1VYKA

Crystal structure of psbq protein of photosystem ii from higher plants
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
149
structure length
129
Chain Sequence
EARPIVVGPPPPLTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OXYGEN-EVOLVING ENHANCER PROTEIN 3
publication title The 1.49 A Resolution Crystal Structure of Psbq from Photosystem II of Spinacia Oleracea Reveals a Ppii Structure in the N-Terminal Region.
pubmed doi rcsb
molecule tags Photosystem ii
total genus 56
structure length 129
sequence length 149
ec nomenclature
pdb deposition date 2004-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1vykA00
3JCUQ 3LS1A 3LS0A 1VYKA 1NZEA 3RFYA 2MWQA 3ZSUA
chains in the Genus database with same CATH superfamily
1HE9A 4OD4A 1JPJA 1LPEA 1VTMP 2DYSC 3L1MA 2XXAA 1ST6A 4H4KC 1F1MA 4MTOA 3JT1A 2YWAA 1LVKA 2W45A 5JS5A 3KMIA 3ITFA 3OA1A 3B0VC 2YHSA 5JUAA 3SP1A 3BEHA 3Q7GA 3LS0A 2EPMX 4U5DE 5EHHA 2HSQA 1YAUO 2XS8A 4K1OA 4YWQA 2IXMA 3CSKA 3O39A 2CW0F 2XL4A 3RVZA 4Z9HA 1TWCA 3GODA 3B0PA 3FMSA 1T6IA 3G4ZA 4NQFA 2J46A 2J7PD 1CGNA 2MYSA 2E87A 1ORSC 2HV6A 3TD7A 1FAPB 4IARA 1M2OA 2J45A 2MHRA 3DXJF 1G8XA 2H7OA 1BZ4A 1W2WA 2CYDA 2R25A 1C02A 4CS8A 5B3SC 4OIPF 1RMVA 3H2VA 4DRHB 3C8GA 3DE9A 1QLEC 2LCHA 3KKBA 5JP7A 2PBEA 2LD6A 3MYIA 4LLCA 1D0YA 1PCXA 1VLTA 5FZTA 4EWCA 4F4BA 2V3CC 3OEOA 2LK4A 2YLDA 3JSEO 3NMJA 1H7IA 3DI5A 4JVSA 4XPXA 5HSWA 1OXBA 1UG7A 3GEHA 4MW8A 3RQGA 3ZTZA 5L3QA 4OIOF 2NUPB 3U2MA 1APCA 1YLMA 2AVKA 4E0IA 3FVYA 5E2QA 4Q4ZF 2QY9A 4H54A 4MW3A 4U5FE 1M6TA 3O10A 3ZDLA 1NZEA 2Y3HA 1EA8A 2IM8A 2VCCA 3KYJA 3TK0A 4E0HA 1A7DA 1U6HA 1HY5A 5KYWA 4PJJA 2CGEA 2P6VA 3EHMA 3M15A 3T6BA 1HW2A 1E2XA 1VYIA 3ZVRA 3HNLA 3GEEA 3K7DA 4AK9A 3TULA 2R7OA 3PDMP 2EILC 4ER9A 2R7WA 1IZMA 2OOCA 2XLDA 4JKVA 3N24A 1YDIA 1HMDA 1TKNA 4B6IA 2Q7RA 3U8VA 3JZ0A 4BJTA 4N4WA 1L3PA 3EZIA 1B68A 5B1BC 5KYUB 2XM4A 4A2NB 3O55A 3K1HA 3CZ6A 2I15A 4PJLA 4LACB 3SXKA 2R7TA 3DM9B 2L6HA 1Q0MA 1ORJA 3FOOA 3BRJA 4XEFA 1DOWA 1ZHTA 2B0JA 4YL3A 2FFHA 3IHUA 1AUEA 2J9WA 4NC3A 1ZVZA 2WVQA 2LFFA 4U9DA 1RKEB 1MNEA 3L8IA 1BDJB 2YQYA 2W9YA 1BR1A 1M2VB 5B3IA 1I4ZA 4MVOA 4EIYA 2RD9A 5JSLA 2AWYA 2HUJA 4WGYA 1FMWA 4CJOA 3AGUA 1K05A 1NBBA 1ZU5A 1ZZPA 2DGJA 4J30B 2GA0A 4FX5A 4KC9A 4U9EA 5L0IA 2ETSA 1GS9A 2LP4A 1BBHA 1T01A 2WZFA 4OIRF 4DBRA 1WTYA 4EBJA 4FESA 4HEAJ 4C3EA 2NUPA 4CS8C 1Z3IX 3ASOC 2M4EA 2QE9A 4U5EE 3X2QC 5DQZA 2EIKC 2AWCA 4NTBA 4EHPA 4UDVA 2YVKA 2A0BA 4EBKA 1JAFA 4CIPA 3WHNA 2YZSA 5KYYB 3U3FA 1KU2A 4HE8D 1ZW3A 2KQ9A 1ORYA 1OQCA 4XWJA 3S0XA 4XPWA 3ZQVA 3ZSUA 2XLEA 4OD5A 2Q3TA 4YK5A 1YA7O 2ZPAA 3JRTA 2YLIA 3A11A 4P9TA 3SXZA 2Y3DA 3GM1A 3S27A 2OJED 3NMIA 2PP4A 3ZIBA 3S90A 4WGZA 1O5HA 1IW7F 1NU7D 4QI2A 1OCCC 1OCZC 4YJWA 1YZCA 4JTDB 1LS1A 1TWHA 5DVWA 1V54C 4MVSA 4YT8A 1I4YA 2WB7A 3DD7A 5KYUA 2C03A 2KGOA 3MLGA 1JR8A 2DI3A 2A0UA 5TJ5E 2EPOA 3JSZA 2H8AA 4C7OB 3NKEA 3ZTMA 4WJ0A 2PFDA 2DB4A 5E33A 2X0CA 4C3DA 5D91A 2R7XA 5CI9A 2KW3C 3FHDA 4E7ZA 2BE5F 4DRIB 1TR2A 1D0ZA 2J9BA 3KPHA 4DXWA 1V55C 3ATPA 5L0CA 3OWTA 1C03A 3GWLA 1RKEA 3VYWA 3W8HA 2J9UA 3QMKA 4DOZA 5BQHA 3UGOA 2J0WA 1M2VA 3K33A 4GYTA 1T5OA 4PACA 1TWAA 3W8IA 1ZHXA 4FAPB 1ZW2A 2Q9AA 2WVNA 3NG1A 2P1AA 3EPVA 3QTHA 4JZAA 3HNJA 1LM3B 3DZAA 3RQEA 1OW6A 1WGWA 2R03A 2ICWG 3SYNA 2YL0A 3GEIA 3U5SA 4Q7CA 5EGYA 1HE1A 4J32B 1N1CA 1TQGA 2Y69C 2YRFA 3L34A 3QZCA 1YJGA 1J8MF 1D1BA 5COGA 3US6A 4PR9A 5KYYA 1M57C 1LE4A 1K04A 2R02A 3LAYA 2Y3GA 2WZGA 3ABMC 3AGTA 1VLSA 2IYLD 4XLNF 4BJ1A 