2HMZA

The structures of met and azidomet hemerythrin at 1.66 angstroms resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
113
structure length
113
Chain Sequence
b'GFPIPDPYCWDISFRTFYTIIDDEHKTLFNGILLLSQADNADHLNELRRCTGKHFLNEQQLMQASQYAGYAEHKKAHDDFIHKLDTWDGDVTYAKNWLVNHIKTIDFKYRGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMERYTHRIN
publication title Structures of met and azidomet hemerythrin at 1.66 A resolution.
pubmed doi rcsb
source organism Themiste dyscritum
molecule tags Oxygen transport
total genus 50
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1990-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 2hmzA00
1I4ZA 3AGTA 2AWYA 1A7DA 2AWCA 3WHNA 1A7EA 4XPYA 3WAQA 1HMDA 2HMQA 3AGUA 1I4YA 4XPXA 1HMOA 2AVKA 4XPWA 2MHRA 4XQ1A 2HMZA
chains in the Genus database with same CATH superfamily
4MTGA 2MWQA 1RCPA 4J7TA 4O6NA 3T6BA 3U3BA 4CSAA 1VYKA 2QTVA 2R9RB 4OIOF 2W9YA 5FZTA 1RMVA 1Z63A 3G4XA 5E3AA 4DRJB 2XS1A 3M4BA 4JKVA 3WAQA 4YT5A 1LPEA 1VMAA 2D5RB 2ZXRA 1YYJA 2CNWA 4Z9HA 3V5YA 3DE8A 3DZAA 1Z3IX 3DAGA 3K1HA 3L8IA 3T4RA 1OXBA 1LS4A 3OWTA 1ZHTA 1HE9A 4E17A 3IEEA 2C03A 4CS9A 4M63A 3EGXA 4YT8A 4IJJA 1OR2A 5KYWA 3M4CA 3CSKA 1RJ9A 1JAFA 1O3UA 2DYRC 1QVXA 2PP4A 2WVOA 1OCCC 2A0UA 4HFFB 3NG1A 1JR8A 1C17M 5A6BD 4Z9JA 1O87A 4BJ6A 1LVKA 3EHNA 4JVSA 1MNEA 4CDYA 2NG1A 3IPMO 3JYHA 3U9MA 3K1IC 2LSEA 1Z5ZA 3TD7A 4RBNA 1LM3B 5GPGB 1YAUO 5T3TA 1TWCA 4NY3A 2A0BA 3S84A 3ECSA 1QQ3A 2KGOA 4AL0A 2NUTA 3UGOA 3KYJA 5JP7A 3IQTA 3B0UX 3GODA 2XXAB 1HW1A 3ZDLA 5KYYA 3GM2A 4LACB 1FFHA 3W8HA 1D1BA 5B3IA 5KYXB 1CGNA 5E33A 2ZPAA 256BA 2HV6A 3RIPA 4ULVA 2BL2A 2X51A 3DM5A 1M57C 2OU6A 3N2ZB 4LDQA 4NTBA 3LEOA 2J7PA 4DRHB 2XLWA 2EIKC 4XEFA 2XSEA 2ETSA 2R02A 4A2NB 5F28E 3US6A 2OKUA 1ZZPA 1A7VA 2H7VC 3I5QA 3GANA 3RQEA 5B3SC 1VK5A 3DI5A 2KW3C 3EPVA 4N06A 5HV9A 