1VYKA

Crystal structure of psbq protein of photosystem ii from higher plants
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
149
structure length
129
Chain Sequence
b'EARPIVVGPPPPLTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OXYGEN-EVOLVING ENHANCER PROTEIN 3
publication title The 1.49 A Resolution Crystal Structure of Psbq from Photosystem II of Spinacia Oleracea Reveals a Ppii Structure in the N-Terminal Region.
pubmed doi rcsb
molecule tags Photosystem ii
total genus 56
structure length 129
sequence length 149
ec nomenclature
pdb deposition date 2004-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1vykA00
3JCUQ 3RFYA 3ZSUA 1VYKA 3LS1A 3LS0A 1NZEA 2MWQA
chains in the Genus database with same CATH superfamily
4WABA 5KYUB 3AJMA 2XM4A 2CCYA 4ZLDA 1LI5A 3ZG1A 2KW3C 1LPEA 1OCOC 4ULWA 2PBEA 2A69F 4JIOA 3FDQA 5B3IA 1AVOB 5B1BC 4RBNA 1T9KA 3BRJA 2KJGA 1TKNA 2G3KA 4MVQA 4U5BE 2F22A 5KYXA 5B3SC 1S05A 3VRCA 4JJFA 3G4ZA 3O6XA 3SXZA 2VB6A 2FAPB 1V54C 3DM9B 2WZGA 4YN0B 3JTLO 4J30B 2XLEA 2B0JA 3ABLC 2YLIA 4NTAA 2IXNA 4CS7A 3FAJA 2LD6A 3C8GB 4JEBA 1NSGB 5F5HA 3FAPB 4LERA 1OKKA 2XS1A 3ECSA 1CPQA 1JAFA 1NFOA 1TWCA 2Y39A 1JPJA 3M1CB 2CNWA 2IXMA 4CDYA 3B0VC 4YT2A 4CX9A 1Z23A 3LLKA 5L0DA 2X0CA 3KYIA 4KBLA 3ZWIA 2OOCA 1Z3IX 2G62A 1MMNA 4K1OA 2L81A 2CDQA 3JRMO 3X2QC 1CGOA 2OJQA 4M63A 2L7AA 3NYMA 1ORJA 5L0IA 4CS8C 4JCZA 3ZIBA 1V74B 3LS0A 2I15A 4EUKB 3ITFA 2A0BA 3WODF 4DXWA 2YL7A 1TFKB 5D92A 5A6JA 1RKCA 2W9YA 4WGYA 3U2MA 3UGOA 3GM3A 3SNHA 3GM1A 4EKWA 3F46A 2YVKA 4LDQA 2GA0A 2A6HF 2Y3BA 5EGYA 5F5FA 2J7PD 1BBHA 5EHHA 1A7EA 3PHF2 1FAPB 2X51A 2ICWG 2EIMC 2WZFA 4MVRA 1O5HA 1JMWA 1LI7A 2EPNA 2UUHA 2YQYA 2E87A 4DRHB 2P6VA 3GANA 5TJ5E 4LLCA 3ASOC 1VYKA 3FVYA 4QI2A 3LLIA 2EPLX 3JYHA 1FMVA 3T6BA 1PV3A 3E9VA 4CIHA 1FFHA 5KYWA 1H9TA 2Q00A 4QI0A 4Z9JA 4C7OA 3QW1A 2J0WA 2R9RB 3U3FA 4HEAJ 3VAYA 3U3BA 1LE4A 2A6EF 3U8PA 3R2PA 1D1BA 4PJLA 3WG7C 3GWNA 2P7VA 3NKDA 3C62A 3K6BA 1M57C 1R5ID 2M64A 1QLEC 3FHDA 3RVYA 3GEEA 3TJ6A 2GFHA 3NG1A 1TWHA 4XEFA 3F47A 4MTOA 1YA7O 1VOMA 3DE9A 1BR1A 2VC9A 3ABKC 1FTSA 1MMAA 1UFBA 1XWJA 1O3UA 1Z5ZA 3KH2A 2AU5A 2XXAB 3UMHA 4J7TA 3OA1A 3DJUB 3QZCA 3LNMB 1WGWA 2WZLA 5E3AA 1QSPA 256BA 1ZHTA 4NTFA 1E86A 4O6MA 2TMVP 4U5EE 4YL0A 3AG4C 5JUAA 4DBQA 1S7ZA 4K7BA 4OD4A 2XLVA 2MHRA 1OW6A 3RYLA 4AL0A 3N24A 1O87A 2DB4A 2LSEA 1ZW2A 2NUTA 2BL2A 3HNJA 1QKRA 4I1MA 2NG1A 3OWTA 4MVMA 3VYWA 5JLIA 4NQFA 3T6JA 1K05A 3MX3A 4R32A 1U89A 3OEOA 1HE9A 1YA9A 1NU9C 3KL4A 1Q0GA 5GPGB 1YJGA 2J9VA 2NPUA 3A9CA 1H9GA 3V5ZA 3L1MA 4U9EA 4XWJA 4EIYA 3LEVA 2LK4A 3CQZA 5EK0A 3MFNA 1N1CA 4U5CE 3LAYA 1EA8A 1T01A 1UG7A 2B0HA 1F1MA 1GGQA 1ZVZA 3JCUQ 3U0CA 4YWQA 4BPMA 3KKBA 3Q7LA 3ASNC 1FMWA 1U6HA 2HFIA 1G4US 2HS5A 5KYWB 5FZTA 1FNTc 1MNDA 5F28E 2PX0A 2A68F 3K66A 1C03A 5A6BA 3WAQA 3DMDA 1J8YF 4KC9A 1OCRC 2LFFA 4YL1A 1ZU4A 4MTFA 4CBEA 4E0HA 1KNYA 2KK1A 2YZSA 3IEEA 3V5XA 1OCZC 3ZQYA 5DS5A 3U5SA 4G7ZF 2UUIA 5HV9A 3RQEA 4N6CA 5K0IA 4P9TA 2P1AA 2Q9CA 4BG0A 3AOUA 2H7BA 2WB7A 1EI7A 4JTDB 4JURI 2EPOA 4A4AA 3JSZA 3J06A 3G4XA 4D4XA 4YJWA 2ZD9A 5DVWA 3EGXA 1M56C 2ZXPA 3NYJA 4X0RA 2Q9BA 3SYNA 1BR4A 4CDAA 1M6TA 5JS5A 4FAPB 1HMOA 1I4ZA 2H8AA 2PP4A 3POVA 3RKOF 4PFPA 3TULA 3DAFA 1T6IA 1TFOB 5L0CA 1EQ1A 1D0ZA 2AWCA 3T9OA 1ZZPA 1MMGA 3NDBB 3ZVRA 2VCBA 4OIRF 1J8MF 2NUTB 1G4WR 3RIPA 2NUPA 3S28A 2XL4A 4O6NA 3W8HA 1GQAA 3JSEO 4MS2A 4U5GA 3DM5A 1NBBA 2DGJA 2YL0A 1YAUO 1TWAA 2BC5A 3QVYA 4XPYA 5CI9A 2XLOA 3W8IA 1ORYA 5JVEA 1A0BA 