4Z9HA

Asp-tar from e. coli
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
165
structure length
165
Chain Sequence
SLFFSSLHHSQKSFVVSNQLREQQGELTSTWDLMLQTRINLSRSAVRMMMDSSNQQSNAKVELLDSARKTLAQAATHYKKFKSMAPLPEMVATSRNIDEKYKNYYTALTELIDYLDYGNTGAYFAQPTQGMQNAMGEAFAQYALSSEKLYRDIVTDNADDYRFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Methyl-accepting chemotaxis protein II
publication title Structural Analysis of the Ligand-Binding Domain of the Aspartate Receptor Tar from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 71
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 4z9hA00
2LIGA 1VLTA 4Z9HA 2ASRA 3ATPA 1WASA 1JMWA 4Z9JA 3T9OA 1VLSA 2D4UA 1LIHA 4H54A 4Z9IA 1WATA
chains in the Genus database with same CATH superfamily
3JCUQ 5AGFA 5BQHA 4DRJB 5EHHA 4KI2A 3GWLA 1CGOA 2Z15A 1HMOA 1LIHA 1JPNA 4W8KA 5HV9A 3AGTA 2YQYA 4JC7A 4JRZA 5JSLA 2WVOA 1E2XA 2NUTA 5AC5A 4CSAC 3EHMA 2PBEA 1Q0GA 4MVZA 1TR2A 4DRHB 5JLIA 1OCOC 3F46A 1GGQA 2CW0F 2YKZA 5L0HA 2R05A 1YA7O 2NUTB 4PJNA 1QZXA 1CPQA 1ORYA 2HSQA 1YAUO 4RDAA 4DJ9A 3DXJF 3U5SA 4PACA 3TD7A 1C03A 1HW2A 1FNTc 3NMKA 3L8JA 4DOZA 1VMAA 2J7PA 2LSEA 3LNMB 5BUOA 3C8GD 4CIPA 3AG3C 2B0HA 1YLMA 4Q7CA 1ZYRF 4YL0A 4Z9JA 2MWQA 3W2WA 4C3DA 4EBBA 2P61A 2KW3C 3RVYA 1Z23A 1EQ1A 2CYDA 1R5ID 2CCYA 3M4BA 5F5HA 4DXWA 2A0BA 1T6IA 3HJCA 4IB4A 2KYHA 3HKKA 1U0BB 2XXAA 3T9OA 2ZXRA 4IARA 1Y4CA 2Q9CA 2L6FA 4XEKA 3SEOA 1Q0KA 2R03A 1FFTC 3EQLF 4XLPF 4LERA 1GM5A 2W4MA 5B1BC 2XXAB 2ZXPA 4J7TA 5T3WA 1D1CA 4LACB 3IQCA 1AUEA 1LE4A 3IEEA 4U9EA 5COMA 3M15A 3DMDA 4OIPF 4KBLA 1Z5ZA 1LVKA 3EG9A 5L0IA 3QZCA 2QUPA 3NG1A 1WASA 3FAPB 3KYJA 2XS1A 3L0IA 1HY5A 3DM9B 1C02A 3FAJA 3US6A 3GM1A 4CJOA 3C62A 3EG9B 1MMNA 3AQCA 1OCRC 3DJUB 3NRHA 3U3FA 1E83A 5COFA 4MVSA 5BQGA 4XLNF 1KNYA 1TWCA 1RCPA 3N0TA 4HEAJ 1KU2A 4K0DA 4C3BA 4E17A 2J45A 4NQFA 1NLXA 2HFIA 5K0IA 4O7GA 2J9BA 4I44A 1E86A 3H2UA 2YZSA 3S84A 3BRJA 2IOQA 3U3BA 4MTFA 3M4CA 4CBEA 1WGWA 3EHNA 3IPMO 3L1MA 3S29A 3SXMA 3TOLA 4PFOA 1RKEB 4JZAA 1YDIA 3SP1A 4U5CE 1T5OA 1JRAA 2DGJA 3U9MA 2C03A 2R7SA 3ASOC 1Z7Qc 2IYLD 2KNHA 5T1DB 3ZQYA 3KKBA 2VH3A 4D4XA 5EK0A 3RYLA 1C17M 1PV3A 3JSZA 3AJMA 1H9GA 3V5XA 1FTSA 2KGOA 1OXKA 2HSBA 4ZLDA 2Q9AA 1VB5A 3AGUA 3BEHA 4IRUA 4CS9A 4G7ZF 1W2WA 2HUJA 3KL4A 4WGYA 3RKOF 3EJNA 4PR9A 1XZQA 3UNGC 4YK5A 2NUPA 2R25A 5DLJA 4YT2A 3AOUA 1E84A 4H54A 4CX9A 2EPLX 1QPUA 2HKVA 1H7IA 5DQZA 5KYNA 1E85A 1MQVA 2NUPB 