4Z9HA

Asp-tar from e. coli
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
165
structure length
165
Chain Sequence
SLFFSSLHHSQKSFVVSNQLREQQGELTSTWDLMLQTRINLSRSAVRMMMDSSNQQSNAKVELLDSARKTLAQAATHYKKFKSMAPLPEMVATSRNIDEKYKNYYTALTELIDYLDYGNTGAYFAQPTQGMQNAMGEAFAQYALSSEKLYRDIVTDNADDYRFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis protein II
publication title Structural Analysis of the Ligand-Binding Domain of the Aspartate Receptor Tar from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Protein binding
total genus 71
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 4z9hA00
1WATA 4Z9JA 1VLSA 2D4UA 2ASRA 2LIGA 4Z9HA 3T9OA 4Z9IA 3ATPA 1LIHA 1VLTA 4H54A 1WASA 1JMWA
chains in the Genus database with same CATH superfamily
2GFHA 4N6HA 3DAFA 5COFA 1QZXA 4OIOF 4XLNF 4AK9A 1ZHTA 3GWLA 1EI7A 2IXPA 1NLXA 1O3UA 5DLJA 4EBBA 1M2VB 3ZIBA 2KSFA 2HMZA 4MW8A 2PBEA 4JTDB 2IOQA 4X0RA 3U5SA 2VASA 1FTSA 3ZWIA 1BBHA 3DI5A 4CSAC 3FAJA 4K1OA 3HJCA 2NSGA 1BR4A 1L7CA 2QTVA 3SYNA 4C7OA 3UGPA 1I4YA 1NSGB 3V5YA 1GQAA 3LNRA 1JRAA 3KYJA 3LUTB 4LERA 3AOUA 1KTMA 1QSPA 3S90A 3K6BA 4JCZA 4PFOA 2M64A 4J30B 4YK5A 2JX0A 3X2QC 3ABKC 4DRIB 1RKEB 3NRHA 4CDAA 1WTYA 1BR1A 1O87A 2YLGA 4AL0A 1SYQA 2LSEA 4DRJB 5BQHA 5EK0A 3I4UA 4OIQF 1FMWA 3IHUA 3EFOA 3K7DA 5CI8A 1LS4A 2Y3HA 3AG4C 4IGGA 1BR2A 2WZGA 2E87A 3NMJA 2L6GA 2B0JA 4YT5A 3K33A 3Q6NA 3S9OA 4OIRF 1V55C 1C03A 5B1BC 2R7SA 4XTKA 4Z9IA 1LI7A 4O79A 1LS1A 1M56C 2DB4A 1RJ9B 1RCPA 3TOMA 3SEOA 3ZDLA 3Q6MA 3U3FA 1N1CA 2YZSA 1XWJA 2XXAA 3UMHA 1Q0MA 5KYWA 4Z9JA 3L1MA 2Q3TA 3ABMC 5L0DA 4C7OB 2HKVA 2HS5A 3T6BA 1Z63A 4LDQA 2XLWA 3MYIA 5KYXB 1I5NA 1D0ZA 2MWQA 5CI9A 1U89A 2I15A 2MYSA 2LFDA 2Y3BA 4XEKA 2OCCC 4JTAB 2DGJA 3SXZA 5EGYA 1TWAA 3LEOA 2R03A 4QDLA 2YVKA 4MQ9F 4D4NA 2A69F 3DM5A 1JR8A 2OJQA 4DXWA 3G50A 1HW2A 2RD9A 1V4AA 4FESA 1AUEA 1LPEA 1Z5ZA 1ZHXA 2LD6A 2NUPA 4JURI 4EWCA 4K0DA 5KYYB 1GS9A 1F1MA 4YT8A 1TWHA 2IM8A 3S84A 1VYIA 1ZZPA 2J0WA 4YJWA 2XSEA 3RF3A 2J45A 5JUAA 1OCRC 3JSZA 2HZ8A 3GEEA 2J8WA 4QI0A 4R32A 4U5HA 3W4YA 5FZTA 4U5EE 3NYLA 2J7PD 3S28A 2WZFA 3U8PA 5JT4A 3AQBA 4XEVA 3DJUB 3EHNA 1LKXA 1ZVZA 4IRUA 3TK0A 4U9EA 2R7TA 1JAFA 4MNDA 5HSWA 3NMIA 4EHPA 4J7TA 4HEAJ 1D1BA 4A4AA 2XXAB 1YA7O 5E3AA 2IXNA 4XPWA 5GPGB 1IW7F 1CGOA 1APCA 1TWGA 1M2VA 2W4MA 1S05A 3AG3C 1J8YF 4F4BA 3ZQYA 4G78A 3U2MA 1QQ3A 1G5ZA 1HE1A 1CPRA 2LIGA 1T9KA 1TFOB 2HJMA 1OQCA 1XZQA 3GM1A 4JEBA 