KA 2A68F 4MTFA 5IY5C 5KYWA 4I44A 4RDAA 3EGDA 1ORYA 4IB4A 3C7JA 2L7AA 4KNVA 3O55A 1RJ9A 1H6GA 4J32B 3UNGC 3CQZA 3M15A 1EI7A 3S0XA 1TQGA 2HUJA 2CW0F 2V3CC 3US6A 2ZD9A 3G4XA 4U9DA 2XM4A 3ABMC 2YHSA 3O39A 1ZHZA 3C63A 2C03A 3T6JA 3C8GA 1AVOB 4U5CE 3ZTZA 2BL2A 4CSAC 1TWGA 2IOQA 1MQVA 3DM5A 3MFNA 3ZTMA 2QTVA 3QTHA 4PFOA 2J8WA 3DMDA 2H7BA 1NFNA 1GS9A 3BRJA 4ULWA 1AEPA 1LS4A 3K1IC 5L3VA 2YLGA 3AJMA 4JCZA 4CDYA 5L0HA 1YA7O 3ZWIA 3JCUQ 1LE4A 2YVKA 4WGYA 3EZHA 4JZAA 2B0HA 3KH2A 2J7PD 1QQ3A 4WJ0A 1RMVA 2MYSA 3B0UX 2EPLX 1G8XA 1C17M 1ZHXA 4EBBA 2IM8A 2H8AA 2OU6A 2ZPAA 4F4BA 1VLSA 1WN0A 2PX3A 2WZGA 3AG1C 4X0RA 2J0XA 3W4YA 2W4MA 1YLMA 3FAPB 4Z9HA 3UGOA 1FFTC 4BEMJ 1N1CA 4JRZA 4P9FA 2MWQA 5AGFA 3J06A 1Z7Qc 1O3UA 1OW6A 1QPUA 3UMKA 1XWJA 2M64A 4AL0A 2VB6A 2WZLA 3DM9B 2HMQA 2Q3TA 3JTLO 5A6BD 1E84A 4G7ZF 3NKEA 4IAOA 4MTGA 2OEXA 2P61A 2R02A 3Q7LA 3EFOB 3K6BA 4CIHA 2J9BA 2XLHA 3UGPA 5JRAA 3IQTA 3PHF2 2R7TA 3U3FA 1FNTc 1ZW3A 2L6HA 1UFBA 2CNWD 3VM6A 4E7SA 3B0VC 1VTMP 1ZYRF 1QKRA 3HJCA 4JJFA 2Q7RA 3SXKA 3DAFA 3ZQVA 5B3SC 1VYKA 5BQGA 4FAPB 2HS5A 1K05A 3CEXA 3E9VA 1OCZC 3GWNA 3LAYA 4BJ6C 4Z9JA 4G7HF 4IAQA 3RW0A 4XQ1A 2GA0A 3AG2C 1HMOA 1GGQA 1VK5A 3GM2A 4ZLDA 1D0ZA 3PCVA 3E70C 2IXNA 1T6IA 3EFOA 3FDQA 1NZEA 3OEOA 3U2MA 3IHUA 1A7EA 5K0IA 4PJMA 5BQIA 3ZDLA 4EWCA 2I15A 4MVOA 4XPYA 5DS5A 1EA8A 2ZXWC 3B9QA 2VCAA 3EG9B 3JRTA 3IEEA 4J30B 2IBFA 5B3IA 3RQFA 2J9WA 3L8IA 2V26A 1FAPB 3FOOA 4G0HA 1D0XA 1MMGA 1ZHWA 2XLVA 2YZSA 1K40A 3ATPA 3JSZA 4JKVA 2NUPB 1BDJB 1YJGA 5KYYB 1YYJA 3AGTA 1G5ZA 3K7DA 3LESA 3H2UA 1C02A 2LFDA 1FR0A 1BR4A 2WB7A 2XLEA 3O6XA 4IJJA 3S29A 2NSFA 1EKYA 1U0BB 3TOMA 3TOLA 5COFA 2L6FA 2L6GA 3VF0A 5GPGB 3HLZA 5FZTA 1D1BA 1WWPA 3A11A 4JC7A 4AE4B 1NU7D 2NG1A 1ZVZA 3RVZA 4C3DA 5HSWA 3SNHA 1H9TA 4NTFA 2OJED 3ECSA 4EKWA 1TWCA 3EG9A 5DLJA 3IQCA 3KKBA 2P6VA 3DI5A 5HV9A 4MNDA 3U8PA 2EPNA 2QE9A 4OIRF 2E87A 5FCLA 3MLGA 1ZU5A 3RYLA 2WL8A 5A6AA 2AVKA 1HMDA 5JLIA 4ONSA 2NUPA 3OA1A 2KW3C 2PBEA 3RIPA 5CI8A 1YDIA 2QLAA 2UUIA 3CSKA 1LVKA 2MHRA 2NSGA 3M4CA 5E33A 3V7OA 1XZQA 3HKKA 3IQ6A 4XEFA 4JTAB 3Q6NA 3FHDA 2DYRC 5EK0A 1L7CA 3R2PA 1ORJA 2ZXPA 4AE4A 2YKZA 5D91A 1NFOA 5T3WA 4DBQA 4QI0A 5JVEA 4CS8C 3KYJA 4PR9A 3JYYA 3U9MA 3EH2A 1OW8A 2OJQA 1FMWA 2DI3A 2X51A 4FESA 4U5FE 1GM5A 5F5FA 2A1DD 4EHPA 4EIYA 3MYFA 3C8ZA 3LNRA 3M4BA 4BJ5C 4DVZA 5L0JA 1CGNA 2Y3DA 1KU2A 1TFKB 3CZ6A 4WABA 3U3BA 3U9JA 1MNDA 2XXAB 2Z15A 5A6KA 3QW1A 2VCBA 2I8BA 5T3TA 3B29A 3DE9A 3I5PA 3EGXB 2BC5A 1AUEA 3JRMO 5DS4A 1H7IA 1OKKA 3AG3C 3ASOC 4OIPF 1A41A 3HNKA 4EBKA 1TWHA 1I4YA 1YYXA 1Q0KA 1SZIA 3NMJA 4H4KC 4I1OB 5KYUB 5F28E 4HEAJ 2HV7A 1J8YF 3SXYA 3UR3C 1TFOB 3AGUA 4XEVA 5DVWA 2R7WA 1FMVA 2JX0A 4KNWA 3S28A 2EPMX 2GFHA 3F46A 1OW7A 3JT1A 5AC5A 1MNEA 4NCQA 2OG2A 2HZ8A 2IXOA 1YA9A 2KGOA 3LLIA 3SZRA 3VRCA 2C04A 3K1HA 2HV6A 2Y3GA 4CIPA 4C7OB 1C03A 4N4WA 1YZAA 2GWWA 2R05A 3EQLF 2NPUA 2XXAA 3DD7A 1ZU4A 2XLWA 2L81A 1O5HA 3FAJA 3EGXA 3K66A 4JVSA 5L0IA 3MYIA 3DJUB 