4PJMA 3T6JA 5L0FA 3NMJA 3TK0A 1LS4A 2R9RB 1TKNA 2LK4A 1TWAA 3MBGA 4JEAA 1BR1A 2W4BA 2IXPA 3FHDA 3Q6MA 2YL1A 4P9TA 2HS5A 1YA9A 2XL8A 4XEVA 2NSFA 4N4WA 2LP4A 4GEHA 1I5NA 3UGPA 2GFHA 2Y3GA 4CS8C 5A6KA 4ULVA 3IHUA 2EPMX 4C7OA 4MTOA 3DZAA 3UMIA 2W45A 1D0YA 1QLEC 4C3EA 1H6GA 1MNEA 3TOMA 2CNWD 4C7OB 1AVOB 3E70C 1ZZPA 3O55A 2BL2A 5BQIA 1HW1A 2EIJC 4WGZA 4EUKB 1Y6DA 3IQTA 5CI9A 4FX5A 1M56C 2Y3BA 4U5EE 2KC3A 1RXQA 4I1MA 4UDVA 5KYYA 3POVA 2HV7A 4OIQF 2R7OA 5L3QA 4ULWA 3SXYA 3KMIA 3ITFA 3SZRA 1VK5A 2ETSA 2XLDA 3HLZA 2GAQA 1T6UA 3AG1C 4HE8D 4NY3A 5CI8A 3RQGA 3S28A 3ZC4A 3ZVRA 3S90A 2A1DD 3ZIBA 1JR8A 1VLTA 4Z9HA 3GWNA 1B68A 3C8GA 3DKAA 3WAQA 1I4YA 4J30B 3NYJA 4Q5SF 4F4BA 1L7CA 2EINC 4MW3A 1G5ZA 3S0XA 3U0CA 2YL3A 3B29A 1JMWA 1ST6A 4BJ5A 3EH2A 1ORSC 3MYIA 5L0DA 3U2LA 2GDCA 2YRFA 2EPKX 2YHSA 3U8PA 4RD9A 4NTBA 1NG1A 2KK1A 2BC5A 4E7ZA 2OEXA 4YT5A 4CDYA 1EI7A 4LLCA 1NBBA 3Q6NA 3ECSA 4MNDA 4O6NA 2Q9BA 1S05A 4NTFA 4RBNA 3M79A 4I3MA 2J0WA 3JTLO 4CS8A 2C04A 2CDQA 2I8BA 4GQHA 1QQ3A 2R7TA 3LS0A 4BEMJ 1UFBA 1F1MA 2E87A 2V3CC 2D5RB 2DYSC 1G8XA 3OEOA 2YL7A 5A6AA 3CSKA 2NG1A 2OCCC 1I4ZA 2ZPAA 4U5HA 3LNRA 2J9UA 2H7OA 5E2QA 1BDJB 2OJQA 3NYMA 3CEXA 5E3AA 4ZLCA 2XLEA 4CS9C 3LS1A 4OD5A 1EKYA 3DE9A 4JCHA 4N6CA 3JRMO 3LEVA 2IM8A 3GEEA 4U5FE 4AX2A 4BJ6A 3K66A 3WODF 3T6BA 1Q0FA 1LI5A 4N06A 3X2QC 4D4NA 2P7VA 2FGYA 3N24A 2L9JA 1CPRA 2WZLA 5JRAA 3DAGA 4JEBA 2WB7A 1S7ZA 3T6GB 2X51A 1Q0MA 2LFFA 1O87A 3B9QA 4JTAB 3U9JA 5L0CA 1MMDA 3OWTA 1OKKA 2PNOA 2Q4FA 2YLGA 3MFNA 4LDRA 1VOMA 3S27A 1FMWA 2OQMA 3JRTA 3UMKA 3DM5A 1D0XA 4MVOA 4BJ1A 1RJ9A 4EBKA 1LI7A 1SMYF 2AU5A 3S9OA 2IBFA 3FOOA 1WTYA 4B6IA 1RJ9B 1K40A 1WWPA 3EPVA 4AL1A 5KYWA 2OG2A 1J8YF 2L81A 3K33A 3JZ0A 3V5ZA 2VCAA 1VTMP 4G0HA 1OCZC 2P1AA 3UGOA 4MS2A 1QSPA 5KYWB 3MX3A 3GEIA 4IGGA 4OD4A 4U5DE 3W4YA 3ABKC 3FXHA 1H9TA 4W8PA 4JVSA 2JX0A 1ORJA 4JTCB 3TQOA 5JUAA 4U9DA 2IXOA 3EFOA 2WVQA 3IQ6A 2R7XA 4MVQA 1L3PA 2J7PD 2QNLA 2XL6A 2G3VA 2R7WA 1V4AA 1HE1A 3EFOB 3NKEA 4YL3A 2QE9A 1TQGA 1M6TA 1SYQA 2ZXOA 3AG4C 3RFYA 3UMHA 4EKWA 1MMGA 3RIPA 3SNHA 4DBRA 2J8WA 2A68F 1O3UA 2XLHA 1DOVA 2OOCA 4MTGA 4GYTA 3I5QA 3QTHA 4PFPA 2CNWA 1V54C 4J32B 3K1HA 4K7BA 3RF3A 4DBQA 3ZSUA 2PP4A 1M2OA 2PX3A 4OIRF 5L0GA 3RW0A 3VF0A 2LFDA 5T3TA 4E0HA 5JS5A 2VCBA 2RD9A 4BJ5C 4XEFA 1OW6A 5D91A 3ASNC 2O9XA 4M63A 5EGYA 1G4US 3QW0A 5B3SC 3VYWA 2A6HF 3QMKA 3G50A 3AQBA 5L3VA 1A7DA 2AWCA 4YL1A 2EIMC 2NPUA 3ATPA 3EZIA 