3NDBB 1D1CA 4YT2A 1SR2A 2EPNA 2M64A 1LS4A 3KL4A 4RD9A 3ZC4A 1M56C 2A6HF 256BA 2OJQA 2Y3BA 1SYQA 4O6YA 1QSPA 1CGME 4PK4A 4ULVA 4D4XA 2EIMC 3AG3C 3I5PA 2PF4E 1NFOA 2XLOA 2V26A 3CEXA 2PX0A 4LLEA 1Z7Qc 5JRAA 1LE2A 5DS5A 4CBEA 3EFOB 2KYHA 3WG7C 1OR2A 4IWBA 3U3BA 1QQ3A 4N06A 2DYRC 4O7GA 5HV9A 3RVYA 4G7HF 2HJ3A 2Z15A 3A9CA 1MMDA 2J8WA 4GEHA 4X0RA 1A41A 2GAQA 1NFNA 3MX3A 4DJ9A 2W4MA 3MBGA 1E86A 3U0CA 3TOMA 1CPRA 5AGFA 3TJ5A 3K1IA 5L0DA 5COFA 3ABLC 1U89A 4O6NA 3B71A 5L3VA 2FAPB 2HZ8A 3QW0A 1T9KA 1YZAA 4JCHA 1OR3A 2AU5A 4KBLA 3H65A 5AC5A 2XL8A 3F47A 3AQBA 3AG2C 3DJUB 3AG4C 2EIJC 3B9QA 3IEEA 5IY5C 3QVYA 2J0XA 4LDQA 2WL8A 3ABKC 4JW1A 4BPMA 5T1DB 3AOUA 1OCRC 1A7EA 2O9XA 4NTFA 4IRUA 1Z23A 4JJGA 3R7CA 1WOLA 4Q5SF 4CSAA 2VC9A 4E7SA 2LIGA 1Y6DA 4W8KA 3T4RA 2L9JA 3RQFA 1G4US 2NUTB 5DS6A 1G4WR 3PHF2 5A69A 4FWVA 3K6BA 2XSEA 2RSEB 2HS5A 3S28A 4MQ9F 4PJNA 3VAYA 4G7OF 3EGXB 2L6GA 3ZWIA 3UMIA 5T3WA 5CI8A 3PCVA 1T6UA 4RBNA 1O3UA 3EHNA 3NMKA 4I44A 4MS2A 2VASA 1G5ZA 1MQVA 4RDAA 1UFBA 1XZPA 3TOLA 1XZQA 1WATA 4EUKB 1NSGB 5JLIA 2IXOA 1T6QA 2HV7A 3EFOA 1TFKB 4K7BA 4CJGA 2C04A 4AE4B 4YT4A 1VOMA 2XRHA 1LIHA 1FFTC 3EQLF 1KNYA 3VF0A 3G4XA 1YARO 4DRJB 4DVZA 2OQMA 3HLZA 3IQ5A 1SF8A 2Q9BA 3HJCA 3NRHA 5BUOA 3C8ZA 3LUTB 3WODF 3Q7LA 1E83A 3V5YA 1H6GA 2ZXOA 5A6KA 3POVA 3CQZA 1XWJA 2L6FA 3LNMB 3DAFA 3ZG1A 3HNIA 3W2VA 5AC4A 2WZLA 3K1IC 5D92A 1FNTc 4JRZA 3UR3C 3DM5A 2R7QA 4DBQA 1D0XA 4D4NA 1OXKA 1K40A 4LDKA 1BR2A 4P6IC 2VCAA 3S9OA 2R7RA 2P0NA 2R7UA 2NG1A 4JURI 1SMYF 3M4CA 4IAQA 4EKWA 1YYJA 4KNWA 4IGGA 1FMVA 1CPQA 4LERA 2A6EF 3EG9B 5BQIA 1YVIA 2BC5A 2OU6A 3HNKA 3IPMO 4P9FA 4U5BE 2NUTA 4JTAB 4LDRA 4OINF 3WAQA 3N2ZB 1GM5A 2H7VC 2KK1A 4OIQF 3V5XA 3FOPA 4CSAC 2OEVA 3EH2A 2IXPA 3EGXA 4MTFA 1S7ZA 4A4AA 1NU9C 2X51A 2W4BA 2R7SA 2QLAA 2GWWA 5GPGB 3RYLA 1R5ID 2Y39A 4YN0B 3RFYA 5L0FA 2Q4FA 1RXQA 5KYXB 1EQ1A 3FAJA 3C7JA 5E3AA 4EBBA 2A1DD 1JRAA 3NYMA 2NPUA 2VB6A 4ANJA 4AX2A 1MMAA 3M79A 4AE4A 1Z5ZA 4CDAA 1LKXA 3DAGA 4YL0A 1VYKA 1Q0GA 1JPNA 2MWQA 2Q9CA 3GWNA 4MNDA 4ZLCA 1Z63A 3SEOA 3B0UX 3DWWA 4BJ6A 4QI0A 4J7YA 1VB5A 4JE9A 2YL3A 3LS1A 4XQ1A 3T9OA 3NYLA 2QTVA 4G0HA 1QZXA 1E85A 2BL2A 3HTKC 3DMDA 2QUPA 1FR0A 2ZD9A 2L81A 1VMAA 2UUHA 3GM2A 3HKKA 2ZXRA 3LNRA 3C63A 2D4UA 2IBFA 2XS1A 2AP3A 3AJMA 3GORA 3JCUQ 4U5GA 2LSEA 3S29A 1KTMA 2HSBA 3U2LA 1A0BA 5JT4A 1QVXA 4O79A 3LEOA 1R4TA 4MVMA 2XM0A 5L0GA 2G62A 2VCBA 4U5HA 1Y4CA 4MVRA 3KYIA 4AL1A 1H9GA 1QKRA 1H9TA 3EG9A 2WVOA 3LLKA 3T6GB 3IQTA 1MMNA 2HFIA 2ZXWC 4IJJA 4U5CE 3V5ZA 1GQAA 3U8PA 3T6JA 5DQTA 4CDVA 3R2PA 1OCOC 1L7CA 1OW7A 2CNWD 4I1MA 5DS4A 2CDQA 1FFHA 4AL0A 4CIHA 2GFHA 1A7VA 4CS9A 1FTSA 3F46A 3K66A 2H7BA 3VRCA 1C17M 2L7AA 4BG0A 4J7TA 2PX3A 3W4YA 4E17A 2KNHA 5BQGA 3RF3A 2IXNA 2NSGA 5L0JA 2JD3A 1I5NA 1RCPA 2UUIA 2OCCC 3RH3A 3X1OA 2KC3A 2XLHA 1MMGA 5KYXA 1HMOA 2YL1A 4CS7A 4K0DA 3M4BA 1RJ9B 5CIVA 3J06A 2GDCA 2XLMA 3S84A 2NSFA 1OKKA 3O6XA 2JPUA 4JTCB 4BJ5A 2JX0A 1O87A 5B1AC 2OKUA 3RKOF 3LJBA 5JVEA 1WN0A 1Z6AA 4ULWA 2G3VA 3SZRA 4QDLA 4G7ZF 3MFNA 2R05A 2R7VA 4XEVA 1DOVA 1AEPA 3C62A 3Q6MA 2YEVA 4M63A 3B29A 3ZQYA 3C8GD 2YL7A 1NG1A 4MTGA 5A6AA 5E3CA 3C18A 2A68F 1JOGA 2EINC 2KSFA 3SXYA 1EI7A 2Q00A 4BJ6C 5DLJA 4ONSA 1BR4A 4NTAA 4YL1A 1ZU4A 5A6BA 1YYXA 4I1OB 3FDQA 2XLWA 1OW8A 1V4AA 4G78A 3AQCA 4L6RA 4Z9JA 4PJMA 2D5RB 2A69F 2CCYA 3MYFA 3QVZA 3TQOA 3UGPA 3LESA 4O6MA 2F22A 1Q0DA 3VM6A 1OKKD 3IQ6A 5FCLA 5KYNA 3Q6NA 3M1CB 2QNLA 3TJ6A 3DKAA 5A6JA 4ZLDA 4CDYA 3U9JA 3LEVA 1JMWA 3NYJA 4JEAA 4MVQA 1PD0A 1J8YF 