1VYKA

Crystal structure of psbq protein of photosystem ii from higher plants
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
149
structure length
129
Chain Sequence
EARPIVVGPPPPLTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OXYGEN-EVOLVING ENHANCER PROTEIN 3
publication title The 1.49 A Resolution Crystal Structure of Psbq from Photosystem II of Spinacia Oleracea Reveals a Ppii Structure in the N-Terminal Region.
pubmed doi rcsb
molecule tags Photosystem ii
total genus 56
structure length 129
sequence length 149
ec nomenclature
pdb deposition date 2004-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1vykA00
3LS1A 3RFYA 2MWQA 3LS0A 1NZEA 3JCUQ 1VYKA 3ZSUA
chains in the Genus database with same CATH superfamily
4U5FE 2Q3TA 4ZLDA 1U89A 1QPUA 3SYNA 4BJ1A 3LLIA 4CDYA 3V5YA 3JT1A 4PACA 3RW0A 1OW8A 3EZIA 3W8HA 4ZLCA 2A6EF 1TWCA 2NPUA 2AP3A 2H7OA 3QZCA 4K7BA 4U5DE 3C8ZA 2XL8A 3S29A 4XQ1A 3T6GB 4DOZA 1Q0KA 2LFFA 2LD6A 3UMIA 1E85A 2GAQA 2WZLA 3DAFA 3NG1A 4U9DA 1EQ1A 3A11A 1JPNA 5IY5C 3S90A 3A9CA 4M63A 3GM3A 1IZMA 2HSBA 4CSAA 4YT8A 2DYSC 1YDIA 4I1MA 1LM3B 1YZAA 3AQCA 3C62A 4C3DA 5JRAA 3C7JA 4IWBA 1CGME 4NY3A 1J8MF 4D4XA 4AK9A 3K1IA 1GGQA 3RQGA 3ZG1A 3IEEA 2L6FA 3SXYA 2JPUA 4FX5A 2NUPA 3MFNA 4NQFA 4BEMJ 1E86A 3L34A 2HS5A 1YA9A 3C8GB 3E9VA 2R7SA 2O9XA 1HMDA 2R7XA 1FFTC 4FWVA 3TQOA 1OW7A 1YJGA 1TKNA 4U5CE 5COGA 3JSEO 1V74B 2KW3C 1U6HA 2J9UA 2YLDA 3RFYA 2XS1A 2HMZA 2W4MA 1QQ3A 4MVOA 2CDQA 3T6BA 3PCVA 3ZQYA 2YLIA 5GPGB 3VYWA 5K0IA 2HJ3A 3C8GA 3KKBA 3ASNC 4IARA 3U9MA 1L7CA 4H54A 2OEXA 3I4UA 3ABKC 1QVXA 3J06A 4EWCA 3GWLA 4YJWA 4NTFA 5B1AC 1A41A 3RVYA 1T6UA 2OEVA 4LDKA 2LSEA 4XPYA 3S28A 1LVKA 1T6IA 3DI5A 3UGOA 3DJUB 3GM1A 3L8JA 5AC5A 4J7TA 2EIJC 1NZEA 4MVQA 3IHUA 3OWTA 5B3SC 1C02A 1VMAA 3US6A 4EHPA 2Y69C 1BZ4A 4X0RA 5KYNA 3W2VA 3KMIA 3KPHA 2A6HF 3SXZA 3JYYA 2XLVA 2OU6A 2EIMC 3SZRA 1Q0GA 3EFOA 3BRJA 3ZTZA 2J0XA 2EPLX 5TJ5E 3PDMP 1A7EA 1LE4A 1H7IA 1V4AA 1IW7F 2J7PD 3EJNA 2XS8A 2Z15A 5COFA 3NYMA 3RIPA 3EGXA 4AE4B 1CGOA 3VM6A 2KYHA 3AG4C 3DE8A 4GYTA 4N06A 1JAFA 4E0HA 2HJMA 4XEFA 3UMHA 4GEHA 1NLXA 4CS7A 2V26A 4JW1A 1T5OA 2HKVA 3B29A 1A0BA 2P61A 4AE4A 1FNTc 4MVZA 1ZHYA 3G50A 1Q0FA 1YLMA 2R7QA 3L8IA 3TK0A 1E84A 2ZXWC 2NUTA 3PHF2 3LJBA 2Y3HA 1WN0A 1M2VB 4CDAA 3O39A 1VLSA 1H9GA 2PNOA 4E18A 1WATA 2ZXPA 2R7VA 4WGYA 3ECSA 1ORYA 4OIRF 2KNHA 4MW8A 2XM4A 3QVYA 5DS6A 2MHRA 2A68F 2LP4A 2W9YA 5KYWB 1ORSC 3ZTMA 1ZHTA 4DRJB 1ZHZA 1D1AA 5L0JA 4G7HF 3MYFA 3L1MA 1M2VA 5L3VA 3M4CA 4B6IA 3AOUA 3VRCA 2OOCA 1LI7A 1ZHXA 1ZU4A 3IQ6A 3WHNA 2QUPA 2HV6A 3SNHA 3U2MA 2CGEA 3HJCA 5JVEA 3S84A 1FR0A 3LEVA 1TFOB 2I8BA 4IJJA 3ITFA 1FFHA 2XRHA 3EZHA 4PJLA 2P0NA 3U8VA 3U2LA 5HV9A 4QI2A 3GWNA 1OW6A 5FCLA 1JRAA 4F4BA 1YZCA 1JR8A 4MVRA 3AGUA 4KC9A 4LLEA 3F47A 2V3CC 3DWWA 4EKWA 1S7ZA 3MBGA 3IQCA 2IXMA 2YL7A 2WL8A 1VOMA 3OA1A 5JSLA 4DBRA 3K1HA 1HMOA 1AEPA 4KNVA 3TULA 1ZHWA 2RD9A 4J30B 1HW2A 2ZXRA 5DQZA 1Z3IX 5A6BD 3LUTB 2EILC 3FOPA 1V55C 4RBNA 2HUJA 3Q7GA 3F46A 4CS9A 3RH3A 5BQHA 1I5NA 5KYXB 1VYIA 4YN0B 4MNDA 5F28E 3V5XA 2UUHA 3HLZA 1ORJA 2FGYA 4C7OB 3G4XA 2YVKA 1T9KA 2OCCC 3NKDA 4MS2A 1KNYA 4YL1A 3DD7A 2EPMX 2EINC 1OXKA 1PCXA 4OD5A 2H8AA 2LIGA 4C7OA 3B9QA 3QW1A 4NTBA 3R2PA 1OCOC 2R7OA 1LS1A 2CNWD 3N2ZB 1TQGA 5A69A 4PFPA 4UDVA 2M64A 3LS1A 4R32A 2GA0A 5BQGA 3CZ6A 4MVSA 2FFHA 3O6XA 1M6TA 5A6AA 4WJ0A 1WOLA 4W8PA 3JRMO 5AGFA 3KL4A 4JC7A 5JS5A 1YVIA 1ZW3A 2AVKA 3NYLA 4G0HA 4ULVA 5BQIA 5EGYA 2IXPA 2YL3A 3DM5A 1AUEA 