4PK4A 1SF8A 2R7UA 1OXBA 3IQ5A 4JJGA 4QI0A 4CIHA 1T01A 2JPUA 256BA 2BE5F 3H65A 1ZU4A 4EIYA 3HTKC 4JJFA 4CDAA 3HNIA 3KPHA 1D1BA 4PJLA 1IZMA 4KNVA 1A0BA 4DVYP 4P9FA 1D1AA 2HMZA 3UR3C 3LEOA 2Q00A 3I4UA 5DS6A 2ZD9A 1ZVZA 3DI5A 4NCQA 4KC9A 2ICWG 3G4XA 1Z6AA 1IW7F 2OJED 1FMVA 4EWCA 1LPEA 3G4ZA 3GANA 4H4KC 4JE9A 2Y39A 4BJ6C 1VYKA 4YN0B 2XLMA 2AWYA 1OW8A 3WHNA 1SZIA 4JW1A 3RQFA 1T6QA 3O6XA 4BPMA 3TJ5A 3O39A 2OEVA 2LIGA 4XTKA 1U6HA 4Z9IA 3R7CA 2I15A 5L0JA 1FAPB 3DAFA 3K7DA 3KH2A 2R7QA 1YJGA 4AL0A 3JYYA 3MYFA 4O6YA 4FAPB 5KYYB 4A4AA 4E7SA 2P6VA 3A11A 4OIOF 5F5FA 4I1OB 5E3CA 3V5YA 3B0PA 3QVZA 3L34A 3C8GB 4HFKB 2A0UA 3EZHA 1NU9C 3VAYA 2WZGA 1YZAA 3C63A 3EGDA 3EH1A 4YT8A 4XQ1A 1NU7D 4LDQA 4O79A 2J46A 3GEHA 1BBHA 1J8MF 3GODA 1LS1A 3X1OA 3EGDB 2GWWA 2H7VC 3RH3A 1CGME 1NZEA 1NFNA 3JT1A 2JD3A 2QLAA 1JAFA 5A6BD 2IXNA 3GORA 1ZHXA 1DOWA 2CGEA 5DS4A 5TJ5E 4R32A 5FZTA 1V74B 4A2NB 2G62A 5KYXA 5F28E 2AVKA 2YVKA 1ZHTA 3GM2A 4J7YA 4JTDB 3B0UX 4EHPA 2L7AA 5GPGB 4BG0A 4XPXA 1T9KA 5KYXB 4G78A 4OINF 3NKDA 3TJ6A 5JVEA 2LQGA 3QW1A 1A41A 1LE2A 1O5HA 1D0ZA 2R7VA 1BR2A 2ASRA 1M2VA 2VB6A 1ZU5A 1WATA 2RSEB 2L6GA 1PCXA 3SYNA 1QKRA 4NTAA 5JP7A 1ZW3A 3ZTMA 2QTVA 3W8IA 1M2VB 1R4TA 2EIKC 2WZFA 1ZHWA 2Y69C 4E18A 2TMVP 4G7OF 4QI2A 3MLGA 1YYXA 1WN0A 3QVYA 1FR0A 1NFOA 3U8VA 3ZWIA 2XSEA 4MVUA 4XPYA 5B1AC 4ANJA 3A9CA 5FCLA 2XM4A 2Q3TA 4MQ9F 3K1IA 2AP3A 4JKVA 1OR2A 3JSEO 1A7VA 3CZ6A 3DE8A 3O10A 2J9WA 5DVWA 3JYHA 3PDMP 2HZ8A 2QY9A 4IAQA 3RVZA 1OR3A 2HV6A 4E0IA 4EBJA 3VRCA 4NC3A 1PD0A 2XRHA 3DD7A 2F22A 3DWWA 3I5PA 1OCCC 1GS9A 2A69F 3C8ZA 4PJJA 5A69A 1Z63A 2LD6A 3FVYA 3HNLA 3KYIA 2Y3DA 2M4EA 4JURI 2YEVA 2V26A 3V7OA 2KJGA 3B71A 3LLIA 4WABA 3H2VA 4IJJA 3LLKA 1VYIA 3W8HA 4Q4ZF 2GA0A 4XPWA 2FFHA 2M64A 2VASA 2XL4A 4MVMA 3ZDLA 3AG2C 3ABMC 1V55C 4CDVA 2XLVA 3EGXA 4FWVA 2XLWA 4JCZA 4CSAA 3FOPA 2H7BA 2OU6A 1OW7A 4XWJA 1UG7A 1XWJA 3ABLC 1QVXA 1RKEA 2EPNA 5JT4A 3Q7LA 5CIVA 1OQCA 4CJGA 3EGXB 2UUIA 3C18A 3ZTZA 2P0NA 1TFKB 3NYLA 1GQAA 2PFDA 3R2PA 1TWHA 5COGA 3PHF2 1A7EA 2HJ3A 1K05A 1N1CA 3OA1A 2PX0A 3NMIA 3PMRA 4ER9A 3B0VC 3SXZA 1TWGA 4DVZA 2XS8A 4HFFB 2YLDA 2A6EF 1Z3IX 1OKKD 2KQ9A 2DYRC 2MYSA 1VLSA 1ZHYA 2ZXWC 3E9VA 2Y3HA 1K04A 3FDQA 2KSFA 3LUTB 3FMSA 1Q0DA 4JIOA 4L6RA 4ONSA 5KYUA 1LM3B 2XM0A 1FFHA 1SR2A 3LAYA 4WJ0A 3DJNB 4QDLA 3NDBB 3L8IA 1PD1A 1JOGA 3Q7GA 4LLEA 3W2VA 3ZQVA 2HMQA 5KYUB 1KTMA 1YZCA 5E33A 3HNJA 1ZHZA 2B0JA 3LESA 1AEPA 2G3KA 