2J9VA 2LQGA 3DJNB 3EGDB 3G50A 4R32A 2YLGA 2HJMA 3SNHA 3E70C 3JTLO 3UNGC 1LI7A 1E84A 1AVOB 3H2UA 4N6HA 3IQCA 1Q0KA 3GANA 4XTKA 4WABA 4MVZA 5K0IA 3JYYA 5COMA 4XPYA 5EK0A 2HKVA 4GQHA 3I5QA 2XXAB 3EH1A 3EJNA 3ASNC 1LI5A 3GM3A 4Z9IA 4E18A 3JRMO 2VH3A 3L8JA 3E9VA 5A6BD 3N0TA 1PV3A 1WASA 4W8PA 4CS9C 3NKDA 2B0HA 1GGQA 1Q0FA 3LLIA 1S05A 3RIPA 4BEJA 1RJ9A 1SZIA 4YT5A 2FGYA 3UMKA 1QPUA 3DE8A 1HW1A 4HFFB 4I3MA 4PFPA 5F5HA 2YKZA 2I8BA 2HMZA 1TFOB 5F28E 2XL6A 4MVUA 1CGOA 4JCZA 4NY3A 5T3TA 5F5FA 1RKCA 4KI2A 3V7OA 4BEMJ 1VK5A 2EPLX 4C3BA 4XLPF 1ZHZA 4BJ5C 1YA9A 4KNVA 3KH2A 4JEBA 4IB4A 3FXHA 3C8GB 4JJFA 4XEKA 2TMVP 3SXMA 2P7VA 1D1AA 3EZHA 2ZXPA 4NCQA 3RW0A 1MNDA 4IAOA 2LFDA 3CAXA 1V74B 2ASRA 2IOQA 2OEXA 4CX9A 1U0BB 2R9RB 1NLXA 3PMRA 2XLVA 4N6CA 4HFKB 2HMQA 1TWGA 2P61A 2PNOA 3FAPB 1ZHWA 2G3KA 2OG2A 3JYHA 3QW1A 4PFOA 3U9MA 3ECSA 5L0HA 3I4UA 2J7PA 2KJGA 4DVYP 4JC7A 3EGDA 1ZYRF 2CNWA 1PD1A 3UMHA 5KYWB 1EKYA 3L0IA 1ZHYA 1WWPA 3AG1C 4JIOA 3W2WA 2EPKX 4C7OA
chains in the Genus database with same CATH topology
4OD4A 1JPJA 2DYSC 2XXAA 1ST6A 4H4KC 3JT1A 1LVKA 2W45A 3KMIA 3ITFA 3OA1A 3B0VC 2YHSA 3SP1A 3Q7GA 3LS0A 4U5DE 5EHHA 4YWQA 2IXMA 3CSKA 3O39A 2CW0F 2XL4A 1TWCA 3GODA 3B0PA 2J46A 2J7PD 2MYSA 2E87A 2HV6A 3TD7A 1M2OA 2J45A 1G8XA 2H7OA 1W2WA 5B3SC 4CS8A 4OIPF 3KKBA 1QLEC 4LLCA 1D0YA 1PCXA 4F4BA 2V3CC 4EWCA 3OEOA 4JVSA 5HSWA 5L3QA 4OIOF 2NUPB 3FVYA 5E2QA 4Q4ZF 2QY9A 4U5FE 1NZEA 2Y3HA 5KYWA 4PJJA 2CGEA 2P6VA 3EHMA 3T6BA 1VYIA 3ZVRA 4AK9A 3K7DA 2R7OA 2R7WA 2EILC 1IZMA 3N24A 1TKNA 4B6IA 4BJTA 3EZIA 5B1BC 5KYUB 4A2NB 3K1HA 3CZ6A 4PJLA 4LACB 2R7TA 3DM9B 1ZHTA 2B0JA 2FFHA 2J9WA 2WVQA 1MNEA 2W9YA 1BR1A 1M2VB 1FMWA 1ZU5A 2DGJA 4J30B 4KC9A 4FX5A 4DBRA 2WZFA 4OIRF 4FESA 4HEAJ 4C3EA 2NUPA 4CS8C 1Z3IX 3ASOC 2M4EA 4U5EE 3X2QC 2R7SA 5DQZA 2EIKC 5KYYB 2YZSA 1KU2A 4HE8D 2KQ9A 4XWJA 3ZSUA 4OD5A 2Q3TA 2ZPAA 3JRTA 2Y3DA 3S27A 2PP4A 3ZIBA 1O5HA 1IW7F 1NU7D 4QI2A 1OCCC 1OCZC 4YJWA 1LS1A 1TWHA 5DVWA 1V54C 4YT8A 2WB7A 3DD7A 5KYUA 2C03A 2KGOA 3MLGA 3JSZA 3NKEA 4WJ0A 2PFDA 5E33A 4C3DA 5D91A 2R7XA 5CI9A 2KW3C 3FHDA 4E7ZA 2BE5F 1TR2A 1D0ZA 1V55C 3OWTA 3VYWA 3W8HA 2J9UA 3QMKA 4DOZA 3UGOA 2J0WA 1M2VA 3K33A 4GYTA 1TWAA 3W8IA 1ZHXA 2Q9AA 2WVNA 3NG1A 3EPVA 4JZAA 3DZAA 3SYNA 1WGWA 4Q7CA 5EGYA 4J32B 1N1CA 2Y69C 3L34A 3QZCA 5KYYA 1J8MF 1D1BA 1M57C 3LAYA 2Y3GA 2WZGA 3ABMC 4XLNF 4BJ1A 2IYLD 3NDBB 1D1CA 4YT2A 3KL4A 3ZC4A 4RD9A 1M56C 2A6HF 2Y3BA 4O6YA 4PK4A 2EIMC 3AG3C 3I5PA 2PF4E 2V26A 4LLEA 2PX0A 5DS5A 4CBEA 3EFOB 3WG7C 4IWBA 4N06A 2DYRC 4O7GA 4G7HF 2Z15A 4GEHA 1MMDA 4X0RA 3MX3A 2W4MA 3ABLC 4O6NA 5L3VA 4JCHA 4KBLA 3H65A 3F47A 3AQBA 3IEEA 3DJUB 3AG2C 2EIJC 3AG4C 3B9QA 5IY5C 2J0XA 2WL8A 3ABKC 4JW1A 5T1DB 1OCRC 2O9XA 4IRUA 1Z23A 4JJGA 4Q5SF 4CSAA 4E7SA 4W8KA 3T4RA 2L9JA 2NUTB 5DS6A 3PHF2 4FWVA 3K6BA 2XSEA 3S28A 4MQ9F 4PJNA 3VAYA 4G7OF 3EGXB 3UMIA 5T3WA 5CI8A 4RBNA 3EHNA 4I44A 2VASA 4RDAA 2IXOA 2HV7A 3EFOA 4K7BA 2C04A 4AE4B 4YT4A 1VOMA 2XRHA 3EQLF 1FFTC 4DVZA 3HLZA 3NRHA 1SF8A 2Q9BA 3HJCA 5BUOA 3WODF 3Q7LA 2ZXOA 3POVA 3CQZA 3DAFA 3ZG1A 3W2VA 2WZLA 3K1IC 5D92A 3UR3C 3DM5A 2R7QA 4DBQA 1D0XA 1BR2A 4P6IC 2R7RA 2R7UA 2NG1A 4JURI 1SMYF 4KNWA 1FMVA 4LERA 2A6EF 3EG9B 4U5BE 2NUTA 4OINF 3N2ZB 2H7VC 4OIQF 4CSAC 3EH2A 2IXPA 3EGXA 1S7ZA 1NU9C 2X51A 2W4BA 3RYLA 2Y39A 4YN0B 3RFYA 5KYXB 3FAJA 5E3AA 4EBBA 2A1DD 3NYMA 2VB6A 4ANJA 4AX2A 1MMAA 4AE4A 1Z5ZA 1LKXA 3DAGA 1VYKA 2Q9CA 1JPNA 2MWQA 4MNDA 4ZLCA 1Z63A 3SEOA 3B0UX 4BJ6A 4QI0A 3LS1A 3NYLA 2QTVA 4G0HA 