3NKEA 2CYDA 2R7SA 3MLGA 2L6FA 3MBGA 1PCXA 3FXHA 1Q0FA 1SF8A 3MX3A 4PJLA 3ZWIA 1ORJA 4XPYA 4LERA 3MYIA 1R4TA 2EIJC 4RD9A 1EKYA 3LS0A 3O6XA 2BC5A 3JCUQ 1Q0KA 2YLDA 2P1AA 3C8ZA 1M56C 1TWHA 3EH2A 2OJED 4AK9A 4XPXA 3CQZA 1W2WA 5D91A 2IXPA 2R7VA 4P9FA 4CS8C 3TOMA 4JTAB 4MW8A 4BJTA 2YL3A 4G7ZF 3IQCA 4MVOA 1QLEC 3VAYA 2J0XA 2LCHA 3EG9A 3Q7LA 3Q6NA 3RKOF 5A69A 2R7XA 3V5XA 3NYLA 4H54A 4CX9A 3JSEO 5JS5A 3U8PA 3FAJA 1ORYA 4JC7A 5L3VA 4A4AA 5A6JA 3EHMA 1Y4CA 1YYXA 5A6AA 4XEVA 2FAPB 3ABMC 3EGDA 1G4US 2YVKA 2P61A 3A11A 4Q7CA 1NU7D 1U89A 2YL0A 5L0FA 3F47A 3NMKA 2PF4E 4U9EA 4JEBA 4E0IA 3EQLF 2KSFA 4C3BA 1J8YF 4PJJA 1E83A 2DB4A 1UG7A 4X0RA 1VLSA 1Z23A 3LLIA 2G62A 3C7JA 3F46A 3S29A 1CGME 1F1MA 1NLXA 4PJNA 1ZU4A 5KYUB 1V55C 1HW2A 4AE4A 4XQ1A 2JX0A 3OEOA 2VH3A 4AX2A 3BEHA 1FR0A 4Q4ZF 2EPKX 3AG2C 3VYWA 2NSFA 4BG0A 2VCCA 4E7SA 3C8GA 4JE9A 4CDAA 3BRJA 4WGZA 1OW8A 2DGJA 1H9TA 4JRZA 3N24A 4N6CA 4K7BA 5D92A 4DJ9A 4OINF 2Q7RA 2KC3A 1Q0DA 1TKNA 3DXJF 3IQ6A 5F5FA 3O55A 1EA8A 4L6RA 4YN0B 3I4UA 5L0IA 3ASOC 5BUOA 4KI2A 4PK4A 2GWWA 3WODF 1S7ZA 3S0XA 3NMIA 3SYNA 3QW1A 3DKAA 3L0IA 4C7OA 4YT4A 2XLOA 3U5SA 1FMWA 2YQYA 5BQIA 4DBRA 3DWWA 3AG4C 3QW0A 2WZLA 3HTKC 1T5OA 2L6HA 3FMSA 5E3CA 1T6QA 2A69F 3LUTB 4D4NA 1GM5A 2MYSA 4I44A 3MFNA 2XLVA 3LAYA 2V3CC 2CW0F 3L8JA 3AOUA 3JRTA 1FAPB 3ABLC 1AVOB 1NU9C 2J0WA 4J7YA 1ZW2A 1D0ZA 1LI7A 1L7CA 1IW7F 1T01A 1M2VB 1T9KA 4NQFA 5AGFA 2LP4A 4R32A 1PD1A 2X0CA 1OKKA 5L0DA 1EQ1A 4IWBA 4NC3A 3PMRA 1K40A 3VRCA 1G4WR 5CI9A 1FNTc 4ZLDA 2Q3TA 3U2LA 1I4YA 3IQ5A 3LNRA 2WB7A 4FESA 3W2VA 4QI2A 3TQOA 2IYLD 1SR2A 1GQAA 5L0GA 5BQHA 4JURI 4CBEA 3ZQYA 2HSBA 1H9GA 5E2QA 1OW6A 2W45A 1CGOA 4NTAA 3ZG1A 4MTOA 4O7GA 2FGYA 4PFPA 1D1CA 1I4ZA 1GGQA 3CEXA 3JYYA 3W8IA 4O6MA 1RKCA 1A7DA 1RKEB 4FAPB 1FMVA 1WASA 4XEKA 4MNDA 3KL4A 3ZIBA 4WABA 4IAOA 4PJMA 2Q9BA 4DOZA 3T9OA 2EPNA 4WJ0A 