2YLIA 2DI3A 4KNWA 4LDKA 2PF4E 1WOLA 4P6IC 2YWAA 4AE4A 3T4RA 3U2MA 3ZG1A 2L6HA 3CQZA 1BZ4A 4DRIB 2J0XA 3PCVA 5AC4A 3WG7C 1NSGB 4AE4B 1LKXA 2EILC 2R02A 5A6BA 1JPJA 1MNDA 1U89A 2XLOA 4U5BE 4K1OA 2J9VA 3SXKA 3RQEA 5D92A 4MVRA 1M57C 1G4WR 4N6HA 2HJMA 2VC9A 5A6JA 2YL0A 4IWBA 5IY5C 4X0RA 3N2ZB 2H8AA 4U5GA 5DQTA 2VCCA 2MHRA 3CAXA 4MW8A 2X0CA 1RKCA 1EA8A 4YJWA 1YYJA 2R7RA 4AK9A 3K1IC 2NSGA 2UUHA 2WL8A 4YT4A 2DB4A 2EPOA 3J06A 1BR4A 1CGNA 2OKUA 3LJBA 1HE9A 5HSWA 2D4UA 2FAPB 4BJTA 1HMDA 1ZW2A 3K6BA 1YARO 1YVIA 3C7JA 1MMAA 4G7HF 1XZPA 4CS7A 2WVNA 2Q7RA 3GM3A 3M1CB 4O6MA 4YWQA 3F47A 4FESA 1RMVA 1TFOB 2IXMA 3VM6A 3TULA 2W9YA 5DS5A 4IAOA 5B3IA 2LCHA 4BEJA 1APCA 3HNKA
chains in the Genus database with same CATH topology
2LIGA 1VLTA 4Z9HA 2ASRA 3ATPA 1WASA 1JMWA 4Z9JA 3T9OA 1VLSA 2D4UA 1LIHA 4H54A 4Z9IA 1WATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LIG A;  1VLT A;  4Z9H A;  2ASR A;  3ATP A;  1WAS A;  1JMW A;  4Z9J A;  3T9O A;  1VLS A;  2D4U A;  1LIH A;  4H54 A;  4Z9I A;  1WAT A; 
#chains in the Genus database with same CATH topology
 3JCU Q;  5AGF A;  5BQH A;  4DRJ B;  5EHH A;  4KI2 A;  3GWL A;  1CGO A;  2Z15 A;  1HMO A;  1LIH A;  1JPN A;  4W8K A;  5HV9 A;  3AGT A;  2YQY A;  4JC7 A;  4JRZ A;  5JSL A;  2WVO A;  1E2X A;  2NUT A;  5AC5 A;  4CSA C;  3EHM A;  2PBE A;  1Q0G A;  4MVZ A;  1TR2 A;  4DRH B;  5JLI A;  1OCO C;  3F46 A;  1GGQ A;  2CW0 F;  2YKZ A;  5L0H A;  2R05 A;  1YA7 O;  2NUT B;  4PJN A;  1QZX A;  1CPQ A;  1ORY A;  2HSQ A;  1YAU O;  4RDA A;  4DJ9 A;  3DXJ F;  3U5S A;  4PAC A;  3TD7 A;  1C03 A;  1HW2 A;  1FNT c;  3NMK A;  3L8J A;  4DOZ A;  1VMA A;  2J7P A;  2LSE A;  3LNM B;  5BUO A;  3C8G D;  4CIP A;  3AG3 C;  2B0H A;  1YLM A;  4Q7C A;  1ZYR F;  4YL0 A;  4Z9J A;  2MWQ A;  3W2W A;  4C3D A;  4EBB A;  2P61 A;  2KW3 C;  3RVY A;  1Z23 A;  1EQ1 A;  2CYD A;  1R5I D;  2CCY A;  3M4B A;  5F5H A;  4DXW A;  2A0B A;  1T6I A;  3HJC A;  4IB4 A;  2KYH A;  3HKK A;  1U0B B;  2XXA A;  3T9O A;  2ZXR A;  4IAR A;  1Y4C A;  2Q9C A;  2L6F A;  4XEK A;  3SEO A;  1Q0K A;  2R03 A;  1FFT C;  3EQL F;  4XLP F;  4LER A;  1GM5 A;  2W4M A;  5B1B C;  2XXA B;  2ZXP A;  4J7T A;  5T3W A;  1D1C A;  4LAC B;  3IQC A;  1AUE A;  1LE4 A;  3IEE A;  4U9E A;  5COM A;  3M15 A;  3DMD A;  4OIP F;  4KBL A;  1Z5Z A;  1LVK A;  3EG9 A;  5L0I A;  3QZC A;  2QUP A;  3NG1 A;  1WAS A;  3FAP B;  3KYJ A;  2XS1 A;  3L0I A;  1HY5 A;  3DM9 