4CS9A 5KYUA 2OU6A 2L6HA 2XL6A 2ZXRA 2Y69C 3BEHA 4DJ9A 3HKKA 1B68A 5B3IA 1WOLA 5A6JA 1K40A 4MS2A 3CEXA 3IQ6A 5B1AC 2R02A 2EPNA 1ZU4A 5L0CA 2Q9AA 5L0GA 2D5RB 3AG2C 2V3CC 4J7YA 4NTFA 4IARA 3KKBA 4WJ0A 1Y4CA 2BL2A 2NUPB 4DBQA 1ZW3A 4CIHA 2XLOA 3LEVA 1NFOA 1NFNA 3PDMP 2M4EA 3C63A 5HV9A 1RKEA 3S27A 2PF4E 3SNHA 2RSEB 1ZHYA 3ECSA 4NC3A 4ZLCA 3NDBB 4MVQA 5DS5A 4RBNA 2J7PA 4BJ6C 1OKKD 4E17A 2J9WA 1CGME 3HNLA 4Q7CA 3O10A 2HV6A 4FWVA 1DOVA 2XM4A 2PNOA 3V7OA 1T6IA 3E9VA 4U5GA 1VB5A 2CNWA 2QNLA 3J06A 3FXHA 3TULA 3B0UX 1EKYA 4K7BA 2EIMC 3NG1A 3ABLC 3SXKA 3DAGA 1MQVA 3G4XA 2NUTB 3B0PA 1RJ9A 4RDAA 2DYRC 5JS5A 2J46A 5A69A 2LP4A 5K0IA 1D1AA 4XPXA 4HFFB 3O6XA 2XLVA 3H2VA 2LQGA 3ZVRA 1D1CA 2YL1A 4FX5A 2H7BA 5KYUB 3UGOA 1OCOC 2KGOA 2P6VA 3RYLA 4G7OF 2YHSA 4O6MA 3T9OA 1FMVA 2TMVP 3KL4A 4MVZA 2VC9A 5AGFA 4ULVA 5DQZA 1OR3A 5AC5A 4Q5SF 4HFKB 4MTFA 4BEMJ 3S0XA 3I5PA 4P9FA 2HSBA 1ORYA 5KYXA 2EPMX 1OKKA 2KK1A 2X0CA 5FCLA 3C62A 3KPHA 3Q7GA 5KYYA 2LFFA 1TR2A 2UUIA 4OIPF 4OD5A 5JSLA 5BQGA 5A6AA 3F47A 3AJMA 4BJ5A 4E0IA 4JEAA 4L6RA 4ONSA 3FDQA 4EBJA 3M79A 4N6CA 2XS1A 1CPQA 1ZW2A 4P6IC 4U5BE 1D0XA 2XRHA 2A68F 2OEXA 3RFYA 2GDCA 3U9MA 1WGWA 2R7UA 4NY3A 4CJOA 3C8GD 1VLTA 3RH3A 2WVOA 4YL0A 3IQCA 3RVZA 1ZHWA 4CBEA 2XS8A 2A6EF 2CYDA 2H8AA 4P9TA 3N0TA 3W2VA 4BJ5C 1C02A 1YVIA 1ZU5A 4Q4ZF 2G62A 4O7GA 1LI5A 1Q0FA 2OOCA 4N06A 3X1OA 4KI2A 1QKRA 3O55A 3WODF 4FAPB 4MVUA 3F46A 3GANA 5L3QA 1CGNA 2D4UA 2Y3DA 2R7OA 3GM2A 3HNIA 1E2XA 3IQ5A 4JTCB 3G4ZA 1ORJA 2AP3A 2IXOA 3DJNB 3LLIA 4WABA 5EHHA 3U0CA 3UMKA 4JE9A 3GWNA 2C03A 3TJ6A 2HMQA 2HUJA 2L6FA 4JCHA 2VH3A 3MX3A 4XEFA 4C3DA 4DVYP 1JPNA 2R7XA 4H4KC 3DE8A 1G4US 1AEPA 1U6HA 2QY9A 4PACA 1EQ1A 3B9QA 1G4WR 2R25A 1ZYRF 4KNWA 3VAYA 2A6HF 3GEIA 4JRZA 4MVSA 3ZG1A 1RXQA 3JT1A 1A7EA 5JLIA 3AQCA 3WG7C 2R9RB 4MTGA 4U9DA 3RQFA 3L0IA 4CS8A 2Y3GA 1HY5A 1WATA 2W4BA 3LS0A 5L0HA 2A0BA 1H9GA 4DOZA 1YYJA 1XZPA 2KW3C 2PP4A 4U5CE 2Q9BA 4IJJA 1LE2A 4JIOA 4PR9A 1PD1A 2J9BA 3FAPB 2GWWA 2GAQA 5L0FA 2WB7A 4I44A 1E83A 4RD9A 5A6BD 2NUTA 5BQIA 4PJNA 4MVRA 2V26A 3EJNA 4OD4A 4BJ1A 3K1IA 3MBGA 3V5XA 2LCHA 3PHF2 2XLMA 1Q0GA 3H2UA 4LDRA 4JC7A 2YLDA 5COGA 4YT4A 2YWAA 1H9TA 1OCZC 2FFHA 2FGYA 4NTBA 1YZCA 1L3PA 3KYIA 3GORA 5E2QA 4EUKB 4EBKA 4IB4A 2DYSC 2NSFA 4I3MA 1WWPA 1HE9A 2GA0A 2AWYA 3ZTZA 5IY5C 4ZLDA 3MLGA 4JW1A 3R7CA 2EPLX 3FMSA 1SMYF 2XLDA 3QMKA 3NKDA 4LLCA 3R2PA 2CW0F 3UNGC 4B6IA 3OWTA 1G8XA 3QVYA 3K1IC 3EPVA 