2HMZA

The structures of met and azidomet hemerythrin at 1.66 angstroms resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
113
structure length
113
Chain Sequence
GFPIPDPYCWDISFRTFYTIIDDEHKTLFNGILLLSQADNADHLNELRRCTGKHFLNEQQLMQASQYAGYAEHKKAHDDFIHKLDTWDGDVTYAKNWLVNHIKTIDFKYRGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxygen transport
molecule keywords HEMERYTHRIN
publication title Structures of met and azidomet hemerythrin at 1.66 A resolution.
pubmed doi rcsb
source organism Themiste dyscritum
total genus 50
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1990-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 2hmzA00
3AGUA 1A7DA 3WAQA 4XQ1A 2MHRA 1HMDA 2AWYA 2AWCA 1I4ZA 2HMQA 4XPXA 3AGTA 4XPYA 2AVKA 3WHNA 1A7EA 1HMOA 1I4YA 4XPWA 2HMZA
chains in the Genus database with same CATH superfamily
3KPHA 3ITFA 5DQTA 2J7PD 3LLKA 3SEOA 3C18A 2EPNA 2OG2A 4DXWA 2Q9BA 3KYIA 5A6JA 3K1IC 5TJ5E 3NDBB 2YHSA 1CGOA 2CNWD 5DQZA 1ZZPA 3H2VA 1PCXA 3E9VA 2DI3A 4Z9HA 2P61A 3GANA 2XLHA 1YYJA 4KNVA 2V26A 1B68A 1TWHA 3DMDA 3QW0A 3JT1A 4NC3A 1RXQA 2NSFA 1NG1A 4FWVA 5B1AC 3S90A 4MVRA 1FFTC 1YA7O 1ZU4A 3O55A 5BQHA 4M63A 5JRAA 4DVZA 3IQ6A 1H6GA 1M56C 3MFNA 3EZHA 3M79A 3CSKA 1PD1A 3MX3A 1NBBA 3ZTMA 5JS5A 4MVQA 3RQGA 2YZSA 3KH2A 1ZHYA 2YL0A 3I4UA 3MLGA 5DS5A 3S0XA 3FMSA 1WATA 4YT4A 2QY9A 1ZW3A 1NFNA 3BEHA 3ZQVA 2W9YA 4FESA 2MHRA 5F5FA 5HSWA 1OW6A 3ATPA 3GWLA 1XZPA 3ZC4A 5F28E 1OCRC 4IAQA 1AUEA 2LQGA 3GEEA 1I4ZA 1SYQA 5E2QA 4MVMA 3LEVA 3S29A 2P0NA 3MYFA 4HFFB 1Z63A 5FZTA 1QZXA 2OOCA 5A6KA 3VAYA 2M64A 3AGTA 1D1CA 1SMYF 2YLDA 3CAXA 3N24A 3RF3A 4CS8C 2R7TA 1VYKA 4U5CE 3SXKA 2VCAA 4N6HA 2Y39A 3ZIBA 2XLWA 4K7BA 4U5DE 2A1DD 3HNIA 1T01A 1ZHXA 1ORYA 3C8GA 3LS0A 4YT8A 4OIOF 1H9TA 5EHHA 2C03A 3TQOA 1O3UA 4XQ1A 1NU9C 3B0PA 1MMNA 1JRAA 1QQ3A 1RKEB 4DRIB 4I1OB 2LSEA 1PV3A 1MMGA 1VMAA 2HFIA 2XLDA 3KL4A 2Y3DA 3OEOA 2OEVA 4JCZA 3DZAA 3US6A 2YEVA 3FOPA 2XSEA 2HSQA 1D0ZA 4EHPA 2X51A 2J9BA 2HKVA 3R7CA 1SZIA 2R7RA 1WN0A 4MVUA 3NMJA 2EIMC 1OXBA 3QMKA 4E17A 2XL4A 3NG1A 3K33A 2C04A 4RBNA 1YA9A 2VH3A 3Q7GA 3W4YA 5JT4A 2ASRA 1T6QA 2HUJA 2Q9AA 4IB4A 4KBLA 1N1CA 2YLGA 4OD5A 5L0HA 4WGYA 3S9OA 4LACB 4Q5SF 3JRTA 4XPWA 2L6HA 1RKCA 2PNOA 2HMZA 3KYJA 1Z6AA 3NMKA 4U5FE 4JEBA 4MW3A 1LVKA 2I8BA 4WABA 1WWPA 1J8YF 4O6MA 3RW0A 1EA8A 2Q9CA 4U9DA 3VRCA 1RMVA 2G62A 5AC4A 2Y3HA 4BJ5A 1WASA 1OCOC 3NKDA 3DE8A 4YL0A 4AK9A 1L3PA 2A6EF 1F1MA 4PJJA 1VYIA 3T4RA 