2HMZA

The structures of met and azidomet hemerythrin at 1.66 angstroms resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
113
structure length
113
Chain Sequence
GFPIPDPYCWDISFRTFYTIIDDEHKTLFNGILLLSQADNADHLNELRRCTGKHFLNEQQLMQASQYAGYAEHKKAHDDFIHKLDTWDGDVTYAKNWLVNHIKTIDFKYRGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMERYTHRIN
publication title Structures of met and azidomet hemerythrin at 1.66 A resolution.
pubmed doi rcsb
source organism Themiste dyscritum
molecule tags Oxygen transport
total genus 50
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1990-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 2hmzA00
3WHNA 1A7DA 4XPWA 2AWCA 2AWYA 2AVKA 3AGUA 4XPYA 1I4YA 1A7EA 2HMZA 4XPXA 3AGTA 2MHRA 1I4ZA 1HMOA 3WAQA 4XQ1A 2HMQA 1HMDA
chains in the Genus database with same CATH superfamily
1WWPA 4NY3A 1VYIA 1BDJB 4AX2A 2JD3A 2Y3DA 3GWLA 3UMHA 4JIOA 5F5FA 1Q0GA 4RBNA 1XZPA 4PK4A 1HE1A 2XL4A 3F47A 3EJNA 2DYRC 3JTLO 3LESA 4E0HA 2XLHA 3GM2A 4XPYA 3HLZA 3O10A 4EWCA 4AK9A 3LNMB 4CS9A 4LDRA 5COFA 1LI5A 4BJ1A 2HZ8A 2KQ9A 2EPOA 4YN0B 2J46A 4ULVA 5FCLA 5DQTA 3RH3A 3B9QA 4KC9A 3T4RA 1M56C 1RKEB 3C8GA 1ZHXA 3ZSUA 2Q4FA 1TFKB 4J32B 1B68A 2DB4A 2HSBA 3L34A 2W4BA 1OW7A 4F4BA 1HMDA 4JEAA 4O79A 2TMVP 2UUIA 2KW3C 3IQ6A 1H9GA 1DOVA 3S28A 1JR8A 2CYDA 2QE9A 3HNJA 4KNWA 3CZ6A 3DI5A 1JAFA 2MYSA 3S90A 3I5PA 2PX3A 5E33A 3U8VA 3VM6A 2AP3A 3POVA 4JCHA 2XS1A 1OKKD 1LIHA 1H6GA 2BL2A 3H65A 3ZTZA 3MYFA 3E70C 4DXWA 3U2MA 4BEMJ 4IGGA 3K33A 1WTYA 3ASNC 2DI3A 2YWAA 2LK4A 5JP7A 2HV6A 2DGJA 4DOZA 3M4BA 3EH1A 1EA8A 2GA0A 3BEHA 5L0JA 1Z6AA 4B6IA 3K1HA 3EGDA 2WZFA 4MW8A 4O6YA 1FMVA 4WJ0A 1U0BB 1AEPA 3HNLA 2G3VA 3X1OA 5KYUB 1Z23A 2VH3A 4MTOA 4ONSA 1NFNA 1OCOC 4NTBA 4I1OB 1G5ZA 4DRJB 5KYYA 1BR1A 1CGOA 5BUOA 2XLOA 1TWAA 3O55A 1MMNA 3SP1A 4YT2A 4YT8A 4G7OF 5T3TA 1D0YA 4N06A 3U9MA 1AUEA 2V3CC 3C7JA 4AE4A 4ANJA 4XLPF 2OG2A 3M15A 3GM1A 1E83A 1TKNA 3H2UA 1E86A 2EPKX 3NKDA 2R9RB 4JW1A 5TJ5E 3US6A 1T6QA 3DJNB 4C7OA 5AC4A 3S29A 3PHF2 3BRJA 2FAPB 4O7GA 3DE9A 2OOCA 2Q9BA 1H7IA 1YDIA 3ATPA 1BR4A 1XWJA 4E7SA 1VTMP 3FAPB 1S7ZA 2A1DD 3O39A 5EK0A 3UMKA 2VCCA 3ECSA 4XEVA 1QZXA 1C17M 2ICWG 3NYLA 4QDLA 2YLIA 2D4UA 2CDQA 4E0IA 3A9CA 1LE4A 1GGQA 3B71A 3K6BA 4I44A 3V5ZA 3CEXA 3ZQVA 3NMKA 1VLTA 2EINC 3HNKA 1ZU4A 1K40A 4ULWA 2A68F 2L6FA 2W4MA 4AL0A 2Y69C 1VB5A 1TWGA 3X2QC 4A2NB 5JSLA 4AL1A 2Y3BA 2A6HF 5COGA 1NU9C 1BR2A 3AG1C 3QW1A 4LLCA 2FGYA 