1ZU5A 2J9WA 2PX0A 3FXHA 4A2NB 4BEJA 4CS8C 4YWQA 3N24A 2J7PA 1B68A 3EG9B 1T01A 1SYQA 1VTMP 3CQZA 2OJED 1N1CA 3O55A 4CIHA 3GANA 3NKEA 3U5SA 4FAPB 4PR9A 4U5BE 4I44A 4DRHB 2I15A 2DYRC 2R9RB 4I3MA 2BL2A 1ZW2A 5L0DA 1HY5A 1LI5A 5DVWA 3V7OA 2XXAB 2G3KA 4XPWA 1NFOA 1PD0A 2IYLD 4H4KC 2BC5A 1LPEA 2GDCA 3ZVRA 1G8XA 1OCCC 2PX3A 1K05A 5COMA 1UG7A 5CIVA 2WZFA 3B71A 3HNJA 2A1DD 1WWPA 3AGTA 3S9OA 3TJ5A 4WGZA 4EIYA 2M4EA 2W4BA 2Y3GA 1DOWA 2LFDA 4P9TA 4XTKA 4JE9A 4LDRA 2TMVP 2YL1A 3QVZA 5FZTA 1V54C 3TD7A 1Y4CA 1Z7Qc 4OIQF 3X2QC 2YLGA 2XLDA 3OEOA 3MLGA 3T9OA 3TJ6A 1APCA 5EK0A 2P1AA 1Q0DA 4DJ9A 3QMKA 3EH2A 4PFOA 3U8PA 2CYDA 4BG0A 1QLEC 4N6CA 2J8WA 3TOMA 4BJ5C 3VF0A 4JEBA 5E33A 3ZDLA 3B0VC 2NSGA 4AX2A 3FAJA 2H7BA 1NU7D 5D92A 1E83A 3DXJF 3DE9A 2LK4A 3GORA 1VLTA 3K66A 2EPNA 4JURI 5L3QA 2R7RA 1TWAA 4MQ9F 1OCZC 2R02A 3M15A 3U3BA 4C3BA 1NBBA 4O7GA 4CJGA 5E3CA 1YYXA 4O6MA 2CW0F 3HKKA 3Q6MA 4LACB 3SXMA 3I5QA 3RQEA 3R7CA 1H9TA 3QW0A 2VH3A 2AU5A 2HFIA 2ZXOA 4I1OB 3DZAA 2HV7A 4HEAJ 2XLMA 1TR2A 4PJNA 3EHNA 3NMIA 3RKOF 2JX0A 1OR2A 1OKKD 3UMKA 4E0IA 5A6BA 2D5RB 3DKAA 1RKEB 1QSPA 3JYHA 4PJMA 3CAXA 4CBEA 4CDVA 4HFFB 2HSQA 3HNKA 2P7VA 1FMVA 3C18A 4NTAA 4G78A 4N4WA 5L0FA 3U0CA 2KK1A 1U0BB 2WVNA 1I4YA 4EBKA 5E3AA 4L6RA 5T3TA 4YL0A 3POVA 3LEOA 3GM2A 1O5HA 2CCYA 1NFNA 4ONSA 2QY9A 2Y3BA 4K1OA 4DRIB 4DXWA 1VB5A 5D91A 1W2WA 4U5HA 4BJTA 4D4NA 2L9JA 3NMKA 3FHDA 3WODF 1AVOB 1D1CA 1ZZPA 2ASRA 4CJOA 2L81A 5KYWA 4Q5SF 1MMAA 2DGJA 2IBFA 4MTOA 1VK5A 4BPMA 5A6JA 2R7UA 1WASA 2CNWA 4U5EE 1K04A 3JRTA 4ANJA 4NCQA 3SEOA 3O10A 4XWJA 4BJ6A 2R7WA 3BEHA 3EHMA 2J9VA 2B0JA 2DI3A 2ICWG 4JZAA 2VCBA 1G4WR 4LERA 2XL6A 1T6QA 5CI8A 2F22A 3K6BA 5L0GA 2W45A 3I5PA 1ZYRF 1TWHA 4K0DA 2ZD9A 1BR1A 2MWQA 1Q0MA 3B0PA 1HW1A 3C63A 2WVOA 5L0HA 4MTGA 1RCPA 1XZQA 4KBLA 1ST6A 4OINF 3LLKA 4WABA 4ER9A 1J8YF 4AL0A 2Q9AA 2FAPB 1M56C 2LCHA 3H65A 5F5FA 1YA7O 3LAYA 3Q7LA 4CS9C 3GODA 3AG1C 2EPOA 5A6KA 3FDQA 2VC9A 2YEVA 4GQHA 4N6HA 3DJNB 2A69F 2X51A 1Y6DA 3T6JA 3Q6NA 4OD4A 4W8KA 2MYSA 1H6GA 2D4UA 3H2UA 1MNEA 3QTHA 4JJFA 3ABLC 4KNWA 4DBQA 2QTVA 4JVSA 2GFHA 2ZPAA 3LS0A 2QNLA 2YKZA 3M1CB 1A7DA 3RF3A 3ZIBA 1F1MA 3NRHA 4RDAA 5L0IA 1UFBA 3U3FA 2J45A 2VCAA 4CX9A 1O87A 1OCRC 1Z5ZA 2DB4A 3IPMO 4JEAA 4CSAC 4IB4A 2OJQA 2AWYA 5KYUB 2L6HA 2UUIA 3S27A 3U9JA 2IM8A 2R05A 2WZGA 3ATPA 3EPVA 3M4BA 3ZC4A 4YT2A 3K1IC 4EBBA 4U9EA 3KYIA 2L7AA 2EPKX 256BA 2KC3A 5CI9A 2HMQA 3FAPB 3IQ5A 5AC4A 2OKUA 2PF4E 2WVQA 5KYUA 4JKVA 5L0CA 4U5GA 3W2WA 4IGGA 1Z23A 4QDLA 3GEEA 4JTDB 2NUPB 3DMDA 2Q9BA 1MNDA 2Q9CA 1M57C 1NSGB 2ETSA 3AQBA 1YYJA 4ULWA 2XLHA 1VYKA 4LDQA 2EIKC 4PK4A 2IOQA 5HSWA 1L3PA 4OIOF 1D1BA 2YZSA 2KSFA 1SF8A 1YARO 3EG9A 5E2QA 4J32B 2OG2A 5DS5A 1MMDA 1KTMA 1QZXA 1TWGA 3M79A 4E7ZA 2YHSA 3GEIA 1MMGA 3PMRA 1XZPA 2B0HA 4HFKB 4CS8A 1D0YA 4E17A 1EA8A 4G7OF 3K7DA 1MMNA 4Z9IA 4AL1A 1OKKA 5EHHA 1SZIA 2YRFA 1JMWA 3SXKA 4MVMA 1GS9A 4YT5A 2VB6A 2XXAA 4YK5A 3WAQA 2YL0A 3CEXA 2A0BA 4KI2A 1LS4A 3EQLF 1HE9A 3HTKC 3LESA 4J7YA 5B3IA 3X1OA 2C03A 2J9BA 2XLWA 4MVUA 1RKCA 3KYJA 4P6IC 1RMVA 2Q7RA 3HNIA 1G4US 1LIHA 1I4ZA 4Z9HA 4EBJA 1GM5A 4A4AA 1BR4A 3HNLA 1BBHA 1A7VA 3EFOB 3LNMB 2HZ8A 2LQGA 5T1DB 2L6GA 3EGDB 4NC3A 2JD3A 3ZQVA 1RJ9B 2Y39A 1BR2A 4XEVA 1HE1A 2E87A 2R7TA 3EGXB 2XM0A 2G62A 3FMSA 3B0UX 3ASOC 5BUOA 2RSEB 4FESA 2GWWA 4BJ5A 3AJMA 3EGDA 3T4RA 3H2VA 3LNRA 4EUKB 5JUAA 3GEHA 5DLJA 1FTSA 3ABMC 1FAPB 1RJ9A 3AG2C 4IRUA 1ZVZA 5T3WA 2Y3DA 4O6NA 1O3UA 4C3EA 2IXOA 4HE8D 2AWCA 1BDJB 5DS4A 2XSEA 1PV3A 3K33A 3V5ZA 