1Q0MA 3ZQYA 3RFYA 2VCBA 4E18A 4ZLDA 3OWTA 4CSAC 1OCCC 2XL6A 2R7XA 4BJ6C 4L6RA 1Q0KA 1FTSA 5COGA 2NG1A 5KYWA 2R7WA 3RQFA 2MYSA 1VLSA 4XPXA 4D4XA 2L81A 4J32B 2JPUA 2YRFA 3AG3C 2FAPB 1I5NA 5T1DB 2EPOA 1MNDA 1WTYA 3LJBA 4FX5A 4BJ1A 3U9JA 2J46A 4LDRA 2QUPA 3W8HA 4YT5A 1M2VA 4ONSA 3L0IA 2KQ9A 3AG1C 3C63A 1E85A 4O79A 4I44A 4OD4A 1LIHA 2PFDA 3A9CA 4MTOA 2ZXWC 1LE2A 256BA 5D92A 2CCYA 4G7ZF 1D1BA 3AG4C 1HY5A 2CYDA 2NPUA 1JMWA 1YZCA 1E83A 3R2PA 2XLEA 3TK0A 1CGNA 4MVOA 3TD7A 1OXKA 2H7BA 3UGOA 2Y3GA 2EPMX 2IBFA 1WOLA 3EH2A 5GPGB 1T5OA 2HV7A 1XWJA 1D0YA 4CJGA 1VOMA 3QTHA 4PACA 2WZLA 3BRJA 1M6TA 4P9TA 1V74B 4C3DA 1TWCA 2X0CA 3DAGA 2DGJA 2ZD9A 3JSEO 3LNRA 3M4CA 4IWBA 4O7GA 4R32A 4HEAJ 4XEKA 2A69F 4YN0B 5JP7A 3T6GB 3K6BA 2H7OA 3EFOB 5D91A 4BEMJ 2GA0A 4PFPA 3SXYA 4CIHA 3V7OA 4CDVA 2CW0F 3IQCA 1RJ9B 4DRHB 2CNWA 3NYJA 2UUHA 4A4AA 4X0RA 2G3VA 2R7OA 1YJGA 4I3MA 3ZDLA 4N6CA 4K0DA 4Q4ZF 4MVZA 1TWGA 3JTLO 3ZTZA 3EG9A 1S7ZA 3ZG1A 1Q0DA 3AJMA 3CZ6A 2XLMA 2CGEA 4KNWA 1GM5A 3B9QA 1ZHTA 3LS1A 2M4EA 2NUPB 5KYUA 1FMVA 1LI7A 3DI5A 4C3EA 2WL8A 4NCQA 1YAUO 3KKBA 5F5HA 2A0BA 1K04A 2YL7A 4MTFA 1H7IA 5CI8A 1LS1A 2Q3TA 3SZRA 2EINC 1BDJB 5CIVA 1QPUA 1R4TA 3ABMC 4G78A 3TOMA 4AE4B 4E0IA 3EJNA 2WZGA 4RD9A 2UUIA 4NTBA 2JD3A 3FVYA 3H65A 3H2UA 1YDIA 4C7OB 3L1MA 1GQAA 5DVWA 1C02A 4MNDA 3POVA 3EZIA 4O6NA 1ST6A 3EPVA 2VC9A 1D0XA 3EH1A 4Q7CA 3ECSA 1BR1A 4NY3A 5JLIA 5JUAA 1E84A 2KK1A 2OEXA 2XL8A 4XLPF 1Z5ZA 4MVSA 4C3BA 3ZSUA 2GAQA 5JVEA 2DYRC 2O9XA 4HE8D 1TR2A 3HKKA 3GWNA 1XZQA 4JJFA 1OKKA 3U8PA 4W8PA 4H4KC 2CDQA 4EBKA 4P9FA 1UG7A 2J0XA 4DBQA 3IQ5A 4PJMA 4OIQF 4G7HF 4GYTA 4Z9JA 1VK5A 3FHDA 4IGGA 4DJ9A 4YT2A 3DXJF 3WAQA 2YL3A 3HLZA 4JTCB 2OU6A 3GM1A 3FOOA 4NQFA 1RCPA 5E3AA 3SXZA 5L0JA 5FCLA 1VLTA 1K05A 5EK0A 2A6HF 4CJOA 2A68F 2H7VC 2KYHA 5L3VA 3LEOA 2XS1A 1EI7A 2R03A 3JZ0A 4MW8A 2KW3C 4IJJA 3EGDB 2Q4FA 4JE9A 4YJWA 4WJ0A 1NSGB 3EGXB 2LFDA 3RYLA 3NYLA 5DLJA 4E0HA 3GEHA 3B0UX 1BR4A 2BL2A 4EUKB 1U0BB 4IARA 4XPYA 1APCA 2OCCC 4K1OA 1J8MF 2PX0A 2QE9A 4FAPB 2VASA 1YLMA 4LDKA 4OIPF 2IXMA 3C62A 2QNLA 1OR3A 1NU7D 3RQEA 3N2ZB 4ZLCA 1BZ4A 1C17M 3OA1A 2GDCA 3EHNA 4B6IA 3Q6NA 2HJ3A 1ORJA 1H9GA 2MWQA 3C8GD 2VB6A 3SP1A 3B29A 4H54A 4JKVA 2HSBA 2XLVA 1G4WR 3K66A 4PK4A 3X2QC 2XRHA 4A2NB 4PJLA 2OJQA 2YWAA 3EHMA 2F22A 2R02A 3MBGA 4GEHA 2Q00A 2WZFA 2XXAB 3VM6A 2RSEB 5IY5C 3V5XA 3HNJA 2HZ8A 1G4US 1NFOA 1QKRA 1O87A 2WVOA 1ZVZA 2ZXPA 3DM9B 5E3CA 5KYYA 2XM0A 4IAOA 3T6BA 1HMOA 