3GODA 1ZZPA 4ZLCA 5EGYA 1BR1A 1LS1A 3DZAA 5KYUA 3NKDA 3LUTB 3TQOA 2LD6A 2D5RB 3SYNA 2D4UA 3HNLA 3LLKA 4DBRA 1A0BA 3M79A 2OOCA 1WTYA 2EIKC 2H7VC 4KC9A 1SMYF 3C8GD 4U5BE 3W2WA 1JPNA 2HSQA 3RVYA 2YL1A 2CDQA 1T9KA 2EIMC 3H65A 4C7OA 1A7DA 3GORA 3SEOA 1Z23A 3RH3A 5L0GA 1RXQA 3ZQYA 2IYLD 2W4BA 1ZHTA 4Z9IA 4O6MA 1HW1A 4LDRA 2EPOA 5E3AA 3UMHA 4EBJA 2XLMA 2HMZA 1Z63A 3S27A 1HE9A 1PCXA 1LIHA 1GQAA 4NTBA 1RCPA 2NUTB 5D92A 4CDAA 5A6JA 2XRHA 3DJNB 2R7XA 2QY9A 1V55C 3NYMA 2PX0A 4JEAA 4MVSA 3B71A 2RSEB 4O6YA 3FVYA 4E7ZA 4IRUA 1F1MA 2R25A 1APCA 3WG7C 1O87A 1RKCA 3F47A 4M63A 3WAQA 2KJGA 5JS5A 3K33A 2OEVA 4G78A 2G62A 3AG4C 1R4TA 3N24A 2GAQA 3GEHA 1EQ1A 4CJGA 5L3QA 1Y4CA 2WVNA 1VOMA 3DE8A 2O9XA 4DRIB 1U6HA 2J9VA 2KYHA 2CGEA 3ABLC 4NTAA
chains in the Genus database with same CATH topology
3MX3A 3NYLA 2NUTA 4RD9A 5DS6A 3GANA 2LSEA 2OCCC 2ZXRA 2PP4A 3AQCA 5B1BC 5F5HA 4C3BA 4IWBA 4B6IA 3W8HA 3JYHA 2G3KA 2R7UA 4BJ1A 3M1CB 4JURI 3ZG1A 4P6IC 4CS9C 3NRHA 1VYIA 4OD4A 1ST6A 4OD5A 3EHNA 4QI2A 4Q7CA 2PFDA 4PJNA 1IZMA 2EIJC 5KYXB 1Z5ZA 3L34A 3SP1A 2Q9AA 4YT2A 2XL4A 3VYWA 4I3MA 1Z6AA 3LJBA 1PD1A 3ZIBA 3EZIA 5E3CA 4BJ5A 4GEHA 4K0DA 4K7BA 1NG1A 2FFHA 4CSAA 2ZXOA 2Q9BA 2W9YA 4HFFB 3Q7GA 2DGJA 3W2VA 2A6EF 3PMRA 1SF8A 2Y3BA 5KYXA 3NG1A 2KNHA 3HTKC 4ZLDA 1W2WA 3B0PA 3N2ZB 2Q9CA 2XSEA 3EPVA 2J7PA 4YWQA 5DQTA 3VAYA 5KYNA 1QZXA 5CI9A 4LLCA 4O7GA 3ZVRA 1TKNA 1OCCC 5BUOA 2KQ9A 2A6HF 3NYJA 4U5GA 1MMDA 3ITFA 4XTKA 4XLNF 4O79A 2Y39A 2BE5F 4FX5A 1MMAA 1IW7F 4AK9A 2J46A 4DOZA 4LERA 4KI2A 1NU9C 4AX2A 2IXPA 5B1AC 3ZC4A 2WZFA 4YT8A 5E2QA 2CNWA 2WVQA 2R7RA 1D1AA 2PF4E 2VASA 3L0IA 2EINC 1M2VB 3OWTA 4U5HA 3QZCA 4BJ6A 4PK4A 1TR2A 3POVA 3ASNC 4U5EE 4NY3A 3W8IA 1M56C 1Z3IX 3QMKA 1OCOC 1OKKD 3DXJF 3EHMA 1M2OA 2DYSC 1FTSA 3T4RA 3RFYA 1D0YA 2YEVA 1BR2A 1JPJA 2R7OA 4G7OF 2M4EA 2J45A 1ZHYA 3ABKC 2B0JA 4O6NA 3TD7A 1M2VA 4N06A 2Y3HA 4Q5SF 1J8MF 2R7SA 4JJGA 3DAGA 2JD3A 2A69F 1S7ZA 1MMNA 4OIQF 4BJTA 4PJLA 3T6BA 3AQBA 1TWAA 4CS9A 3ZSUA 3WODF 4OINF 4CBEA 1OCRC 4HFKB 1PD0A 4GYTA 2J9UA 4OIOF 2R7QA 4I1MA 3Q6MA 4FWVA 2P7VA 4DVYP 1FFHA 3N0TA 4JW1A 2VH3A 4HE8D 2L9JA 3UMIA 2WVOA 3LS0A 4QDLA 1M57C 4CS8A 3I5QA 2EILC 1QLEC 4Q4ZF 4YJWA 3X2QC 2J0WA 4PFPA 4KBLA 2W45A 5DQZA 4BEJA 3RKOF 4BG0A 1WGWA 3LEVA 2H7OA 4YT4A 4YN0B 5EHHA 5KYWB 3EGDB 3KL4A 4ANJA 3X1OA 3EH1A 1RJ9B 4LLEA 4XWJA 3KMIA 4JCHA 4RBNA 4C3EA 4LACB 4PJJA 4YT5A 4CS7A 5KYYA 1D1CA 2IXMA 4U5DE 3I4UA 4MQ9F 3EJNA 2Y69C 2R7VA 2FGYA 1V54C 5T1DB 2G3VA 1LKXA 1VMAA 3LS1A 4A2NB 4W8KA 2A68F 5IY5C 5KYWA 4I44A 4RDAA 3EGDA 4KNVA 1RJ9A 4J32B 3UNGC 3CQZA 3S0XA 2CW0F 2V3CC 3ABMC 2YHSA 3O39A 1ZHZA 4CSAC 2C03A 3T6JA 4U5CE 1TWGA 2IOQA 3DM5A 2QTVA 4PFOA 3DMDA 2H7BA 4ULWA 3K1IC 5L3VA 3JCUQ 3EZHA 4JZAA 3KH2A 2J7PD 4WJ0A 2MYSA 3B0UX 1G8XA 1ZHXA 4EBBA 2ZPAA 4F4BA 2PX3A 2WZGA 3AG1C 4X0RA 2J0XA 2W4MA 3UGOA 1FFTC 1N1CA 2MWQA 3UMKA 2VB6A 2WZLA 3DM9B 2Q3TA 4G7ZF 3NKEA 4IAOA 3Q7LA 3EFOB 3K6BA 4CIHA 3UGPA 3PHF2 2R7TA 2CNWD 