3VAYA 3C8GD 1G5ZA 1KU2A 2PBEA 4RD9A 5KYYB 2NUTB 4XPXA 2QE9A 1NU9C 1XWJA 1LKXA 5JLIA 3JCUQ 4G7ZF 1SR2A 4LLCA 4CIPA 1C03A 4IAOA 1RKEA 4MW3A 1M2OA 1SMYF 2QLAA 2YWAA 5B1BC 3JTLO 4YL3A 1CPQA 2NG1A 4QI0A 3IQTA 3L0IA 4JJGA 3ZSUA 5KYYA 1CGNA 1R5ID 2R03A 3FVYA 5DQTA 1GQAA 2PP4A 3EH1A 3UGPA 3ZWIA 2KJGA 4JIOA 1Z63A 4XLNF 3S0XA 1DOVA 2YQYA 4E7SA 2VCCA 3W8IA 3FOOA 4Q4ZF 4OIPF 1JOGA 2X0CA 5KYXA 2NSFA 2H7VC 3UR3C 3E70C 4BJ6C 4Z9JA 4YT4A 2IXNA 1OXBA 1EI7A 1FMWA 4XEKA 4O6YA 1EKYA 1WTYA 2VASA 1D0ZA 2BE5F 3RYLA 4IAQA 1YAUO 3DM9B 4JTCB 3NYJA 1C17M 2P6VA 2Q00A 4PJJA 1NG1A 1K40A 4JCHA 3RVZA 1LE2A 3CSKA 3NDBB 4Q7CA 3AG3C 1OQCA 2J0WA 3JZ0A 1QKRA 2J46A 3MYIA 1D0XA 2KGOA 3MX3A 3N0TA 4O79A 3TOLA 2Q4FA 1PD1A 4JRZA 1Z6AA 5JP7A 3UNGC 1S05A 1CPRA 1OR3A 3G4ZA 1MQVA 4MTFA 2XL4A 3KH2A 1TFKB 2XLEA 5F5HA 4XLPF 5JT4A 2G3VA 2WB7A 4DVZA 1R4TA 2C04A 3NMJA 4JCZA 3RQFA 3W4YA 2OQMA 1WGWA 2PFDA 2R25A 2A0UA 2XLOA 3JSZA 4JTAB 3SP1A 3DAGA 4DVYP 3WG7C 2KQ9A 1RXQA 4P9FA 1E2XA 1JPJA
chains in the Genus database with same CATH topology
4U5FE 2Q3TA 4ZLDA 3SYNA 4BJ1A 3LLIA 3JT1A 3W8HA 4ZLCA 2A6EF 1TWCA 2H7OA 3QZCA 4K7BA 4U5DE 3S29A 4DOZA 3UMIA 2WZLA 3DAFA 3NG1A 1JPNA 5IY5C 4M63A 1IZMA 4CSAA 4YT8A 2DYSC 4I1MA 3AQCA 4C3DA 4IWBA 4NY3A 1J8MF 4AK9A 3ZG1A 3IEEA 4FX5A 2NUPA 3L34A 3E9VA 2R7SA 2O9XA 2R7XA 1FFTC 4FWVA 4U5CE 1TKNA 2KW3C 2J9UA 3RFYA 2W4MA 2CDQA 3T6BA 3VYWA 3KKBA 3ASNC 3I4UA 3ABKC 4EWCA 4YJWA 5B1AC 2LSEA 3S28A 1LVKA 3UGOA 3DJUB 2EIJC 1NZEA 5B3SC 3OWTA 1VMAA 2Y69C 4X0RA 5KYNA 3W2VA 3KMIA 2A6HF 3SZRA 2EIMC 3EFOA 2J0XA 3RIPA 2J7PD 1IW7F 3EJNA 2Z15A 3NYMA 3EGXA 4AE4B 3AG4C 4GYTA 4N06A 3UMHA 4GEHA 4CS7A 2V26A 4JW1A 4AE4A 1ZHYA 2R7QA 3PHF2 2ZXWC 2NUTA 3LJBA 2Y3HA 1M2VB 3O39A 2ZXPA 2R7VA 3ECSA 4OIRF 2KNHA 5DS6A 2A68F 2W9YA 5KYWB 1ZHTA 1ZHZA 1D1AA 4G7HF 1M2VA 5L3VA 4B6IA 1ZHXA 1ZU4A 2HV6A 3SNHA 2CGEA 3HJCA 3LEVA 2I8BA 4IJJA 3ITFA 1FFHA 2XRHA 3EZHA 4PJLA 4QI2A 5FCLA 4F4BA 4KC9A 4LLEA 3F47A 2V3CC 1S7ZA 2IXMA 2WL8A 1VOMA 3OA1A 4DBRA 3K1HA 4KNVA 1ZHWA 4J30B 2ZXRA 5DQZA 1Z3IX 2EILC 4RBNA 1V55C 3Q7GA 3F46A 4CS9A 3RH3A 5KYXB 1VYIA 4YN0B 4MNDA 4C7OB 3HLZA 2FGYA 2OCCC 3NKDA 3DD7A 2EINC 1PCXA 4OD5A 4C7OA 3B9QA 1OCOC 2R7OA 1LS1A 2CNWD 3N2ZB 4PFPA 3LS1A 3CZ6A 2FFHA 3O6XA 4WJ0A 3KL4A 3NYLA 4G0HA 5EGYA 2IXPA 3DM5A 1ZU5A 2J9WA 2PX0A 4A2NB 4BEJA 4CS8C 4YWQA 3N24A 2J7PA 3EG9B 3CQZA 1N1CA 4CIHA 3GANA 3NKEA 4U5BE 4I44A 2DYRC 4I3MA 5DVWA 3V7OA 2XXAB 2G3KA 1PD0A 2IYLD 4H4KC 3ZVRA 1G8XA 1OCCC 2PX3A 2WZFA 2A1DD 2M4EA 2W4BA 2Y3GA 4XTKA 1V54C 3TD7A 4OIQF 3X2QC 3OEOA 3MLGA 3QMKA 3EH2A 4PFOA 4BJ5C 4BG0A 1QLEC 5E33A 3B0VC 4AX2A 3FAJA 2H7BA 1NU7D 5D92A 3DXJF 3K66A 5L3QA 2R7RA 4JURI 1TWAA 4MQ9F 1OCZC 4C3BA 4O7GA 5E3CA 4O6MA 2CW0F 3Q6MA 4LACB 3I5QA 2VH3A 4I1OB 2ZXOA 3DZAA 2HV7A 4HEAJ 1TR2A 4PJNA 3EHNA 3RKOF 1OKKD 3UMKA 2D5RB 3JYHA 4PJMA 4CBEA 4HFFB 2P7VA 1FMVA 2WVNA 5E3AA 5T3TA 3POVA 1O5HA 2QY9A 2Y3BA 5D91A 4BJTA 1W2WA 4U5HA 2L9JA 3FHDA 3WODF 1D1CA 4Q5SF 5KYWA 2L81A 1MMAA 2DGJA 1VK5A 2R7UA 2CNWA 4U5EE 3JRTA 4ANJA 3SEOA 2R7WA 4BJ6A 4XWJA 3EHMA 2J9VA 2B0JA 4JZAA 4LERA 5CI8A 3K6BA 2W45A 3I5PA 1ZYRF 1TWHA 4K0DA 1BR1A 2MWQA 3B0PA 2WVOA 4KBLA 1ST6A 4OINF 3LLKA 1J8YF 2Q9AA 1M56C 3H65A 5F5FA 3LAYA 3Q7LA 4CS9C 3GODA 3AG1C 3FDQA 2YEVA 3DJNB 2A69F 2X51A 3T6JA 3Q6NA 4OD4A 4W8KA 2MYSA 4DBQA 5KYXA 1MNEA 4JJFA 3ABLC 4KNWA 2QTVA 4JVSA 2GFHA 2ZPAA 3LS0A 3ZIBA 3M1CB 3NRHA 4RDAA 2J45A 1O87A 1OCRC 1Z5ZA 4CSAC 5KYUB 3S27A 2WZGA 3EPVA 4YT2A 3ZC4A 3K1IC 4EBBA 5CI9A 2PF4E 2WVQA 