B;  1C02 A;  3FAJ A;  3US6 A;  3GM1 A;  4CJO A;  3C62 A;  3EG9 B;  1MMN A;  3AQC A;  1OCR C;  3DJU B;  3NRH A;  3U3F A;  1E83 A;  5COF A;  4MVS A;  5BQG A;  4XLN F;  1KNY A;  1TWC A;  1RCP A;  3N0T A;  4HEA J;  1KU2 A;  4K0D A;  4C3B A;  4E17 A;  2J45 A;  4NQF A;  1NLX A;  2HFI A;  5K0I A;  4O7G A;  2J9B A;  4I44 A;  1E86 A;  3H2U A;  2YZS A;  3S84 A;  3BRJ A;  2IOQ A;  3U3B A;  4MTF A;  3M4C A;  4CBE A;  1WGW A;  3EHN A;  3IPM O;  3L1M A;  3S29 A;  3SXM A;  3TOL A;  4PFO A;  1RKE B;  4JZA A;  1YDI A;  3SP1 A;  4U5C E;  1T5O A;  1JRA A;  2DGJ A;  3U9M A;  2C03 A;  2R7S A;  3ASO C;  1Z7Q c;  2IYL D;  2KNH A;  5T1D B;  3ZQY A;  3KKB A;  2VH3 A;  4D4X A;  5EK0 A;  3RYL A;  1C17 M;  1PV3 A;  3JSZ A;  3AJM A;  1H9G A;  3V5X A;  1FTS A;  2KGO A;  1OXK A;  2HSB A;  4ZLD A;  2Q9A A;  1VB5 A;  3AGU A;  3BEH A;  4IRU A;  4CS9 A;  4G7Z F;  1W2W A;  2HUJ A;  3KL4 A;  4WGY A;  3RKO F;  3EJN A;  4PR9 A;  1XZQ A;  3UNG C;  4YK5 A;  2NUP A;  2R25 A;  5DLJ A;  4YT2 A;  3AOU A;  1E84 A;  4H54 A;  4CX9 A;  2EPL X;  1QPU A;  2HKV A;  1H7I A;  5DQZ A;  5KYN A;  1E85 A;  1MQV A;  2NUP B;  4PJM A;  3T6J A;  5L0F A;  3NMJ A;  3TK0 A;  1LS4 A;  2R9R B;  1TKN A;  2LK4 A;  1TWA A;  3MBG A;  4JEA A;  1BR1 A;  2W4B A;  2IXP A;  3FHD A;  3Q6M A;  2YL1 A;  4P9T A;  2HS5 A;  1YA9 A;  2XL8 A;  4XEV A;  2NSF A;  4N4W A;  2LP4 A;  4GEH A;  1I5N A;  3UGP A;  2GFH A;  2Y3G A;  4CS8 C;  5A6K A;  4ULV A;  3IHU A;  2EPM X;  4C7O A;  4MTO A;  3DZA A;  3UMI A;  2W45 A;  1D0Y A;  1QLE C;  4C3E A;  1H6G A;  1MNE A;  3TOM A;  2CNW D;  4C7O B;  1AVO B;  3E70 C;  1ZZP A;  3O55 A;  2BL2 A;  5BQI A;  1HW1 A;  2EIJ C;  4WGZ A;  4EUK B;  1Y6D A;  3IQT A;  5CI9 A;  4FX5 A;  1M56 C;  2Y3B A;  4U5E E;  2KC3 A;  1RXQ A;  4I1M A;  4UDV A;  5KYY A;  3POV A;  2HV7 A;  4OIQ F;  2R7O A;  5L3Q A;  4ULW A;  3SXY A;  3KMI A;  3ITF A;  3SZR A;  1VK5 A;  2ETS A;  2XLD A;  3HLZ A;  2GAQ A;  1T6U A;  3AG1 C;  4HE8 D;  4NY3 A;  5CI8 A;  3RQG A;  3S28 A;  3ZC4 A;  3ZVR A;  3S90 A;  2A1D D;  3ZIB A;  1JR8 A;  1VLT A;  4Z9H A;  3GWN A;  1B68 A;  3C8G A;  3DKA A;  3WAQ A;  1I4Y A;  4J30 B;  3NYJ A;  4Q5S F;  4F4B A;  1L7C A;  2EIN C;  4MW3 A;  1G5Z A;  3S0X A;  3U0C A;  2YL3 A;  3B29 A;  1JMW A;  1ST6 A;  4BJ5 A;  3EH2 A;  1ORS C;  3MYI A;  5L0D A;  3U2L A;  2GDC A;  2YRF A;  2EPK X;  2YHS A;  3U8P A;  4RD9 A;  4NTB A;  1NG1 A;  2KK1 A;  2BC5 