4KI2A 4MVZA 5E2QA 4BJ5A 2RSEB 2YL3A 3DZAA 3FXHA 3SXKA 4EBJA 4YT4A 1Q0FA 3DJNB 1TWGA 2R7WA 4H54A 4Q4ZF 1ZHYA 3C8GD 1I5NA 3IHUA 4IRUA 4DJ9A 1OW7A 4OIOF 3RF3A 1RJ9B 1SR2A 3TQOA 2VH3A 1CPRA 5DS4A 5JRAA 1D1CA 5L3QA 4CS9A 1OQCA 1A7VA 2KYHA 4BJ1A 4G0HA 1GS9A 3ATPA 2IOQA 2GDCA 2IBFA 3K1IA 1QZXA 3LESA 2C04A 2H7OA 3CAXA 4PR9A 3M4BA 4XPWA 4ULVA 4C3DA 2QLAA 5JT4A 4XTKA 2HV7A 4CSAA 3AGUA 4E18A 1LIHA 1NLXA 4FX5A 3V7OA 4C3BA 1E85A 1E84A 1V4AA 4AE4A 5L0FA 2PNOA 3EGXB 4NTBA 4Z9HA 2AVKA 5KYXB 4MW3A 3S27A 2YWAA 3DKAA 2IYLD 1K04A 1VTMP 3S29A 4NY3A 3MLGA 2XLHA 3WHNA 1B68A 4I44A 2R7XA 5HSWA 1XZPA 2OEXA 3PMRA 3LUTB 3EHNA 1T5OA 3NRHA 2KC3A 4W8PA 5BUOA 5E33A 2EINC 2P0NA 1GM5A 2HJMA 1SMYF 1H7IA 2JPUA 3AG1C 3NYLA 1YYJA 4AL1A 2OCCC 1OR2A 5DLJA 3U8VA 4GEHA 3S90A 1QQ3A 5COFA 5DQTA 3LEOA 4JVSA 4A2NB 2PFDA 2XRHA 2YKZA 2D4UA 4BEJA 2Y69C 1H6GA 1NFNA 4IGGA 3RH3A 4IAQA 1Y6DA 2CGEA 2Q4FA 1HY5A 2JD3A 2ASRA 1HE1A 3QW0A 4JTCB 4JZAA 2OEVA 3DI5A 1KTMA 3I5QA 2ETSA 3M4CA 4GYTA 4YT5A 3SP1A 3NMIA 3IPMO 4G7OF 3EGDA 4Q5SF 2Q9AA 3HJCA 3IQTA 2IXOA 4BJ5C 1CGNA 3ZSUA 3O55A 4MW8A 1Z7Qc 4BJ6C 1DOWA 3GORA 3Q6NA 1OKKD 4MTGA 1AEPA 3GEHA 3ZTZA 5KYNA 4MNDA 2YRFA 2W4BA 5L3VA 1MMDA 3Q7GA 4KNVA 2R7VA 2QNLA 5L0GA 1ZU5A 2GAQA 2OG2A 1PCXA 3LNRA 4P6IC 3K1IC 3KPHA 4HFKB 3UMKA 1V55C 5CIVA 3S84A 4MVSA 3BEHA 2LQGA 3PCVA 4AX2A 2XM0A 1G5ZA 2LIGA 2KSFA 2WVNA 2ZXWC 3FMSA 3TOLA 2HKVA 1ZHXA 3EFOA 3LJBA 3AG3C 2VASA 4O6YA 4CSAC 1FFTC 1OW8A 5T3WA 1PD0A 2HZ8A 2HV6A 2V3CC 1QVXA 2IM8A 3IQ5A 1NZEA 3B71A 5A6AA 3C8GA 4HFFB 3S9OA 3JZ0A 1WOLA 2A1DD 3ZC4A 2GWWA 3UNGC 2XSEA 4ANJA 4C7OB 2L6HA 2Q3TA 2I8BA 4XQ1A 2C03A 2J8WA 4JEAA 3S0XA 3EH1A 1LE2A 4BJTA 2J7PA 3CEXA 3KMIA 3NMKA 1A41A 1Z63A 3SEOA 2Y3HA 4IARA 4OIPF 3GM2A 5AC5A 2WVOA 2Q7RA 3U9MA 1YZCA 4CS8A 3EH2A 1LS1A 2W4MA 2FGYA 4IJJA 2XLDA 4CJGA 4JC7A 3O39A 1WTYA 3ZTMA 4EWCA 1TQGA 4EBBA 3SZRA 5CI8A 2YHSA 4U9DA 4LDKA 2R7QA 2HUJA 4BJ6A 4RDAA 4IAOA 3DE8A 3U2LA 4YK5A 3N0TA 1K40A 3TK0A 1M2VA 5E3CA 1ZHWA 1PD1A 3RW0A 3JRTA 2HJ3A 3R7CA 1QPUA 3GEIA 5A69A 2A0UA 4MVUA 3HNLA 4JW1A 2QUPA 4GQHA 4LDRA 2R25A 2R03A 2R7UA 3SXYA 3FOPA 1Y4CA 3TJ5A 1MNEA 1JPNA 3HKKA 5A6KA 4JCHA 5BQGA 2HSBA 1YZAA 3H2UA 1BDJB 1R4TA 5IY5C 3HNIA 3B9QA 4PFOA 3PDMP 1NG1A 4DVZA 1YYXA 1WATA 3B29A 3C63A 2EPKX 2Z15A 2P61A 3EFOB 4FWVA 2LP4A 4PACA 3O10A 2CW0F 1T6UA 2OU6A 3NKEA 4E17A 3UGPA 2AP3A 4JJGA 3DWWA 3MYFA 4XPXA 3KYJA 1DOVA 2J45A 2R7RA 4Z9IA 3NMJA 4P9FA 3W4YA 4WJ0A 2EPMX 2KNHA 4E7SA 2Y3GA 3MYIA 3IQCA 1LVKA 3RFYA 1YVIA 1KU2A 3JT1A 5T1DB 2D5RB 3AG2C 3DAGA 4DVYP 1Q0MA 1IZMA 3HLZA 3CZ6A 4CJOA 1HMDA 4O79A 5T3TA 1T6QA 2EIJC 1D0YA 4U5FE 4EHPA 2HSQA 3RQGA 3VM6A 3L0IA 4UDVA 3B0UX 1I4YA 4NC3A 2AWYA 2O9XA 2XLWA 4YL3A 4IB4A 3UR3C 2G3VA 2XXAA 2JX0A 4ZLCA 1OXBA 1EKYA 1L3PA 2QTVA 1Z6AA 2L9JA 1RKEA 2WL8A 1VMAA 2M4EA 1JR8A 3GWLA 4MQ9F 3VF0A 2IXPA 1E83A 2L6GA 3EHMA 1RCPA 3LS1A 3EPVA 1OR3A 4N6HA 4PK4A 5JSLA 4C3EA 4EBKA 4PJMA 3GODA 4JTAB 2PF4E 2YEVA 5A6BD 4JE9A 1VYIA 1IW7F 1M2VB 2YLGA 3H2VA 3K33A 1ST6A 3K7DA 3Q6MA 1ZW3A 4ONSA 1LS4A 3EZIA 1M2OA 4NCQA 4K0DA 3T4RA 4JRZA 1YDIA 2XLMA 4JKVA 2NUPB 1SF8A 5DS6A 2Y3DA 1JRAA 4DOZA 5B1AC 1RXQA 4B6IA 3RQFA 4AK9A 2LCHA 4OIQF 2J9BA 2VCAA 4J7YA 1U0BB 2OKUA 1ORSC 3EZHA 1D0XA 3B0PA 2W45A 1W2WA 2J9WA 2YL1A 3G50A 3I4UA 4DBRA 1VLSA 5L0JA 2V26A 3C18A 4LLEA 2EILC 4I1OB 3H65A 1RMVA 2J0XA 2ZPAA 2L6FA 2VCCA 4E7ZA 4KNWA 5L0HA 1HW2A 2KGOA 2DYSC 3U9JA 3EG9A 5KYYA 2DYRC 1Q0KA 1VK5A 1BZ4A 4CIPA 3A11A 4Q7CA 4YT8A 1SYQA 2NSFA 3HNKA 1VB5A 4FESA 1YARO 1XZQA 