3B0VC 4E7SA 1ZYRF 3HJCA 4JJFA 3DAFA 5B3SC 1VYKA 3E9VA 1OCZC 3LAYA 4BJ6C 4G7HF 3AG2C 1VK5A 1D0ZA 3E70C 2IXNA 3EFOA 3FDQA 1NZEA 3OEOA 4PJMA 4EWCA 5DS5A 2ZXWC 3B9QA 3EG9B 3JRTA 3IEEA 4J30B 2J9WA 2V26A 4G0HA 1D0XA 1MMGA 1ZHWA 2YZSA 3JSZA 2NUPB 5KYYB 3NDBB 3K7DA 3LESA 1BR4A 2WB7A 3O6XA 4IJJA 3S29A 3HLZA 1D1BA 4AE4B 1NU7D 2NG1A 4C3DA 5HSWA 3SNHA 3ECSA 1TWCA 3EG9A 5DLJA 3KKBA 2P6VA 4MNDA 4OIRF 2E87A 5FCLA 3MLGA 1ZU5A 3RYLA 2WL8A 2NUPA 3OA1A 2KW3C 3RIPA 5CI8A 3CSKA 1LVKA 3V7OA 5E33A 3Q6NA 3FHDA 2DYRC 2ZXPA 4AE4A 5D91A 5T3WA 4DBQA 4QI0A 4CS8C 3EH2A 1FMWA 2X51A 4FESA 4U5FE 5F5FA 2A1DD 4BJ5C 3LNRA 4DVZA 2Y3DA 1KU2A 3CZ6A 2XXAB 1MNDA 2Z15A 2I8BA 5T3TA 3I5PA 3EGXB 5DS4A 1OKKA 3AG3C 3ASOC 4OIPF 1TWHA 5KYUB 1SZIA 4I1OB 4H4KC 4HEAJ 2HV7A 1J8YF 3UR3C 2R7WA 5DVWA 1FMVA 4KNWA 3S28A 2GFHA 3F46A 3JT1A 1MNEA 2OG2A 2KGOA 2IXOA 3LLIA 3SZRA 2C04A 3K1HA 2HV6A 2Y3GA 4C7OB 2XXAA 3EQLF 3DD7A 1ZU4A 2L81A 1O5HA 3FAJA 3EGXA 3K66A 4JVSA 3DJUB 3GODA 5EGYA 4ZLCA 1BR1A 1LS1A 3DZAA 5KYUA 3NKDA 2D5RB 3SYNA 3LLKA 4DBRA 3W2WA 2EIKC 2H7VC 4KC9A 1SMYF 4U5BE 1JPNA 2CDQA 2EIMC 3H65A 4C7OA 3SEOA 1Z23A 3RH3A 2IYLD 2W4BA 1ZHTA 4XLPF 4O6MA 3UMHA 5E3AA 1Z63A 3S27A 1PCXA 5D92A 2NUTB 2XRHA 3DJNB 2R7XA 2QY9A 1V55C 3NYMA 2PX0A 4O6YA 3FVYA 4E7ZA 4IRUA 3WG7C 1O87A 3F47A 4M63A 2KJGA 3K33A 2G62A 3AG4C 3N24A 5L3QA 2WVNA 1VOMA 2O9XA 2J9VA 2CGEA 3ABLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCU Q;  2MWQ A;  3LS0 A;  1VYK A;  1NZE A;  3LS1 A;  3RFY A;  3ZSU A; 
#chains in the Genus database with same CATH topology
 1G4W R;  2RD9 A;  2Q4F A;  1OR3 A;  3MX3 A;  3NYL A;  4RD9 A;  2NUT A;  1VLT A;  3GAN A;  3QVZ A;  4MTO A;  3TJ6 A;  5DS6 A;  2LSE A;  1T6Q A;  2EPK X;  2OCC C;  2P1A A;  2ZXR A;  2PP4 A;  3NMK A;  3AQC A;  4JEB A;  5B1B C;  5F5H A;  4C3B A;  4IWB A;  3JSE O;  4B6I A;  1XZP A;  2UUH A;  3W8H A;  3JYH A;  3T6G B;  2G3K A;  2R7U A;  1LI7 A;  1YAR O;  1YVI A;  1YZC A;  4BJ1 A;  3M1C B;  4JUR I;  3ZG1 A;  4P6I C;  4CS9 C;  3NRH A;  1VYI A;  2HJ3 A;  4OD4 A;  1ST6 A;  1V74 B;  3TK0 A;  4OD5 A;  3EHN A;  3FOP A;  2XM0 A;  4ER9 A;  4QI2 A;  4Q7C A;  2PFD A;  4PJN A;  1IZM A;  2EIJ C;  2CYD A;  3GEE A;  4JTD B;  5KYX B;  2LP4 A;  1Z5Z A;  2HKV A;  3L34 A;  3SP1 A;  3G4Z A;  2Q9A A;  4YT2 A;  2FAP B;  2XL4 A;  3VYW A;  4CX9 A;  4I3M A;  3SXZ A;  1Z6A A;  2ASR A;  3LJB A;  1CPR A;  1PD1 A;  1JMW A;  4U9E A;  3ZIB A;  3S9O A;  3EZI A;  3TUL A;  4YL3 A;  5E3C A;  3V5X A;  4GEH A;  4K0D A;  4BJ5 A;  4K7B A;  1NG1 A;  2FFH A;  5AC4 A;  2QNL A;  4XEK A;  1PV3 A;  3U8V A;  4CSA A;  2ZXO A;  2Q9B A;  1NBB A;  2AWY A;  2W9Y A;  4HFF B;  3Q7G A;  2DGJ A;  3W2V A;  2A6E F;  3C62 A;  1I5N A;  1WAT A;  2OQM A;  3PMR A;  1SF8 A;  2Y3B A;  4XPW A;  3BEH A;  4YK5 A;  5KYX A;  3NG1 A;  4MVR A;  1Q0M A;  2LQG A;  2KNH A;  3GM3 A;  3K1I A;  3U2L A;  3C18 A;  3HTK C;  1HE1 A;  1W2W A;  3B0P A;  1LI5 A;  2PNO A;  1NSG B;  3N2Z B;  2Q9C