3DXJF 2DI3A 3ATPA 3NKEA 2EPOA 1EA8A 3RQGA 3LNMB 2AU5A 1LVKA 2AWCA 3MFNA 2JD3A 1T01A 4I1MA 4EIYA 4CS9C 2IBFA 2MHRA 3POVA 3DMDA 3FOOA 3GEHA 1Q0DA 5T3TA 3DE9A 2YLIA 5F28E 1O5HA 3C8GB 1VYKA 3EGDB 4G7ZF 3W8IA 1NBBA 1SZIA 2ASRA 3HLZA 3OEOA 1M6TA 5D91A 3T6JA 3L34A 1VTMP 5A6BA 2WZLA 1IZMA 4HE8D 2G3VA 5DS6A 5L3VA 1E85A 3DM9B 5A6KA 4C3EA 1W2WA 5B3SC 2PX0A 3RIPA 2XLHA 2YRFA 3QZCA 3MYFA 3DD7A 4XLPF 3DKAA 2YEVA 2YQYA 1KNYA 4DRHB 1PV3A 2R7RA 3M4BA 3KMIA 4AL1A 1LIHA 4E7ZA 2BC5A 1HMDA 3FVYA 3SP1A 1OW6A 1C17M 3EHMA 1Z23A 4MW3A 4I1OB 2OG2A 1Z7Qc 2KQ9A 5L0JA 2OJED 2R05A 1H6GA 1BZ4A 3N2ZB 2CCYA 2R7QA 2X51A 3CQZA 2A0UA 2P61A 4CS7A 5F5FA 1MMNA 1LE4A 2W9YA 3DWWA 4E7SA 2VCCA 2Q7RA 4C3BA 1FNTc 2ZD9A 3HTKC 3JRTA 1LM3B 4CX9A 3GODA 1JOGA 3TJ5A 2H7VC 2KJGA 4BPMA 3EH2A 4NCQA 3CSKA 3IEEA 2R7VA 1VK5A 3M1CB 4IAOA 3U9JA 3QVZA 1KU2A 2IYLD 3O39A 5DS4A 1YA9A 3Q7LA 1V54C 3EZHA 4JJGA 4MVOA 3TQOA 2HV7A 4GEHA 1TQGA 1VLSA 3NYJA 1BDJB 3C18A 2ICWG 5KYNA 2P0NA 5CIVA 2Q4FA 3US6A 4NQFA 4W8KA 1MMDA 3VYWA 4JZAA 1JMWA 3AG1C 4W8PA 5COMA 3RQEA 4AE4A 2VB6A 3LS1A 3VM6A 3ZC4A 3TOLA 4MTOA 1ST6A 3LLKA 3C7JA 3UMIA 3NYMA 2P7VA 2Q00A 1E84A 1AVOB 2QE9A 2BE5F 2HSQA 2H7OA 1NZEA 3A11A 4KC9A 3A9CA 2IXMA 3JYHA 3LAYA 4G0HA 1FFTC 2EIKC 3ASNC 2VCAA 2JPUA 3E70C 3ASOC 5L0IA 1GM5A 1TFKB 1PCXA 3U3BA 2EPKX 4UDVA 2B0HA 2Y39A 5T1DB 1TKNA 1VOMA 1OR2A 4M63A 1FFHA 1OCCC 4MVMA 1HW1A 1Z6AA 2KC3A 2KNHA 4U5FE 1RMVA 2J0XA 2ZXOA 2J9UA 2HJ3A 3EG9B 2L7AA 1D0YA 2XL4A 3IPMO 4PJMA 3AGUA 3CAXA 4H54A 3SXYA 1YJGA 3JRMO 2L9JA 1A0BA 1A7DA 4YL1A 3WAQA 2QLAA 2W45A 3M15A 2G3KA 3B29A 2OKUA 2ZXWC 3LJBA 3U8VA 3NMKA 1QPUA 2J9VA 2FAPB 4J32B 1MMAA 2ZXPA 3FHDA 4ER9A 4YWQA 1YLMA 5JVEA 5TJ5E 4PK4A 1YARO 1RKCA 1YZAA 1S7ZA 1ZHZA 4E0HA 4JVSA 4IWBA 2CGEA 4CIPA 1J8MF 1JPJA 3DZAA 4GYTA 3M4CA 4AE4B 2AVKA 3C8GA 3EGDA 4A2NB 5AC4A 3HNKA 1GGQA 3OA1A 1A41A 1V74B 2CDQA 2EILC 2L81A 3JSEO 2EINC 1K05A 4ANJA 1QVXA 4JKVA 4OINF 2YL3A 3QW0A 1ORSC 4NTAA 3PCVA 3RKOF 3TD7A 4QI2A 1H7IA 4LDKA 4PJJA 3AGTA 2P1AA 4GQHA 3VF0A 3V5ZA 2UUHA 1Q0KA 2R7WA 1T6UA 1FAPB 1SF8A 5DVWA 4CS8C 3HNJA 2LK4A 3JZ0A 5BUOA 2I8BA 4E18A 2OQMA 1OW7A 4XPYA 1PD0A 1UG7A 3I5QA 4DVZA 1T6QA 3EFOB 3KH2A 1WN0A 3QW1A 3SXMA 4N4WA 3UR3C 3L8IA 1HMOA 2O9XA 4O6YA 3CZ6A 2XLEA 3L8JA 1OXBA 3W2WA 3EQLF 3IQTA 3B71A 3LESA 5D92A 4YT2A 3K66A 4XWJA 3WHNA 3EGXA 3H65A 3VRCA 4CJGA 4YL3A 1QLEC 3C8ZA 5DQTA 1VMAA 4JJFA 2C04A 4PFPA 3U2LA 1A7VA 2WVNA 2YKZA 2Z15A 