2J9UA 2NSGA 4J32B 2YLDA 3W2WA 2PX3A 5BQHA 1WWPA 2QY9A 5KYUA 1TR2A 4W8KA 5JP7A 3EQLF 4ER9A 2OJED 4XEVA 3AGTA 2DI3A 3MBGA 3TOMA 3QTHA 2R05A 4O7GA 4DRIB 4E0IA 2CNWD 1AUEA 1NU7D 3ABMC 1CGME 1MQVA 4CS9C 3DXJF 3V5YA 3K1HA 1APCA 1YLMA 3ZQVA 1C02A 1D1AA 1L7CA 3JYYA 4WGZA 1OXKA 2EIKC 5COMA 4AE4B 3W2VA 1A7DA 2XL6A 1BR2A 1RKEB 1WN0A 4MVOA 1OCCC 5AGFA 3FOOA 4H4KC 4N06A 5DQZA 3RVZA 2RD9A 4OD5A 2MYSA 2CYDA 4PJNA 3ZDLA 1G8XA 2R7OA 3QMKA 4XLNF 1LKXA 3L8JA 1Q0DA 2BE5F 2XL8A 3US6A 3M15A 1ZYRF 4F4BA 2R7TA 2HMQA 3CSKA 3SXMA 4U5HA 4XEKA 5BQIA 4N4WA 2XS8A 5D91A 1LM3B 3TD7A 3QVZA 4LACB 4OINF 4U5DE 2MWQA 4D4NA 2FFHA 4I3MA 4XLPF 5COGA 2J46A 4PJJA 3I5PA 4BEMJ 3C7JA 4RD9A 2OQMA 5FCLA 3EJNA 3N2ZB 1E2XA 2QE9A 4QDLA 1HW1A 4CDVA 3E70C 3HTKC 1C17M 2R02A 2ZXRA 3X1OA 3AQCA 1ZHZA 4L6RA 5AC4A 2LFDA 1VLTA 4G78A 2HMZA 2R7SA 3DD7A 3AQBA 3L34A 3L8IA 2ZXOA 3C8ZA 1FR0A 4IWBA 1SZIA 3EG9B 3IQ6A 5KYYB 1RJ9A 3M79A 2WVQA 3EGDB 4HE8D 3T6GB 1WASA 4DRJB 3UMIA 4G7HF 1JOGA 2H7VC 2KQ9A
chains in the Genus database with same CATH topology
5KYUB 4ZLDA 3ZG1A 2KW3C 1OCOC 4ULWA 2A69F 3FDQA 5B1BC 4RBNA 2KJGA 1TKNA 2G3KA 4U5BE 5KYXA 5B3SC 4JJFA 3O6XA 2VB6A 1V54C 3DM9B 2WZGA 4YN0B 4J30B 2B0JA 3ABLC 4CS7A 2IXNA 3FAJA 5F5HA 4LERA 1OKKA 3ECSA 2Y39A 1TWCA 1JPJA 3M1CB 2CNWA 2IXMA 3B0VC 4YT2A 1Z23A 3LLKA 4KBLA 1Z3IX 2G62A 1MMNA 2L81A 2CDQA 3X2QC 4M63A 3NYMA 4CS8C 3ZIBA 3LS0A 3ITFA 3WODF 5D92A 2W9YA 3UGOA 3SNHA 3F46A 2A6HF 2Y3BA 5EGYA 5F5FA 2J7PD 5EHHA 3PHF2 2X51A 2EIMC 2WZFA 1O5HA 2E87A 2P6VA 3GANA 4LLCA 3ASOC 1VYKA 3FVYA 4QI2A 3LLIA 3JYHA 1FMVA 3T6BA 3E9VA 4CIHA 1FFHA 5KYWA 4QI0A 4C7OA 2J0WA 4HEAJ 3VAYA 2A6EF 1D1BA 4PJLA 3WG7C 2P7VA 3NKDA 3K6BA 1M57C 1QLEC 3FHDA 2GFHA 3NG1A 1TWHA 3F47A 1VOMA 1BR1A 3ABKC 1FTSA 1MMAA 1Z5ZA 3KH2A 2XXAB 3UMHA 3OA1A 3DJUB 3QZCA 1WGWA 2WZLA 5E3AA 1ZHTA 4O6MA 4U5EE 3AG4C 4DBQA 1S7ZA 4K7BA 4OD4A 3RYLA 3N24A 1O87A 2LSEA 2NUTA 4I1MA 3VYWA 2NG1A 3OWTA 3T6JA 3MX3A 3OEOA 1NU9C 3KL4A 2J9VA 4XLPF 4XWJA 3LEVA 3CQZA 1N1CA 4U5CE 3LAYA 3JCUQ 4YWQA 3KKBA 3Q7LA 3ASNC 1FMWA 5KYWB 1MNDA 2PX0A 2A68F 3K66A 3DMDA 1J8YF 4KC9A 1OCRC 1ZU4A 4CBEA 2YZSA 3IEEA 5DS5A 1OCZC 4G7ZF 2Q9CA 4BG0A 2H7BA 2WB7A 4JURI 3JSZA 4YJWA 5DVWA 3EGXA 1M56C 2ZXPA 3NYJA 4X0RA 2Q9BA 3SYNA 1BR4A 2PP4A 3POVA 3RKOF 4PFPA 3DAFA 1D0ZA 1MMGA 3NDBB 3ZVRA 4OIRF 1J8MF 2NUTB 3RIPA 2NUPA 3S28A 2XL4A 4O6NA 3W8HA 4U5GA 3DM5A 2DGJA 5CI9A 1TWAA 3W8IA 4KI2A 5E2QA 4BJ5A 4YT4A 3DZAA 3DJNB 1TWGA 2R7WA 4Q4ZF 1ZHYA 4IRUA 4OIOF 1RJ9B 2VH3A 5DS4A 1D1CA 5L3QA 4CS9A 4BJ1A 4G0HA 2IOQA 3LESA 1QZXA 2C04A 2H7OA 4C3DA 4XTKA 2HV7A 4CSAA 4FX5A 3V7OA 4C3BA 4AE4A 3EGXB 5KYXB 3S27A 2IYLD 3S29A 4NY3A 3MLGA 4I44A 2R7XA 5HSWA 3PMRA 3EHNA 5BUOA 3NRHA 5E33A 2EINC 1SMYF 3AG1C 3NYLA 5DLJA 2OCCC 4GEHA 5DQTA 4JVSA 4A2NB 2PFDA 2XRHA 4BEJA 2Y69C 3RH3A 2CGEA 2JD3A 4JZAA 3I5QA 4GYTA 4YT5A 3SP1A 4G7OF 3EGDA 4Q5SF 2Q9AA 3HJCA 4BJ5C 2IXOA 3ZSUA 3Q6NA 1OKKD 5KYNA 4MNDA 2W4BA 5L3VA 1MMDA 3Q7GA 4KNVA 2R7VA 1ZU5A 2OG2A 1PCXA 3LNRA 4P6IC 3K1IC 4HFKB 3UMKA 1V55C 4AX2A 2WVNA 2ZXWC 4CSAC 1ZHXA 3EFOA 3LJBA 3AG3C 2VASA 4O6YA 1FFTC 5T3WA 1PD0A 2HV6A 2V3CC 1NZEA 4HFFB 2A1DD 3UNGC 4ANJA 2XSEA 4C7OB 2Q3TA 2I8BA 2C03A 3S0XA 3EH1A 4BJTA 2J7PA 3KMIA 1Z63A 3SEOA 2Y3HA 4OIPF 2WVOA 4CS8A 3EH2A 1LS1A 2W4MA 2FGYA 4IJJA 3O39A 4EWCA 4EBBA 3SZRA 5CI8A 2YHSA 2R7QA 4BJ6A 4RDAA 4IAOA 3N0TA 1M2VA 5E3CA 1ZHWA 1PD1A 3JRTA 4JW1A 2R7UA 1MNEA 1JPNA 4JCHA 5IY5C 3B9QA 4PFOA 1NG1A 4DVZA 2Z15A 3EFOB 4FWVA 2CW0F 3NKEA 3UGPA 4JJGA 2J45A 2R7RA 4WJ0A 2KNHA 4E7SA 2Y3GA 3RFYA 1LVKA 1KU2A 3JT1A 5T1DB 2D5RB 3AG2C 3DAGA 4DVYP 1IZMA 3HLZA 3CZ6A 5T3TA 4O79A 2EIJC 1D0YA 4U5FE 3L0IA 3B0UX 3UR3C 2O9XA 2G3VA 2XXAA 4ZLCA 2QTVA 1Z6AA 2L9JA 2WL8A 1VMAA 2M4EA 4MQ9F 2IXPA 3EHMA 4PK4A 3LS1A 4C3EA 3EPVA 4PJMA 3GODA 2PF4E 2YEVA 1VYIA 1IW7F 1M2VB 3K33A 3K7DA 3Q6MA 1ST6A 3QMKA 4BJ6C 3EZIA 1M2OA 4K0DA 3T4RA 2NUPB 1SF8A 5DS6A 2Y3DA 4DOZA 5B1AC 4B6IA 4AK9A 4OIQF 3EZHA 1D0XA 3B0PA 2W45A 1W2WA 2J9WA 4DBRA 3I4UA 2V26A 4LLEA 2EILC 4I1OB 3H65A 2J0XA 2ZPAA 4E7ZA 4KNWA 2KGOA 2DYSC 5KYYA 3EG9A 2DYRC 1VK5A 4Q7CA 4YT8A 3ZC4A 4FESA 4J32B 2J9UA 3W2WA 2PX3A 2QY9A 5KYUA 1TR2A 4W8KA 3EQLF 4O7GA 2CNWD 1NU7D 3ABMC 4CS9C 3DXJF 3K1HA 1D1AA 2EIKC 4AE4B 3W2VA 1BR2A 1OCCC 4H4KC 4N06A 5DQZA 4OD5A 2MYSA 4PJNA 1G8XA 2R7OA 4XLNF 1LKXA 2BE5F 1ZYRF 4F4BA 2R7TA 3CSKA 4U5HA 5D91A 3TD7A 4LACB 4OINF 4U5DE 2MWQA 2FFHA 4I3MA 2J46A 4PJJA 3I5PA 4RD9A 5FCLA 3EJNA 3N2ZB 4QDLA 3E70C 3HTKC 2ZXRA 3X1OA 3AQCA 1ZHZA 2R7SA 3DD7A 3AQBA 3L34A 2ZXOA 4IWBA 1SZIA 3EG9B 5KYYB 1RJ9A 2WVQA 3EGDB 4HE8D 3UMIA 4G7HF 2H7VC 2KQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCU Q;  3RFY A;  3ZSU A;  1VYK A;  3LS1 A;  3LS0 A;  1NZE A;  2MWQ A; 
#chains in the Genus database with same CATH topology
 4WAB A;  5KYU B;  3AJM A;  2XM4 A;  2CCY A;  4ZLD A;  1LI5 A;  3ZG1 A;  2KW3 C;  1LPE A;  1OCO C;  4ULW A;  2PBE A;  2A69 F;  4JIO A;  3FDQ A;  5B3I A;  1AVO B;  5B1B C;  4RBN A;  1T9K A;  3BRJ A;  2KJG A;  1TKN A;  2G3K A;  4MVQ A;  4U5B E;  2F22 A;  5KYX A;  5B3S C;  1S05 A;  3VRC A;  4JJF A;  3G4Z A;  3O6X A;  3SXZ A;  2VB6 A;  2FAP B;  1V54 C;  3DM9 B;  2WZG A;  4YN0 B;  3JTL O;  4J30 B;  2XLE A;  2B0J A;  3ABL C;  2YLI A;  4NTA A;  2IXN A;  4CS7 A;  3FAJ A;  2LD6 A;  3C8G B;  4JEB A;  1NSG B;  5F5H A;  3FAP B;  4LER A;  1OKK A;  2XS1 A;  3ECS A;  1CPQ A;  1JAF A;  1NFO A;  1TWC A;  2Y39 A;  1JPJ A;  3M1C B;  2CNW A;  2IXM A;  4CDY A;  3B0V C;  4YT2 A;  4CX9 A;  1Z23 A;  3LLK A;  5L0D A;  2X0C A;  3KYI A;  4KBL A;  3ZWI A;  2OOC A;  1Z3I X;  2G62 A;  1MMN A;  4K1O A;  2L81 A;  2CDQ A;  3JRM O;  3X2Q C;  1CGO A;  2OJQ A;  4M63 A;  2L7A A;  3NYM A;  1ORJ A;  5L0I A;  4CS8 C;  4JCZ A;  3ZIB A;  1V74 B;  3LS0 A;  2I15 A;  4EUK B;  3ITF A;  2A0B A;  3WOD F;  4DXW A;  2YL7 A;  1TFK B;  5D92 A;  5A6J A;  1RKC A;  2W9Y A;  4WGY A;  3U2M A;  3UGO A;  3GM3 A;  3SNH A;  3GM1 A;  4EKW A;  3F46 A;  2YVK A;  4LDQ A;  2GA0 A;  2A6H F;  2Y3B A;  5EGY A;  5F5F A;  2J7P D;  1BBH A;  5EHH A;  1A7E A;  3PHF 2;  1FAP B;  2X51 A;  2ICW G;  2EIM C;  2WZF A;  4MVR A;  1O5H A;  1JMW A;  1LI7 A;  2EPN A;  2UUH A;  2YQY A;  2E87 A;  4DRH B;  2P6V A;  3GAN A;  5TJ5 E;  4LLC A;  3ASO C;  1VYK A;  3FVY A;  4QI2 A;  3LLI A;  2EPL X;  3JYH A;  1FMV A;  3T6B A;  1PV3 A;  3E9V A;  4CIH A;  1FFH A;  5KYW A;  1H9T A;  2Q00 A;  4QI0 A;  4Z9J A;  4C7O A;  3QW1 A;  2J0W A;  2R9R B;  3U3F A;  4HEA J;  3VAY A;  3U3B A;  1LE4 A;  2A6E F;  3U8P A;  3R2P A;  1D1B A;  4PJL A;  3WG7 C;  3GWN A;  2P7V A;  3NKD A;  3C62 A;  3K6B A;  1M57 C;  1R5I D;  2M64 A;  1QLE C;  3FHD A;  3RVY A;  3GEE A;  3TJ6 A;  2GFH A;  3NG1 A;  1TWH A;  4XEF A;  3F47 A;  4MTO A;  1YA7 O;  1VOM A;  3DE9 A;  1BR1 A;  2VC9 A;  3ABK C;  1FTS A;  1MMA A;  1UFB A;  1XWJ A;  1O3U A;  1Z5Z A;  3KH2 A;  2AU5 A;  2XXA B;  3UMH A;  4J7T A;  3OA1 A;  3DJU B;  3QZC A;  3LNM B;  1WGW A;  2WZL A;  5E3A A;  1QSP A;  256B A;  1ZHT A;  4NTF A;  1E86 A;  4O6M A;  2TMV P;  