2HV6A 1E86A 4PJNA 1CPQA 5A6AA 1NLXA 3EG9B 3I5PA 3TJ6A 3O10A 4GQHA 3AGUA 2Q7RA 2R7QA 3GM2A 4CDAA 1LKXA 1LPEA 3V5ZA 1U6HA 2ZPAA 4BJ5C 4G7OF 2L6GA 4QI2A 1IZMA 3C8ZA 3S28A 5KYUB 1AVOB 2LD6A 3DKAA 4DOZA 2R25A 3M4BA 3FXHA 1FAPB 2L7AA 2A0UA 2RD9A 4KI2A 3L8IA 3KMIA 1A0BA 2EIJC 4BG0A 1FMWA 2HMQA 1RKEA 2PBEA 4DRJB 3PMRA 3GEIA 2ETSA 4EWCA 4BJTA 4W8KA 3U9MA 2L6FA 3B0VC 4ER9A 3S84A 1EQ1A 1FR0A 2TMVP 2DB4A 2AVKA 3I5QA 2IXPA 3GODA 1AEPA 1D1AA 2J7PA 1CPRA 2YL1A 2GFHA 1V4AA 2FGYA 4J30B 3M1CB 3ZVRA 2R9RB 3HNKA 2WVQA 3J06A 1TQGA 2PF4E 4JTDB 5A6BD 1JPJA 1DOWA 2R7UA 1SR2A 4P6IC 1KNYA 3NYMA 4EBJA 2GWWA 4XLNF 3K1IA 3JYHA 1YZAA 5BQIA 3SNHA 3FAJA 4YL3A 2R7VA 4CS7A 1JPNA 2FFHA 4JEAA 1LI5A 2OJED 1BBHA 2YLIA 4JVSA 4U5BE 3UR3C 3W8IA 5KYXA 3F46A 1EKYA 3IPMO 4E7SA 3FAPB 2QLAA 2JX0A 3W2WA 1TKNA 3DWWA 4ULVA 4NTAA 4QI0A 2LIGA 4JW1A 3C8GB 2LCHA 2L9JA 3DJUB 4MS2A 3Q7LA 2Y69C 1OW7A 3HNLA 1Z23A 5CI9A 4CDYA 2J9VA 2NUTA 2R05A 1MMAA 5A69A 1LE4A 2W4BA 4N4WA 2EIKC 1ZYRF 3CEXA 3UMIA 3VF0A 5AGFA 3JYYA 2I15A 4LDQA 1E2XA 2XM4A 3G50A 4JTAB 4CX9A 1PD0A 3GM3A 3U5SA 4EBBA 3DD7A 5L3QA 1YARO 2EILC 3K1HA 4PR9A 1Z3IX 5B3SC 1HW2A 2IOQA 1JAFA 1K40A 4PFOA 5COFA 1C03A 2LFFA 4I1MA 4JJGA 4BPMA 4UDVA 3T6JA 3U8VA 2QTVA 5AC5A 4CS8A 1T6IA 1Y4CA 1HE1A 1MQVA 4XEFA 2AU5A 4WGZA 3O39A 3QVYA 5BUOA 1CGME 1G5ZA 2LP4A 3E70C 1KU2A 1Y6DA 2WVNA 3EFOA 3IQTA 1G8XA 1V55C 4OIRF 1VTMP 3RVYA 1RJ9A 4U5GA 5KYWB 4G0HA 3EQLF 3G4XA 4YL1A 3RIPA 2HS5A 2P1AA 3QW1A 1WGWA 5B1BC 3QVZA 4XWJA 5KYYB 2ZXOA 3M15A 4NTFA 3LAYA 4U9EA 3GORA 2W4MA 3LLIA 2YQYA 4JCHA 2AP3A 5JSLA 1M2VB 2EPLX 3MYIA 2WB7A 5KYNA 3ZWIA 3PDMP 3UNGC 1ORSC 1GS9A 5T3TA 2NUPA 3DM5A 4MQ9F 3UMHA 2EPKX 4N06A 1NZEA 1M2OA 4MTGA 3N0TA 2V3CC 1OKKD 2H8AA 5E33A 4CS9A 4YK5A 1JOGA 3LESA 4J7TA 3U3FA 1GGQA 1LM3B 2ICWG 3B71A 4F4BA 2DYSC 2OKUA 3WODF 4ULWA 4AE4A 4KC9A 3UGPA 3DE9A 1HE9A 1Q0GA 3JSZA 4C7OA 1A7VA 1QSPA 4CSAA 4EKWA 2YVKA 1JR8A 1KTMA 2YKZA 1QLEC 1ZHZA 1W2WA 3TOLA 3ASOC 2KGOA 3T9OA 4BJ6A 1MMDA 2J9WA 2VCCA 3IHUA 4RDAA 4BEJA 5EGYA 3CQZA 4XEVA 1ZW2A 4J7YA 3RVZA 3UMKA 1FNTc 3C7JA 1LS4A 4JZAA 2IYLD 3AQBA 2J0WA 2Z15A 3S27A 4CBEA 1I4YA 4D4NA 4U5HA 3RH3A 3U2LA 1DOVA 2XS8A 5L0DA 4CS9C 3AG2C 3K7DA 2XLOA 3NKEA 4E7ZA 3X1OA 1A7DA 1QVXA 2IXOA 3ABLC 3VYWA 1OR2A 4AL1A 2J9UA 2OQMA 3A11A 3F47A 4LERA 5KYXB 5L0CA 1TFOB 2PX3A 1OQCA 5L0FA 3WG7C 1T6UA 1HMDA 2J8WA 3PCVA 4O6YA 2BC5A 1BR2A 4Z9IA 4OINF 3AOUA 4LLEA 3FDQA 5BQGA 2B0JA 1Q0FA 3LNMB 1A41A 4ANJA 4JURI 