4YWQA 5KYXB 3WAQA 5GPGB 2NSFA 3KPHA 3H2VA 2NSGA 3JYYA 3RQEA 3RQGA 2CNWD 1CGNA 4C3DA 3NKEA 3GM3A 2R25A 5KYWB 1CPQA 1RXQA 3Q6NA 2YL7A 3AJMA 3PCVA 1KTMA 2R7WA 4Z9IA 3TQOA 2J9UA 1OKKA 3QTHA 1TR2A 2GWWA 3A11A 2J7PD 3EG9B 5A6BD 3EHNA 2J45A 4G0HA 2Q7RA 4U9EA 3PDMP 3AG4C 1OW6A 1F1MA 2BC5A 2XSEA 3LUTB 3K7DA 1YYXA 2PF4E 1ZHWA 2XM4A 3EPVA 1YA9A 4JE9A 3SYNA 1SZIA 2Q3TA 3TK0A 1RKEA 1YAUO 3NDBB 3EFOB 1TWCA 3NYMA 3RVYA 2M64A 4X0RA 2MHRA 1I4ZA 2P61A 3RF3A 2OJQA 1QQ3A 3DKAA 2F22A 2IOQA 3VF0A 1FMWA 4IARA 1C02A 3SZRA 3WG7C 2HJMA 1NSGB 2KSFA 1CPRA 2XM0A 3GANA 4XEFA 2XL6A 1Y4CA 2LD6A 2EIKC 1M57C 3AG3C 1LKXA 4JKVA 2OJED 3T9OA 3I4UA 1A0BA 3QVZA 1LM3B 2HFIA 1E85A 1BZ4A 1J8MF 1HW1A 2D5RB 2OKUA 3V5YA 1ZHZA 3ZTMA 3DJUB 3GEEA 2R05A 3J06A 4PJLA 4C3EA 2Q9CA 5HSWA 3R2PA 2ZXWC 2J0XA 2EIMC 2C04A 1OXKA 3K1IC 1D1BA 1O3UA 4IRUA 1N1CA 2VC9A 2HUJA 3G50A 4MVZA 256BA 3LEVA 4ER9A 2KGOA 1KU2A 3Q7LA 4C3BA 4NC3A 1HMOA 2I8BA 2WZLA 3IQTA 1YARO 5KYUA 3UNGC 3RW0A 2H8AA 2LCHA 4Q7CA 2P0NA 2XLWA 3M4CA 5DS4A 5F28E 1GM5A 2EIJC 2QUPA 5AGFA 4JEBA 5COMA 2KNHA 1T6UA 3CQZA 3JCUQ 1CGME 3ITFA 4PJNA 2QLAA 3QZCA 1ZYRF 4FESA 2HS5A 3TOLA 4JTDB 2HSQA 3RVZA 3ZDLA 1FFHA 4DBRA 3JYHA 4U5CE 1RJ9A 2HKVA 1VMAA 2A0BA 3ZG1A 3QVYA 1I4YA 4CS7A 3RYLA 1GS9A 5DS5A 3JSEO 4IJJA 4MVQA 3B0UX 2R7XA 2IXMA 4P9TA 1WOLA 1V4AA 1I5NA 2H7BA 5A6KA 1TQGA 3FMSA 1MMGA 2HJ3A 2UUHA 4KNVA 3GEIA 4PFOA 1D0XA 2GFHA 4CDVA 4EBBA 4XQ1A 5E2QA 1ZZPA 4JTAB 4MVSA 4BJ6C 2YVKA 2CCYA 4G78A 4N4WA 3S9OA 1ZVZA 2EILC 1HW2A 2CW0F 3ASOC 2L6GA 1YA7O 1A7DA 3FVYA 1EI7A 3JRTA 4WGYA 4BEJA 2V26A 1TWHA 1ORYA 2A6EF 2G62A 3KH2A 1U89A 3NYJA 1ORJA 4N6HA 2AWYA 4XPWA 3K1IA 2VCAA 2A69F 3T6BA 3FOOA 5D91A 4YK5A 3ABKC 1A7EA 4CSAC 4DJ9A 4I1MA 1G4US 2IM8A 4PJMA 5KYXA 4O6NA 3PMRA 2NUTA 4E17A 1LI7A 4PJJA 4E7ZA 4U5HA 1NG1A 2XRHA 3JZ0A 3SNHA 2RD9A 2VCBA 3EGXA 3U9JA 4EIYA 4DBQA 3OA1A 2Y3HA 2ZD9A 4BPMA 3C8GB 4U5EE 3LEOA 5KYWA 2XXAA 2G3KA 2R7SA 3LS0A 3DM5A 4JVSA 1FAPB 2OU6A 2OQMA 2KJGA 2R7QA 4Z9HA 4A4AA 3VAYA 3EG9A 1GQAA 1NU7D 1M6TA 3IPMO 1UFBA 2DYSC 3IEEA 3ZWIA 3B29A 4UDVA 2C03A 2PNOA 4RD9A 5L0IA 3S84A 2P1AA 2AVKA 4MVRA 4XTKA 3W8IA 2QTVA 3NMJA 4OIRF 3SEOA 3NG1A 3TD7A 2J9BA 4W8KA 3HTKC 2YLDA 5F5HA 4OIOF 1ZHTA 4BJ6A 2LFDA 3C62A 1O5HA 2W9YA 3W2WA 5IY5C 1H9TA 2GDCA 1YZAA 3JSZA 3LAYA 1EKYA 4KBLA 1RMVA 3FOPA 5T3WA 4J30B 3C8GD 5EHHA 3N2ZB 3WODF 2IYLD 2Y3GA 1U6HA 3EGDB 3SXKA 4EBJA 2GAQA 2KC3A 3LNRA 1QKRA 3TJ6A 3FDQA 2R7UA 3U8PA 4ZLCA 4DRIB 4Z9JA 