4U5E E;  4YL0 A;  3AG4 C;  5JUA A;  4DBQ A;  1S7Z A;  4K7B A;  4OD4 A;  2XLV A;  2MHR A;  1OW6 A;  3RYL A;  4AL0 A;  3N24 A;  1O87 A;  2DB4 A;  2LSE A;  1ZW2 A;  2NUT A;  2BL2 A;  3HNJ A;  1QKR A;  4I1M A;  2NG1 A;  3OWT A;  4MVM A;  3VYW A;  5JLI A;  4NQF A;  3T6J A;  1K05 A;  3MX3 A;  4R32 A;  1U89 A;  3OEO A;  1HE9 A;  1YA9 A;  1NU9 C;  3KL4 A;  1Q0G A;  5GPG B;  1YJG A;  2J9V A;  2NPU A;  3A9C A;  1H9G A;  3V5Z A;  3L1M A;  4U9E A;  4XWJ A;  4EIY A;  3LEV A;  2LK4 A;  3CQZ A;  5EK0 A;  3MFN A;  1N1C A;  4U5C E;  3LAY A;  1EA8 A;  1T01 A;  1UG7 A;  2B0H A;  1F1M A;  1GGQ A;  1ZVZ A;  3JCU Q;  3U0C A;  4YWQ A;  4BPM A;  3KKB A;  3Q7L A;  3ASN C;  1FMW A;  1U6H A;  2HFI A;  1G4U S;  2HS5 A;  5KYW B;  5FZT A;  1FNT c;  1MND A;  5F28 E;  2PX0 A;  2A68 F;  3K66 A;  1C03 A;  5A6B A;  3WAQ A;  3DMD A;  1J8Y F;  4KC9 A;  1OCR C;  2LFF A;  4YL1 A;  1ZU4 A;  4MTF A;  4CBE A;  4E0H A;  1KNY A;  2KK1 A;  2YZS A;  3IEE A;  3V5X A;  1OCZ C;  3ZQY A;  5DS5 A;  3U5S A;  4G7Z F;  2UUI A;  5HV9 A;  3RQE A;  4N6C A;  5K0I A;  4P9T A;  2P1A A;  2Q9C A;  4BG0 A;  3AOU A;  2H7B A;  2WB7 A;  1EI7 A;  4JTD B;  4JUR I;  2EPO A;  4A4A A;  3JSZ A;  3J06 A;  3G4X A;  4D4X A;  4YJW A;  2ZD9 A;  5DVW A;  3EGX A;  1M56 C;  2ZXP A;  3NYJ A;  4X0R A;  2Q9B A;  3SYN A;  1BR4 A;  4CDA A;  1M6T A;  5JS5 A;  4FAP B;  1HMO A;  1I4Z A;  2H8A A;  2PP4 A;  3POV A;  3RKO F;  4PFP A;  3TUL A;  3DAF A;  1T6I A;  1TFO B;  5L0C A;  1EQ1 A;  1D0Z A;  2AWC A;  3T9O A;  1ZZP A;  1MMG A;  3NDB B;  3ZVR A;  2VCB A;  4OIR F;  1J8M F;  2NUT B;  1G4W R;  3RIP A;  2NUP A;  3S28 A;  2XL4 A;  4O6N A;  3W8H A;  1GQA A;  3JSE O;  4MS2 A;  4U5G A;  3DM5 A;  1NBB A;  2DGJ A;  2YL0 A;  1YAU O;  1TWA A;  2BC5 A;  3QVY A;  4XPY A;  5CI9 A;  2XLO A;  3W8I A;  1ORY A;  5JVE A;  1A0B A;  4KI2 A;  4MVZ A;  5E2Q A;  4BJ5 A;  2RSE B;  2YL3 A;  3DZA A;  3FXH A;  3SXK A;  4EBJ A;  4YT4 A;  1Q0F A;  3DJN B;  1TWG A;  2R7W A;  4H54 A;  4Q4Z F;  1ZHY A;  3C8G D;  1I5N A;  3IHU A;  4IRU A;  4DJ9 A;  1OW7 A;  4OIO F;  3RF3 A;  1RJ9 B;  1SR2 A;  3TQO A;  2VH3 A;  1CPR A;  5DS4 A;  5JRA A;  1D1C A;  5L3Q A;  4CS9 A;  1OQC A;  1A7V A;  2KYH A;  4BJ1 A;  4G0H A;  1GS9 A;  3ATP A;  2IOQ A;  2GDC A;  2IBF A;  3K1I A;  1QZX A;  3LES A;  2C04 A;  2H7O A;  3CAX A;  4PR9 A;  3M4B A;  4XPW A;  4ULV A;  4C3D A;  2QLA A;  5JT4 A;  4XTK A;  2HV7 A;  4CSA A;  3AGU A;  4E18 A;  1LIH A;  1NLX A;  4FX5 A;  3V7O A;  4C3B A;  1E85 A;  1E84 A;  1V4A A;  4AE4 A;  5L0F A;  2PNO A;  3EGX B;  4NTB A;  4Z9H A;  2AVK A;  5KYX B;  4MW3 A;  3S27 A;  2YWA A;  3DKA A;  2IYL D;  1K04 A;  1VTM P;  3S29 A;  4NY3 A;  3MLG A;  2XLH A;  3WHN A;  1B68 A;  4I44 A;  2R7X A;  5HSW A;  1XZP A;  2OEX A;  3PMR A;  3LUT B;  3EHN A;  1T5O A;  3NRH A;  2KC3 A;  4W8P A;  5BUO A;  5E33 A;  2EIN C;  2P0N A;  1GM5 A;  2HJM A;  1SMY F;  1H7I A;  2JPU A;  3AG1 C;  3NYL A;  1YYJ A;  4AL1 A;  2OCC C;  1OR2 A;  5DLJ A;  3U8V A;  4GEH A;  3S90 A;  1QQ3 A;  5COF A;  5DQT A;  3LEO A;  4JVS A;  4A2N B;  2PFD A;  2XRH A;  2YKZ A;  2D4U A;  4BEJ A;  2Y69 C;  1H6G A;  1NFN A;  4IGG A;  3RH3 A;  4IAQ A;  1Y6D A;  2CGE A;  2Q4F A;  1HY5 A;  2JD3 A;  2ASR A;  1HE1 A;  3QW0 A;  4JTC B;  4JZA A;  2OEV A;  3DI5 A;  1KTM A;  3I5Q A;  2ETS A;  3M4C A;  4GYT A;  4YT5 A;  3SP1 A;  3NMI A;  3IPM O;  4G7O F;  3EGD A;  4Q5S F;  2Q9A A;  3HJC A;  3IQT A;  2IXO A;  4BJ5 C;  1CGN A;  3ZSU A;  3O55 A;  4MW8 A;  1Z7Q