A;  2XSE A;  4CJO A;  3EPV A;  2VCC A;  1JAF A;  2J7P A;  4DRJ B;  1UG7 A;  5DQT A;  4YWQ A;  3VAY A;  3LEO A;  2VC9 A;  5KYN A;  4LDQ A;  4E0H A;  1E83 A;  3IPM O;  4MVQ A;  1QZX A;  5CI9 A;  4LLC A;  4O7G A;  2DB4 A;  3ZVR A;  4MW3 A;  5L0C A;  1TKN A;  2YWA A;  1OCC C;  5BUO A;  2KQ9 A;  3FMS A;  4MW8 A;  2A6H F;  3NYJ A;  2YL3 A;  4U5G A;  1LM3 B;  1BBH A;  2XL6 A;  1MMD A;  4L6R A;  3ITF A;  4XTK A;  4XLN F;  1SR2 A;  4O79 A;  1E85 A;  1I4Z A;  1JOG A;  1WAS A;  4N6H A;  4BPM A;  2AU5 A;  2BE5 F;  2ICW G;  2Y39 A;  5COM A;  5A6B A;  1LE2 A;  3RF3 A;  3HNI A;  4FX5 A;  1MMA A;  1ORS C;  2A0U A;  1IW7 F;  2XLO A;  4AK9 A;  2OKU A;  4XPX A;  4JE9 A;  2J46 A;  4DOZ A;  4LER A;  5JUA A;  4KI2 A;  1NU9 C;  4AX2 A;  2IXP A;  5B1A C;  3ZC4 A;  2GDC A;  2WZF A;  5E2Q A;  4YT8 A;  4PAC A;  5JP7 A;  2CNW A;  2WVQ A;  2YL7 A;  4H54 A;  3MBG A;  1D1A A;  2LFF A;  2PF4 E;  3A9C A;  2R7R A;  2XS1 A;  2VAS A;  2YLD A;  5L0F A;  2JPU A;  3PDM P;  3KYI A;  1A7V A;  3L0I A;  2EIN C;  4NC3 A;  1M2V B;  3OWT A;  2TMV P;  3GEI A;  1S05 A;  4U5H A;  3QZC A;  1T6U A;  1M6T A;  4BJ6 A;  4MVZ A;  4P9T A;  3S84 A;  3T9O A;  4PK4 A;  1TR2 A;  4ULV A;  3POV A;  3ASN C;  4U5E E;  4NY3 A;  3W8I A;  1M56 C;  1RKE B;  1Z3I X;  4DRH B;  3QMK A;  1OCO C;  1OKK D;  3DXJ F;  3IQ5 A;  3L1M A;  4MVU A;  3EHM A;  1M2O A;  2LCH A;  1LPE A;  2DYS C;  2AWC A;  2R03 A;  3LNM B;  1FTS A;  2KSF A;  3T4R A;  1ZW2 A;  3GWL A;  3RFY A;  1D0Y A;  4DXW A;  2YEV A;  1BR2 A;  3L8J A;  1T5O A;  3CAX A;  4N6C A;  1Q0D A;  1JPJ A;  2R7O A;  4G7O F;  3RQG A;  3QW0 A;  2M4E A;  2YQY A;  4NQF A;  3NMI A;  2J45 A;  1ZHY A;  5JT4 A;  1E86 A;  3ABK C;  2B0J A;  4O6N A;  3TD7 A;  1M2V A;  4AL1 A;  4N06 A;  2YL0 A;  2Y3H A;  4D4N A;  1HW2 A;  4Q5S F;  1H9G A;  1J8M F;  1YAU O;  3GM1 A;  2R7S A;  2LIG A;  4JJG A;  1R5I D;  3DAG A;  1JRA A;  1OQC A;  1RKE A;  2JD3 A;  2A69 F;  1S7Z A;  1JR8 A;  3WHN A;  1MMN A;  2R9R B;  4OIQ F;  4BJT A;  4PJL A;  1B68 A;  5JSL A;  3AQB A;  3T6B A;  1Y6D A;  3QVY A;  1TWA A;  4CS9 A;  4EUK B;  5BQH A;  1CGO A;  3V5Z A;  3ZSU A;  3WOD F;  5CIV A;  4W8P A;  4OIN F;  4CBE A;  1Q0F A;  1OCR C;  4IGG A;  256B A;  4HFK B;  1PD0 A;  1QVX A;  4R32 A;  4E18 A;  4UDV A;  4GYT A;  5L0D A;  1L3P A;  1SYQ A;  4YL1 A;  2J9U A;  3JZ0 A;  1HY5 A;  4OIO F;  2R7Q A;  4WGZ A;  4I1M A;  3Q6M A;  2ETS A;  1QSP A;  4FWV A;  4IAR A;  2P7V A;  4JTC B;  3HNJ A;  4DVY P;  1FFH A;  3N0T A;  4JW1 A;  2P0N A;  3SXM A;  2VH3 A;  4HE8 D;  2L9J A;  3UMI A;  2WVO A;  1U89 A;  2YLI A;  3LS0 A;  3NDB B;  1KNY A;  1OR2 A;  4CDV A;  1KTM A;  4QDL A;  1M57 C;  4CS8 A;  3I5Q A;  2EIL C;  1QLE C;  3TJ5 A;  4Q4Z F;  3O10 A;  4YJW A;  3H2V A;  4K1O A;  3X2Q C;  4XLP F;  1OXK A;  1Q0G A;  2J0W A;  2XLD A;  3KPH A;  4PFP A;  3DWW A;  2F22 A;  4KBL A;  3AOU A;  2W45 A;  5DQZ A;  2X0C A;  3DKA A;  4BEJ A;  3RKO F;  1K04 A;  4BG0 A;  1G4U S;  