5KYUA 4U5GA 3W2WA 4QDLA 1Z23A 2NUPB 3DMDA 2Q9BA 1MNDA 2Q9CA 1M57C 3AQBA 4ULWA 1VYKA 2EIKC 4PK4A 2IOQA 5HSWA 4OIOF 1D1BA 2YZSA 1SF8A 3EG9A 5E2QA 4J32B 2OG2A 5DS5A 1MMDA 1QZXA 1TWGA 4E7ZA 2YHSA 1MMGA 3PMRA 4HFKB 4CS8A 4G7OF 1D0YA 3K7DA 1MMNA 5EHHA 1OKKA 1SZIA 4YT5A 2VB6A 2XXAA 4KI2A 3EQLF 3LESA 3HTKC 3X1OA 2C03A 4P6IC 1BR4A 3EFOB 5T1DB 3EGDB 2JD3A 1RJ9B 2Y39A 1BR2A 2E87A 2R7TA 3EGXB 2G62A 3B0UX 3ASOC 5BUOA 4FESA 4BJ5A 3EGDA 3T4RA 3LNRA 5DLJA 1FTSA 3ABMC 1RJ9A 3AG2C 4IRUA 5T3WA 2Y3DA 4O6NA 4C3EA 2IXOA 4HE8D 5DS4A 2XSEA 3VAYA 3K33A 5KYYB 1KU2A 4RD9A 2NUTB 4G7ZF 1NU9C 1LKXA 3JCUQ 4LLCA 4IAOA 1M2OA 1SMYF 5B1BC 2NG1A 4QI0A 3L0IA 3ZSUA 4JJGA 5KYYA 3FVYA 5DQTA 2PP4A 3EH1A 3UGPA 2KJGA 1Z63A 4XLNF 3S0XA 4E7SA 3W8IA 4Q4ZF 4OIPF 2H7VC 3UR3C 3E70C 4BJ6C 4YT4A 2IXNA 1FMWA 4O6YA 2VASA 1D0ZA 2BE5F 3RYLA 3DM9B 3NYJA 2P6VA 4PJJA 1NG1A 4JCHA 3CSKA 3NDBB 4Q7CA 3AG3C 2J0WA 3N0TA 2J46A 1D0XA 2KGOA 3MX3A 4O79A 3UNGC 1PD1A 1Z6AA 2XL4A 3KH2A 4XLPF 5F5HA 2G3VA 2WB7A 4DVZA 2C04A 2PFDA 1WGWA 3JSZA 3SP1A 3DAGA 4DVYP 3WG7C 2KQ9A 3EZIA 1JPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LS1 A;  3RFY A;  2MWQ A;  3LS0 A;  1NZE A;  3JCU Q;  1VYK A;  3ZSU A; 
#chains in the Genus database with same CATH topology
 4U5F E;  2Q3T A;  4ZLD A;  1U89 A;  1QPU A;  3SYN A;  4BJ1 A;  3LLI A;  4CDY A;  3V5Y A;  3JT1 A;  4PAC A;  3RW0 A;  1OW8 A;  3EZI A;  3W8H A;  4ZLC A;  2A6E F;  1TWC A;  2NPU A;  2AP3 A;  2H7O A;  3QZC A;  4K7B A;  4U5D E;  3C8Z A;  2XL8 A;  3S29 A;  4XQ1 A;  3T6G B;  4DOZ A;  1Q0K A;  2LFF A;  2LD6 A;  3UMI A;  1E85 A;  2GAQ A;  2WZL A;  3DAF A;  3NG1 A;  4U9D A;  1EQ1 A;  3A11 A;  1JPN A;  5IY5 C;  3S90 A;  3A9C A;  4M63 A;  3GM3 A;  1IZM A;  2HSB A;  4CSA A;  4YT8 A;  2DYS C;  1YDI A;  4I1M A;  1LM3 B;  1YZA A;  3AQC A;  3C62 A;  4C3D A;  5JRA A;  3C7J A;  4IWB A;  1CGM E;  4NY3 A;  1J8M F;  4D4X A;  4AK9 A;  3K1I A;  1GGQ A;  3RQG A;  3ZG1 A;  3IEE A;  2L6F A;  3SXY A;  2JPU A;  4FX5 A;  2NUP A;  3MFN A;  4NQF A;  4BEM J;  1E86 A;  3L34 A;  2HS5 A;  1YA9 A;  3C8G B;  3E9V A;  2R7S A;  2O9X A;  1HMD A;  2R7X A;  1FFT C;  4FWV A;  3TQO A;  1OW7 A;  1YJG A;  1TKN A;  4U5C E;  5COG A;  3JSE O;  1V74 B;  2KW3 C;  1U6H A;  2J9U A;  2YLD A;  3RFY A;  2XS1 A;  2HMZ A;  2W4M A;  1QQ3 A;  4MVO A;  2CDQ A;  3T6B A;  3PCV A;  3ZQY A;  2YLI A;  5GPG B;  3VYW A;  5K0I A;  2HJ3 A;  3C8G A;  3KKB A;  3ASN C;  4IAR A;  3U9M A;  1L7C A;  4H54 A;  2OEX A;  3I4U A;  3ABK C;  1QVX A;  3J06 A;  4EWC A;  3GWL A;  4YJW A;  4NTF A;  5B1A C;  1A41 A;  3RVY A;  1T6U A;  2OEV A;  4LDK A;  2LSE A;  4XPY A;  3S28 A;  1LVK A;  1T6I A;  3DI5 A;  3UGO A;  3DJU B;  3GM1 A;  3L8J A;  5AC5 A;  4J7T A;  2EIJ C;  1NZE A;  4MVQ A;  3IHU A;  3OWT A;  5B3S C;  1C02 A;  1VMA A;  3US6 A;  4EHP A;  2Y69 C;  1BZ4 A;  4X0R A;  5KYN A;  3W2V A;  3KMI A;  3KPH A;  2A6H F;  3SXZ A;  3JYY A;  2XLV A;  2OU6 A;  2EIM C;  3SZR A;  1Q0G A;  3EFO A;  3BRJ A;  3ZTZ A;  2J0X A;  2EPL X;  5TJ5 E;  3PDM P;  1A7E A;  1LE4 A;  1H7I A;  1V4A A;  1IW7 F;  2J7P D;  3EJN A;  2XS8 A;  2Z15 A;  5COF A;  3NYM A;  3RIP A;  3EGX A;  4AE4 B;  1CGO A;  3VM6 A;  2KYH A;  3AG4 C;  3DE8 A;  4GYT A;  4N06 A;  1JAF A;  4E0H A;  2HJM A;  4XEF A;  3UMH A;  4GEH A;  1NLX A;  4CS7 A;  2V26 A;  4JW1 A;  1T5O A;  2HKV A;  3B29 A;  1A0B A;  2P61 A;  4AE4 A;  1FNT c;  4MVZ A;  1ZHY A;  3G50 A;  1Q0F A;  1YLM A;  2R7Q A;  3L8I A;  3TK0 A;  1E84 A;  2ZXW C;  2NUT A;  