1QZXA 3HTKC 3DMDA 2L81A 1VMAA 2ZXRA 3LNRA 4U5GA 3S29A 3JCUQ 2LSEA 4O79A 2G62A 4U5HA 3EG9A 2WVOA 3LLKA 1MMNA 2ZXWC 4IJJA 4U5CE 5DQTA 3T6JA 1OCOC 4I1MA 2CNWD 5DS4A 2CDQA 1FFHA 4CIHA 2GFHA 4CS9A 1FTSA 3F46A 3K66A 2H7BA 4BG0A 2PX3A 2KNHA 2IXNA 2JD3A 2OCCC 3RH3A 3X1OA 5KYXA 1MMGA 4CS7A 4K0DA 1RJ9B 1OKKA 3O6XA 4BJ5A 1O87A 5B1AC 3RKOF 3LJBA 1Z6AA 4ULWA 2G3VA 3SZRA 4QDLA 4G7ZF 2R7VA 3Q6MA 4M63A 2YEVA 1NG1A 5E3CA 2A68F 2EINC 4BJ6C 5DLJA 3FDQA 1BR4A 1ZU4A 4I1OB 3AQCA 4PJMA 2D5RB 2A69F 3UGPA 3LESA 4O6MA 1OKKD 5FCLA 5KYNA 3Q6NA 3M1CB 4ZLDA 3LEVA 3NYJA 1PD0A 1J8YF 2J9VA 3EGDB 3DJNB 3SNHA 3E70C 3UNGC 4XTKA 3GANA 4C7OB 2XXAB 3I5QA 3EH1A 3EJNA 3ASNC 3S0XA 2VH3A 3E9VA 3N0TA 4CS9C 3NKDA 3LLIA 3RIPA 4BEJA 1RJ9A 1SZIA 4YT5A 2FGYA 3UMKA 4I3MA 4HFFB 4PFPA 5F5HA 2I8BA 5T3TA 4NY3A 5F5FA 4KI2A 3V7OA 1VK5A 4C3BA 4XLPF 1ZHZA 4BJ5C 4KNVA 3KH2A 4JJFA 2P7VA 1D1AA 3EZHA 2ZXPA 1MNDA 4IAOA 2IOQA 3PMRA 4HFKB 1TWGA 3JYHA 1ZHWA 2G3KA 2OG2A 4PFOA 3ECSA 3I4UA 2J7PA 2KJGA 4DVYP 3EGDA 1ZYRF 2CNWA 1PD1A 3UMHA 5KYWB 3L0IA 1ZHYA 3AG1C 3W2WA 3DXJF 4C7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCU Q;  3LS1 A;  3LS0 A;  1VYK A;  1NZE A;  3RFY A;  2MWQ A;  3ZSU A; 
#chains in the Genus database with same CATH topology
 1HE9 A;  4OD4 A;  1JPJ A;  1LPE A;  1VTM P;  2DYS C;  3L1M A;  2XXA A;  1ST6 A;  4H4K C;  1F1M A;  4MTO A;  3JT1 A;  2YWA A;  1LVK A;  2W45 A;  5JS5 A;  3KMI A;  3ITF A;  3OA1 A;  3B0V C;  2YHS A;  5JUA A;  3SP1 A;  3BEH A;  3Q7G A;  3LS0 A;  2EPM X;  4U5D E;  5EHH A;  2HSQ A;  1YAU O;  2XS8 A;  4K1O A;  4YWQ A;  2IXM A;  3CSK A;  3O39 A;  2CW0 F;  2XL4 A;  3RVZ A;  4Z9H A;  1TWC A;  3GOD A;  3B0P A;  3FMS A;  1T6I A;  3G4Z A;  4NQF A;  2J46 A;  2J7P D;  1CGN A;  2MYS A;  2E87 A;  1ORS C;  2HV6 A;  3TD7 A;  1FAP B;  4IAR A;  1M2O A;  2J45 A;  2MHR A;  3DXJ F;  1G8X A;  2H7O A;  1BZ4 A;  1W2W A;  2CYD A;  2R25 A;  1C02 A;  4CS8 A;  5B3S C;  4OIP F;  1RMV A;  3H2V A;  4DRH B;  3C8G A;  3DE9 A;  1QLE C;  2LCH A;  3KKB A;  5JP7 A;  2PBE A;  2LD6 A;  3MYI A;  4LLC A;  1D0Y A;  1PCX A;  1VLT A;  5FZT A;  4EWC A;  4F4B A;  2V3C C;  3OEO A;  2LK4 A;  2YLD A;  3JSE O;  3NMJ A;  1H7I A;  3DI5 A;  4JVS A;  4XPX A;  5HSW A;  1OXB A;  1UG7 A;  3GEH A;  4MW8 A;  3RQG A;  3ZTZ A;  5L3Q A;  4OIO F;  2NUP B;  3U2M A;  1APC A;  1YLM A;  2AVK A;  4E0I A;  3FVY A;  5E2Q A;  4Q4Z F;  2QY9 A;  4H54 A;  4MW3 A;  4U5F E;  1M6T A;  3O10 A;  3ZDL A;  1NZE A;  2Y3H A;  1EA8 A;  2IM8 A;  2VCC A;  3KYJ A;  3TK0 A;  4E0H A;  1A7D A;  1U6H A;  1HY5 A;  5KYW A;  4PJJ A;  2CGE A;  2P6V A;  3EHM A;  3M15 A;  3T6B A;  1HW2 A;  1E2X A;  1VYI A;  3ZVR A;  3HNL A;  3GEE A;  3K7D A;  4AK9 A;  3TUL A;  2R7O A;  3PDM P;  2EIL C;  4ER9 A;  2R7W A;  1IZM A;  2OOC A;  2XLD A;  4JKV A;  3N24 A;  1YDI A;  1HMD A;  1TKN A;  4B6I A;  2Q7R A;  3U8V A;  3JZ0 A;  4BJT A;  4N4W A;  1L3P A;  3EZI A;  1B68 A;  5B1B C;  5KYU B;  2XM4 A;  4A2N B;  3O55 A;  3K1H A;  3CZ6 A;  2I15 A;  4PJL A;  4LAC B;  3SXK A;  2R7T A;  3DM9 B;  2L6H A;  1Q0M A;  1ORJ A;  3FOO A;  3BRJ A;  4XEF A;  1DOW A;  1ZHT A;  2B0J A;  4YL3 A;  2FFH A;  3IHU A;  1AUE A;  2J9W A;  4NC3 A;  1ZVZ A;  2WVQ A;  2LFF A;  4U9D A;  1RKE B;  1MNE A;  3L8I A;  1BDJ B;  2YQY A;  2W9Y A;  1BR1 A;  1M2V B;  5B3I A;  1I4Z A;  4MVO A;  4EIY A;  2RD9 A;  5JSL A;  2AWY A;  2HUJ A;  4WGY A;  1FMW A;  4CJO A;  3AGU A;  1K05 A;  1NBB A;  1ZU5 A;  1ZZP A;  2DGJ A;  4J30 B;  2GA0 A;  4FX5 A;  