A;  4E7Z A;  2OEX A;  4YT5 A;  4CDY A;  1EI7 A;  4LLC A;  1NBB A;  3Q6N A;  3ECS A;  4MND A;  4O6N A;  2Q9B A;  1S05 A;  4NTF A;  4RBN A;  3M79 A;  4I3M A;  2J0W A;  3JTL O;  4CS8 A;  2C04 A;  2CDQ A;  2I8B A;  4GQH A;  1QQ3 A;  2R7T A;  3LS0 A;  4BEM J;  1UFB A;  1F1M A;  2E87 A;  2V3C C;  2D5R B;  2DYS C;  1G8X A;  3OEO A;  2YL7 A;  5A6A A;  3CSK A;  2NG1 A;  2OCC C;  1I4Z A;  2ZPA A;  4U5H A;  3LNR A;  2J9U A;  2H7O A;  5E2Q A;  1BDJ B;  2OJQ A;  3NYM A;  3CEX A;  5E3A A;  4ZLC A;  2XLE A;  4CS9 C;  3LS1 A;  4OD5 A;  1EKY A;  3DE9 A;  4JCH A;  4N6C A;  3JRM O;  3LEV A;  2IM8 A;  3GEE A;  4U5F E;  4AX2 A;  4BJ6 A;  3K66 A;  3WOD F;  3T6B A;  1Q0F A;  1LI5 A;  4N06 A;  3X2Q C;  4D4N A;  2P7V A;  2FGY A;  3N24 A;  2L9J A;  1CPR A;  2WZL A;  5JRA A;  3DAG A;  4JEB A;  2WB7 A;  1S7Z A;  3T6G B;  2X51 A;  1Q0M A;  2LFF A;  1O87 A;  3B9Q A;  4JTA B;  3U9J A;  5L0C A;  1MMD A;  3OWT A;  1OKK A;  2PNO A;  2Q4F A;  2YLG A;  3MFN A;  4LDR A;  1VOM A;  3S27 A;  1FMW A;  2OQM A;  3JRT A;  3UMK A;  3DM5 A;  1D0X A;  4MVO A;  4BJ1 A;  1RJ9 A;  4EBK A;  1LI7 A;  1SMY F;  2AU5 A;  3S9O A;  2IBF A;  3FOO A;  1WTY A;  4B6I A;  1RJ9 B;  1K40 A;  1WWP A;  3EPV A;  4AL1 A;  5KYW A;  2OG2 A;  1J8Y F;  2L81 A;  3K33 A;  3JZ0 A;  3V5Z A;  2VCA A;  1VTM P;  4G0H A;  1OCZ C;  2P1A A;  3UGO A;  4MS2 A;  1QSP A;  5KYW B;  3MX3 A;  3GEI A;  4IGG A;  4OD4 A;  4U5D E;  3W4Y A;  3ABK C;  3FXH A;  1H9T A;  4W8P A;  4JVS A;  2JX0 A;  1ORJ A;  4JTC B;  3TQO A;  5JUA A;  4U9D A;  2IXO A;  3EFO A;  2WVQ A;  3IQ6 A;  2R7X A;  4MVQ A;  1L3P A;  2J7P D;  2QNL A;  2XL6 A;  2G3V A;  2R7W A;  1V4A A;  1HE1 A;  3EFO B;  3NKE A;  4YL3 A;  2QE9 A;  1TQG A;  1M6T A;  1SYQ A;  2ZXO A;  3AG4 C;  3RFY A;  3UMH A;  4EKW A;  1MMG A;  3RIP A;  3SNH A;  4DBR A;  2J8W A;  2A68 F;  1O3U A;  2XLH A;  1DOV A;  2OOC A;  4MTG A;  4GYT A;  3I5Q A;  3QTH A;  4PFP A;  2CNW A;  1V54 C;  4J32 B;  3K1H A;  4K7B A;  3RF3 A;  4DBQ A;  3ZSU A;  2PP4 A;  1M2O A;  2PX3 A;  4OIR F;  5L0G A;  3RW0 A;  3VF0 A;  2LFD A;  5T3T A;  4E0H A;  5JS5 A;  2VCB A;  2RD9 A;  4BJ5 C;  4XEF A;  1OW6 A;  5D91 A;  3ASN C;  2O9X A;  4M63 A;  5EGY A;  1G4U S;  3QW0 A;  5B3S C;  3VYW A;  2A6H F;  3QMK A;  3G50 A;  3AQB A;  5L3V A;  1A7D A;  2AWC A;  4YL1 A;  2EIM C;  2NPU A;  3ATP A;  3EZI A;  4PK4 A;  1SF8 A;  2R7U A;  1OXB A;  3IQ5 A;  4JJG A;  4QI0 A;  4CIH A;  