1E86A 3S29A 2EIJC 3QTHA 2CNWD 1NU9C 4WGZA 4LACB 3EH1A 4XQ1A 3FOPA 3RVYA 4D4XA 5KYWB 1SR2A 1UFBA 3SZRA 4BG0A 4LLEA 3B0VC 3K1HA 1YAUO 4IAQA 3ZTMA 2VCBA 5JRAA 4KNVA 1MMGA 1Y6DA 2OEVA 4KBLA 4AX2A 3EZIA 2WL8A 1Z3IX 1R5ID 1NU7D 3JTLO 3RW0A 1I4ZA 1WASA 3JCUQ 4BJ6A 2Q9CA 2WVQA 3T4RA 1MNDA 1M2OA 2PFDA 4CDVA 1MNEA 1T5OA 2HFIA 3JYYA 2NPUA 1NG1A 1YYXA 3ITFA 256BA 4U5DE 5F5HA 4BEJA 2XL8A 2YL7A 4ULWA 1OXKA 2ZPAA 2YL0A 3BRJA 3T6GB 1DOWA 2PX3A 1TWCA 2QUPA 1YDIA 5JP7A 5T3WA 4EKWA 1U0BB 3W8HA 4YN0B 2ETSA 2NG1A 2XM0A 3PMRA 5E33A 4BJTA 4G7HF 1FR0A 3ZQVA 4DBRA 1OW8A 3N24A 3EG9A 4PJLA 2A1DD 4CDYA 4O6NA 3EGXB 5E3CA 4CSAA 4Z9HA 4WGYA 3ZSUA 2KYHA 3GM3A 2F22A 1M57C 1K04A 1R4TA
chains in the Genus database with same CATH topology
1WATA 4Z9JA 1VLSA 2D4UA 2ASRA 2LIGA 4Z9HA 3T9OA 4Z9IA 3ATPA 1LIHA 1VLTA 4H54A 1WASA 1JMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAT A;  4Z9J A;  1VLS A;  2D4U A;  2ASR A;  2LIG A;  4Z9H A;  3T9O A;  4Z9I A;  3ATP A;  1LIH A;  1VLT A;  4H54 A;  1WAS A;  1JMW A; 
#chains in the Genus database with same CATH topology
 2GFH A;  4N6H A;  3DAF A;  5COF A;  1QZX A;  4OIO F;  4XLN F;  4AK9 A;  1ZHT A;  3GWL A;  1EI7 A;  2IXP A;  1NLX A;  1O3U A;  5DLJ A;  4EBB A;  1M2V B;  3ZIB A;  2KSF A;  2HMZ A;  4MW8 A;  2PBE A;  4JTD B;  2IOQ A;  4X0R A;  3U5S A;  2VAS A;  1FTS A;  3ZWI A;  1BBH A;  3DI5 A;  4CSA C;  3FAJ A;  4K1O A;  3HJC A;  2NSG A;  1BR4 A;  1L7C A;  2QTV A;  3SYN A;  4C7O A;  3UGP A;  1I4Y A;  1NSG B;  3V5Y A;  1GQA A;  3LNR A;  1JRA A;  3KYJ A;  3LUT B;  4LER A;  3AOU A;  1KTM A;  1QSP A;  3S90 A;  3K6B A;  4JCZ A;  4PFO A;  2M64 A;  4J30 B;  4YK5 A;  2JX0 A;  3X2Q C;  3ABK C;  4DRI B;  1RKE B;  3NRH A;  4CDA A;  1WTY A;  1BR1 A;  1O87 A;  2YLG A;  4AL0 A;  1SYQ A;  2LSE A;  4DRJ B;  5BQH A;  5EK0 A;  3I4U A;  4OIQ F;  1FMW A;  3IHU A;  3EFO A;  3K7D A;  5CI8 A;  1LS4 A;  2Y3H A;  3AG4 C;  4IGG A;  1BR2 A;  2WZG A;  2E87 A;  3NMJ A;  2L6G A;  2B0J A;  4YT5 A;  3K33 A;  3Q6N A;  3S9O A;  4OIR F;  1V55 C;  1C03 A;  5B1B C;  2R7S A;  4XTK A;  4Z9I A;  1LI7 A;  4O79 A;  1LS1 A;  1M56 C;  2DB4 A;  1RJ9 B;  1RCP A;  3TOM A;  3SEO A;  3ZDL A;  3Q6M A;  3U3F A;  1N1C A;  2YZS A;  1XWJ A;  2XXA A;  3UMH A;  1Q0M A;  5KYW A;  4Z9J A;  3L1M A;  2Q3T A;  3ABM C;  5L0D A;  4C7O B;  2HKV A;  2HS5 A;  3T6B A;  1Z63 A;  4LDQ A;  2XLW A;  3MYI A;  5KYX B;  1I5N A;  1D0Z A;  2MWQ A;  5CI9 A;  1U89 A;  2I15 A;  2MYS A;  2LFD A;  2Y3B A;  4XEK A;  2OCC C;  4JTA B;  2DGJ A;  3SXZ A;  5EGY A;  1TWA A;  3LEO A;  2R03 A;  4QDL A;  2YVK A;  4MQ9 F;  4D4N A;  2A69 F;  3DM5 A;  1JR8 A;  2OJQ A;  4DXW A;  3G50 A;  1HW2 A;  2RD9 A;  1V4A A;  4FES A;  1AUE A;  1LPE A;  1Z5Z A;  1ZHX A;  2LD6 A;  2NUP A;  4JUR I;  4EWC A;  4K0D A;  5KYY B;  1GS9 A;  1F1M A;  4YT8 A;  1TWH A;  2IM8 A;  3S84 A;  1VYI A;  1ZZP A;  2J0W A;  4YJW A;  2XSE A;  3RF3 A;  2J45 A;  5JUA A;  1OCR C;  3JSZ A;  2HZ8 A;  3GEE A;  2J8W A;  4QI0 A;  4R32 A;  4U5H A;  3W4Y A;  5FZT A;  4U5E E;  3NYL A;  2J7P D;  3S28 A;  2WZF A;  3U8P A;  5JT4 A;  3AQB A;  4XEV A;  3DJU B;  3EHN A;  1LKX A;  1ZVZ A;  4IRU A;  3TK0 A;  4U9E A;  2R7T A;  1JAF A;  4MND A;  5HSW A;  3NMI A;  4EHP A;  4J7T A;  4HEA J;  1D1B A;  4A4A A;  2XXA B;  1YA7 O;  5E3A A;  2IXN A;  4XPW A;  5GPG B;  1IW7 F;  1CGO A;  1APC A;  1TWG A;  1M2V A;  2W4M A;  1S05 A;  3AG3 C;  1J8Y F;  4F4B A;  3ZQY A;  4G78 A;  3U2M A;  1QQ3 A;  1G5Z A;  1HE1 A;  1CPR A;  2LIG A;  1T9K A;  1TFO B;  2HJM A;  1OQC A;  1XZQ A;  3GM1 A;  4JEB A;  4CS9 A;  5KYU A;  2OU6 A;  2L6H A;  2XL6 A;  2ZXR A;  2Y69 C;  3BEH A;  4DJ9 A;  3HKK A;  1B68 A;  5B3I A;  1WOL A;  5A6J A;  1K40 A;  4MS2 A;  3CEX A;  3IQ6 A;  5B1A C;  2R02 A;  2EPN A;  1ZU4 A;  5L0C A;  2Q9A A;  5L0G A;  2D5R B;  3AG2 C;  2V3C C;  4J7Y A;  4NTF A;  4IAR A;  3KKB A;  4WJ0 A;  1Y4C A;  2BL2 A;  2NUP B;  4DBQ A;  1ZW3 A;  4CIH A;  2XLO A;  3LEV A;  1NFO A;  1NFN A;  3PDM P;  2M4E A;  3C63 A;  5HV9 A;  1RKE A;  3S27 A;  2PF4 E;  3SNH A;  2RSE B;  1ZHY A;  3ECS A;  4NC3 A;  4ZLC A;  3NDB B;  4MVQ A;  5DS5 A;  4RBN A;  2J7P A;  4BJ6 C;  1OKK D;  4E17 A;  2J9W A;  1CGM E;  3HNL A;  4Q7C A;  3O10 A;  2HV6 A;  4FWV A;  1DOV A;  2XM4 A;  2PNO A;  3V7O A;  1T6I A;  3E9V A;  4U5G A;  1VB5 A;  2CNW A;  2QNL A;  3J06 A;  3FXH A;  3TUL A;  3B0U X;  1EKY A;  4K7B A;  2EIM C;  3NG1 A;  3ABL C;  3SXK A;  3DAG A;  1MQV A;  3G4X A;  2NUT B;  3B0P A;  1RJ9 A;  4RDA A;  2DYR C;  5JS5 A;  2J46 A;  5A69 A;  2LP4 A;  5K0I A;  1D1A A;  4XPX A;  4HFF B;  3O6X A;  2XLV A;  3H2V A;  2LQG A;  3ZVR A;  1D1C A;  2YL1 A;  4FX5 A;  2H7B A;  5KYU B;  3UGO A;  1OCO C;  2KGO A;  2P6V A;  3RYL A;  4G7O F;  2YHS A;  4O6M A;  3T9O A;  1FMV A;  2TMV P;  3KL4 A;  4MVZ A;  2VC9 A;  5AGF A;  4ULV A;  5DQZ A;  1OR3 A;  5AC5 A;  4Q5S