4KC9 A;  4U9E A;  5L0I A;  2ETS A;  1GS9 A;  2LP4 A;  1BBH A;  1T01 A;  2WZF A;  4OIR F;  4DBR A;  1WTY A;  4EBJ A;  4FES A;  4HEA J;  4C3E A;  2NUP A;  4CS8 C;  1Z3I X;  3ASO C;  2M4E A;  2QE9 A;  4U5E E;  3X2Q C;  5DQZ A;  2EIK C;  2AWC A;  4NTB A;  4EHP A;  4UDV A;  2YVK A;  2A0B A;  4EBK A;  1JAF A;  4CIP A;  3WHN A;  2YZS A;  5KYY B;  3U3F A;  1KU2 A;  4HE8 D;  1ZW3 A;  2KQ9 A;  1ORY A;  1OQC A;  4XWJ A;  3S0X A;  4XPW A;  3ZQV A;  3ZSU A;  2XLE A;  4OD5 A;  2Q3T A;  4YK5 A;  1YA7 O;  2ZPA A;  3JRT A;  2YLI A;  3A11 A;  4P9T A;  3SXZ A;  2Y3D A;  3GM1 A;  3S27 A;  2OJE D;  3NMI A;  2PP4 A;  3ZIB A;  3S90 A;  4WGZ A;  1O5H A;  1IW7 F;  1NU7 D;  4QI2 A;  1OCC C;  1OCZ C;  4YJW A;  1YZC A;  4JTD B;  1LS1 A;  1TWH A;  5DVW A;  1V54 C;  4MVS A;  4YT8 A;  1I4Y A;  2WB7 A;  3DD7 A;  5KYU A;  2C03 A;  2KGO A;  3MLG A;  1JR8 A;  2DI3 A;  2A0U A;  5TJ5 E;  2EPO A;  3JSZ A;  2H8A A;  4C7O B;  3NKE A;  3ZTM A;  4WJ0 A;  2PFD A;  2DB4 A;  5E33 A;  2X0C A;  4C3D A;  5D91 A;  2R7X A;  5CI9 A;  2KW3 C;  3FHD A;  4E7Z A;  2BE5 F;  4DRI B;  1TR2 A;  1D0Z A;  2J9B A;  3KPH A;  4DXW A;  1V55 C;  3ATP A;  5L0C A;  3OWT A;  1C03 A;  3GWL A;  1RKE A;  3VYW A;  3W8H A;  2J9U A;  3QMK A;  4DOZ A;  5BQH A;  3UGO A;  2J0W A;  1M2V A;  3K33 A;  4GYT A;  1T5O A;  4PAC A;  1TWA A;  3W8I A;  1ZHX A;  4FAP B;  1ZW2 A;  2Q9A A;  2WVN A;  3NG1 A;  2P1A A;  3EPV A;  3QTH A;  4JZA A;  3HNJ A;  1LM3 B;  3DZA A;  3RQE A;  1OW6 A;  1WGW A;  2R03 A;  2ICW G;  3SYN A;  2YL0 A;  3GEI A;  3U5S A;  4Q7C A;  5EGY A;  1HE1 A;  4J32 B;  1N1C A;  1TQG A;  2Y69 C;  2YRF A;  3L34 A;  3QZC A;  1YJG A;  1J8M F;  1D1B A;  5COG A;  3US6 A;  4PR9 A;  5KYY A;  1M57 C;  1LE4 A;  1K04 A;  2R02 A;  3LAY A;  2Y3G A;  2WZG A;  3ABM C;  3AGT A;  1VLS A;  2IYL D;  4XLN F;  4BJ1 A;  3NDB B;  1D1C A;  4YT2 A;  1SR2 A;  2EPN A;  2M64 A;  1LS4 A;  3KL4 A;  4RD9 A;  3ZC4 A;  1M56 C;  2A6H F;  256B A;  2OJQ A;  2Y3B A;  1SYQ A;  4O6Y A;  1QSP A;  1CGM E;  4PK4 A;  4ULV A;  4D4X A;  2EIM C;  3AG3 C;  3I5P A;  2PF4 E;  1NFO A;  2XLO A;  2V26 A;  3CEX A;  2PX0 A;  4LLE A;  1Z7Q c;  5JRA A;  1LE2 A;  5DS5 A;  4CBE A;  3EFO B;  2KYH A;  3WG7 C;  1OR2 A;  4IWB A;  3U3B A;  1QQ3 A;  4N06 A;  2DYR C;  4O7G A;  5HV9 A;  3RVY A;  4G7H F;  2HJ3 A;  2Z15 A;  3A9C A;  1MMD A;  2J8W A;  4GEH A;  4X0R A;  1A41 A;  2GAQ A;  1NFN A;  3MX3 A;  4DJ9 A;  2W4M A;  3MBG A;  1E86 A;  3U0C A;  3TOM A;  1CPR A;  5AGF A;  3TJ5 A;  3K1I A;  5L0D A;  5COF A;  3ABL C;  1U89 A;  4O6N A;  3B71 A;  5L3V A;  2FAP B;  2HZ8 A;  3QW0 A;  1T9K A;  1YZA A;  4JCH A;  1OR3 A;  2AU5 A;  4KBL A;  3H65 A;  5AC5 A;  2XL8 A;  3F47 A;  3AQB A;  3AG2 C;  3DJU B;  3AG4 C;  2EIJ C;  3B9Q A;  3IEE A;  5IY5 C;  3QVY A;  2J0X A;  4LDQ A;  2WL8 A;  3ABK C;  4JW1 A;  4BPM A;  5T1D B;  3AOU A;  1OCR C;  1A7E A;  2O9X A;  4NTF A;  4IRU A;  1Z23 A;  4JJG A;  3R7C A;  1WOL A;  4Q5S F;  4CSA A;  2VC9 A;  4E7S A;  2LIG A;  1Y6D A;  4W8K A;  3T4R A;  2L9J A;  3RQF A;  1G4U S;  2NUT B;  5DS6 A;  1G4W R;  3PHF 2;  5A69 A;  4FWV A;  3K6B A;  2XSE A;  2RSE B;  2HS5 A;  3S28 A;  4MQ9 F;  4PJN A;  3VAY A;  4G7O F;  3EGX B;  2L6G A;  3ZWI A;  3UMI A;  5T3W A;  5CI8 A;  3PCV A;  1T6U A;  4RBN A;  1O3U A;  3EHN A;  3NMK A;  4I44 A;  4MS2 A;  2VAS A;  1G5Z A;  1MQV A;  4RDA A;  1UFB A;  1XZP A;  3TOL A;  1XZQ A;  1WAT A;  4EUK B;  1NSG B;  5JLI A;  2IXO A;  1T6Q A;  2HV7 A;  3EFO A;  1TFK B;  4K7B