3PHF 2;  3LJB A;  2Y3H A;  1WN0 A;  1M2V B;  4CDA A;  3O39 A;  1VLS A;  1H9G A;  2PNO A;  4E18 A;  1WAT A;  2ZXP A;  2R7V A;  4WGY A;  3ECS A;  1ORY A;  4OIR F;  2KNH A;  4MW8 A;  2XM4 A;  3QVY A;  5DS6 A;  2MHR A;  2A68 F;  2LP4 A;  2W9Y A;  5KYW B;  1ORS C;  3ZTM A;  1ZHT A;  4DRJ B;  1ZHZ A;  1D1A A;  5L0J A;  4G7H F;  3MYF A;  3L1M A;  1M2V A;  5L3V A;  3M4C A;  4B6I A;  3AOU A;  3VRC A;  2OOC A;  1LI7 A;  1ZHX A;  1ZU4 A;  3IQ6 A;  3WHN A;  2QUP A;  2HV6 A;  3SNH A;  3U2M A;  2CGE A;  3HJC A;  5JVE A;  3S84 A;  1FR0 A;  3LEV A;  1TFO B;  2I8B A;  4IJJ A;  3ITF A;  1FFH A;  2XRH A;  3EZH A;  4PJL A;  2P0N A;  3U8V A;  3U2L A;  5HV9 A;  4QI2 A;  3GWN A;  1OW6 A;  5FCL A;  1JRA A;  4F4B A;  1YZC A;  1JR8 A;  4MVR A;  3AGU A;  4KC9 A;  4LLE A;  3F47 A;  2V3C C;  3DWW A;  4EKW A;  1S7Z A;  3MBG A;  3IQC A;  2IXM A;  2YL7 A;  2WL8 A;  1VOM A;  3OA1 A;  5JSL A;  4DBR A;  3K1H A;  1HMO A;  1AEP A;  4KNV A;  3TUL A;  1ZHW A;  2RD9 A;  4J30 B;  1HW2 A;  2ZXR A;  5DQZ A;  1Z3I X;  5A6B D;  3LUT B;  2EIL C;  3FOP A;  1V55 C;  4RBN A;  2HUJ A;  3Q7G A;  3F46 A;  4CS9 A;  3RH3 A;  5BQH A;  1I5N A;  5KYX B;  1VYI A;  4YN0 B;  4MND A;  5F28 E;  3V5X A;  2UUH A;  3HLZ A;  1ORJ A;  2FGY A;  4C7O B;  3G4X A;  2YVK A;  1T9K A;  2OCC C;  3NKD A;  4MS2 A;  1KNY A;  4YL1 A;  3DD7 A;  2EPM X;  2EIN C;  1OXK A;  1PCX A;  4OD5 A;  2H8A A;  2LIG A;  4C7O A;  3B9Q A;  3QW1 A;  4NTB A;  3R2P A;  1OCO C;  2R7O A;  1LS1 A;  2CNW D;  3N2Z B;  1TQG A;  5A69 A;  4PFP A;  4UDV A;  2M64 A;  3LS1 A;  4R32 A;  2GA0 A;  5BQG A;  3CZ6 A;  4MVS A;  2FFH A;  3O6X A;  1M6T A;  5A6A A;  4WJ0 A;  1WOL A;  4W8P A;  3JRM O;  5AGF A;  3KL4 A;  4JC7 A;  5JS5 A;  1YVI A;  1ZW3 A;  2AVK A;  3NYL A;  4G0H A;  4ULV A;  5BQI A;  5EGY A;  2IXP A;  2YL3 A;  3DM5 A;  1AUE A;  1ZU5 A;  2J9W A;  2PX0 A;  3FXH A;  4A2N B;  4BEJ A;  4CS8 C;  4YWQ A;  3N24 A;  2J7P A;  1B68 A;  3EG9 B;  1T01 A;  1SYQ A;  1VTM P;  3CQZ A;  2OJE D;  1N1C A;  3O55 A;  4CIH A;  3GAN A;  3NKE A;  3U5S A;  4FAP B;  4PR9 A;  4U5B E;  4I44 A;  4DRH B;  2I15 A;  2DYR C;  2R9R B;  4I3M A;  2BL2 A;  1ZW2 A;  5L0D A;  1HY5 A;  1LI5 A;  5DVW A;  3V7O A;  2XXA B;  2G3K A;  4XPW A;  1NFO A;  1PD0 A;  2IYL D;  4H4K C;  2BC5 A;  1LPE A;  2GDC A;  3ZVR A;  1G8X A;  1OCC C;  2PX3 A;  1K05 A;  5COM A;  1UG7 A;  5CIV A;  2WZF A;  3B71 A;  3HNJ A;  2A1D D;  1WWP A;  3AGT A;  3S9O A;  3TJ5 A;  4WGZ A;  4EIY A;  2M4E A;  2W4B A;  2Y3G A;  1DOW A;  2LFD A;  4P9T A;  4XTK A;  4JE9 A;  4LDR A;  2TMV P;  2YL1 A;  3QVZ A;  5FZT A;  1V54 C;  3TD7 A;  1Y4C A;  1Z7Q c;  4OIQ F;  3X2Q C;  2YLG A;  2XLD A;  3OEO A;  3MLG A;  3T9O A;  3TJ6 A;  1APC A;  5EK0 A;  2P1A A;  1Q0D A;  4DJ9 A;  3QMK A;  3EH2 A;  4PFO A;  3U8P A;  2CYD A;  4BG0 A;  1QLE C;  4N6C A;  2J8W A;  3TOM A;  4BJ5 C;  3VF0 A;  4JEB A;  5E33 A;  3ZDL A;  3B0V C;  2NSG A;  4AX2 A;  3FAJ A;  2H7B A;  1NU7 D;  5D92 A;  1E83 A;  3DXJ F;  3DE9 A;  2LK4 A;  3GOR A;  1VLT A;  3K66 A;  2EPN A;  4JUR I;  5L3Q A;  2R7R A;  1TWA A;  4MQ9 F;  1OCZ C;  2R02 A;  3M15 A;  3U3B A;  4C3B A;  1NBB A;  4O7G A;  4CJG A;  5E3C A;  1YYX A;  4O6M A;  2CW0 F;  3HKK A;  3Q6M A;  4LAC B;  3SXM A;  3I5Q A;  3RQE A;  3R7C A;  1H9T A;  3QW0 A;  2VH3 A;  2AU5 A;  2HFI A;  2ZXO A;  4I1O B;  3DZA A;  2HV7 A;  4HEA J;  2XLM A;  1TR2 A;  4PJN A;  3EHN A;  3NMI A;  3RKO F;  2JX0 A;  1OR2 A;  1OKK D;  3UMK A;  4E0I A;  5A6B A;  2D5R B;  3DKA