1WGW A;  2AP3 A;  2KC3 A;  4LDK A;  2KK1 A;  3LEV A;  1VB5 A;  2H7O A;  2XL8 A;  4YT4 A;  4YN0 B;  5TJ5 E;  5A69 A;  5EHH A;  1E2X A;  4E0I A;  3G50 A;  5KYW B;  4MS2 A;  3EGD B;  4D4X A;  4A4A A;  3KL4 A;  4ANJ A;  2A0B A;  3X1O A;  3EH1 A;  1RJ9 B;  4LLE A;  4XWJ A;  3KMI A;  4JCH A;  1DOV A;  2XS8 A;  2QUP A;  4RBN A;  3S90 A;  1CGM E;  2YRF A;  1NLX A;  3FXH A;  4DJ9 A;  4C3E A;  4LAC B;  4PJJ A;  3R7C A;  4J7Y A;  3U0C A;  1T01 A;  3RQE A;  4YT5 A;  2HJM A;  3U5S A;  4CS7 A;  5KYY A;  1D1C A;  2IXM A;  4U5D E;  1WOL A;  3I4U A;  4MQ9 F;  3C8G B;  1CPQ A;  2Y69 C;  3EJN A;  1OXB A;  4GQH A;  5COG A;  4JIO A;  4MVM A;  2R7V A;  2FGY A;  4YL0 A;  1V54 C;  1BZ4 A;  1V4A A;  2CCY A;  5T1D B;  2HSB A;  1DOW A;  2G3V A;  4J7T A;  1LKX A;  1VMA A;  2Q00 A;  3LS1 A;  4A2N B;  2HFI A;  4E17 A;  3V5Y A;  2LK4 A;  4W8K A;  2A68 F;  4MTF A;  5IY5 C;  5KYW A;  4I44 A;  4RDA A;  3EGD A;  1ORY A;  4IB4 A;  3C7J A;  2L7A A;  4KNV A;  3O55 A;  1RJ9 A;  1H6G A;  4J32 B;  3UNG C;  3CQZ A;  3M15 A;  1EI7 A;  3S0X A;  1TQG A;  2HUJ A;  2CW0 F;  2V3C C;  3US6 A;  2ZD9 A;  3G4X A;  4U9D A;  2XM4 A;  3ABM C;  2YHS A;  3O39 A;  1ZHZ A;  3C63 A;  2C03 A;  3T6J A;  3C8G A;  1AVO B;  4U5C E;  3ZTZ A;  2BL2 A;  4CSA C;  1TWG A;  2IOQ A;  1MQV A;  3DM5 A;  3MFN A;  3ZTM A;  2QTV A;  3QTH A;  4PFO A;  2J8W A;  3DMD A;  2H7B A;  1NFN A;  1GS9 A;  3BRJ A;  4ULW A;  1AEP A;  1LS4 A;  3K1I C;  5L3V A;  2YLG A;  3AJM A;  4JCZ A;  4CDY A;  5L0H A;  1YA7 O;  3ZWI A;  3JCU Q;  1LE4 A;  2YVK A;  4WGY A;  3EZH A;  4JZA A;  2B0H A;  3KH2 A;  2J7P D;  1QQ3 A;  4WJ0 A;  1RMV A;  2MYS A;  3B0U X;  2EPL X;  1G8X A;  1C17 M;  1ZHX A;  4EBB A;  2IM8 A;  2H8A A;  2OU6 A;  2ZPA A;  4F4B A;  1VLS A;  1WN0 A;  2PX3 A;  2WZG A;  3AG1 C;  4X0R A;  2J0X A;  3W4Y A;  2W4M A;  1YLM A;  3FAP B;  4Z9H A;  3UGO A;  1FFT C;  4BEM J;  1N1C A;  4JRZ A;  4P9F A;  2MWQ A;  5AGF A;  3J06 A;  1Z7Q c;  1O3U A;  1OW6 A;  1QPU A;  3UMK A;  1XWJ A;  2M64 A;  4AL0 A;  2VB6 A;  2WZL A;  3DM9 B;  2HMQ A;  2Q3T A;  3JTL O;  5A6B D;  1E84 A;  4G7Z F;  3NKE A;  4IAO A;  4MTG A;  2OEX A;  2P61 A;  2R02 A;  3Q7L A;  3EFO B;  3K6B A;  4CIH A;  2J9B A;  2XLH A;  3UGP A;  5JRA A;  3IQT A;  3PHF 2;  2R7T A;  3U3F A;  1FNT c;  1ZW3 A;  2L6H A;  1UFB A;  2CNW D;  3VM6 A;  4E7S A;  3B0V C;  1VTM P;  1ZYR F;  1QKR A;  3HJC A;  4JJF A;  2Q7R A;  3SXK A;  3DAF A;  3ZQV A;  5B3S C;  1VYK A;  5BQG A;  4FAP B;  2HS5 A;  1K05 A;  3CEX A;  3E9V A;  1OCZ C;  3GWN A;  3LAY A;  4BJ6 C;  4Z9J A;  4G7H F;  4IAQ A;  3RW0 A;  4XQ1 A;  2GA0 A;  3AG2 C;  1HMO A;  1GGQ A;  1VK5 A;  3GM2 A;  4ZLD A;  1D0Z A;  3PCV A;  3E70 C;  2IXN A;  1T6I A;  3EFO A;  3FDQ A;  1NZE A;  3OEO A;  3U2M A;  3IHU A;  1A7E A;  5K0I A;  4PJM A;  5BQI A;  3ZDL A;  4EWC A;  2I15 A;  4MVO A;  4XPY A;  5DS5 A;  1EA8 A;  2ZXW C;  3B9Q A;  2VCA A;  3EG9 B;  3JRT A;  3IEE A;  4J30 B;  2IBF A;  5B3I