A;  4CJG A;  2C04 A;  4AE4 B;  4YT4 A;  1VOM A;  2XRH A;  1LIH A;  1FFT C;  3EQL F;  1KNY A;  3VF0 A;  3G4X A;  1YAR O;  4DRJ B;  4DVZ A;  2OQM A;  3HLZ A;  3IQ5 A;  1SF8 A;  2Q9B A;  3HJC A;  3NRH A;  5BUO A;  3C8Z A;  3LUT B;  3WOD F;  3Q7L A;  1E83 A;  3V5Y A;  1H6G A;  2ZXO A;  5A6K A;  3POV A;  3CQZ A;  1XWJ A;  2L6F A;  3LNM B;  3DAF A;  3ZG1 A;  3HNI A;  3W2V A;  5AC4 A;  2WZL A;  3K1I C;  5D92 A;  1FNT c;  4JRZ A;  3UR3 C;  3DM5 A;  2R7Q A;  4DBQ A;  1D0X A;  4D4N A;  1OXK A;  1K40 A;  4LDK A;  1BR2 A;  4P6I C;  2VCA A;  3S9O A;  2R7R A;  2P0N A;  2R7U A;  2NG1 A;  4JUR I;  1SMY F;  3M4C A;  4IAQ A;  4EKW A;  1YYJ A;  4KNW A;  4IGG A;  1FMV A;  1CPQ A;  4LER A;  2A6E F;  3EG9 B;  5BQI A;  1YVI A;  2BC5 A;  2OU6 A;  3HNK A;  3IPM O;  4P9F A;  4U5B E;  2NUT A;  4JTA B;  4LDR A;  4OIN F;  3WAQ A;  3N2Z B;  1GM5 A;  2H7V C;  2KK1 A;  4OIQ F;  3V5X A;  3FOP A;  4CSA C;  2OEV A;  3EH2 A;  2IXP A;  3EGX A;  4MTF A;  1S7Z A;  4A4A A;  1NU9 C;  2X51 A;  2W4B A;  2R7S A;  2QLA A;  2GWW A;  5GPG B;  3RYL A;  1R5I D;  2Y39 A;  4YN0 B;  3RFY A;  5L0F A;  2Q4F A;  1RXQ A;  5KYX B;  1EQ1 A;  3FAJ A;  3C7J A;  5E3A A;  4EBB A;  2A1D D;  1JRA A;  3NYM A;  2NPU A;  2VB6 A;  4ANJ A;  4AX2 A;  1MMA A;  3M79 A;  4AE4 A;  1Z5Z A;  4CDA A;  1LKX A;  3DAG A;  4YL0 A;  1VYK A;  1Q0G A;  1JPN A;  2MWQ A;  2Q9C A;  3GWN A;  4MND A;  4ZLC A;  1Z63 A;  3SEO A;  3B0U X;  3DWW A;  4BJ6 A;  4QI0 A;  4J7Y A;  1VB5 A;  4JE9 A;  2YL3 A;  3LS1 A;  4XQ1 A;  3T9O A;  3NYL A;  2QTV A;  4G0H A;  1QZX A;  1E85 A;  2BL2 A;  3HTK C;  3DMD A;  2QUP A;  1FR0 A;  2ZD9 A;  2L81 A;  1VMA A;  2UUH A;  3GM2 A;  3HKK A;  2ZXR A;  3LNR A;  3C63 A;  2D4U A;  2IBF A;  2XS1 A;  2AP3 A;  3AJM A;  3GOR A;  3JCU Q;  4U5G A;  2LSE A;  3S29 A;  1KTM A;  2HSB A;  3U2L A;  1A0B A;  5JT4 A;  1QVX A;  4O79 A;  3LEO A;  1R4T A;  4MVM A;  2XM0 A;  5L0G A;  2G62 A;  2VCB A;  4U5H A;  1Y4C A;  4MVR A;  3KYI A;  4AL1 A;  1H9G A;  1QKR A;  1H9T A;  3EG9 A;  2WVO A;  3LLK A;  3T6G B;  3IQT A;  1MMN A;  2HFI A;  2ZXW C;  4IJJ A;  4U5C E;  3V5Z A;  1GQA A;  3U8P A;  3T6J A;  5DQT A;  4CDV A;  3R2P A;  1OCO C;  1L7C A;  1OW7 A;  2CNW D;  4I1M A;  5DS4 A;  2CDQ A;  1FFH A;  4AL0 A;  4CIH A;  2GFH A;  1A7V A;  4CS9 A;  1FTS A;  3F46 A;  3K66 A;  2H7B A;  3VRC A;  1C17 M;  2L7A A;  4BG0 A;  4J7T A;  2PX3 A;  3W4Y A;  4E17 A;  2KNH A;  5BQG A;  3RF3 A;  2IXN A;  2NSG A;  5L0J A;  2JD3 A;  1I5N A;  1RCP A;  2UUI A;  2OCC C;  3RH3 A;  3X1O A;  2KC3 A;  2XLH A;  1MMG A;  5KYX A;  1HMO A;  2YL1 A;  4CS7 A;  4K0D A;  3M4B A;  1RJ9 B;  5CIV A;  3J06 A;  2GDC A;  2XLM A;  3S84 A;  2NSF A;  1OKK A;  3O6X A;  2JPU A;  4JTC B;  4BJ5 A;  2JX0 A;  1O87 A;  5B1A C;  2OKU A;  3RKO F;  3LJB A;  5JVE A;  1WN0 A;  1Z6A A;  4ULW A;  2G3V A;  3SZR A;  4QDL A;  4G7Z F;  3MFN A;  2R05 A;  2R7V A;  4XEV A;  1DOV A;  1AEP A;  3C62 A;  3Q6M A;  2YEV A;  4M63 A;  3B29 A;  3ZQY A;  3C8G D;  2YL7 A;  1NG1 A;  4MTG A;  5A6A A;  5E3C A;  3C18 A;  2A68 F;  1JOG A;  2EIN C;  2KSF A;  3SXY A;  1EI7 A;  2Q00 A;  4BJ6 C;  5DLJ A;  4ONS A;  1BR4 A;  4NTA A;  4YL1 A;  1ZU4 A;  5A6B A;  1YYX A;  4I1O B;  3FDQ A;  2XLW A;  1OW8 A;  1V4A A;  4G78 A;  3AQC A;  4L6R A;  4Z9J A;  4PJM A;  2D5R B;  2A69 F;  2CCY A;  3MYF A;  3QVZ A;  3TQO A;  3UGP A;  3LES A;  4O6M A;  2F22 A;  1Q0D A;  3VM6 A;  1OKK D;  3IQ6 A;  5FCL A;  5KYN A;  3Q6N A;  3M1C B;  2QNL A;  3TJ6 A;  3DKA A;  5A6J