1AEPA 1KNYA 2GAQA 2M64A 4MVRA 4CS7A 1R5ID 3K7DA 2GDCA 4WGYA 4JEAA 2XL4A 4ZLCA 2H7OA 2OJQA 3SXYA 3LJBA 3GM3A 1XWJA 4YK5A 1MMAA 1ZW3A 3H2UA 3IHUA 3CAXA 5B1BC 3WG7C 4U5BE 3NDBB 1JOGA 2NSGA 3RVZA 3B9QA 4DRIB 1C02A 1CPRA 2F22A 2XLEA 5JLIA 2L6GA 1BZ4A 3L34A 3GM1A 3V7OA 1SZIA 2L7AA 1HY5A 2R03A 3S28A 3EGXB 2Y3GA 4FX5A 3RVYA 5KYWB 2XLHA 1JPNA 1RJ9B 3H65A 1V54C 5EK0A 4G7OF 4OD4A 4G78A 4QDLA 2NUPA 2J9BA 1D0YA 1H6GA 1TWAA 1NFOA 2KNHA 3W4YA 4C3DA 5K0IA 1SYQA 1BR1A 4UDVA 2P0NA 3DM9B 4JCZA 4RDAA 2R7RA 1EI7A 3GEEA 2LIGA 4ONSA 4EIYA 5DQZA 2QNLA 2KQ9A 4KC9A 3ASNC 4H4KC 1E2XA 2PFDA 2A6HF 4PFOA 3Q7GA 2XRHA 1FTSA 2QLAA 3LEVA 2NUTB 3T6GB 3K1IA 3RYLA 2AU5A 2IM8A 2R7TA 5KYYB 1C03A 3SXZA 5CIVA 3R2PA 4YT2A 3UR3C 2CGEA 1LIHA 3UMHA 1A7EA 1CPQA 4IRUA 4CDVA 1E86A 3FVYA 4YL3A 1DOWA 5T3WA 5HSWA 2J45A 3VM6A 2OEVA 2QE9A 2YLIA 2VC9A 4U5HA 3AGUA 3GWNA 4U5DE 1VB5A 5A6BA 4HEAJ 5JUAA 2PBEA 3NMJA 2JPUA 1ZU5A 3JSZA 1Q0GA 3ZTMA 5L0JA 3FHDA 2TMVP 2CNWD 1ZYRF 2A1DD 4JJFA 3L1MA 1Q0MA 3SZRA 4B6IA 2HZ8A 3KKBA 1ZHXA 4CJGA 1NG1A 1YZCA 1TFKB 2EPLX 2HKVA 1XZPA 2L81A 2WZFA 3EFOA 2P7VA 2DYSC 4DXWA 1U0BB 1WGWA 5DS6A 1XZQA 2AWYA 2Q9AA 2WVNA 3EZHA 3HKKA 4IAQA 5JSLA 1BR4A 4JW1A 1G5ZA 1D0XA 3FAPB 3GEHA 3SXKA 4DBQA 2OOCA 4JZAA 5L0HA 2G3VA 2P6VA 1G8XA 1MMNA 1MNDA 3GWLA 3JT1A 2L9JA 1WOLA 3N0TA 4EBBA 3M1CB 2D4UA 2J9VA 2GA0A 3EG9B 4DVYP 2VB6A 3JRMO 4CS8A 4W8PA 4IGGA 3S90A 2R7UA 5DS5A 3U0CA 2YHSA 3K66A 3EJNA 2DI3A 3DJUB 5FCLA 4O6YA 2PX0A 2R7WA 1APCA 2R05A 2YRFA 1ORSC 1TWGA 2WZGA 3QZCA 4OD5A 5A6KA 4JTDB 1PV3A 3EGDB 4BJ6C 5EGYA 1YDIA 3AG3C 1U6HA 1OCOC 2Y3DA 3DMDA 3U2MA 3I5PA 3PHF2 2YL7A 4IARA 3G4ZA 3PCVA 1SMYF 4MS2A 2KJGA 3KPHA 3UGPA 4MQ9F 1YZAA 3DJNB 4K1OA 3X2QC 2R7QA 4N6HA 3C62A 5EHHA 3HLZA 3E70C 4CIHA 4YL1A 2RD9A 4NCQA 1M6TA 3M15A 4AE4B 1TFOB 2J9WA 3EH1A 4E18A 5JRAA 3S9OA 3FOOA 4GYTA 2Z15A 4CJOA 1TQGA 