F;  4HFK B;  4MTF A;  4BEM J;  3S0X A;  3I5P A;  4P9F A;  2HSB A;  1ORY A;  5KYX A;  2EPM X;  1OKK A;  2KK1 A;  2X0C A;  5FCL A;  3C62 A;  3KPH A;  3Q7G A;  5KYY A;  2LFF A;  1TR2 A;  2UUI A;  4OIP F;  4OD5 A;  5JSL A;  5BQG A;  5A6A A;  3F47 A;  3AJM A;  4BJ5 A;  4E0I A;  4JEA A;  4L6R A;  4ONS A;  3FDQ A;  4EBJ A;  3M79 A;  4N6C A;  2XS1 A;  1CPQ A;  1ZW2 A;  4P6I C;  4U5B E;  1D0X A;  2XRH A;  2A68 F;  2OEX A;  3RFY A;  2GDC A;  3U9M A;  1WGW A;  2R7U A;  4NY3 A;  4CJO A;  3C8G D;  1VLT A;  3RH3 A;  2WVO A;  4YL0 A;  3IQC A;  3RVZ A;  1ZHW A;  4CBE A;  2XS8 A;  2A6E F;  2CYD A;  2H8A A;  4P9T A;  3N0T A;  3W2V A;  4BJ5 C;  1C02 A;  1YVI A;  1ZU5 A;  4Q4Z F;  2G62 A;  4O7G A;  1LI5 A;  1Q0F A;  2OOC A;  4N06 A;  3X1O A;  4KI2 A;  1QKR A;  3O55 A;  3WOD F;  4FAP B;  4MVU A;  3F46 A;  3GAN A;  5L3Q A;  1CGN A;  2D4U A;  2Y3D A;  2R7O A;  3GM2 A;  3HNI A;  1E2X A;  3IQ5 A;  4JTC B;  3G4Z A;  1ORJ A;  2AP3 A;  2IXO A;  3DJN B;  3LLI A;  4WAB A;  5EHH A;  3U0C A;  3UMK A;  4JE9 A;  3GWN A;  2C03 A;  3TJ6 A;  2HMQ A;  2HUJ A;  2L6F A;  4JCH A;  2VH3 A;  3MX3 A;  4XEF A;  4C3D A;  4DVY P;  1JPN A;  2R7X A;  4H4K C;  3DE8 A;  1G4U S;  1AEP A;  1U6H A;  2QY9 A;  4PAC A;  1EQ1 A;  3B9Q A;  1G4W R;  2R25 A;  1ZYR F;  4KNW A;  3VAY A;  2A6H F;  3GEI A;  4JRZ A;  4MVS A;  3ZG1 A;  1RXQ A;  3JT1 A;  1A7E A;  5JLI A;  3AQC A;  3WG7 C;  2R9R B;  4MTG A;  4U9D A;  3RQF A;  3L0I A;  4CS8 A;  2Y3G A;  1HY5 A;  1WAT A;  2W4B A;  3LS0 A;  5L0H A;  2A0B A;  1H9G A;  4DOZ A;  1YYJ A;  1XZP A;  2KW3 C;  2PP4 A;  4U5C E;  2Q9B A;  4IJJ A;  1LE2 A;  4JIO A;  4PR9 A;  1PD1 A;  2J9B A;  3FAP B;  2GWW A;  2GAQ A;  5L0F A;  2WB7 A;  4I44 A;  1E83 A;  4RD9 A;  5A6B D;  2NUT A;  5BQI A;  4PJN A;  4MVR A;  2V26 A;  3EJN A;  4OD4 A;  4BJ1 A;  3K1I A;  3MBG A;  3V5X A;  2LCH A;  3PHF 2;  2XLM A;  1Q0G A;  3H2U A;  4LDR A;  4JC7 A;  2YLD A;  5COG A;  4YT4 A;  2YWA A;  1H9T A;  1OCZ C;  2FFH A;  2FGY A;  4NTB A;  1YZC A;  1L3P A;  3KYI A;  3GOR A;  5E2Q A;  4EUK B;  4EBK A;  4IB4 A;  2DYS C;  2NSF A;  4I3M A;  1WWP A;  1HE9 A;  2GA0 A;  2AWY A;  3ZTZ A;  5IY5 C;  4ZLD A;  3MLG A;  4JW1 A;  3R7C A;  2EPL X;  3FMS A;  1SMY F;  2XLD A;  3QMK A;  3NKD A;  4LLC A;  3R2P A;  2CW0 F;  3UNG C;  4B6I A;  3OWT A;  1G8X A;  3QVY A;  3K1I C;  3EPV A;  3DXJ F;  2DI3 A;  3ATP A;  3NKE A;  2EPO A;  1EA8 A;  3RQG A;  3LNM B;  