A;  1RKE B;  1QSP A;  3JYH A;  4PJM A;  3CAX A;  4CBE A;  4CDV A;  4HFF B;  2HSQ A;  3HNK A;  2P7V A;  1FMV A;  3C18 A;  4NTA A;  4G78 A;  4N4W A;  5L0F A;  3U0C A;  2KK1 A;  1U0B B;  2WVN A;  1I4Y A;  4EBK A;  5E3A A;  4L6R A;  5T3T A;  4YL0 A;  3POV A;  3LEO A;  3GM2 A;  1O5H A;  2CCY A;  1NFN A;  4ONS A;  2QY9 A;  2Y3B A;  4K1O A;  4DRI B;  4DXW A;  1VB5 A;  5D91 A;  1W2W A;  4U5H A;  4BJT A;  4D4N A;  2L9J A;  3NMK A;  3FHD A;  3WOD F;  1AVO B;  1D1C A;  1ZZP A;  2ASR A;  4CJO A;  2L81 A;  5KYW A;  4Q5S F;  1MMA A;  2DGJ A;  2IBF A;  4MTO A;  1VK5 A;  4BPM A;  5A6J A;  2R7U A;  1WAS A;  2CNW A;  4U5E E;  1K04 A;  3JRT A;  4ANJ A;  4NCQ A;  3SEO A;  3O10 A;  4XWJ A;  4BJ6 A;  2R7W A;  3BEH A;  3EHM A;  2J9V A;  2B0J A;  2DI3 A;  2ICW G;  4JZA A;  2VCB A;  1G4W R;  4LER A;  2XL6 A;  1T6Q A;  5CI8 A;  2F22 A;  3K6B A;  5L0G A;  2W45 A;  3I5P A;  1ZYR F;  1TWH A;  4K0D A;  2ZD9 A;  1BR1 A;  2MWQ A;  1Q0M A;  3B0P A;  1HW1 A;  3C63 A;  2WVO A;  5L0H A;  4MTG A;  1RCP A;  1XZQ A;  4KBL A;  1ST6 A;  4OIN F;  3LLK A;  4WAB A;  4ER9 A;  1J8Y F;  4AL0 A;  2Q9A A;  2FAP B;  1M56 C;  2LCH A;  3H65 A;  5F5F A;  1YA7 O;  3LAY A;  3Q7L A;  4CS9 C;  3GOD A;  3AG1 C;  2EPO A;  5A6K A;  3FDQ A;  2VC9 A;  2YEV A;  4GQH A;  4N6H A;  3DJN B;  2A69 F;  2X51 A;  1Y6D A;  3T6J A;  3Q6N A;  4OD4 A;  4W8K A;  2MYS A;  1H6G A;  2D4U A;  3H2U A;  1MNE A;  3QTH A;  4JJF A;  3ABL C;  4KNW A;  4DBQ A;  2QTV A;  4JVS A;  2GFH A;  2ZPA A;  3LS0 A;  2QNL A;  2YKZ A;  3M1C B;  1A7D A;  3RF3 A;  3ZIB A;  1F1M A;  3NRH A;  4RDA A;  5L0I A;  1UFB A;  3U3F A;  2J45 A;  2VCA A;  4CX9 A;  1O87 A;  1OCR C;  1Z5Z A;  2DB4 A;  3IPM O;  4JEA A;  4CSA C;  4IB4 A;  2OJQ A;  2AWY A;  5KYU B;  2L6H A;  2UUI A;  3S27 A;  3U9J A;  2IM8 A;  2R05 A;  2WZG A;  3ATP A;  3EPV A;  3M4B A;  3ZC4 A;  4YT2 A;  3K1I C;  4EBB A;  4U9E A;  3KYI A;  2L7A A;  2EPK X;  256B A;  2KC3 A;  5CI9 A;  2HMQ A;  3FAP B;  3IQ5 A;  5AC4 A;  2OKU A;  2PF4 E;  2WVQ A;  5KYU A;  4JKV A;  5L0C A;  4U5G A;  3W2W A;  4IGG A;  1Z23 A;  4QDL A;  3GEE A;  4JTD B;  2NUP B;  3DMD A;  2Q9B A;  1MND A;  2Q9C A;  1M57 C;  1NSG B;  2ETS A;  3AQB A;  1YYJ A;  4ULW A;  2XLH A;  1VYK A;  4LDQ A;  2EIK C;  4PK4 A;  2IOQ A;  5HSW A;  1L3P A;  4OIO F;  1D1B A;  2YZS A;  2KSF A;  1SF8 A;  1YAR O;  3EG9 A;  5E2Q A;  4J32 B;  2OG2 A;  5DS5 A;  1MMD A;  1KTM A;  1QZX A;  1TWG A;  3M79 A;  4E7Z A;  2YHS A;  3GEI A;  1MMG A;  3PMR A;  1XZP A;  2B0H A;  4HFK B;  4CS8 A;  1D0Y A;  4E17 A;  1EA8 A;  4G7O F;  3K7D A;  1MMN A;  4Z9I A;  4AL1 A;  1OKK A;  5EHH A;  1SZI A;  2YRF A;  1JMW A;  3SXK A;  4MVM A;  1GS9 A;  4YT5 A;  2VB6 A;  2XXA A;  4YK5 A;  3WAQ A;  2YL0 A;  3CEX A;  2A0B A;  4KI2 A;  1LS4 A;  3EQL F;  1HE9 A;  3HTK C;  3LES A;  4J7Y A;  5B3I A;  3X1O A;  2C03 A;  2J9B A;  2XLW A;  4MVU A;  1RKC A;  3KYJ A;  4P6I C;  1RMV A;  2Q7R A;  3HNI A;  1G4U S;  1LIH A;  1I4Z A;  4Z9H A;  4EBJ A;  1GM5 A;  4A4A A;  1BR4 A;  3HNL A;  1BBH A;  1A7V A;  3EFO B;  3LNM B;  2HZ8 A;  2LQG A;  5T1D B;  2L6G A;  3EGD B;  4NC3 A;  2JD3 A;  3ZQV A;  1RJ9 B;  2Y39 A;  1BR2 A;  4XEV A;  1HE1 A;  2E87 A;  2R7T A;  3EGX B;  2XM0 A;  2G62 A;  3FMS A;  3B0U X;  3ASO C;  5BUO A;  2RSE B;  4FES A;  2GWW A;  4BJ5 A;  3AJM A;  3EGD A;  3T4R A;  3H2V A;  3LNR A;  4EUK B;  5JUA A;  3GEH A;  5DLJ A;  1FTS A;  3ABM C;  1FAP B;  1RJ9 A;  3AG2 C;  4IRU A;  1ZVZ A;  5T3W A;  2Y3D A;  4O6N A;  1O3U A;  4C3E A;  2IXO A;  4HE8 D;  2AWC A;  1BDJ B;  5DS4 A;  2XSE A;  1PV3 A;  3K33 A;  3V5Z A;  3VAY A;  3C8G D;  1G5Z A;  1KU2 A;  2PBE A;  4RD9 A;  5KYY B;  2NUT B;  4XPX A;  2QE9 A;  1NU9 C;  1XWJ A;  1LKX A;  5JLI A;  3JCU Q;  4G7Z F;  1SR2 A;  4LLC A;  4CIP A;  1C03 A;  4IAO A;  1RKE A;  4MW3 A;  1M2O A;  1SMY F;  2QLA A;  2YWA A;  5B1B C;  3JTL O;  4YL3 A;  1CPQ A;  2NG1 A;  4QI0 A;  3IQT A;  3L0I A;  4JJG A;  3ZSU A;  5KYY A;  1CGN A;  1R5I D;  2R03 A;  3FVY A;  5DQT A;  1GQA A;  2PP4 A;  3EH1 A;  3UGP A;  3ZWI A;  2KJG A;  4JIO A;  1Z63 A;  4XLN F;  3S0X A;  1DOV A;  2YQY A;  4E7S A;  2VCC A;  3W8I A;  3FOO A;  4Q4Z F;  4OIP F;  1JOG A;  2X0C A;  5KYX A;  2NSF A;  2H7V C;  3UR3 C;  3E70 C;  4BJ6 C;  4Z9J A;  4YT4 A;  2IXN A;  1OXB A;  1EI7 A;  1FMW A;  4XEK A;  4O6Y A;  1EKY A;  1WTY A;  2VAS A;  1D0Z A;  2BE5 F;  3RYL A;  4IAQ A;  1YAU O;  3DM9 B;  4JTC B;  3NYJ A;  1C17 M;  2P6V A;  2Q00 A;  4PJJ A;  1NG1 A;  1K40 A;  4JCH A;  3RVZ A;  1LE2 A;  3CSK A;  3NDB B;  4Q7C A;  3AG3 C;  1OQC A;  2J0W A;  3JZ0 A;  1QKR A;  2J46 A;  3MYI A;  1D0X A;  2KGO A;  3MX3 A;  3N0T A;  4O79 A;  3TOL A;  2Q4F A;  1PD1 A;  4JRZ A;  1Z6A A;  5JP7 A;  3UNG C;  1S05 A;  1CPR A;  1OR3 A;  3G4Z A;  1MQV A;  4MTF A;  2XL4 A;  3KH2 A;  1TFK B;  2XLE A;  5F5H A;  4XLP F;  5JT4 A;  2G3V A;  2WB7 A;  4DVZ A;  1R4T A;  2C04 A;  3NMJ A;  4JCZ A;  3RQF A;  3W4Y A;  2OQM A;  1WGW A;  2PFD A;  2R25 A;  2A0U A;  2XLO A;  3JSZ A;  4JTA B;  3SP1 A;  3DAG A;  4DVY P;  3WG7 C;  2KQ9 A;  1RXQ A;  4P9F A;  1E2X A;  1JPJ A; 
#chains in the Genus database with same CATH homology
 4U5F E;  2Q3T A;  4ZLD A;  3SYN A;  4BJ1 A;  3LLI A;  3JT1 A;  3W8H A;  4ZLC A;  2A6E F;  1TWC A;  2H7O A;  3QZC A;  4K7B A;  4U5D E;  3S29 A;  4DOZ A;  3UMI A;  2WZL A;  3DAF A;  3NG1 A;  1JPN A;  5IY5 C;  4M63 A;  1IZM A;  4CSA A;  4YT8 A;  2DYS C;  4I1M A;  3AQC A;  4C3D A;  4IWB A;  4NY3 A;  1J8M F;  4AK9 A;  3ZG1 A;  3IEE A;  4FX5 A;  2NUP A;  3L34 A;  3E9V A;  2R7S A;  2O9X A;  2R7X A;  1FFT C;  4FWV A;  4U5C E;  1TKN A;  2KW3 C;  2J9U A;  3RFY A;  2W4M A;  2CDQ A;  3T6B A;  3VYW A;  3KKB A;  3ASN C;  3I4U A;  3ABK C;  4EWC A;  4YJW A;  5B1A C;  2LSE A;  3S28 A;  1LVK A;  3UGO A;  3DJU B;  2EIJ C;  1NZE A;  5B3S C;  3OWT A;  1VMA A;  2Y69 C;  4X0R A;  5KYN A;  3W2V A;  3KMI A;  2A6H F;  3SZR A;  2EIM C;  3EFO A;  2J0X A;  3RIP A;  2J7P D;  1IW7 F;  3EJN A;  2Z15 A;  3NYM A;  3EGX A;  4AE4 B;  3AG4 C;  4GYT A;  4N06 A;  3UMH A;  4GEH A;  4CS7 A;  2V26 A;  4JW1 A;  4AE4 A;  1ZHY A;  2R7Q A;  3PHF 2;  2ZXW C;  2NUT A;  3LJB A;  2Y3H A;  1M2V B;  3O39 A;  2ZXP A;  2R7V A;  3ECS A;  4OIR F;  2KNH A;  5DS6 A;  2A68 F;  2W9Y A;  5KYW B;  1ZHT A;  1ZHZ A;  1D1A A;  4G7H F;  1M2V A;  5L3V A;  4B6I A;  1ZHX A;  1ZU4 A;  2HV6 A;  3SNH A;  2CGE A;  3HJC A;  3LEV A;  2I8B A;  4IJJ A;  3ITF A;  1FFH A;  2XRH A;  3EZH A;  4PJL A;  4QI2 A;  5FCL A;  4F4B A;  4KC9 A;  4LLE A;  3F47 A;  2V3C C;  1S7Z A;  2IXM A;  2WL8 A;  1VOM A;  3OA1 A;  4DBR A;  3K1H A;  4KNV A;  1ZHW A;  4J30 B;  2ZXR A;  5DQZ A;  1Z3I X;  2EIL C;  4RBN A;  1V55 C;  3Q7G A;  3F46 A;  4CS9 A;  3RH3 A;  5KYX B;  1VYI A;  4YN0 B;  4MND A;  4C7O B;  3HLZ A;  2FGY A;  2OCC C;  3NKD A;  3DD7 A;  2EIN C;  1PCX A;  4OD5 A;  4C7O A;  3B9Q A;  1OCO C;  2R7O A;  1LS1 A;  2CNW D;  3N2Z B;  4PFP A;  3LS1 A;  3CZ6 A;  2FFH A;  3O6X A;  4WJ0 A;  3KL4 A;  3NYL A;  4G0H A;  5EGY A;  