2NUPB 4CSAA 5DVWA 5CI8A 4U5DE 5DS6A 4LLEA 2PBEA 4CJOA 4EUKB 4BJ5C 1M2OA 5CIVA 1T01A 4J7TA 3DE8A 1FNTc 1K05A 1PD1A 1SF8A 3QW0A 2J9WA 2Q00A 5JS5A 2KK1A 4QI2A 1E84A 4Q5SF 2YL3A 3EZHA 5BQGA 2NPUA 4R32A 2A0UA 3ABMC 3UR3C 2Z15A 3TULA 3N0TA 5CI9A 1LPEA 5D92A 4KI2A 4HEAJ 5B3IA 2J8WA 3W8HA 1MQVA 4JZAA 2AU5A 4NQFA 4FAPB 4I3MA 3FAJA 1MNDA 4MW3A 1VK5A 3C63A 4YL0A 3MYIA 4P6IC 3ZIBA 3U2LA 3AG2C 4HE8D 3QMKA 4XEKA 3DAGA 2JX0A 1VYKA 1Z63A 3V5XA 3E9VA 5B3SC 4DVYP 3IQCA 4JJFA 3U3FA 1QLEC 2J9VA 2JPUA 2AWCA 2X51A 4XLNF 1RKCA 1QPUA 1HY5A 1D1AA 1S05A 2M4EA 5B1BC 1LE2A 3MBGA 3HKKA 4U9DA 4YT5A 1ZW2A 5DQZA 4G7HF 4MTFA 2ZXOA 1YZCA 2LP4A 4IAOA 4OIQF 4DVZA 2H7OA 2R03A 2W45A 4K0DA 3JT1A 4N6CA 4BJTA 4MVUA 2EPMX 2P7VA 1D1CA 2IXPA 4G7ZF 1PCXA 1ORSC 1APCA 1R4TA 2QY9A 4JCZA 4U5BE 3V7OA 2R7RA 2XS8A 4OINF 2L9JA 1M2VB 4GQHA 4HFKB 2QNLA 4LERA 4PFPA 2HMQA 1Q0KA 4DRHB 3C18A 2HV7A 1OCRC 4CBEA 5KYNA 3B0VC 2P6VA 1WATA 4CS8C 3KYIA 4CIPA 3F46A 5E3CA 4BJ5A 4C7OB 1ZW3A 2WL8A 2J0WA 4YL3A 4MNDA 1G8XA 4YL1A 4U5FE 2WVNA 2WZGA 4IWBA 3U0CA 2VASA 4QI0A 4U5GA 2XLEA 5BQHA 2L7AA 3AQCA 2R7OA 2I15A 1Q0FA 2OEVA 2O9XA 3GEHA 1EQ1A 3SXMA 1LS1A 3VRCA 3W2VA 1ZU5A 3R7CA 4EBKA 2RSEB 5A69A 3AOUA 1ST6A 4LDKA 3LLIA 1YJGA 2WVOA 2FFHA 1R5ID 3DAFA 4WABA 3HNIA 1AVOB 3RIPA 1DOWA 1WASA 2CNWA 2XLVA 3U3BA 3G4ZA 5DLJA 3HJCA 3MLGA 2LQGA 4O6MA 1J8YF 2YZSA 2B0HA 5T1DB 3SXZA 1FFTC 4JC7A 1Q0DA 3RFYA 2J7PA 3GORA 5A6BA 2CGEA 3LLKA 3G4XA 1A7VA 3KMIA 2KYHA 1SR2A 1G4WR 1YVIA 2OCCC 3AGUA 4JTCB 1V74B 3N24A 1SYQA 5JRAA 2L6HA 4MVMA 1BBHA 4PACA 3FXHA 1JMWA 2HMZA 4OD4A 2B0JA 3RKOF 3SXYA 4XWJA 5L0GA 2R7VA 2IXOA 4YT4A 4GEHA 1FR0A 2ASRA 3T6GB 3EH2A 4E18A 5L3VA 4HFFB 1LVKA 4EHPA 3DM9B 4FX5A 5E3AA 2EPLX 2MWQA 4FWVA 3M79A 4OD5A 4CS8A 1KNYA 2YHSA 3CAXA 4CX9A 1OR2A 3AQBA 1V55C 3GODA 5K0IA 1QSPA 2YL0A 3EHMA 2PX0A 3ZVRA 5AC5A 1PD0A 2YQYA 1XZQA 1L3PA 2NUPA 4IB4A 4MS2A 2R7TA 3FHDA 1RCPA 5L0FA 4RDAA 1D0ZA 4K1OA 5BQIA 1W2WA 5B1AC 1A41A 5L3QA 1T5OA 3EZIA 1V54C 2Q9AA 3GWNA 1MMAA 1JRAA 1FTSA 1T9KA 2LSEA 4JURI 1NBBA 3KKBA 2XLDA 3B0PA 1RJ9B 3EFOA 3S27A 4XPXA 2X0CA 3S0XA 1HE9A 3ABLC 5L0CA 3DZAA 1NLXA 3AGTA 1IW7F 3MFNA 3UGOA 1MMDA 1OQCA 4JJGA 2ZXPA 5JLIA 4PR9A 4CDYA 4CIHA 2ZPAA 1ZHYA 4CDAA 5A6AA 1T6IA 1JPNA 3Q7GA 3L1MA 2WVQA 1TFOB 3C8ZA 4Q4ZF 1Y6DA 4H4KC 1OR3A 1Q0MA 5JT4A 3WHNA 3DD7A 3NMIA 3ZC4A 3Q6MA 3UMIA 1UG7A 2YL1A 1SMYF 1NZEA 1WN0A 4EKWA 5L0DA 3K66A 3O6XA 3JRMO 5HV9A 5KYYB 4K7BA 2H7VC 4LACB 2R02A 3MX3A 4M63A 