4JRZA 2IM8A 2NUTB 3L34A 4IRUA 1TFKB 2KSFA 3NMIA 4U5EE 2W45A 3HTKC 4DVYP 4HFKB 3Q6MA 2D5RB 5A6BA 3EGDA 5T3WA 3U2MA 5DS6A 1VB5A 2HJMA 2D4UA 2LK4A 4JIOA 1A7EA 4JC7A 2BE5F 2J45A 1OCZC 3EGXA 3QZCA 3SXMA 2P6VA 5L0GA 5K0IA 1TWAA 3AQCA 1OW8A 1R5ID 1L7CA 1S05A 2G3KA 2KNHA 1U89A 1ZHWA 2IXNA 2PP4A 4LLCA 4EIYA 5L0IA 2KJGA 2NSGA 3NRHA 3LUTB 3SYNA 3HJCA 1SF8A 3W2VA 3U0CA 3JCUQ 4DBRA 1V54C 2P7VA 1HW1A 1M57C 2Y3BA 3V5YA 4AX2A 2B0HA 4QDLA 4XTKA 5HV9A 3TULA 2AWYA 2AWCA 1Z7Qc 3G4ZA 4AL0A 3ASNC 3L8JA 1O5HA 1YVIA 5COMA 2R7SA 5B3IA 4CIPA 5DS4A 3DAFA 3IEEA 1T9KA 3ABKC 1MNEA 3PHF2 3O6XA 3WHNA 2XXAA 3U3BA 1ZU5A 2KC3A 1IW7F 3DJNB 3TJ5A 3JRMO 1FFHA 1UFBA 2E87A 3RKOF 2ZXRA 4YWQA 1YYXA
chains in the Genus database with same CATH topology
3AGUA 1A7DA 3WAQA 4XQ1A 2MHRA 1HMDA 2AWYA 2AWCA 1I4ZA 2HMQA 4XPXA 3AGTA 4XPYA 2AVKA 3WHNA 1A7EA 1HMOA 1I4YA 4XPWA 2HMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGU A;  1A7D A;  3WAQ A;  4XQ1 A;  2MHR A;  1HMD A;  2AWY A;  2AWC A;  1I4Z A;  2HMQ A;  4XPX A;  3AGT A;  4XPY A;  2AVK A;  3WHN A;  1A7E A;  1HMO A;  1I4Y A;  4XPW A;  2HMZ A; 
#chains in the Genus database with same CATH topology
 3KPH A;  3ITF A;  5DQT A;  2J7P D;  3LLK A;  3SEO A;  3C18 A;  2EPN A;  2OG2 A;  4DXW A;  2Q9B A;  3KYI A;  5A6J A;  3K1I C;  5TJ5 E;  3NDB B;  2YHS A;  1CGO A;  2CNW D;  5DQZ A;  1ZZP A;  3H2V A;  1PCX A;  3E9V A;  2DI3 A;  4Z9H A;  2P61 A;  3GAN A;  2XLH A;  1YYJ A;  4KNV A;  2V26 A;  1B68 A;  1TWH A;  3DMD A;  3QW0 A;  3JT1 A;  4NC3 A;  1RXQ A;  2NSF A;  1NG1 A;  4FWV A;  5B1A C;  3S90 A;  4MVR A;  1FFT C;  1YA7 O;  1ZU4 A;  3O55 A;  5BQH A;  4M63 A;  5JRA A;  4DVZ A;  3IQ6 A;  1H6G A;  1M56 C;  3MFN A;  3EZH A;  3M79 A;  3CSK A;  1PD1 A;  3MX3 A;  1NBB A;  3ZTM A;  5JS5 A;  4MVQ A;  3RQG A;  2YZS A;  3KH2 A;  1ZHY A;  2YL0 A;  3I4U A;  3MLG A;  5DS5 A;  3S0X A;  3FMS A;  1WAT A;  4YT4 A;  2QY9 A;  1ZW3 A;  1NFN A;  3BEH A;  3ZQV A;  2W9Y A;  4FES A;  2MHR A;  5F5F A;  5HSW A;  1OW6 A;  3ATP A;  3GWL A;  1XZP A;  3ZC4 A;  5F28 E;  1OCR C;  4IAQ A;  1AUE A;  2LQG A;  3GEE A;  1I4Z A;  1SYQ A;  5E2Q A;  4MVM A;  3LEV A;  3S29 A;  2P0N A;  3MYF A;  4HFF B;  1Z63 A;  5FZT A;  1QZX A;  2OOC A;  5A6K A;  3VAY A;  2M64 A;  3AGT A;  1D1C A;  1SMY F;  2YLD A;  3CAX A;  3N24 A;  3RF3 A;  4CS8 C;  2R7T A;  1VYK A;  4U5C E;  3SXK A;  2VCA A;  4N6H A;  2Y39 A;  3ZIB A;  2XLW A;  4K7B A;  4U5D E;  2A1D D;  3HNI