c;  4BJ6 C;  1DOW A;  3GOR A;  3Q6N A;  1OKK D;  4MTG A;  1AEP A;  3GEH A;  3ZTZ A;  5KYN A;  4MND A;  2YRF A;  2W4B A;  5L3V A;  1MMD A;  3Q7G A;  4KNV A;  2R7V A;  2QNL A;  5L0G A;  1ZU5 A;  2GAQ A;  2OG2 A;  1PCX A;  3LNR A;  4P6I C;  3K1I C;  3KPH A;  4HFK B;  3UMK A;  1V55 C;  5CIV A;  3S84 A;  4MVS A;  3BEH A;  2LQG A;  3PCV A;  4AX2 A;  2XM0 A;  1G5Z A;  2LIG A;  2KSF A;  2WVN A;  2ZXW C;  3FMS A;  3TOL A;  2HKV A;  1ZHX A;  3EFO A;  3LJB A;  3AG3 C;  2VAS A;  4O6Y A;  4CSA C;  1FFT C;  1OW8 A;  5T3W A;  1PD0 A;  2HZ8 A;  2HV6 A;  2V3C C;  1QVX A;  2IM8 A;  3IQ5 A;  1NZE A;  3B71 A;  5A6A A;  3C8G A;  4HFF B;  3S9O A;  3JZ0 A;  1WOL A;  2A1D D;  3ZC4 A;  2GWW A;  3UNG C;  2XSE A;  4ANJ A;  4C7O B;  2L6H A;  2Q3T A;  2I8B A;  4XQ1 A;  2C03 A;  2J8W A;  4JEA A;  3S0X A;  3EH1 A;  1LE2 A;  4BJT A;  2J7P A;  3CEX A;  3KMI A;  3NMK A;  1A41 A;  1Z63 A;  3SEO A;  2Y3H A;  4IAR A;  4OIP F;  3GM2 A;  5AC5 A;  2WVO A;  2Q7R A;  3U9M A;  1YZC A;  4CS8 A;  3EH2 A;  1LS1 A;  2W4M A;  2FGY A;  4IJJ A;  2XLD A;  4CJG A;  4JC7 A;  3O39 A;  1WTY A;  3ZTM A;  4EWC A;  1TQG A;  4EBB A;  3SZR A;  5CI8 A;  2YHS A;  4U9D A;  4LDK A;  2R7Q A;  2HUJ A;  4BJ6 A;  4RDA A;  4IAO A;  3DE8 A;  3U2L A;  4YK5 A;  3N0T A;  1K40 A;  3TK0 A;  1M2V A;  5E3C A;  1ZHW A;  1PD1 A;  3RW0 A;  3JRT A;  2HJ3 A;  3R7C A;  1QPU A;  3GEI A;  5A69 A;  2A0U A;  4MVU A;  3HNL A;  4JW1 A;  2QUP A;  4GQH A;  4LDR A;  2R25 A;  2R03 A;  2R7U A;  3SXY A;  3FOP A;  1Y4C A;  3TJ5 A;  1MNE A;  1JPN A;  3HKK A;  5A6K A;  4JCH A;  5BQG A;  2HSB A;  1YZA A;  3H2U A;  1BDJ B;  1R4T A;  5IY5 C;  3HNI A;  3B9Q A;  4PFO A;  3PDM P;  1NG1 A;  4DVZ A;  1YYX A;  1WAT A;  3B29 A;  3C63 A;  2EPK X;  2Z15 A;  2P61 A;  3EFO B;  4FWV A;  2LP4 A;  4PAC A;  3O10 A;  2CW0 F;  1T6U A;  2OU6 A;  3NKE A;  4E17 A;  3UGP A;  2AP3 A;  4JJG A;  3DWW A;  3MYF A;  4XPX A;  3KYJ A;  1DOV A;  2J45 A;  2R7R A;  4Z9I A;  3NMJ A;  4P9F A;  3W4Y A;  4WJ0 A;  2EPM X;  2KNH A;  4E7S A;  2Y3G A;  3MYI A;  3IQC A;  1LVK A;  3RFY A;  1YVI A;  1KU2 A;  3JT1 A;  5T1D B;  2D5R B;  3AG2 C;  3DAG A;  4DVY P;  1Q0M A;  1IZM A;  3HLZ A;  3CZ6 A;  4CJO A;  1HMD A;  4O79 A;  5T3T A;  1T6Q A;  2EIJ C;  1D0Y A;  4U5F E;  4EHP A;  2HSQ A;  3RQG A;  3VM6 A;  3L0I A;  4UDV A;  3B0U X;  1I4Y A;  4NC3 A;  2AWY A;  2O9X A;  2XLW A;  4YL3 A;  4IB4 A;  3UR3 C;  2G3V A;  2XXA A;  2JX0 A;  4ZLC A;  1OXB A;  1EKY A;  1L3P A;  2QTV A;  1Z6A A;  2L9J A;  1RKE A;  2WL8 A;  1VMA A;  2M4E A;  1JR8 A;  3GWL A;  4MQ9 F;  3VF0 A;  2IXP A;  1E83 A;  2L6G A;  3EHM A;  1RCP A;  3LS1 A;  3EPV A;  1OR3 A;  4N6H A;  4PK4 A;  5JSL A;  4C3E A;  4EBK A;  4PJM A;  3GOD A;  4JTA B;  2PF4 E;  2YEV A;  5A6B D;  4JE9 A;  1VYI A;  1IW7 F;  1M2V B;  2YLG A;  3H2V A;  3K33 A;  1ST6 A;  3K7D A;  3Q6M A;  1ZW3 A;  4ONS A;  1LS4 A;  3EZI A;  1M2O A;  4NCQ A;  4K0D A;  3T4R A;  4JRZ A;  1YDI A;  2XLM A;  4JKV A;  2NUP B;  1SF8 A;  5DS6 A;  2Y3D A;  1JRA A;  4DOZ A;  5B1A C;  1RXQ A;  4B6I A;  3RQF A;  4AK9 A;  2LCH A;  4OIQ F;  2J9B A;  2VCA A;  4J7Y A;  1U0B B;  2OKU A;  1ORS C;  3EZH A;  1D0X A;  3B0P A;  2W45 A;  1W2W A;  2J9W A;  2YL1 A;  3G50 A;  3I4U A;  4DBR A;  1VLS A;  5L0J A;  2V26 A;  3C18 A;  4LLE A;  2EIL C;  4I1O B;  3H65 A;  1RMV A;  2J0X A;  2ZPA A;  2L6F A;  2VCC A;  4E7Z A;  4KNW A;  5L0H A;  1HW2 A;  2KGO A;  2DYS C;  3U9J A;  3EG9 A;  5KYY A;  2DYR C;  1Q0K A;  1VK5 A;  1BZ4 A;  