A;  4ZLD A;  4CDY A;  3U9J A;  3LEV A;  1JMW A;  3NYJ A;  4JEA A;  4MVQ A;  1PD0 A;  1J8Y F;  2J9V A;  2LQG A;  3DJN B;  3EGD B;  3G50 A;  4R32 A;  2YLG A;  2HJM A;  3SNH A;  3E70 C;  3JTL O;  3UNG C;  1LI7 A;  1E84 A;  1AVO B;  3H2U A;  4N6H A;  3IQC A;  1Q0K A;  3GAN A;  4XTK A;  4WAB A;  4MVZ A;  5K0I A;  3JYY A;  5COM A;  4XPY A;  5EK0 A;  2HKV A;  4GQH A;  3I5Q A;  2XXA B;  3EH1 A;  3EJN A;  3ASN C;  1LI5 A;  3GM3 A;  4Z9I A;  4E18 A;  3JRM O;  2VH3 A;  3L8J A;  3E9V A;  5A6B D;  3N0T A;  1PV3 A;  1WAS A;  4W8P A;  4CS9 C;  3NKD A;  2B0H A;  1GGQ A;  1Q0F A;  3LLI A;  1S05 A;  3RIP A;  4BEJ A;  1RJ9 A;  1SZI A;  4YT5 A;  2FGY A;  3UMK A;  1QPU A;  3DE8 A;  1HW1 A;  4HFF B;  4I3M A;  4PFP A;  5F5H A;  2YKZ A;  2I8B A;  2HMZ A;  1TFO B;  5F28 E;  2XL6 A;  4MVU A;  1CGO A;  4JCZ A;  4NY3 A;  5T3T A;  5F5F A;  1RKC A;  4KI2 A;  3V7O A;  4BEM J;  1VK5 A;  2EPL X;  4C3B A;  4XLP F;  1ZHZ A;  4BJ5 C;  1YA9 A;  4KNV A;  3KH2 A;  4JEB A;  4IB4 A;  3FXH A;  3C8G B;  4JJF A;  4XEK A;  2TMV P;  3SXM A;  2P7V A;  1D1A A;  3EZH A;  2ZXP A;  4NCQ A;  3RW0 A;  1MND A;  4IAO A;  2LFD A;  3CAX A;  1V74 B;  2ASR A;  2IOQ A;  2OEX A;  4CX9 A;  1U0B B;  2R9R B;  1NLX A;  3PMR A;  2XLV A;  4N6C A;  4HFK B;  2HMQ A;  1TWG A;  2P61 A;  2PNO A;  3FAP B;  1ZHW A;  2G3K A;  2OG2 A;  3JYH A;  3QW1 A;  4PFO A;  3U9M A;  3ECS A;  5L0H A;  3I4U A;  2J7P A;  2KJG A;  4DVY P;  4JC7 A;  3EGD A;  1ZYR F;  2CNW A;  1PD1 A;  3UMH A;  5KYW B;  1EKY A;  3L0I A;  1ZHY A;  1WWP A;  3AG1 C;  4JIO A;  3W2W A;  2EPK X;  4C7O A; 
#chains in the Genus database with same CATH homology
 4OD4 A;  1JPJ A;  2DYS C;  2XXA A;  1ST6 A;  4H4K C;  3JT1 A;  1LVK A;  2W45 A;  3KMI A;  3ITF A;  3OA1 A;  3B0V C;  2YHS A;  3SP1 A;  3Q7G A;  3LS0 A;  4U5D E;  5EHH A;  4YWQ A;  2IXM A;  3CSK A;  3O39 A;  2CW0 F;  2XL4 A;  1TWC A;  3GOD A;  3B0P A;  2J46 A;  2J7P D;  2MYS A;  2E87 A;  2HV6 A;  3TD7 A;  1M2O A;  2J45 A;  1G8X A;  2H7O A;  1W2W A;  5B3S C;  4CS8 A;  4OIP F;  3KKB A;  1QLE C;  4LLC A;  1D0Y A;  1PCX A;  4F4B A;  2V3C C;  4EWC A;  3OEO A;  4JVS A;  5HSW A;  5L3Q A;  4OIO F;  2NUP B;  3FVY A;  5E2Q A;  4Q4Z F;  2QY9 A;  4U5F E;  1NZE A;  2Y3H A;  5KYW A;  4PJJ A;  2CGE A;  2P6V A;  3EHM A;  3T6B A;  1VYI A;  3ZVR A;  4AK9 A;  3K7D A;  2R7O A;  2R7W A;  2EIL C;  1IZM A;  3N24 A;  1TKN A;  4B6I A;  4BJT A;  3EZI A;  5B1B C;  5KYU B;  4A2N B;  3K1H A;  3CZ6 A;  4PJL A;  4LAC B;  2R7T A;  3DM9 B;  1ZHT A;  2B0J A;  2FFH A;  2J9W A;  2WVQ A;  1MNE A;  2W9Y A;  1BR1 A;  1M2V B;  1FMW A;  1ZU5 A;  2DGJ A;  4J30 B;  4KC9 A;  4FX5 A;  4DBR A;  2WZF A;  4OIR F;  4FES A;  4HEA J;  4C3E A;  2NUP A;  4CS8 C;  1Z3I X;  3ASO C;  2M4E A;  4U5E E;  3X2Q C;  2R7S A;  5DQZ A;  2EIK C;  5KYY B;  2YZS A;  1KU2 A;  4HE8 D;  2KQ9 A;  4XWJ A;  3ZSU A;  4OD5 A;  2Q3T A;  2ZPA A;  3JRT A;  2Y3D A;  3S27 A;  2PP4 A;  3ZIB A;  1O5H A;  1IW7 F;  1NU7 D;  4QI2 A;  1OCC C;  1OCZ C;  4YJW A;  1LS1 A;  1TWH A;  5DVW A;  1V54 C;  4YT8 A;  2WB7 A;  3DD7 A;  5KYU A;  2C03 A;  2KGO A;  3MLG A;  3JSZ A;  3NKE A;  4WJ0 A;  2PFD A;  5E33 A;  4C3D A;  5D91 A;  2R7X A;  5CI9 A;  2KW3 C;  3FHD A;  4E7Z A;  2BE5 F;  1TR2 A;  1D0Z A;  1V55 C;  3OWT A;  3VYW A;  3W8H A;  2J9U A;  3QMK A;  4DOZ A;  3UGO A;  2J0W A;  1M2V A;  3K33 A;  4GYT A;  1TWA A;  3W8I A;  1ZHX A;  2Q9A A;  2WVN A;  3NG1 A;  3EPV A;  4JZA A;  3DZA A;  3SYN A;  1WGW A;  4Q7C A;  5EGY A;  