A;  3RQF A;  2J9W A;  3L8I A;  2V26 A;  1FAP B;  3FOO A;  4G0H A;  1D0X A;  1MMG A;  1ZHW A;  2XLV A;  2YZS A;  1K40 A;  3ATP A;  3JSZ A;  4JKV A;  2NUP B;  1BDJ B;  1YJG A;  5KYY B;  1YYJ A;  3AGT A;  1G5Z A;  3K7D A;  3LES A;  3H2U A;  1C02 A;  2LFD A;  1FR0 A;  1BR4 A;  2WB7 A;  2XLE A;  3O6X A;  4IJJ A;  3S29 A;  2NSF A;  1EKY A;  1U0B B;  3TOM A;  3TOL A;  5COF A;  2L6F A;  2L6G A;  3VF0 A;  5GPG B;  3HLZ A;  5FZT A;  1D1B A;  1WWP A;  3A11 A;  4JC7 A;  4AE4 B;  1NU7 D;  2NG1 A;  1ZVZ A;  3RVZ A;  4C3D A;  5HSW A;  3SNH A;  1H9T A;  4NTF A;  2OJE D;  3ECS A;  4EKW A;  1TWC A;  3EG9 A;  5DLJ A;  3IQC A;  3KKB A;  2P6V A;  3DI5 A;  5HV9 A;  4MND A;  3U8P A;  2EPN A;  2QE9 A;  4OIR F;  2E87 A;  5FCL A;  3MLG A;  1ZU5 A;  3RYL A;  2WL8 A;  5A6A A;  2AVK A;  1HMD A;  5JLI A;  4ONS A;  2NUP A;  3OA1 A;  2KW3 C;  2PBE A;  3RIP A;  5CI8 A;  1YDI A;  2QLA A;  2UUI A;  3CSK A;  1LVK A;  2MHR A;  2NSG A;  3M4C A;  5E33 A;  3V7O A;  1XZQ A;  3HKK A;  3IQ6 A;  4XEF A;  4JTA B;  3Q6N A;  3FHD A;  2DYR C;  5EK0 A;  1L7C A;  3R2P A;  1ORJ A;  2ZXP A;  4AE4 A;  2YKZ A;  5D91 A;  1NFO A;  5T3W A;  4DBQ A;  4QI0 A;  5JVE A;  4CS8 C;  3KYJ A;  4PR9 A;  3JYY A;  3U9M A;  3EH2 A;  1OW8 A;  2OJQ A;  1FMW A;  2DI3 A;  2X51 A;  4FES A;  4U5F E;  1GM5 A;  5F5F A;  2A1D D;  4EHP A;  4EIY A;  3MYF A;  3C8Z A;  3LNR A;  3M4B A;  4BJ5 C;  4DVZ A;  5L0J A;  1CGN A;  2Y3D A;  1KU2 A;  1TFK B;  3CZ6 A;  4WAB A;  3U3B A;  3U9J A;  1MND A;  2XXA B;  2Z15 A;  5A6K A;  3QW1 A;  2VCB A;  2I8B A;  5T3T A;  3B29 A;  3DE9 A;  3I5P A;  3EGX B;  2BC5 A;  1AUE A;  3JRM O;  5DS4 A;  1H7I A;  1OKK A;  3AG3 C;  3ASO C;  4OIP F;  1A41 A;  3HNK A;  4EBK A;  1TWH A;  1I4Y A;  1YYX A;  1Q0K A;  1SZI A;  3NMJ A;  4H4K C;  4I1O B;  5KYU B;  5F28 E;  4HEA J;  2HV7 A;  1J8Y F;  3SXY A;  3UR3 C;  1TFO B;  3AGU A;  4XEV A;  5DVW A;  2R7W A;  1FMV A;  2JX0 A;  4KNW A;  3S28 A;  2EPM X;  2GFH A;  3F46 A;  1OW7 A;  3JT1 A;  5AC5 A;  1MNE A;  4NCQ A;  2OG2 A;  2HZ8 A;  2IXO A;  1YA9 A;  2KGO A;  3LLI A;  3SZR A;  3VRC A;  2C04 A;  3K1H A;  2HV6 A;  2Y3G A;  4CIP A;  4C7O B;  1C03 A;  4N4W A;  1YZA A;  2GWW A;  2R05 A;  3EQL F;  2NPU A;  2XXA A;  3DD7 A;  1ZU4 A;  2XLW A;  2L81 A;  1O5H A;  3FAJ A;  3EGX A;  3K66 A;  4JVS A;  5L0I A;  3MYI A;  3DJU B;  3GOD A;  1ZZP A;  4ZLC A;  5EGY A;  1BR1 A;  1LS1 A;  3DZA A;  5KYU A;  3NKD A;  3LUT B;  3TQO A;  2LD6 A;  2D5R B;  3SYN A;  2D4U A;  3HNL A;  3LLK A;  4DBR A;  1A0B A;  3M79 A;  2OOC A;  1WTY A;  2EIK C;  2H7V C;  4KC9 A;  1SMY F;  3C8G D;  4U5B E;  3W2W A;  1JPN A;  2HSQ A;  3RVY A;  2YL1 A;  2CDQ A;  1T9K A;  2EIM C;  3H65 A;  4C7O A;  1A7D A;  3GOR A;  3SEO A;  1Z23 A;  3RH3 A;  5L0G A;  1RXQ A;  3ZQY A;  2IYL D;  2W4B A;  1ZHT A;  4Z9I A;  4O6M A;  1HW1 A;  4LDR A;  2EPO A;  5E3A A;  3UMH A;  4EBJ A;  2XLM A;  2HMZ A;  1Z63 A;  3S27 A;  1HE9 A;  1PCX A;  1LIH A;  1GQA A;  