4CIP A;  3A11 A;  4Q7C A;  4YT8 A;  1SYQ A;  2NSF A;  3HNK A;  1VB5 A;  4FES A;  1YAR O;  1XZQ A;  2J9U A;  2NSG A;  4J32 B;  2YLD A;  3W2W A;  2PX3 A;  5BQH A;  1WWP A;  2QY9 A;  5KYU A;  1TR2 A;  4W8K A;  5JP7 A;  3EQL F;  4ER9 A;  2OJE D;  4XEV A;  3AGT A;  2DI3 A;  3MBG A;  3TOM A;  3QTH A;  2R05 A;  4O7G A;  4DRI B;  4E0I A;  2CNW D;  1AUE A;  1NU7 D;  3ABM C;  1CGM E;  1MQV A;  4CS9 C;  3DXJ F;  3V5Y A;  3K1H A;  1APC A;  1YLM A;  3ZQV A;  1C02 A;  1D1A A;  1L7C A;  3JYY A;  4WGZ A;  1OXK A;  2EIK C;  5COM A;  4AE4 B;  3W2V A;  1A7D A;  2XL6 A;  1BR2 A;  1RKE B;  1WN0 A;  4MVO A;  1OCC C;  5AGF A;  3FOO A;  4H4K C;  4N06 A;  5DQZ A;  3RVZ A;  2RD9 A;  4OD5 A;  2MYS A;  2CYD A;  4PJN A;  3ZDL A;  1G8X A;  2R7O A;  3QMK A;  4XLN F;  1LKX A;  3L8J A;  1Q0D A;  2BE5 F;  2XL8 A;  3US6 A;  3M15 A;  1ZYR F;  4F4B A;  2R7T A;  2HMQ A;  3CSK A;  3SXM A;  4U5H A;  4XEK A;  5BQI A;  4N4W A;  2XS8 A;  5D91 A;  1LM3 B;  3TD7 A;  3QVZ A;  4LAC B;  4OIN F;  4U5D E;  2MWQ A;  4D4N A;  2FFH A;  4I3M A;  4XLP F;  5COG A;  2J46 A;  4PJJ A;  3I5P A;  4BEM J;  3C7J A;  4RD9 A;  2OQM A;  5FCL A;  3EJN A;  3N2Z B;  1E2X A;  2QE9 A;  4QDL A;  1HW1 A;  4CDV A;  3E70 C;  3HTK C;  1C17 M;  2R02 A;  2ZXR A;  3X1O A;  3AQC A;  1ZHZ A;  4L6R A;  5AC4 A;  2LFD A;  1VLT A;  4G78 A;  2HMZ A;  2R7S A;  3DD7 A;  3AQB A;  3L34 A;  3L8I A;  2ZXO A;  3C8Z A;  1FR0 A;  4IWB A;  1SZI A;  3EG9 B;  3IQ6 A;  5KYY B;  1RJ9 A;  3M79 A;  2WVQ A;  3EGD B;  4HE8 D;  3T6G B;  1WAS A;  4DRJ B;  3UMI A;  4G7H F;  1JOG A;  2H7V C;  2KQ9 A; 
#chains in the Genus database with same CATH homology
 5KYU B;  4ZLD A;  3ZG1 A;  2KW3 C;  1OCO C;  4ULW A;  2A69 F;  3FDQ A;  5B1B C;  4RBN A;  2KJG A;  1TKN A;  2G3K A;  4U5B E;  5KYX A;  5B3S C;  4JJF A;  3O6X A;  2VB6 A;  1V54 C;  3DM9 B;  2WZG A;  4YN0 B;  4J30 B;  2B0J A;  3ABL C;  4CS7 A;  2IXN A;  3FAJ A;  5F5H A;  4LER A;  1OKK A;  3ECS A;  2Y39 A;  1TWC A;  1JPJ A;  3M1C B;  2CNW A;  2IXM A;  3B0V C;  4YT2 A;  1Z23 A;  3LLK A;  4KBL A;  1Z3I X;  2G62 A;  1MMN A;  2L81 A;  2CDQ A;  3X2Q C;  4M63 A;  3NYM A;  4CS8 C;  3ZIB A;  3LS0 A;  3ITF A;  3WOD F;  5D92 A;  2W9Y A;  3UGO A;  3SNH A;  3F46 A;  2A6H F;  2Y3B A;  5EGY A;  5F5F A;  2J7P D;  5EHH A;  3PHF 2;  2X51 A;  2EIM C;  2WZF A;  1O5H A;  2E87 A;  2P6V A;  3GAN A;  4LLC A;  3ASO C;  1VYK A;  3FVY A;  4QI2 A;  3LLI A;  3JYH A;  1FMV A;  3T6B A;  3E9V A;  4CIH A;  1FFH A;  5KYW A;  4QI0 A;  4C7O A;  2J0W A;  4HEA J;  3VAY A;  2A6E F;  1D1B A;  4PJL A;  3WG7 C;  2P7V A;  3NKD A;  3K6B A;  1M57 C;  1QLE C;  3FHD A;  2GFH A;  3NG1 A;  1TWH A;  3F47 A;  1VOM A;  1BR1 A;  3ABK C;  1FTS A;  1MMA A;  1Z5Z A;  3KH2 A;  2XXA B;  3UMH A;  3OA1 A;  3DJU B;  3QZC A;  1WGW A;  2WZL A;  5E3A A;  1ZHT A;  4O6M A;  4U5E E;  3AG4 C;  4DBQ A;  1S7Z A;  4K7B A;  4OD4 A;  3RYL A;  3N24 A;  1O87 A;  2LSE A;  2NUT A;  4I1M A;  3VYW A;  2NG1 A;  3OWT A;  3T6J A;  3MX3 A;  3OEO A;  1NU9 C;  3KL4 A;  2J9V A;  4XLP F;  4XWJ A;  3LEV A;  3CQZ A;  1N1C A;  4U5C E;  3LAY A;  3JCU Q;  4YWQ A;  3KKB A;  3Q7L A;  3ASN C;  1FMW A;  5KYW B;  1MND A;  2PX0 A;  2A68 F;  3K66 A;  3DMD A;  1J8Y F;  4KC9 A;  1OCR C;  1ZU4 A;  4CBE A;  2YZS A;  3IEE A;  5DS5 A;  1OCZ C;  4G7Z F;  2Q9C A;  4BG0 A;  2H7B A;  2WB7 A;  4JUR I;  3JSZ A;  4YJW A;  5DVW A;  3EGX A;  1M56 C;  2ZXP A;  3NYJ A;  4X0R A;  2Q9B A;  3SYN A;  1BR4 A;  2PP4 A;  3POV A;  3RKO F;  4PFP A;  