3H2VA 4MVSA 2XXAA 1V74B 2YL1A 3C8GB 4MVUA 4XPWA 1E85A 1WN0A 4IB4A 5TJ5E 3FOPA 2EINC 3RW0A 4EBJA 1K04A 4BEJA 2KK1A 4ANJA 5KYXA 5AC4A 3DD7A 2OG2A 3C63A 4YWQA 4NTFA 5DVWA 1QKRA 1NZEA 1T6UA 3AJMA 3W2WA 2VCAA 3SXMA 3E9VA 3KYIA 3LLKA 3EZIA 5CI8A 2AWCA 5F5HA 3VF0A 2XM0A 3LNMB 3WHNA 4Q5SF 2Q4FA 4C7OB 4P6IC 4ER9A 2J9UA 5DQTA 1J8MF 4C3EA 1PD0A 3B0PA 4N4WA 2PX3A 4P9TA 4PACA 5L0CA 2VASA 2ZD9A 4E7ZA 2M4EA 2OEXA 3O39A 1Z6AA 1BDJB 4GQHA 3NYJA 4J32B 2LFFA 3AQCA 3RF3A 1OW7A 3PDMP 1M2OA 1D1AA 3ABKC 3NKDA 2GFHA 2UUIA 4QI0A 1ST6A 2PNOA 4EBKA 2ZXWC 1YVIA 2YZSA 4G7HF 2QY9A 3X1OA 4JTCB 2J8WA 5DLJA 3AG1C 1N1CA 3CZ6A 1GS9A 3O10A 4MVZA 1I5NA 4AL1A 4I1OB 3FDQA 5JT4A 2Y39A 4U5CE 3KMIA 2LD6A 4MTFA 3ZVRA 2NPUA 1WTYA 3TOLA 4OIQF 1OXKA 4HFKB 2G3KA 1YLMA 4LLCA 1E84A 4EKWA 5AC5A 2LFDA 3DE9A 3C8GD 3POVA 3K33A 3QVZA 4MW3A 1YARO 3J06A 3B29A 1A41A 4HE8D 4BJ1A 4YJWA 2JD3A 3QTHA 3OA1A 3NYMA 2KYHA 1FFTC 1MMDA 2AVKA 1WATA 2ZXPA 3U8VA 3HJCA 3QVYA 3UMKA 2LK4A 2A6EF 3ATPA 2HMQA 2HJ3A 4D4XA 1VLTA 1L3PA 1Y6DA 2VCBA 2H8AA 1IZMA 5DS4A 2H7BA 1UFBA 2O9XA 2W4BA 1ZHZA 1HE1A 1NFNA 3NRHA 1JPJA 2Y3BA 4GEHA 4K0DA 5BQGA 1LI5A 5KYUA 4BJ5C 4JJGA 2YLGA 3G50A 3JZ0A 4EHPA 3KH2A 3LS1A 1JRAA 3M79A 4ULWA 1HMDA 3HNIA 4U9DA 2FFHA 5JVEA 2IBFA 2IOQA 4XTKA 2HS5A 2XS8A 1T6IA 2YWAA 1ZHYA 3GORA 3ZSUA 3JTLO 1AUEA 3ITFA 3HNKA 4PR9A 2ZXOA 4Z9IA 4OIRF 5KYNA 2EPOA 1HMOA 1TR2A 1MMGA 2IXNA 1OKKD 1YJGA 2J46A 1VTMP 3TK0A 3U3FA 4EWCA 3RH3A 2V26A 2HUJA 4CIPA 2WL8A 1OCZC 4E0HA 4I1MA 1QSPA 1WWPA 2ASRA 1NSGB 1LKXA 4YL0A 3RFYA 1KTMA 4XLNF 2Q9CA 3MYFA 4LDRA 4FWVA 4XWJA 2HJMA 1A0BA 4CSAC 3RQGA 3B71A 4J30B 2NUPB 3TJ6A 4DVZA 4I3MA 1OQCA 2R7OA 2LQGA 1Z7Qc 4XLPF 5B1AC 5L3QA 4KNWA 3LESA 2W4MA 5T1DB 3S27A 3SEOA 2HSQA 2CCYA 4JCHA 1KU2A 3A9CA 3RQFA 3B0VC 2XL8A 2OQMA 1RXQA 1M2VA 2I15A 3DAFA 4U5FE 3UMIA 3C18A 2YEVA 4CS9C 4LLEA 4MVMA 2YKZA 