2IXP A;  3DM5 A;  1ZU5 A;  2J9W A;  2PX0 A;  4A2N B;  4BEJ A;  4CS8 C;  4YWQ A;  3N24 A;  2J7P A;  3EG9 B;  3CQZ A;  1N1C A;  4CIH A;  3GAN A;  3NKE A;  4U5B E;  4I44 A;  2DYR C;  4I3M A;  5DVW A;  3V7O A;  2XXA B;  2G3K A;  1PD0 A;  2IYL D;  4H4K C;  3ZVR A;  1G8X A;  1OCC C;  2PX3 A;  2WZF A;  2A1D D;  2M4E A;  2W4B A;  2Y3G A;  4XTK A;  1V54 C;  3TD7 A;  4OIQ F;  3X2Q C;  3OEO A;  3MLG A;  3QMK A;  3EH2 A;  4PFO A;  4BJ5 C;  4BG0 A;  1QLE C;  5E33 A;  3B0V C;  4AX2 A;  3FAJ A;  2H7B A;  1NU7 D;  5D92 A;  3DXJ F;  3K66 A;  5L3Q A;  2R7R A;  4JUR I;  1TWA A;  4MQ9 F;  1OCZ C;  4C3B A;  4O7G A;  5E3C A;  4O6M A;  2CW0 F;  3Q6M A;  4LAC B;  3I5Q A;  2VH3 A;  4I1O B;  2ZXO A;  3DZA A;  2HV7 A;  4HEA J;  1TR2 A;  4PJN A;  3EHN A;  3RKO F;  1OKK D;  3UMK A;  2D5R B;  3JYH A;  4PJM A;  4CBE A;  4HFF B;  2P7V A;  1FMV A;  2WVN A;  5E3A A;  5T3T A;  3POV A;  1O5H A;  2QY9 A;  2Y3B A;  5D91 A;  4BJT A;  1W2W A;  4U5H A;  2L9J A;  3FHD A;  3WOD F;  1D1C A;  4Q5S F;  5KYW A;  2L81 A;  1MMA A;  2DGJ A;  1VK5 A;  2R7U A;  2CNW A;  4U5E E;  3JRT A;  4ANJ A;  3SEO A;  2R7W A;  4BJ6 A;  4XWJ A;  3EHM A;  2J9V A;  2B0J A;  4JZA A;  4LER A;  5CI8 A;  3K6B A;  2W45 A;  3I5P A;  1ZYR F;  1TWH A;  4K0D A;  1BR1 A;  2MWQ A;  3B0P A;  2WVO A;  4KBL A;  1ST6 A;  4OIN F;  3LLK A;  1J8Y F;  2Q9A A;  1M56 C;  3H65 A;  5F5F A;  3LAY A;  3Q7L A;  4CS9 C;  3GOD A;  3AG1 C;  3FDQ A;  2YEV A;  3DJN B;  2A69 F;  2X51 A;  3T6J A;  3Q6N A;  4OD4 A;  4W8K A;  2MYS A;  4DBQ A;  5KYX A;  1MNE A;  4JJF A;  3ABL C;  4KNW A;  2QTV A;  4JVS A;  2GFH A;  2ZPA A;  3LS0 A;  3ZIB A;  3M1C B;  3NRH A;  4RDA A;  2J45 A;  1O87 A;  1OCR C;  1Z5Z A;  4CSA C;  5KYU B;  3S27 A;  2WZG A;  3EPV A;  4YT2 A;  3ZC4 A;  3K1I C;  4EBB A;  5CI9 A;  2PF4 E;  2WVQ A;  5KYU A;  4U5G A;  3W2W A;  4QDL A;  1Z23 A;  2NUP B;  3DMD A;  2Q9B A;  1MND A;  2Q9C A;  1M57 C;  3AQB A;  4ULW A;  1VYK A;  2EIK C;  4PK4 A;  2IOQ A;  5HSW A;  4OIO F;  1D1B A;  2YZS A;  1SF8 A;  3EG9 A;  5E2Q A;  4J32 B;  2OG2 A;  5DS5 A;  1MMD A;  1QZX A;  1TWG A;  4E7Z A;  2YHS A;  1MMG A;  3PMR A;  4HFK B;  4CS8 A;  4G7O F;  1D0Y A;  3K7D A;  1MMN A;  5EHH A;  1OKK A;  1SZI A;  4YT5 A;  2VB6 A;  2XXA A;  4KI2 A;  3EQL F;  3LES A;  3HTK C;  3X1O A;  2C03 A;  4P6I C;  1BR4 A;  3EFO B;  5T1D B;  3EGD B;  2JD3 A;  1RJ9 B;  2Y39 A;  1BR2 A;  2E87 A;  2R7T A;  3EGX B;  2G62 A;  3B0U X;  3ASO C;  5BUO A;  4FES A;  4BJ5 A;  3EGD A;  3T4R A;  3LNR A;  5DLJ A;  1FTS A;  3ABM C;  1RJ9 A;  3AG2 C;  4IRU A;  5T3W A;  2Y3D A;  4O6N A;  4C3E A;  2IXO A;  4HE8 D;  5DS4 A;  2XSE A;  3VAY A;  3K33 A;  5KYY B;  1KU2 A;  4RD9 A;  2NUT B;  4G7Z F;  1NU9 C;  1LKX A;  3JCU Q;  4LLC A;  4IAO A;  1M2O A;  1SMY F;  5B1B C;  2NG1 A;  4QI0 A;  3L0I A;  3ZSU A;  4JJG A;  5KYY A;  3FVY A;  5DQT A;  2PP4 A;  3EH1 A;  3UGP A;  2KJG A;  1Z63 A;  4XLN F;  3S0X A;  4E7S A;  3W8I A;  4Q4Z F;  4OIP F;  2H7V C;  3UR3 C;  3E70 C;  4BJ6 C;  4YT4 A;  2IXN A;  1FMW A;  4O6Y A;  2VAS A;  1D0Z A;  2BE5 F;  3RYL A;  3DM9 B;  3NYJ A;  2P6V A;  4PJJ A;  1NG1 A;  4JCH A;  3CSK A;  3NDB B;  4Q7C A;  3AG3 C;  2J0W A;  3N0T A;  2J46 A;  1D0X A;  2KGO A;  3MX3 A;  4O79 A;  3UNG C;  1PD1 A;  1Z6A A;  2XL4 A;  3KH2 A;  4XLP F;  5F5H A;  2G3V A;  2WB7 A;  4DVZ A;  2C04 A;  2PFD A;  1WGW A;  3JSZ A;  3SP1 A;  3DAG A;  4DVY P;  3WG7 C;  2KQ9 A;  3EZI A;  1JPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...