A;  1T01 A;  1ZHX A;  1ORY A;  3C8G A;  3LS0 A;  4YT8 A;  4OIO F;  1H9T A;  5EHH A;  2C03 A;  3TQO A;  1O3U A;  4XQ1 A;  1NU9 C;  3B0P A;  1MMN A;  1JRA A;  1QQ3 A;  1RKE B;  4DRI B;  4I1O B;  2LSE A;  1PV3 A;  1MMG A;  1VMA A;  2HFI A;  2XLD A;  3KL4 A;  2Y3D A;  3OEO A;  2OEV A;  4JCZ A;  3DZA A;  3US6 A;  2YEV A;  3FOP A;  2XSE A;  2HSQ A;  1D0Z A;  4EHP A;  2X51 A;  2J9B A;  2HKV A;  3R7C A;  1SZI A;  2R7R A;  1WN0 A;  4MVU A;  3NMJ A;  2EIM C;  1OXB A;  3QMK A;  4E17 A;  2XL4 A;  3NG1 A;  3K33 A;  2C04 A;  4RBN A;  1YA9 A;  2VH3 A;  3Q7G A;  3W4Y A;  5JT4 A;  2ASR A;  1T6Q A;  2HUJ A;  2Q9A A;  4IB4 A;  4KBL A;  1N1C A;  2YLG A;  4OD5 A;  5L0H A;  4WGY A;  3S9O A;  4LAC B;  4Q5S F;  3JRT A;  4XPW A;  2L6H A;  1RKC A;  2PNO A;  2HMZ A;  3KYJ A;  1Z6A A;  3NMK A;  4U5F E;  4JEB A;  4MW3 A;  1LVK A;  2I8B A;  4WAB A;  1WWP A;  1J8Y F;  4O6M A;  3RW0 A;  1EA8 A;  2Q9C A;  4U9D A;  3VRC A;  1RMV A;  2G62 A;  5AC4 A;  2Y3H A;  4BJ5 A;  1WAS A;  1OCO C;  3NKD A;  3DE8 A;  4YL0 A;  4AK9 A;  1L3P A;  2A6E F;  1F1M A;  4PJJ A;  1VYI A;  3T4R A;  1Q0M A;  3ZQY A;  3RFY A;  2VCB A;  4E18 A;  4ZLD A;  3OWT A;  4CSA C;  1OCC C;  2XL6 A;  2R7X A;  4BJ6 C;  4L6R A;  1Q0K A;  1FTS A;  5COG A;  2NG1 A;  5KYW A;  2R7W A;  3RQF A;  2MYS A;  1VLS A;  4XPX A;  4D4X A;  2L81 A;  4J32 B;  2JPU A;  2YRF A;  3AG3 C;  2FAP B;  1I5N A;  5T1D B;  2EPO A;  1MND A;  1WTY A;  3LJB A;  4FX5 A;  4BJ1 A;  3U9J A;  2J46 A;  4LDR A;  2QUP A;  3W8H A;  4YT5 A;  1M2V A;  4ONS A;  3L0I A;  2KQ9 A;  3AG1 C;  3C63 A;  1E85 A;  4O79 A;  4I44 A;  4OD4 A;  1LIH A;  2PFD A;  3A9C A;  4MTO A;  2ZXW C;  1LE2 A;  256B A;  5D92 A;  2CCY A;  4G7Z F;  1D1B A;  3AG4 C;  1HY5 A;  2CYD A;  2NPU A;  1JMW A;  1YZC A;  1E83 A;  3R2P A;  2XLE A;  3TK0 A;  1CGN A;  4MVO A;  3TD7 A;  1OXK A;  2H7B A;  3UGO A;  2Y3G A;  2EPM X;  2IBF A;  1WOL A;  3EH2 A;  5GPG B;  1T5O A;  2HV7 A;  1XWJ A;  1D0Y A;  4CJG A;  1VOM A;  3QTH A;  4PAC A;  2WZL A;  3BRJ A;  1M6T A;  4P9T A;  1V74 B;  4C3D A;  1TWC A;  2X0C A;  3DAG A;  2DGJ A;  2ZD9 A;  3JSE O;  3LNR A;  3M4C A;  4IWB A;  4O7G A;  4R32 A;  4HEA J;  4XEK A;  2A69 F;  4YN0 B;  5JP7 A;  3T6G B;  3K6B A;  2H7O A;  3EFO B;  5D91 A;  4BEM J;  2GA0 A;  4PFP A;  3SXY A;  4CIH A;  3V7O A;  4CDV A;  2CW0 F;  3IQC A;  1RJ9 B;  4DRH B;  2CNW A;  3NYJ A;  2UUH A;  4A4A A;  4X0R A;  2G3V A;  2R7O A;  1YJG A;  4I3M A;  3ZDL