2EPNA 1M2VA 3ZQYA 4CJGA 1VOMA 4AE4B 4P9FA 2OEXA 3LJBA 2L81A 2XL8A 4NTAA 1OW8A 4MQ9F 1Z7Qc 4CS9C 1QVXA 1O87A 2NUTB 2PFDA 4J7YA 2LFFA 3IHUA 2BE5F 1JOGA 1PV3A 2E87A 4H54A 3EGXB 3OWTA 3CSKA 5JVEA 5L0HA 1OXBA 1K04A 1VLSA 2NG1A 1Z3IX 4BG0A 4D4XA 1IZMA 4L6RA 2XXAB 4ZLDA 1MNEA 1WGWA 2ZXRA 3VYWA 4D4NA 2YRFA 1JPJA 1OCZC 3NRHA 4JRZA 3L8IA 3DXJF 2IBFA 1OCCC 2Y39A 3L8JA 4W8PA 5A6JA 4OIPF 4GYTA 1E2XA 2WB7A 4WGZA 4NCQA 3IQ5A 2YKZA 3M1CB 3UGPA 2ETSA 3LS1A 4YJWA 3RQFA 2YLGA 2PP4A 3KL4A 1NFOA 4IAQA 4LDQA 3TJ5A 3W4YA 3DWWA 5FZTA 1L7CA 1Z5ZA 2YEVA 1C03A 5JUAA 2XLMA 3T6JA 3OEOA 3EQLF 3TOMA 5EGYA 2VB6A 3L0IA 4MVOA 3U5SA 1YLMA 1YYJA 3KYJA 4MTGA 2IXNA 2LIGA 3DMDA 3I5QA 4NTFA 1LS4A
chains in the Genus database with same CATH topology
3WHNA 1A7DA 4XPWA 2AWCA 2AWYA 2AVKA 3AGUA 4XPYA 1I4YA 1A7EA 2HMZA 4XPXA 3AGTA 2MHRA 1I4ZA 1HMOA 3WAQA 4XQ1A 2HMQA 1HMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHN A;  1A7D A;  4XPW A;  2AWC A;  2AWY A;  2AVK A;  3AGU A;  4XPY A;  1I4Y A;  1A7E A;  2HMZ A;  4XPX A;  3AGT A;  2MHR A;  1I4Z A;  1HMO A;  3WAQ A;  4XQ1 A;  2HMQ A;  1HMD A; 
#chains in the Genus database with same CATH topology
 1WWP A;  4NY3 A;  1VYI A;  1BDJ B;  4AX2 A;  2JD3 A;  2Y3D A;  3GWL A;  3UMH A;  4JIO A;  5F5F A;  1Q0G A;  4RBN A;  1XZP A;  4PK4 A;  1HE1 A;  2XL4 A;  3F47 A;  3EJN A;  2DYR C;  3JTL O;  3LES A;  4E0H A;  2XLH A;  3GM2 A;  4XPY A;  3HLZ A;  3O10 A;  4EWC A;  4AK9 A;  3LNM B;  4CS9 A;  4LDR A;  5COF A;  1LI5 A;  4BJ1 A;  2HZ8 A;  2KQ9 A;  2EPO A;  4YN0 B;  2J46 A;  4ULV A;  5FCL A;  5DQT A;  3RH3 A;  3B9Q A;  4KC9 A;  3T4R A;  1M56 C;  1RKE B;  3C8G A;  1ZHX A;  3ZSU A;  2Q4F A;  1TFK B;  4J32 B;  1B68 A;  2DB4 A;  2HSB A;  3L34 A;  2W4B A;  1OW7 A;  4F4B A;  1HMD A;  4JEA A;  4O79 A;  2TMV P;  2UUI A;  2KW3 C;  3IQ6 A;  1H9G A;  1DOV A;  3S28 A;  1JR8 A;  2CYD A;  2QE9 A;  3HNJ A;  4KNW A;  3CZ6 A;  3DI5 A;  1JAF A;  2MYS A;  3S90 A;  3I5P A;  2PX3 A;  5E33 A;  3U8V A;  3VM6 A;  2AP3 A;  3POV A;  4JCH A;  2XS1 A;  1OKK D;  1LIH A;  1H6G A;  2BL2 A;  3H65 A;  3ZTZ A;  3MYF A;  3E70 C;  4DXW A;  3U2M A;  4BEM J;  4IGG A;  3K33 A;  1WTY A;  3ASN C;  2DI3 A;  2YWA A;  2LK4 A;  5JP7 A;  2HV6 A;  2DGJ A;  4DOZ A;  3M4B A;  3EH1 A;  1EA8 A;  2GA0 A;  3BEH A;  5L0J A;  1Z6A A;  4B6I A;  3K1H A;  3EGD A;  2WZF A;  4MW8 A;  4O6Y A;  1FMV A;  4WJ0 A;  1U0B B;  1AEP A;  3HNL A;  2G3V A;  3X1O A;  5KYU B;  1Z23 