1T01 A;  2JPU A;  256B A;  2BE5 F;  3H65 A;  1ZU4 A;  4EIY A;  3HTK C;  4JJF A;  4CDA A;  3HNI A;  3KPH A;  1D1B A;  4PJL A;  1IZM A;  4KNV A;  1A0B A;  4DVY P;  4P9F A;  1D1A A;  2HMZ A;  3UR3 C;  3LEO A;  2Q00 A;  3I4U A;  5DS6 A;  2ZD9 A;  1ZVZ A;  3DI5 A;  4NCQ A;  4KC9 A;  2ICW G;  3G4X A;  1Z6A A;  1IW7 F;  2OJE D;  1FMV A;  4EWC A;  1LPE A;  3G4Z A;  3GAN A;  4H4K C;  4JE9 A;  2Y39 A;  4BJ6 C;  1VYK A;  4YN0 B;  2XLM A;  2AWY A;  1OW8 A;  3WHN A;  1SZI A;  4JW1 A;  3RQF A;  1T6Q A;  3O6X A;  4BPM A;  3TJ5 A;  3O39 A;  2OEV A;  2LIG A;  4XTK A;  1U6H A;  4Z9I A;  3R7C A;  2I15 A;  5L0J A;  1FAP B;  3DAF A;  3K7D A;  3KH2 A;  2R7Q A;  1YJG A;  4AL0 A;  3JYY A;  3MYF A;  4O6Y A;  4FAP B;  5KYY B;  4A4A A;  4E7S A;  2P6V A;  3A11 A;  4OIO F;  5F5F A;  4I1O B;  5E3C A;  3V5Y A;  3B0P A;  3QVZ A;  3L34 A;  3C8G B;  4HFK B;  2A0U A;  3EZH A;  1NU9 C;  3VAY A;  2WZG A;  1YZA A;  3C63 A;  3EGD A;  3EH1 A;  4YT8 A;  4XQ1 A;  1NU7 D;  4LDQ A;  4O79 A;  2J46 A;  3GEH A;  1BBH A;  1J8M F;  3GOD A;  1LS1 A;  3X1O A;  3EGD B;  2GWW A;  2H7V C;  3RH3 A;  1CGM E;  1NZE A;  1NFN A;  3JT1 A;  2JD3 A;  2QLA A;  1JAF A;  5A6B D;  2IXN A;  3GOR A;  1ZHX A;  1DOW A;  2CGE A;  5DS4 A;  5TJ5 E;  4R32 A;  5FZT A;  1V74 B;  4A2N B;  2G62 A;  5KYX A;  5F28 E;  2AVK A;  2YVK A;  1ZHT A;  3GM2 A;  4J7Y A;  4JTD B;  3B0U X;  4EHP A;  2L7A A;  5GPG B;  4BG0 A;  4XPX A;  1T9K A;  5KYX B;  4G78 A;  4OIN F;  3NKD A;  3TJ6 A;  5JVE A;  2LQG A;  3QW1 A;  1A41 A;  1LE2 A;  1O5H A;  1D0Z A;  2R7V A;  1BR2 A;  2ASR A;  1M2V A;  2VB6 A;  1ZU5 A;  1WAT A;  2RSE B;  2L6G A;  1PCX A;  3SYN A;  1QKR A;  4NTA A;  5JP7 A;  1ZW3 A;  3ZTM A;  2QTV A;  3W8I A;  1M2V B;  1R4T A;  2EIK C;  2WZF A;  1ZHW A;  2Y69 C;  4E18 A;  2TMV P;  4G7O F;  4QI2 A;  3MLG A;  1YYX A;  1WN0 A;  3QVY A;  1FR0 A;  1NFO A;  3U8V A;  3ZWI A;  2XSE A;  4MVU A;  4XPY A;  5B1A C;  4ANJ A;  3A9C A;  5FCL A;  2XM4 A;  2Q3T A;  4MQ9 F;  3K1I A;  2AP3 A;  4JKV A;  1OR2 A;  3JSE O;  1A7V A;  3CZ6 A;  3DE8 A;  3O10 A;  2J9W A;  5DVW A;  3JYH A;  3PDM P;  2HZ8 A;  2QY9 A;  4IAQ A;  3RVZ A;  1OR3 A;  2HV6 A;  4E0I A;  4EBJ A;  3VRC A;  4NC3 A;  1PD0 A;  2XRH A;  3DD7 A;  2F22 A;  3DWW A;  3I5P A;  1OCC C;  1GS9 A;  2A69 F;  3C8Z A;  4PJJ A;  5A69 A;  1Z63 A;  2LD6 A;  3FVY A;  3HNL A;  3KYI A;  2Y3D A;  2M4E A;  4JUR I;  2YEV A;  2V26 A;  3V7O A;  2KJG