A;  4N6C A;  4K0D A;  4Q4Z F;  4MVZ A;  1TWG A;  3JTL O;  3ZTZ A;  3EG9 A;  1S7Z A;  3ZG1 A;  1Q0D A;  3AJM A;  3CZ6 A;  2XLM A;  2CGE A;  4KNW A;  1GM5 A;  3B9Q A;  1ZHT A;  3LS1 A;  2M4E A;  2NUP B;  5KYU A;  1FMV A;  1LI7 A;  3DI5 A;  4C3E A;  2WL8 A;  4NCQ A;  1YAU O;  3KKB A;  5F5H A;  2A0B A;  1K04 A;  2YL7 A;  4MTF A;  1H7I A;  5CI8 A;  1LS1 A;  2Q3T A;  3SZR A;  2EIN C;  1BDJ B;  5CIV A;  1QPU A;  1R4T A;  3ABM C;  4G78 A;  3TOM A;  4AE4 B;  4E0I A;  3EJN A;  2WZG A;  4RD9 A;  2UUI A;  4NTB A;  2JD3 A;  3FVY A;  3H65 A;  3H2U A;  1YDI A;  4C7O B;  3L1M A;  1GQA A;  5DVW A;  1C02 A;  4MND A;  3POV A;  3EZI A;  4O6N A;  1ST6 A;  3EPV A;  2VC9 A;  1D0X A;  3EH1 A;  4Q7C A;  3ECS A;  1BR1 A;  4NY3 A;  5JLI A;  5JUA A;  1E84 A;  2KK1 A;  2OEX A;  2XL8 A;  4XLP F;  1Z5Z A;  4MVS A;  4C3B A;  3ZSU A;  2GAQ A;  5JVE A;  2DYR C;  2O9X A;  4HE8 D;  1TR2 A;  3HKK A;  3GWN A;  1XZQ A;  4JJF A;  1OKK A;  3U8P A;  4W8P A;  4H4K C;  2CDQ A;  4EBK A;  4P9F A;  1UG7 A;  2J0X A;  4DBQ A;  3IQ5 A;  4PJM A;  4OIQ F;  4G7H F;  4GYT A;  4Z9J A;  1VK5 A;  3FHD A;  4IGG A;  4DJ9 A;  4YT2 A;  3DXJ F;  3WAQ A;  2YL3 A;  3HLZ A;  4JTC B;  2OU6 A;  3GM1 A;  3FOO A;  4NQF A;  1RCP A;  5E3A A;  3SXZ A;  5L0J A;  5FCL A;  1VLT A;  1K05 A;  5EK0 A;  2A6H F;  4CJO A;  2A68 F;  2H7V C;  2KYH A;  5L3V A;  3LEO A;  2XS1 A;  1EI7 A;  2R03 A;  3JZ0 A;  4MW8 A;  2KW3 C;  4IJJ A;  3EGD B;  2Q4F A;  4JE9 A;  4YJW A;  4WJ0 A;  1NSG B;  3EGX B;  2LFD A;  3RYL A;  3NYL A;  5DLJ A;  4E0H A;  3GEH A;  3B0U X;  1BR4 A;  2BL2 A;  4EUK B;  1U0B B;  4IAR A;  4XPY A;  1APC A;  2OCC C;  4K1O A;  1J8M F;  2PX0 A;  2QE9 A;  4FAP B;  2VAS A;  1YLM A;  4LDK A;  4OIP F;  2IXM A;  3C62 A;  2QNL A;  1OR3 A;  1NU7 D;  3RQE A;  3N2Z B;  4ZLC A;  1BZ4 A;  1C17 M;  3OA1 A;  2GDC A;  3EHN A;  4B6I A;  3Q6N A;  2HJ3 A;  1ORJ A;  1H9G A;  2MWQ A;  3C8G D;  2VB6 A;  3SP1 A;  3B29 A;  4H54 A;  4JKV A;  2HSB A;  2XLV A;  1G4W R;  3K66 A;  4PK4 A;  3X2Q C;  2XRH A;  4A2N B;  4PJL A;  2OJQ A;  2YWA A;  3EHM A;  2F22 A;  2R02 A;  3MBG A;  4GEH A;  2Q00 A;  2WZF A;  2XXA B;  3VM6 A;  2RSE B;  5IY5 C;  3V5X A;  3HNJ A;  2HZ8 A;  1G4U S;  1NFO A;  1QKR A;  1O87 A;  2WVO A;  1ZVZ A;  2ZXP A;  3DM9 B;  5E3C A;  5KYY A;  2XM0 A;  4IAO A;  3T6B A;  1HMO A;  2HV6 A;  1E86 A;  4PJN A;  1CPQ A;  5A6A A;  1NLX A;  3EG9 B;  3I5P A;  3TJ6 A;  3O10 A;  4GQH A;  3AGU A;  2Q7R