A;  2VH3 A;  4MTO A;  4ONS A;  1NFN A;  1OCO C;  4NTB A;  4I1O B;  1G5Z A;  4DRJ B;  5KYY A;  1BR1 A;  1CGO A;  5BUO A;  2XLO A;  1TWA A;  3O55 A;  1MMN A;  3SP1 A;  4YT2 A;  4YT8 A;  4G7O F;  5T3T A;  1D0Y A;  4N06 A;  3U9M A;  1AUE A;  2V3C C;  3C7J A;  4AE4 A;  4ANJ A;  4XLP F;  2OG2 A;  3M15 A;  3GM1 A;  1E83 A;  1TKN A;  3H2U A;  1E86 A;  2EPK X;  3NKD A;  2R9R B;  4JW1 A;  5TJ5 E;  3US6 A;  1T6Q A;  3DJN B;  4C7O A;  5AC4 A;  3S29 A;  3PHF 2;  3BRJ A;  2FAP B;  4O7G A;  3DE9 A;  2OOC A;  2Q9B A;  1H7I A;  1YDI A;  3ATP A;  1BR4 A;  1XWJ A;  4E7S A;  1VTM P;  3FAP B;  1S7Z A;  2A1D D;  3O39 A;  5EK0 A;  3UMK A;  2VCC A;  3ECS A;  4XEV A;  1QZX A;  1C17 M;  2ICW G;  3NYL A;  4QDL A;  2YLI A;  2D4U A;  2CDQ A;  4E0I A;  3A9C A;  1LE4 A;  1GGQ A;  3B71 A;  3K6B A;  4I44 A;  3V5Z A;  3CEX A;  3ZQV A;  3NMK A;  1VLT A;  2EIN C;  3HNK A;  1ZU4 A;  1K40 A;  4ULW A;  2A68 F;  2L6F A;  2W4M A;  4AL0 A;  2Y69 C;  1VB5 A;  1TWG A;  3X2Q C;  4A2N B;  5JSL A;  4AL1 A;  2Y3B A;  2A6H F;  5COG A;  1NU9 C;  1BR2 A;  3AG1 C;  3QW1 A;  4LLC A;  2FGY A;  4YWQ A;  5KYX B;  3WAQ A;  5GPG B;  2NSF A;  3KPH A;  3H2V A;  2NSG A;  3JYY A;  3RQE A;  3RQG A;  2CNW D;  1CGN A;  4C3D A;  3NKE A;  3GM3 A;  2R25 A;  5KYW B;  1CPQ A;  1RXQ A;  3Q6N A;  2YL7 A;  3AJM A;  3PCV A;  1KTM A;  2R7W A;  4Z9I A;  3TQO A;  2J9U A;  1OKK A;  3QTH A;  1TR2 A;  2GWW A;  3A11 A;  2J7P D;  3EG9 B;  5A6B D;  3EHN A;  2J45 A;  4G0H A;  2Q7R A;  4U9E A;  3PDM P;  3AG4 C;  1OW6 A;  1F1M A;  2BC5 A;  2XSE A;  3LUT B;  3K7D A;  1YYX A;  2PF4 E;  1ZHW A;  2XM4 A;  3EPV A;  1YA9 A;  4JE9 A;  3SYN A;  1SZI A;  2Q3T A;  3TK0 A;  1RKE A;  1YAU O;  3NDB B;  3EFO B;  1TWC A;  3NYM A;  3RVY A;  2M64 A;  4X0R A;  2MHR A;  1I4Z A;  2P61 A;  3RF3 A;  2OJQ A;  1QQ3 A;  3DKA A;  2F22 A;  2IOQ A;  3VF0 A;  1FMW A;  4IAR A;  1C02 A;  3SZR A;  3WG7 C;  2HJM A;  1NSG B;  2KSF A;  1CPR A;  2XM0 A;  3GAN A;  4XEF A;  2XL6 A;  1Y4C A;  2LD6 A;  2EIK C;  1M57 C;  3AG3 C;  1LKX A;  4JKV A;  2OJE D;  3T9O A;  3I4U A;  1A0B A;  3QVZ A;  1LM3 B;  2HFI A;  1E85 A;  1BZ4 A;  1J8M F;  1HW1 A;  2D5R B;  2OKU A;  3V5Y A;  1ZHZ A;  3ZTM A;  3DJU B;  3GEE A;  2R05 A;  3J06 A;  4PJL A;  4C3E A;  2Q9C A;  5HSW A;  3R2P A;  2ZXW C;  2J0X A;  2EIM C;  2C04 A;  1OXK A;  3K1I C;  1D1B A;  1O3U A;  4IRU A;  1N1C A;  2VC9 A;  2HUJ A;  3G50 A;  4MVZ A;  256B A;  3LEV A;  4ER9 A;  2KGO