4J32 B;  1N1C A;  2Y69 C;  3L34 A;  3QZC A;  5KYY A;  1J8M F;  1D1B A;  1M57 C;  3LAY A;  2Y3G A;  2WZG A;  3ABM C;  4XLN F;  4BJ1 A;  2IYL D;  3NDB B;  1D1C A;  4YT2 A;  3KL4 A;  3ZC4 A;  4RD9 A;  1M56 C;  2A6H F;  2Y3B A;  4O6Y A;  4PK4 A;  2EIM C;  3AG3 C;  3I5P A;  2PF4 E;  2V26 A;  4LLE A;  2PX0 A;  5DS5 A;  4CBE A;  3EFO B;  3WG7 C;  4IWB A;  4N06 A;  2DYR C;  4O7G A;  4G7H F;  2Z15 A;  4GEH A;  1MMD A;  4X0R A;  3MX3 A;  2W4M A;  3ABL C;  4O6N A;  5L3V A;  4JCH A;  4KBL A;  3H65 A;  3F47 A;  3AQB A;  3IEE A;  3DJU B;  3AG2 C;  2EIJ C;  3AG4 C;  3B9Q A;  5IY5 C;  2J0X A;  2WL8 A;  3ABK C;  4JW1 A;  5T1D B;  1OCR C;  2O9X A;  4IRU A;  1Z23 A;  4JJG A;  4Q5S F;  4CSA A;  4E7S A;  4W8K A;  3T4R A;  2L9J A;  2NUT B;  5DS6 A;  3PHF 2;  4FWV A;  3K6B A;  2XSE A;  3S28 A;  4MQ9 F;  4PJN A;  3VAY A;  4G7O F;  3EGX B;  3UMI A;  5T3W A;  5CI8 A;  4RBN A;  3EHN A;  4I44 A;  2VAS A;  4RDA A;  2IXO A;  2HV7 A;  3EFO A;  4K7B A;  2C04 A;  4AE4 B;  4YT4 A;  1VOM A;  2XRH A;  3EQL F;  1FFT C;  4DVZ A;  3HLZ A;  3NRH A;  1SF8 A;  2Q9B A;  3HJC A;  5BUO A;  3WOD F;  3Q7L A;  2ZXO A;  3POV A;  3CQZ A;  3DAF A;  3ZG1 A;  3W2V A;  2WZL A;  3K1I C;  5D92 A;  3UR3 C;  3DM5 A;  2R7Q A;  4DBQ A;  1D0X A;  1BR2 A;  4P6I C;  2R7R A;  2R7U A;  2NG1 A;  4JUR I;  1SMY F;  4KNW A;  1FMV A;  4LER A;  2A6E F;  3EG9 B;  4U5B E;  2NUT A;  4OIN F;  3N2Z B;  2H7V C;  4OIQ F;  4CSA C;  3EH2 A;  2IXP A;  3EGX A;  1S7Z A;  1NU9 C;  2X51 A;  2W4B A;  3RYL A;  2Y39 A;  4YN0 B;  3RFY A;  5KYX B;  3FAJ A;  5E3A A;  4EBB A;  2A1D D;  3NYM A;  2VB6 A;  4ANJ A;  4AX2 A;  1MMA A;  4AE4 A;  1Z5Z A;  1LKX A;  3DAG A;  1VYK A;  2Q9C A;  1JPN A;  2MWQ A;  4MND A;  4ZLC A;  1Z63 A;  3SEO A;  3B0U X;  4BJ6 A;  4QI0 A;  3LS1 A;  3NYL A;  2QTV A;  4G0H A;  1QZX A;  3HTK C;  3DMD A;  2L81 A;  1VMA A;  2ZXR A;  3LNR A;  4U5G A;  3S29 A;  3JCU Q;  2LSE A;  4O79 A;  2G62 A;  4U5H A;  3EG9 A;  2WVO A;  3LLK A;  1MMN A;  2ZXW C;  4IJJ A;  4U5C E;  5DQT A;  3T6J A;  1OCO C;  4I1M A;  2CNW D;  5DS4 A;  2CDQ A;  1FFH A;  4CIH A;  2GFH A;  4CS9 A;  1FTS A;  3F46 A;  3K66 A;  2H7B A;  4BG0 A;  2PX3 A;  2KNH A;  2IXN A;  2JD3 A;  2OCC C;  3RH3 A;  3X1O A;  5KYX A;  1MMG A;  4CS7 A;  4K0D A;  1RJ9 B;  1OKK A;  3O6X A;  4BJ5 A;  1O87 A;  5B1A C;  3RKO F;  3LJB A;  1Z6A A;  4ULW A;  2G3V A;  3SZR A;  4QDL A;  4G7Z F;  2R7V A;  3Q6M A;  4M63 A;  2YEV A;  1NG1 A;  5E3C A;  2A68 F;  2EIN C;  4BJ6 C;  5DLJ A;  3FDQ A;  1BR4 A;  1ZU4 A;  4I1O B;  3AQC A;  4PJM A;  2D5R B;  2A69 F;  3UGP A;  3LES A;  4O6M A;  1OKK D;  5FCL A;  5KYN A;  3Q6N A;  3M1C B;  4ZLD A;  3LEV A;  3NYJ A;  1PD0 A;  1J8Y F;  2J9V A;  3EGD B;  3DJN B;  3SNH A;  3E70 C;  3UNG C;  4XTK A;  3GAN A;  4C7O B;  2XXA B;  3I5Q A;  3EH1 A;  3EJN A;  3ASN C;  3S0X A;  2VH3 A;  3E9V A;  3N0T A;  4CS9 C;  3NKD A;  3LLI A;  3RIP A;  4BEJ A;  1RJ9 A;  1SZI A;  4YT5 A;  2FGY A;  3UMK A;  4I3M A;  4HFF B;  4PFP A;  5F5H A;  2I8B A;  5T3T A;  4NY3 A;  5F5F A;  4KI2 A;  3V7O A;  1VK5 A;  4C3B A;  4XLP F;  1ZHZ A;  4BJ5 C;  4KNV A;  3KH2 A;  4JJF A;  2P7V A;  1D1A A;  3EZH A;  2ZXP A;  1MND A;  4IAO A;  2IOQ A;  3PMR A;  4HFK B;  1TWG A;  3JYH A;  1ZHW A;  2G3K A;  2OG2 A;  4PFO A;  3ECS A;  3I4U A;  2J7P A;  2KJG A;  4DVY P;  3EGD A;  1ZYR F;  2CNW A;  1PD1 A;  3UMH A;  5KYW B;  3L0I A;  1ZHY A;  3AG1 C;  3W2W A;  3DXJ F;  4C7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...