A;  2R7Q A;  3GM2 A;  4CDA A;  1LKX A;  1LPE A;  3V5Z A;  1U6H A;  2ZPA A;  4BJ5 C;  4G7O F;  2L6G A;  4QI2 A;  1IZM A;  3C8Z A;  3S28 A;  5KYU B;  1AVO B;  2LD6 A;  3DKA A;  4DOZ A;  2R25 A;  3M4B A;  3FXH A;  1FAP B;  2L7A A;  2A0U A;  2RD9 A;  4KI2 A;  3L8I A;  3KMI A;  1A0B A;  2EIJ C;  4BG0 A;  1FMW A;  2HMQ A;  1RKE A;  2PBE A;  4DRJ B;  3PMR A;  3GEI A;  2ETS A;  4EWC A;  4BJT A;  4W8K A;  3U9M A;  2L6F A;  3B0V C;  4ER9 A;  3S84 A;  1EQ1 A;  1FR0 A;  2TMV P;  2DB4 A;  2AVK A;  3I5Q A;  2IXP A;  3GOD A;  1AEP A;  1D1A A;  2J7P A;  1CPR A;  2YL1 A;  2GFH A;  1V4A A;  2FGY A;  4J30 B;  3M1C B;  3ZVR A;  2R9R B;  3HNK A;  2WVQ A;  3J06 A;  1TQG A;  2PF4 E;  4JTD B;  5A6B D;  1JPJ A;  1DOW A;  2R7U A;  1SR2 A;  4P6I C;  1KNY A;  3NYM A;  4EBJ A;  2GWW A;  4XLN F;  3K1I A;  3JYH A;  1YZA A;  5BQI A;  3SNH A;  3FAJ A;  4YL3 A;  2R7V A;  4CS7 A;  1JPN A;  2FFH A;  4JEA A;  1LI5 A;  2OJE D;  1BBH A;  2YLI A;  4JVS A;  4U5B E;  3UR3 C;  3W8I A;  5KYX A;  3F46 A;  1EKY A;  3IPM O;  4E7S A;  3FAP B;  2QLA A;  2JX0 A;  3W2W A;  1TKN A;  3DWW A;  4ULV A;  4NTA A;  4QI0 A;  2LIG A;  4JW1 A;  3C8G B;  2LCH A;  2L9J A;  3DJU B;  4MS2 A;  3Q7L A;  2Y69 C;  1OW7 A;  3HNL A;  1Z23 A;  5CI9 A;  4CDY A;  2J9V A;  2NUT A;  2R05 A;  1MMA A;  5A69 A;  1LE4 A;  2W4B A;  4N4W A;  2EIK C;  1ZYR F;  3CEX A;  3UMI A;  3VF0 A;  5AGF A;  3JYY A;  2I15 A;  4LDQ A;  1E2X A;  2XM4 A;  3G50 A;  4JTA B;  4CX9 A;  1PD0 A;  3GM3 A;  3U5S A;  4EBB A;  3DD7 A;  5L3Q A;  1YAR O;  2EIL C;  3K1H A;  4PR9 A;  1Z3I X;  5B3S C;  1HW2 A;  2IOQ A;  1JAF A;  1K40 A;  4PFO A;  5COF A;  1C03 A;  2LFF A;  4I1M A;  4JJG A;  4BPM A;  4UDV A;  3T6J A;  3U8V A;  2QTV A;  5AC5 A;  4CS8 A;  1T6I A;  1Y4C A;  1HE1 A;  1MQV A;  4XEF A;  2AU5 A;  4WGZ A;  3O39 A;  3QVY A;  5BUO A;  1CGM E;  1G5Z A;  2LP4 A;  3E70 C;  1KU2 A;  1Y6D A;  2WVN A;  3EFO A;  3IQT A;  1G8X A;  1V55 C;  4OIR F;  1VTM P;  3RVY A;  1RJ9 A;  4U5G A;  5KYW B;  4G0H A;  3EQL F;  3G4X A;  4YL1 A;  3RIP A;  2HS5 A;  2P1A A;  3QW1 A;  1WGW A;  5B1B C;  3QVZ A;  4XWJ A;  5KYY B;  2ZXO A;  3M15 A;  4NTF A;  3LAY A;  4U9E A;  3GOR A;  2W4M A;  3LLI A;  2YQY A;  4JCH A;  2AP3 A;  5JSL A;  1M2V B;  2EPL X;  3MYI A;  2WB7 A;  5KYN A;  3ZWI A;  3PDM P;  3UNG C;  1ORS C;  1GS9 A;  5T3T A;  2NUP A;  3DM5 A;  4MQ9 F;  3UMH A;  2EPK X;  4N06 A;  1NZE A;  1M2O A;  4MTG A;  3N0T A;  2V3C C;  1OKK