3DAF A;  1D0Z A;  1MMG A;  3NDB B;  3ZVR A;  4OIR F;  1J8M F;  2NUT B;  3RIP A;  2NUP A;  3S28 A;  2XL4 A;  4O6N A;  3W8H A;  4U5G A;  3DM5 A;  2DGJ A;  5CI9 A;  1TWA A;  3W8I A;  4KI2 A;  5E2Q A;  4BJ5 A;  4YT4 A;  3DZA A;  3DJN B;  1TWG A;  2R7W A;  4Q4Z F;  1ZHY A;  4IRU A;  4OIO F;  1RJ9 B;  2VH3 A;  5DS4 A;  1D1C A;  5L3Q A;  4CS9 A;  4BJ1 A;  4G0H A;  2IOQ A;  3LES A;  1QZX A;  2C04 A;  2H7O A;  4C3D A;  4XTK A;  2HV7 A;  4CSA A;  4FX5 A;  3V7O A;  4C3B A;  4AE4 A;  3EGX B;  5KYX B;  3S27 A;  2IYL D;  3S29 A;  4NY3 A;  3MLG A;  4I44 A;  2R7X A;  5HSW A;  3PMR A;  3EHN A;  5BUO A;  3NRH A;  5E33 A;  2EIN C;  1SMY F;  3AG1 C;  3NYL A;  5DLJ A;  2OCC C;  4GEH A;  5DQT A;  4JVS A;  4A2N B;  2PFD A;  2XRH A;  4BEJ A;  2Y69 C;  3RH3 A;  2CGE A;  2JD3 A;  4JZA A;  3I5Q A;  4GYT A;  4YT5 A;  3SP1 A;  4G7O F;  3EGD A;  4Q5S F;  2Q9A A;  3HJC A;  4BJ5 C;  2IXO A;  3ZSU A;  3Q6N A;  1OKK D;  5KYN A;  4MND A;  2W4B A;  5L3V A;  1MMD A;  3Q7G A;  4KNV A;  2R7V A;  1ZU5 A;  2OG2 A;  1PCX A;  3LNR A;  4P6I C;  3K1I C;  4HFK B;  3UMK A;  1V55 C;  4AX2 A;  2WVN A;  2ZXW C;  4CSA C;  1ZHX A;  3EFO A;  3LJB A;  3AG3 C;  2VAS A;  4O6Y A;  1FFT C;  5T3W A;  1PD0 A;  2HV6 A;  2V3C C;  1NZE A;  4HFF B;  2A1D D;  3UNG C;  4ANJ A;  2XSE A;  4C7O B;  2Q3T A;  2I8B A;  2C03 A;  3S0X A;  3EH1 A;  4BJT A;  2J7P A;  3KMI A;  1Z63 A;  3SEO A;  2Y3H A;  4OIP F;  2WVO A;  4CS8 A;  3EH2 A;  1LS1 A;  2W4M A;  2FGY A;  4IJJ A;  3O39 A;  4EWC A;  4EBB A;  3SZR A;  5CI8 A;  2YHS A;  2R7Q A;  4BJ6 A;  4RDA A;  4IAO A;  3N0T A;  1M2V A;  5E3C A;  1ZHW A;  1PD1 A;  3JRT A;  4JW1 A;  2R7U A;  1MNE A;  1JPN A;  4JCH A;  5IY5 C;  3B9Q A;  4PFO A;  1NG1 A;  4DVZ A;  2Z15 A;  3EFO B;  4FWV A;  2CW0 F;  3NKE A;  3UGP A;  4JJG A;  2J45 A;  2R7R A;  4WJ0 A;  2KNH A;  4E7S A;  2Y3G A;  3RFY A;  1LVK A;  1KU2 A;  3JT1 A;  5T1D B;  2D5R B;  3AG2 C;  3DAG A;  4DVY P;  1IZM A;  3HLZ A;  3CZ6 A;  5T3T A;  4O79 A;  2EIJ C;  1D0Y A;  4U5F E;  3L0I A;  3B0U X;  3UR3 C;  2O9X A;  2G3V A;  2XXA A;  4ZLC A;  2QTV A;  1Z6A A;  2L9J A;  2WL8 A;  1VMA A;  2M4E A;  4MQ9 F;  2IXP A;  3EHM A;  4PK4 A;  3LS1 A;  4C3E A;  3EPV A;  4PJM A;  3GOD A;  2PF4 E;  2YEV A;  1VYI A;  1IW7 F;  1M2V B;  3K33 A;  3K7D A;  3Q6M A;  1ST6 A;  3QMK A;  4BJ6 C;  3EZI A;  1M2O A;  4K0D A;  3T4R A;  2NUP B;  1SF8 A;  5DS6 A;  2Y3D A;  4DOZ A;  5B1A C;  4B6I A;  4AK9 A;  4OIQ F;  3EZH A;  1D0X A;  3B0P A;  2W45 A;  1W2W A;  2J9W A;  4DBR A;  3I4U A;  2V26 A;  4LLE A;  2EIL C;  4I1O B;  3H65 A;  2J0X A;  2ZPA A;  4E7Z A;  4KNW A;  2KGO A;  2DYS C;  5KYY A;  3EG9 A;  2DYR C;  1VK5 A;  4Q7C A;  4YT8 A;  3ZC4 A;  4FES A;  4J32 B;  2J9U A;  3W2W A;  2PX3 A;  2QY9 A;  5KYU A;  1TR2 A;  4W8K A;  3EQL F;  4O7G A;  2CNW D;  1NU7 D;  3ABM C;  4CS9 C;  3DXJ F;  3K1H A;  1D1A A;  2EIK C;  4AE4 B;  3W2V A;  1BR2 A;  1OCC C;  4H4K C;  4N06 A;  5DQZ A;  4OD5 A;  2MYS A;  4PJN A;  1G8X A;  2R7O A;  4XLN F;  1LKX A;  2BE5 F;  1ZYR F;  4F4B A;  2R7T A;  3CSK A;  4U5H A;  5D91 A;  3TD7 A;  4LAC B;  4OIN F;  4U5D E;  2MWQ A;  2FFH A;  4I3M A;  2J46 A;  4PJJ A;  3I5P A;  4RD9 A;  5FCL A;  3EJN A;  3N2Z B;  4QDL A;  3E70 C;  3HTK C;  2ZXR A;  3X1O A;  3AQC A;  1ZHZ A;  2R7S A;  3DD7 A;  3AQB A;  3L34 A;  2ZXO A;  4IWB A;  1SZI A;  3EG9 B;  5KYY B;  1RJ9 A;  2WVQ A;  3EGD B;  4HE8 D;  3UMI A;  4G7H F;  2H7V C;  2KQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...