4NTB A;  1RCP A;  2NUT B;  5D92 A;  4CDA A;  5A6J A;  2XRH A;  3DJN B;  2R7X A;  2QY9 A;  1V55 C;  3NYM A;  2PX0 A;  4JEA A;  4MVS A;  3B71 A;  2RSE B;  4O6Y A;  3FVY A;  4E7Z A;  4IRU A;  1F1M A;  2R25 A;  1APC A;  3WG7 C;  1O87 A;  1RKC A;  3F47 A;  4M63 A;  3WAQ A;  2KJG A;  5JS5 A;  3K33 A;  2OEV A;  4G78 A;  2G62 A;  3AG4 C;  1R4T A;  3N24 A;  2GAQ A;  3GEH A;  1EQ1 A;  4CJG A;  5L3Q A;  1Y4C A;  2WVN A;  1VOM A;  3DE8 A;  2O9X A;  4DRI B;  1U6H A;  2J9V A;  2KYH A;  2CGE A;  3ABL C;  4NTA A; 
#chains in the Genus database with same CATH homology
 3MX3 A;  3NYL A;  2NUT A;  4RD9 A;  5DS6 A;  3GAN A;  2LSE A;  2OCC C;  2ZXR A;  2PP4 A;  3AQC A;  5B1B C;  5F5H A;  4C3B A;  4IWB A;  4B6I A;  3W8H A;  3JYH A;  2G3K A;  2R7U A;  4BJ1 A;  3M1C B;  4JUR I;  3ZG1 A;  4P6I C;  4CS9 C;  3NRH A;  1VYI A;  4OD4 A;  1ST6 A;  4OD5 A;  3EHN A;  4QI2 A;  4Q7C A;  2PFD A;  4PJN A;  1IZM A;  2EIJ C;  5KYX B;  1Z5Z A;  3L34 A;  3SP1 A;  2Q9A A;  4YT2 A;  2XL4 A;  3VYW A;  4I3M A;  1Z6A A;  3LJB A;  1PD1 A;  3ZIB A;  3EZI A;  5E3C A;  4BJ5 A;  4GEH A;  4K0D A;  4K7B A;  1NG1 A;  2FFH A;  4CSA A;  2ZXO A;  2Q9B A;  2W9Y A;  4HFF B;  3Q7G A;  2DGJ A;  3W2V A;  2A6E F;  3PMR A;  1SF8 A;  2Y3B A;  5KYX A;  3NG1 A;  2KNH A;  3HTK C;  4ZLD A;  1W2W A;  3B0P A;  3N2Z B;  2Q9C A;  2XSE A;  3EPV A;  2J7P A;  4YWQ A;  5DQT A;  3VAY A;  5KYN A;  1QZX A;  5CI9 A;  4LLC A;  4O7G A;  3ZVR A;  1TKN A;  1OCC C;  5BUO A;  2KQ9 A;  2A6H F;  3NYJ A;  4U5G A;  1MMD A;  3ITF A;  4XTK A;  4XLN F;  4O79 A;  2Y39 A;  2BE5 F;  4FX5 A;  1MMA A;  1IW7 F;  4AK9 A;  2J46 A;  4DOZ A;  4LER A;  4KI2 A;  1NU9 C;  4AX2 A;  2IXP A;  5B1A C;  3ZC4 A;  2WZF A;  4YT8 A;  5E2Q A;  2CNW A;  2WVQ A;  2R7R A;  1D1A A;  2PF4 E;  2VAS A;  3L0I A;  2EIN C;  1M2V B;  3OWT A;  4U5H A;  3QZC A;  4BJ6 A;  4PK4 A;  1TR2 A;  3POV A;  3ASN C;  4U5E E;  4NY3 A;  3W8I A;  1M56 C;  1Z3I X;  3QMK A;  1OCO C;  1OKK D;  3DXJ F;  3EHM A;  1M2O A;  2DYS C;  1FTS A;  3T4R A;  3RFY A;  1D0Y A;  2YEV A;  1BR2 A;  1JPJ A;  2R7O A;  4G7O F;  2M4E A;  2J45 A;  1ZHY A;  3ABK C;  2B0J A;  4O6N A;  3TD7 A;  1M2V A;  4N06 A;  2Y3H A;  4Q5S F;  1J8M F;  2R7S A;  4JJG A;  3DAG A;  2JD3 A;  2A69 F;  1S7Z A;  1MMN A;  4OIQ F;  4BJT A;  4PJL A;  3T6B A;  3AQB A;  1TWA A;  4CS9 A;  3ZSU A;  3WOD F;  4OIN F;  4CBE A;  1OCR C;  4HFK B;  1PD0 A;  4GYT A;  2J9U A;  4OIO F;  2R7Q A;  4I1M A;  3Q6M A;  4FWV A;  2P7V A;  4DVY P;  1FFH A;  3N0T A;  4JW1 A;  2VH3 A;  4HE8 D;  2L9J A;  3UMI A;  2WVO A;  3LS0 A;  4QDL A;  1M57 C;  4CS8 A;  3I5Q A;  2EIL C;  1QLE C;  4Q4Z F;  4YJW A;  3X2Q C;  2J0W A;  4PFP A;  4KBL A;  2W45 A;  5DQZ A;  4BEJ A;  3RKO F;  4BG0 A;  1WGW A;  3LEV A;  2H7O A;  4YT4 A;  4YN0 B;  5EHH A;  5KYW B;  3EGD B;  3KL4 A;  4ANJ A;  3X1O A;  3EH1 A;  1RJ9 B;  4LLE A;  4XWJ A;  3KMI A;  4JCH A;  4RBN A;  4C3E A;  4LAC B;  4PJJ A;  4YT5 A;  4CS7 A;  