D;  2H8A A;  5E33 A;  4CS9 A;  4YK5 A;  1JOG A;  3LES A;  4J7T A;  3U3F A;  1GGQ A;  1LM3 B;  2ICW G;  3B71 A;  4F4B A;  2DYS C;  2OKU A;  3WOD F;  4ULW A;  4AE4 A;  4KC9 A;  3UGP A;  3DE9 A;  1HE9 A;  1Q0G A;  3JSZ A;  4C7O A;  1A7V A;  1QSP A;  4CSA A;  4EKW A;  2YVK A;  1JR8 A;  1KTM A;  2YKZ A;  1QLE C;  1ZHZ A;  1W2W A;  3TOL A;  3ASO C;  2KGO A;  3T9O A;  4BJ6 A;  1MMD A;  2J9W A;  2VCC A;  3IHU A;  4RDA A;  4BEJ A;  5EGY A;  3CQZ A;  4XEV A;  1ZW2 A;  4J7Y A;  3RVZ A;  3UMK A;  1FNT c;  3C7J A;  1LS4 A;  4JZA A;  2IYL D;  3AQB A;  2J0W A;  2Z15 A;  3S27 A;  4CBE A;  1I4Y A;  4D4N A;  4U5H A;  3RH3 A;  3U2L A;  1DOV A;  2XS8 A;  5L0D A;  4CS9 C;  3AG2 C;  3K7D A;  2XLO A;  3NKE A;  4E7Z A;  3X1O A;  1A7D A;  1QVX A;  2IXO A;  3ABL C;  3VYW A;  1OR2 A;  4AL1 A;  2J9U A;  2OQM A;  3A11 A;  3F47 A;  4LER A;  5KYX B;  5L0C A;  1TFO B;  2PX3 A;  1OQC A;  5L0F A;  3WG7 C;  1T6U A;  1HMD A;  2J8W A;  3PCV A;  4O6Y A;  2BC5 A;  1BR2 A;  4Z9I A;  4OIN F;  3AOU A;  4LLE A;  3FDQ A;  5BQG A;  2B0J A;  1Q0F A;  3LNM B;  1A41 A;  4ANJ A;  4JUR I;  4JRZ A;  2IM8 A;  2NUT B;  3L34 A;  4IRU A;  1TFK B;  2KSF A;  3NMI A;  4U5E E;  2W45 A;  3HTK C;  4DVY P;  4HFK B;  3Q6M A;  2D5R B;  5A6B A;  3EGD A;  5T3W A;  3U2M A;  5DS6 A;  1VB5 A;  2HJM A;  2D4U A;  2LK4 A;  4JIO A;  1A7E A;  4JC7 A;  2BE5 F;  2J45 A;  1OCZ C;  3EGX A;  3QZC A;  3SXM A;  2P6V A;  5L0G A;  5K0I A;  1TWA A;  3AQC A;  1OW8 A;  1R5I D;  1L7C A;  1S05 A;  2G3K A;  2KNH A;  1U89 A;  1ZHW A;  2IXN A;  2PP4 A;  4LLC A;  4EIY A;  5L0I A;  2KJG A;  2NSG A;  3NRH A;  3LUT B;  3SYN A;  3HJC A;  1SF8 A;  3W2V A;  3U0C A;  3JCU Q;  4DBR A;  1V54 C;  2P7V A;  1HW1 A;  1M57 C;  2Y3B A;  3V5Y A;  4AX2 A;  2B0H A;  4QDL A;  4XTK A;  5HV9 A;  3TUL A;  2AWY A;  2AWC A;  1Z7Q c;  3G4Z A;  4AL0 A;  3ASN C;  3L8J A;  1O5H A;  1YVI A;  5COM A;  2R7S A;  5B3I A;  4CIP A;  5DS4 A;  3DAF A;  3IEE A;  1T9K A;  3ABK C;  1MNE A;  3PHF 2;  3O6X A;  3WHN A;  2XXA A;  3U3B A;  1ZU5 A;  2KC3 A;  1IW7 F;  3DJN B;  3TJ5 A;  3JRM O;  1FFH A;  1UFB A;  2E87 A;  3RKO F;  2ZXR A;  4YWQ A;  1YYX A; 
#chains in the Genus database with same CATH homology
 3AGU A;  1A7D A;  3WAQ A;  4XQ1 A;  2MHR A;  1HMD A;  2AWY A;  2AWC A;  1I4Z A;  2HMQ A;  4XPX A;  3AGT A;  4XPY A;  2AVK A;  3WHN A;  1A7E A;  1HMO A;  1I4Y A;  4XPW A;  2HMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...