A;  1KU2 A;  3Q7L A;  4C3B A;  4NC3 A;  1HMO A;  2I8B A;  2WZL A;  3IQT A;  1YAR O;  5KYU A;  3UNG C;  3RW0 A;  2H8A A;  2LCH A;  4Q7C A;  2P0N A;  2XLW A;  3M4C A;  5DS4 A;  5F28 E;  1GM5 A;  2EIJ C;  2QUP A;  5AGF A;  4JEB A;  5COM A;  2KNH A;  1T6U A;  3CQZ A;  3JCU Q;  1CGM E;  3ITF A;  4PJN A;  2QLA A;  3QZC A;  1ZYR F;  4FES A;  2HS5 A;  3TOL A;  4JTD B;  2HSQ A;  3RVZ A;  3ZDL A;  1FFH A;  4DBR A;  3JYH A;  4U5C E;  1RJ9 A;  2HKV A;  1VMA A;  2A0B A;  3ZG1 A;  3QVY A;  1I4Y A;  4CS7 A;  3RYL A;  1GS9 A;  5DS5 A;  3JSE O;  4IJJ A;  4MVQ A;  3B0U X;  2R7X A;  2IXM A;  4P9T A;  1WOL A;  1V4A A;  1I5N A;  2H7B A;  5A6K A;  1TQG A;  3FMS A;  1MMG A;  2HJ3 A;  2UUH A;  4KNV A;  3GEI A;  4PFO A;  1D0X A;  2GFH A;  4CDV A;  4EBB A;  4XQ1 A;  5E2Q A;  1ZZP A;  4JTA B;  4MVS A;  4BJ6 C;  2YVK A;  2CCY A;  4G78 A;  4N4W A;  3S9O A;  1ZVZ A;  2EIL C;  1HW2 A;  2CW0 F;  3ASO C;  2L6G A;  1YA7 O;  1A7D A;  3FVY A;  1EI7 A;  3JRT A;  4WGY A;  4BEJ A;  2V26 A;  1TWH A;  1ORY A;  2A6E F;  2G62 A;  3KH2 A;  1U89 A;  3NYJ A;  1ORJ A;  4N6H A;  2AWY A;  4XPW A;  3K1I A;  2VCA A;  2A69 F;  3T6B A;  3FOO A;  5D91 A;  4YK5 A;  3ABK C;  1A7E A;  4CSA C;  4DJ9 A;  4I1M A;  1G4U S;  2IM8 A;  4PJM A;  5KYX A;  4O6N A;  3PMR A;  2NUT A;  4E17 A;  1LI7 A;  4PJJ A;  4E7Z A;  4U5H A;  1NG1 A;  2XRH A;  3JZ0 A;  3SNH A;  2RD9 A;  2VCB A;  3EGX A;  3U9J A;  4EIY A;  4DBQ A;  3OA1 A;  2Y3H A;  2ZD9 A;  4BPM A;  3C8G B;  4U5E E;  3LEO A;  5KYW A;  2XXA A;  2G3K A;  2R7S A;  3LS0 A;  3DM5 A;  4JVS A;  1FAP B;  2OU6 A;  2OQM A;  2KJG A;  2R7Q A;  4Z9H A;  4A4A A;  3VAY A;  3EG9 A;  1GQA A;  1NU7 D;  1M6T A;  3IPM O;  1UFB A;  2DYS C;  3IEE A;  3ZWI A;  3B29 A;  4UDV A;  2C03 A;  2PNO A;  4RD9 A;  5L0I A;  3S84 A;  2P1A A;  2AVK A;  4MVR A;  4XTK A;  3W8I A;  2QTV A;  3NMJ A;  4OIR F;  3SEO A;  3NG1 A;  3TD7 A;  2J9B A;  4W8K A;  3HTK C;  2YLD A;  5F5H A;  4OIO F;  1ZHT A;  4BJ6 A;  2LFD A;  3C62 A;  1O5H A;  2W9Y A;  3W2W A;  5IY5 C;  1H9T A;  2GDC A;  1YZA A;  3JSZ A;  3LAY A;  1EKY A;  4KBL A;  1RMV A;  3FOP A;  5T3W A;  4J30 B;  3C8G D;  5EHH A;  3N2Z B;  3WOD F;  2IYL D;  2Y3G A;  1U6H A;  3EGD B;  3SXK A;  4EBJ A;  2GAQ A;  2KC3 A;  3LNR A;  1QKR A;  3TJ6 A;  3FDQ A;  2R7U A;  3U8P A;  4ZLC A;  4DRI B;  4Z9J A;  2NUP B;  4CSA A;  5DVW A;  5CI8 A;  4U5D E;  5DS6 A;  4LLE A;  2PBE A;  4CJO A;  4EUK B;  4BJ5 C;  1M2O A;  5CIV