A;  3B71 A;  3LLI A;  4WAB A;  3H2V A;  4IJJ A;  3LLK A;  1VYI A;  3W8H A;  4Q4Z F;  2GA0 A;  4XPW A;  2FFH A;  2M64 A;  2VAS A;  2XL4 A;  4MVM A;  3ZDL A;  3AG2 C;  3ABM C;  1V55 C;  4CDV A;  2XLV A;  3EGX A;  4FWV A;  2XLW A;  4JCZ A;  4CSA A;  3FOP A;  2H7B A;  2OU6 A;  1OW7 A;  4XWJ A;  1UG7 A;  1XWJ A;  3ABL C;  1QVX A;  1RKE A;  2EPN A;  5JT4 A;  3Q7L A;  5CIV A;  1OQC A;  4CJG A;  3EGX B;  2UUI A;  3C18 A;  3ZTZ A;  2P0N A;  1TFK B;  3NYL A;  1GQA A;  2PFD A;  3R2P A;  1TWH A;  5COG A;  3PHF 2;  1A7E A;  2HJ3 A;  1K05 A;  1N1C A;  3OA1 A;  2PX0 A;  3NMI A;  3PMR A;  4ER9 A;  3B0V C;  3SXZ A;  1TWG A;  4DVZ A;  2XS8 A;  4HFF B;  2YLD A;  2A6E F;  1Z3I X;  1OKK D;  2KQ9 A;  2DYR C;  2MYS A;  1VLS A;  1ZHY A;  2ZXW C;  3E9V A;  2Y3H A;  1K04 A;  3FDQ A;  2KSF A;  3LUT B;  3FMS A;  1Q0D A;  4JIO A;  4L6R A;  4ONS A;  5KYU A;  1LM3 B;  2XM0 A;  1FFH A;  1SR2 A;  3LAY A;  4WJ0 A;  3DJN B;  4QDL A;  3NDB B;  3L8I A;  1PD1 A;  1JOG A;  3Q7G A;  4LLE A;  3W2V A;  3ZQV A;  2HMQ A;  5KYU B;  1KTM A;  1YZC A;  5E33 A;  3HNJ A;  1ZHZ A;  2B0J A;  3LES A;  1AEP A;  2G3K A;  2YLI A;  2DI3 A;  4KNW A;  4LDK A;  2PF4 E;  1WOL A;  4P6I C;  2YWA A;  4AE4 A;  3T4R A;  3U2M A;  3ZG1 A;  2L6H A;  3CQZ A;  1BZ4 A;  4DRI B;  2J0X A;  3PCV A;  5AC4 A;  3WG7 C;  1NSG B;  4AE4 B;  1LKX A;  2EIL C;  2R02 A;  5A6B A;  1JPJ A;  1MND A;  1U89 A;  2XLO A;  4U5B E;  4K1O A;  2J9V A;  3SXK A;  3RQE A;  5D92 A;  4MVR A;  1M57 C;  1G4W R;  4N6H A;  2HJM A;  2VC9 A;  5A6J A;  2YL0 A;  4IWB A;  5IY5 C;  4X0R A;  3N2Z B;  2H8A A;  4U5G A;  5DQT A;  2VCC A;  2MHR A;  3CAX A;  4MW8 A;  2X0C A;  1RKC A;  1EA8 A;  4YJW A;  1YYJ A;  2R7R A;  4AK9 A;  3K1I C;  2NSG A;  2UUH A;  2WL8 A;  4YT4 A;  2DB4 A;  2EPO A;  3J06 A;  1BR4 A;  1CGN A;  2OKU A;  3LJB A;  1HE9 A;  5HSW A;  2D4U A;  2FAP B;  4BJT A;  1HMD A;  1ZW2 A;  3K6B A;  1YAR O;  1YVI A;  3C7J A;  1MMA A;  4G7H F;  1XZP A;  4CS7 A;  2WVN A;  2Q7R A;  3GM3 A;  3M1C B;  4O6M A;  4YWQ A;  3F47 A;  4FES A;  1RMV A;  1TFO B;  2IXM A;  3VM6 A;  3TUL A;  2W9Y A;  5DS5 A;  4IAO A;  5B3I A;  2LCH A;  4BEJ A;  1APC A;  3HNK A; 
#chains in the Genus database with same CATH homology
 2LIG A;  1VLT A;  4Z9H A;  2ASR A;  3ATP A;  1WAS A;  1JMW A;  4Z9J A;  3T9O A;  1VLS A;  2D4U A;  1LIH A;  4H54 A;  4Z9I A;  1WAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...