2AU5 A;  1LVK A;  2AWC A;  3MFN A;  2JD3 A;  1T01 A;  4I1M A;  4EIY A;  4CS9 C;  2IBF A;  2MHR A;  3POV A;  3DMD A;  3FOO A;  3GEH A;  1Q0D A;  5T3T A;  3DE9 A;  2YLI A;  5F28 E;  1O5H A;  3C8G B;  1VYK A;  3EGD B;  4G7Z F;  3W8I A;  1NBB A;  1SZI A;  2ASR A;  3HLZ A;  3OEO A;  1M6T A;  5D91 A;  3T6J A;  3L34 A;  1VTM P;  5A6B A;  2WZL A;  1IZM A;  4HE8 D;  2G3V A;  5DS6 A;  5L3V A;  1E85 A;  3DM9 B;  5A6K A;  4C3E A;  1W2W A;  5B3S C;  2PX0 A;  3RIP A;  2XLH A;  2YRF A;  3QZC A;  3MYF A;  3DD7 A;  4XLP F;  3DKA A;  2YEV A;  2YQY A;  1KNY A;  4DRH B;  1PV3 A;  2R7R A;  3M4B A;  3KMI A;  4AL1 A;  1LIH A;  4E7Z A;  2BC5 A;  1HMD A;  3FVY A;  3SP1 A;  1OW6 A;  1C17 M;  3EHM A;  1Z23 A;  4MW3 A;  4I1O B;  2OG2 A;  1Z7Q c;  2KQ9 A;  5L0J A;  2OJE D;  2R05 A;  1H6G A;  1BZ4 A;  3N2Z B;  2CCY A;  2R7Q A;  2X51 A;  3CQZ A;  2A0U A;  2P61 A;  4CS7 A;  5F5F A;  1MMN A;  1LE4 A;  2W9Y A;  3DWW A;  4E7S A;  2VCC A;  2Q7R A;  4C3B A;  1FNT c;  2ZD9 A;  3HTK C;  3JRT A;  1LM3 B;  4CX9 A;  3GOD A;  1JOG A;  3TJ5 A;  2H7V C;  2KJG A;  4BPM A;  3EH2 A;  4NCQ A;  3CSK A;  3IEE A;  2R7V A;  1VK5 A;  3M1C B;  4IAO A;  3U9J A;  3QVZ A;  1KU2 A;  2IYL D;  3O39 A;  5DS4 A;  1YA9 A;  3Q7L A;  1V54 C;  3EZH A;  4JJG A;  4MVO A;  3TQO A;  2HV7 A;  4GEH A;  1TQG A;  1VLS A;  3NYJ A;  1BDJ B;  3C18 A;  2ICW G;  5KYN A;  2P0N A;  5CIV A;  2Q4F A;  3US6 A;  4NQF A;  4W8K A;  1MMD A;  3VYW A;  4JZA A;  1JMW A;  3AG1 C;  4W8P A;  5COM A;  3RQE A;  4AE4 A;  2VB6 A;  3LS1 A;  3VM6 A;  3ZC4 A;  3TOL A;  4MTO A;  1ST6 A;  3LLK A;  3C7J A;  3UMI A;  3NYM A;  2P7V A;  2Q00 A;  1E84 A;  1AVO B;  2QE9 A;  2BE5 F;  2HSQ A;  2H7O A;  1NZE A;  3A11 A;  4KC9 A;  3A9C A;  2IXM A;  3JYH A;  3LAY A;  4G0H A;  1FFT C;  2EIK C;  3ASN C;  2VCA A;  2JPU A;  3E70 C;  3ASO C;  5L0I A;  1GM5 A;  1TFK B;  1PCX A;  3U3B A;  2EPK X;  4UDV A;  2B0H A;  2Y39 A;  5T1D B;  1TKN A;  1VOM A;  1OR2 A;  4M63 A;  1FFH A;  1OCC C;  4MVM A;  1HW1 A;  1Z6A A;  2KC3 A;  2KNH A;  4U5F E;  1RMV A;  2J0X A;  2ZXO A;  2J9U A;  2HJ3 A;  3EG9 B;  2L7A A;  1D0Y A;  2XL4 A;  3IPM O;  4PJM A;  3AGU A;  3CAX A;  4H54 A;  3SXY A;  1YJG A;  3JRM O;  2L9J A;  1A0B A;  1A7D A;  4YL1 A;  3WAQ A;  2QLA A;  2W45 A;  3M15 A;  2G3K A;  3B29 A;  2OKU A;  2ZXW C;  3LJB A;  3U8V A;  3NMK A;  1QPU A;  2J9V A;  2FAP B;  4J32 B;  1MMA A;  2ZXP A;  3FHD A;  4ER9 A;  4YWQ A;  1YLM A;  5JVE A;  5TJ5 E;  4PK4 A;  1YAR O;  1RKC A;  1YZA A;  1S7Z A;  1ZHZ A;  4E0H A;  4JVS A;  4IWB A;  2CGE A;  4CIP A;  1J8M F;  1JPJ A;  3DZA A;  4GYT A;  3M4C A;  4AE4 B;  2AVK A;  3C8G A;  3EGD A;  4A2N B;  5AC4 A;  3HNK A;  1GGQ A;  3OA1 A;  1A41 A;  1V74 B;  2CDQ A;  2EIL C;  2L81 A;  3JSE O;  2EIN C;  1K05 A;  4ANJ A;  1QVX A;  4JKV A;  4OIN F;  2YL3 A;  3QW0 A;  1ORS C;  4NTA A;  3PCV A;  3RKO F;  3TD7 A;  4QI2 A;  1H7I A;  4LDK A;  4PJJ A;  3AGT A;  2P1A A;  4GQH A;  3VF0 A;  3V5Z A;  2UUH A;  1Q0K A;  2R7W A;  1T6U A;  1FAP B;  1SF8 A;  5DVW A;  4CS8 C;  3HNJ A;  2LK4 A;  3JZ0 A;  5BUO A;  2I8B A;  4E18 A;  2OQM A;  1OW7 A;  4XPY A;  1PD0 A;  1UG7 A;  3I5Q A;  4DVZ A;  1T6Q A;  3EFO B;  3KH2 A;  1WN0 A;  3QW1 A;  3SXM A;  4N4W A;  3UR3 C;  3L8I A;  1HMO A;  2O9X A;  4O6Y A;  3CZ6 A;  2XLE A;  3L8J A;  1OXB A;  3W2W A;  3EQL F;  3IQT A;  3B71 A;  3LES A;  5D92 A;  4YT2 A;  3K66 A;  4XWJ A;  3WHN A;  3EGX A;  3H65 A;  3VRC A;  4CJG A;  4YL3 A;  1QLE C;  3C8Z A;  5DQT A;  1VMA A;  4JJF A;  2C04 A;  4PFP A;  3U2L A;  1A7V A;  2WVN A;  2YKZ A;  2Z15 A;  1E86 A;  3S29 A;  2EIJ C;  3QTH A;  2CNW D;  1NU9 C;  4WGZ A;  4LAC B;  3EH1 A;  4XQ1 A;  3FOP A;  3RVY A;  4D4X A;  5KYW B;  1SR2 A;  1UFB A;  3SZR A;  4BG0 A;  4LLE A;  3B0V C;  3K1H A;  1YAU O;  4IAQ A;  3ZTM A;  2VCB A;  5JRA A;  4KNV A;  1MMG A;  1Y6D A;  2OEV A;  4KBL A;  4AX2 A;  3EZI A;  2WL8 A;  1Z3I X;  1R5I D;  1NU7 D;  3JTL O;  3RW0 A;  1I4Z A;  1WAS A;  3JCU Q;  4BJ6 A;  2Q9C A;  2WVQ A;  3T4R A;  1MND A;  1M2O A;  2PFD A;  4CDV A;  1MNE A;  1T5O A;  2HFI A;  3JYY A;  2NPU A;  1NG1 A;  1YYX A;  3ITF A;  256B A;  4U5D E;  5F5H A;  4BEJ A;  2XL8 A;  2YL7 A;  4ULW A;  1OXK A;  2ZPA A;  2YL0 A;  3BRJ A;  3T6G B;  1DOW A;  2PX3 A;  1TWC A;  2QUP A;  1YDI A;  5JP7 A;  5T3W A;  4EKW A;  1U0B B;  3W8H A;  4YN0 B;  2ETS A;  2NG1 A;  2XM0 A;  3PMR A;  5E33 A;  4BJT A;  4G7H F;  1FR0 A;  3ZQV A;  4DBR A;  1OW8 A;  3N24 A;  3EG9 A;  4PJL A;  2A1D D;  4CDY A;  4O6N A;  3EGX B;  5E3C A;  4CSA A;  4Z9H A;  4WGY A;  3ZSU A;  2KYH A;  3GM3 A;  2F22 A;  1M57 C;  1K04 A;  1R4T A; 
#chains in the Genus database with same CATH homology
 1WAT A;  4Z9J A;  1VLS A;  2D4U A;  2ASR A;  2LIG A;  4Z9H A;  3T9O A;  4Z9I A;  3ATP A;  1LIH A;  1VLT A;  4H54 A;  1WAS A;  1JMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...