A;  1T01 A;  4J7T A;  3DE8 A;  1FNT c;  1K05 A;  1PD1 A;  1SF8 A;  3QW0 A;  2J9W A;  2Q00 A;  5JS5 A;  2KK1 A;  4QI2 A;  1E84 A;  4Q5S F;  2YL3 A;  3EZH A;  5BQG A;  2NPU A;  4R32 A;  2A0U A;  3ABM C;  3UR3 C;  2Z15 A;  3TUL A;  3N0T A;  5CI9 A;  1LPE A;  5D92 A;  4KI2 A;  4HEA J;  5B3I A;  2J8W A;  3W8H A;  1MQV A;  4JZA A;  2AU5 A;  4NQF A;  4FAP B;  4I3M A;  3FAJ A;  1MND A;  4MW3 A;  1VK5 A;  3C63 A;  4YL0 A;  3MYI A;  4P6I C;  3ZIB A;  3U2L A;  3AG2 C;  4HE8 D;  3QMK A;  4XEK A;  3DAG A;  2JX0 A;  1VYK A;  1Z63 A;  3V5X A;  3E9V A;  5B3S C;  4DVY P;  3IQC A;  4JJF A;  3U3F A;  1QLE C;  2J9V A;  2JPU A;  2AWC A;  2X51 A;  4XLN F;  1RKC A;  1QPU A;  1HY5 A;  1D1A A;  1S05 A;  2M4E A;  5B1B C;  1LE2 A;  3MBG A;  3HKK A;  4U9D A;  4YT5 A;  1ZW2 A;  5DQZ A;  4G7H F;  4MTF A;  2ZXO A;  1YZC A;  2LP4 A;  4IAO A;  4OIQ F;  4DVZ A;  2H7O A;  2R03 A;  2W45 A;  4K0D A;  3JT1 A;  4N6C A;  4BJT A;  4MVU A;  2EPM X;  2P7V A;  1D1C A;  2IXP A;  4G7Z F;  1PCX A;  1ORS C;  1APC A;  1R4T A;  2QY9 A;  4JCZ A;  4U5B E;  3V7O A;  2R7R A;  2XS8 A;  4OIN F;  2L9J A;  1M2V B;  4GQH A;  4HFK B;  2QNL A;  4LER A;  4PFP A;  2HMQ A;  1Q0K A;  4DRH B;  3C18 A;  2HV7 A;  1OCR C;  4CBE A;  5KYN A;  3B0V C;  2P6V A;  1WAT A;  4CS8 C;  3KYI A;  4CIP A;  3F46 A;  5E3C A;  4BJ5 A;  4C7O B;  1ZW3 A;  2WL8 A;  2J0W A;  4YL3 A;  4MND A;  1G8X A;  4YL1 A;  4U5F E;  2WVN A;  2WZG A;  4IWB A;  3U0C A;  2VAS A;  4QI0 A;  4U5G A;  2XLE A;  5BQH A;  2L7A A;  3AQC A;  2R7O A;  2I15 A;  1Q0F A;  2OEV A;  2O9X A;  3GEH A;  1EQ1 A;  3SXM A;  1LS1 A;  3VRC A;  3W2V A;  1ZU5 A;  3R7C A;  4EBK A;  2RSE B;  5A69 A;  3AOU A;  1ST6 A;  4LDK A;  3LLI A;  1YJG A;  2WVO A;  2FFH A;  1R5I D;  3DAF A;  4WAB A;  3HNI A;  1AVO B;  3RIP A;  1DOW A;  1WAS A;  2CNW A;  2XLV A;  3U3B A;  3G4Z A;  5DLJ A;  3HJC A;  3MLG A;  2LQG A;  4O6M A;  1J8Y F;  2YZS A;  2B0H A;  5T1D B;  3SXZ A;  1FFT C;  4JC7 A;  1Q0D A;  3RFY A;  2J7P A;  3GOR A;  5A6B A;  2CGE A;  3LLK A;  3G4X A;  1A7V A;  3KMI A;  2KYH A;  1SR2 A;  1G4W R;  1YVI A;  2OCC C;  3AGU A;  4JTC B;  1V74 B;  3N24 A;  1SYQ A;  5JRA A;  2L6H A;  4MVM A;  1BBH A;  4PAC A;  3FXH A;  1JMW A;  2HMZ A;  4OD4 A;  2B0J A;  3RKO F;  3SXY A;  4XWJ A;  5L0G A;  2R7V A;  2IXO A;  4YT4 A;  4GEH A;  1FR0 A;  2ASR A;  3T6G B;  3EH2 A;  4E18 A;  5L3V A;  4HFF B;  1LVK A;  4EHP A;  3DM9 B;  4FX5 A;  5E3A A;  2EPL X;  2MWQ A;  4FWV A;  3M79 A;  4OD5 A;  4CS8 A;  1KNY A;  2YHS A;  3CAX A;  4CX9 A;  1OR2 A;  3AQB A;  1V55 C;  3GOD A;  5K0I A;  1QSP A;  2YL0 A;  3EHM A;  2PX0 A;  3ZVR A;  5AC5 A;  1PD0 A;  2YQY A;  1XZQ A;  1L3P A;  2NUP A;  4IB4 A;  4MS2 A;  2R7T A;  3FHD A;  1RCP A;  5L0F A;  4RDA A;  1D0Z A;  4K1O A;  5BQI A;  1W2W A;  5B1A C;  1A41 A;  5L3Q A;  1T5O A;  3EZI A;  1V54 C;  2Q9A A;  3GWN A;  1MMA A;  1JRA A;  1FTS A;  1T9K A;  2LSE A;  4JUR I;  1NBB A;  3KKB A;  2XLD A;  3B0P A;  1RJ9 B;  3EFO A;  3S27 A;  4XPX A;  2X0C A;  3S0X A;  1HE9 A;  3ABL C;  5L0C A;  3DZA A;  1NLX A;  3AGT A;  1IW7 F;  3MFN A;  3UGO A;  1MMD A;  1OQC A;  4JJG A;  2ZXP A;  5JLI A;  4PR9 A;  4CDY A;  4CIH A;  2ZPA A;  1ZHY A;  4CDA A;  5A6A A;  1T6I A;  1JPN A;  3Q7G A;  3L1M A;  2WVQ A;  1TFO B;  3C8Z A;  4Q4Z F;  1Y6D A;  4H4K C;  1OR3 A;  1Q0M A;  5JT4 A;  3WHN A;  3DD7 A;  3NMI A;  3ZC4 A;  3Q6M A;  3UMI A;  1UG7 A;  2YL1 A;  1SMY F;  1NZE A;  1WN0 A;  4EKW A;  5L0D A;  3K66 A;  3O6X A;  3JRM O;  5HV9 A;  5KYY B;  4K7B A;  2H7V C;  4LAC B;  2R02 A;  3MX3 A;  4M63 A;  2EPN A;  1M2V A;  3ZQY A;  4CJG A;  1VOM A;  4AE4 B;  4P9F A;  2OEX A;  3LJB A;  2L81 A;  2XL8 A;  4NTA A;  1OW8 A;  4MQ9 F;  1Z7Q c;  4CS9 C;  1QVX A;  1O87 A;  2NUT B;  2PFD A;  4J7Y A;  2LFF A;  3IHU A;  2BE5 F;  1JOG A;  1PV3 A;  2E87 A;  4H54 A;  3EGX B;  3OWT A;  3CSK A;  5JVE A;  5L0H A;  1OXB A;  1K04 A;  1VLS A;  2NG1 A;  1Z3I X;  4BG0 A;  4D4X A;  1IZM A;  4L6R A;  2XXA B;  4ZLD A;  1MNE A;  1WGW A;  2ZXR A;  3VYW A;  4D4N A;  2YRF A;  1JPJ A;  1OCZ C;  3NRH A;  4JRZ A;  3L8I A;  3DXJ F;  2IBF A;  1OCC C;  2Y39 A;  3L8J A;  4W8P A;  5A6J A;  4OIP F;  4GYT A;  1E2X A;  2WB7 A;  4WGZ A;  4NCQ A;  3IQ5 A;  2YKZ A;  3M1C B;  3UGP A;  2ETS A;  3LS1 A;  4YJW A;  3RQF A;  2YLG A;  2PP4 A;  3KL4 A;  1NFO A;  4IAQ A;  4LDQ A;  3TJ5 A;  3W4Y A;  3DWW A;  5FZT A;  1L7C A;  1Z5Z A;  2YEV A;  1C03 A;  5JUA A;  2XLM A;  3T6J A;  3OEO A;  3EQL F;  3TOM A;  5EGY A;  2VB6 A;  3L0I A;  4MVO A;  3U5S A;  1YLM A;  1YYJ A;  3KYJ A;  4MTG A;  2IXN A;  2LIG A;  3DMD A;  3I5Q A;  4NTF A;  1LS4 A; 
#chains in the Genus database with same CATH homology
 3WHN A;  1A7D A;  4XPW A;  2AWC A;  2AWY A;  2AVK A;  3AGU A;  4XPY A;  1I4Y A;  1A7E A;  2HMZ A;  4XPX A;  3AGT A;  2MHR A;  1I4Z A;  1HMO A;  3WAQ A;  4XQ1 A;  2HMQ A;  1HMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...