5KYY A;  1D1C A;  2IXM A;  4U5D E;  3I4U A;  4MQ9 F;  3EJN A;  2Y69 C;  2R7V A;  2FGY A;  1V54 C;  5T1D B;  2G3V A;  1LKX A;  1VMA A;  3LS1 A;  4A2N B;  4W8K A;  2A68 F;  5IY5 C;  5KYW A;  4I44 A;  4RDA A;  3EGD A;  4KNV A;  1RJ9 A;  4J32 B;  3UNG C;  3CQZ A;  3S0X A;  2CW0 F;  2V3C C;  3ABM C;  2YHS A;  3O39 A;  1ZHZ A;  4CSA C;  2C03 A;  3T6J A;  4U5C E;  1TWG A;  2IOQ A;  3DM5 A;  2QTV A;  4PFO A;  3DMD A;  2H7B A;  4ULW A;  3K1I C;  5L3V A;  3JCU Q;  3EZH A;  4JZA A;  3KH2 A;  2J7P D;  4WJ0 A;  2MYS A;  3B0U X;  1G8X A;  1ZHX A;  4EBB A;  2ZPA A;  4F4B A;  2PX3 A;  2WZG A;  3AG1 C;  4X0R A;  2J0X A;  2W4M A;  3UGO A;  1FFT C;  1N1C A;  2MWQ A;  3UMK A;  2VB6 A;  2WZL A;  3DM9 B;  2Q3T A;  4G7Z F;  3NKE A;  4IAO A;  3Q7L A;  3EFO B;  3K6B A;  4CIH A;  3UGP A;  3PHF 2;  2R7T A;  2CNW D;  3B0V C;  4E7S A;  1ZYR F;  3HJC A;  4JJF A;  3DAF A;  5B3S C;  1VYK A;  3E9V A;  1OCZ C;  3LAY A;  4BJ6 C;  4G7H F;  3AG2 C;  1VK5 A;  1D0Z A;  3E70 C;  2IXN A;  3EFO A;  3FDQ A;  1NZE A;  3OEO A;  4PJM A;  4EWC A;  5DS5 A;  2ZXW C;  3B9Q A;  3EG9 B;  3JRT A;  3IEE A;  4J30 B;  2J9W A;  2V26 A;  4G0H A;  1D0X A;  1MMG A;  1ZHW A;  2YZS A;  3JSZ A;  2NUP B;  5KYY B;  3NDB B;  3K7D A;  3LES A;  1BR4 A;  2WB7 A;  3O6X A;  4IJJ A;  3S29 A;  3HLZ A;  1D1B A;  4AE4 B;  1NU7 D;  2NG1 A;  4C3D A;  5HSW A;  3SNH A;  3ECS A;  1TWC A;  3EG9 A;  5DLJ A;  3KKB A;  2P6V A;  4MND A;  4OIR F;  2E87 A;  5FCL A;  3MLG A;  1ZU5 A;  3RYL A;  2WL8 A;  2NUP A;  3OA1 A;  2KW3 C;  3RIP A;  5CI8 A;  3CSK A;  1LVK A;  3V7O A;  5E33 A;  3Q6N A;  3FHD A;  2DYR C;  2ZXP A;  4AE4 A;  5D91 A;  5T3W A;  4DBQ A;  4QI0 A;  4CS8 C;  3EH2 A;  1FMW A;  2X51 A;  4FES A;  4U5F E;  5F5F A;  2A1D D;  4BJ5 C;  3LNR A;  4DVZ A;  2Y3D A;  1KU2 A;  3CZ6 A;  2XXA B;  1MND A;  2Z15 A;  2I8B A;  5T3T A;  3I5P A;  3EGX B;  5DS4 A;  1OKK A;  3AG3 C;  3ASO C;  4OIP F;  1TWH A;  5KYU B;  1SZI A;  4I1O B;  4H4K C;  4HEA J;  2HV7 A;  1J8Y F;  3UR3 C;  2R7W A;  5DVW A;  1FMV A;  4KNW A;  3S28 A;  2GFH A;  3F46 A;  3JT1 A;  1MNE A;  2OG2 A;  2KGO A;  2IXO A;  3LLI A;  3SZR A;  2C04 A;  3K1H A;  2HV6 A;  2Y3G A;  4C7O B;  2XXA A;  3EQL F;  3DD7 A;  1ZU4 A;  2L81 A;  1O5H A;  3FAJ A;  3EGX A;  3K66 A;  4JVS A;  3DJU B;  3GOD A;  5EGY A;  4ZLC A;  1BR1 A;  1LS1 A;  3DZA A;  5KYU A;  3NKD A;  2D5R B;  3SYN A;  3LLK A;  4DBR A;  3W2W A;  2EIK C;  2H7V C;  4KC9 A;  1SMY F;  4U5B E;  1JPN A;  2CDQ A;  2EIM C;  3H65 A;  4C7O A;  3SEO A;  1Z23 A;  3RH3 A;  2IYL D;  2W4B A;  1ZHT A;  4XLP F;  4O6M A;  3UMH A;  5E3A A;  1Z63 A;  3S27 A;  1PCX A;  5D92 A;  2NUT B;  2XRH A;  3DJN B;  2R7X A;  2QY9 A;  1V55 C;  3NYM A;  2PX0 A;  4O6Y A;  3FVY A;  4E7Z A;  4IRU A;  3WG7 C;  1O87 A;  3F47 A;  4M63 A;  2KJG A;  3K33 A;  2G62 A;  3AG4 C;  3N24 A;  5L3Q A;  2WVN A;  1VOM A;  2O9X A;  2J9V A;  2CGE A;  3ABL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...