4EUKB 2A68F 2B0HA 2HV7A 1VYIA 2XLMA 1YA7O 4G0HA 2HMZA 4U5GA 5COMA 1OR3A 5IY5C 1JMWA 4JIOA 2EIMC 1YA9A 2QUPA 1LE4A 1S05A 1VOMA 2XM4A 4LDKA 4W8KA 4F4BA 3AGTA 4BJ5A 1LE2A 3U9JA 1ZHWA 3TJ5A 2E87A 2B0JA 3ZQVA 1NBBA 2IXOA 1QPUA 2OCCC 2XL6A 2AP3A 2J7PD 2HFIA 1B68A 3TULA 2XLDA 1DOVA 2EILC 2Y69C 4MVQA 2RSEB 2IXMA 1OCRC 1ZVZA 1MQVA 2I8BA 4BEMJ 1RKEA 2Y3HA 2BE5F 4U5EE 3R7CA 1QZXA 5COFA 3QMKA 3EFOB 2C04A 3V5ZA 1O5HA 2EPMX 3AQBA 3HNLA 4O79A 5COGA 3ZC4A 1H7IA 3SNHA 2ICWG 1BR2A 1K05A 2R25A 3Q6MA 2MHRA 2Q00A 3GEIA 2UUHA 2WVQA 3HNJA 4BPMA 3UNGC 4OIPF 4KNVA 1V4AA 3SP1A 3T6JA 3ZTZA 4KBLA 3K6BA 1BBHA 1LS1A 2CDQA
chains in the Genus database with same CATH topology
1I4ZA 3AGTA 2AWYA 1A7DA 2AWCA 3WHNA 1A7EA 4XPYA 3WAQA 1HMDA 2HMQA 3AGUA 1I4YA 4XPXA 1HMOA 2AVKA 4XPWA 2MHRA 4XQ1A 2HMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I4Z A;  3AGT A;  2AWY A;  1A7D A;  2AWC A;  3WHN A;  1A7E A;  4XPY A;  3WAQ A;  1HMD A;  2HMQ A;  3AGU A;  1I4Y A;  4XPX A;  1HMO A;  2AVK A;  4XPW A;  2MHR A;  4XQ1 A;  2HMZ A; 
#chains in the Genus database with same CATH topology
 4MTG A;  2MWQ A;  1RCP A;  4J7T A;  4O6N A;  3T6B A;  3U3B A;  4CSA A;  1VYK A;  2QTV A;  2R9R B;  4OIO F;  2W9Y A;  5FZT A;  1RMV A;  1Z63 A;  3G4X A;  5E3A A;  4DRJ B;  2XS1 A;  3M4B A;  4JKV A;  3WAQ A;  4YT5 A;  1LPE A;  1VMA A;  2D5R B;  2ZXR A;  1YYJ A;  2CNW A;  4Z9H A;  3V5Y A;  3DE8 A;  3DZA A;  1Z3I X;  3DAG A;  3K1H A;  3L8I A;  3T4R A;  1OXB A;  1LS4 A;  3OWT A;  1ZHT A;  1HE9 A;  4E17 A;  3IEE A;  2C03 A;  4CS9 A;  4M63 A;  3EGX A;  4YT8 A;  4IJJ A;  1OR2 A;  5KYW A;  3M4C A;  3CSK A;  1RJ9 A;  1JAF A;  1O3U A;  2DYR C;  1QVX A;  2PP4 A;  2WVO A;  1OCC C;  2A0U A;  4HFF B;  3NG1 A;  1JR8 A;  1C17 M;  5A6B D;  4Z9J A;  1O87 A;  4BJ6 A;  1LVK A;  3EHN A;  4JVS A;  1MNE A;  4CDY A;  2NG1 A;  3IPM O;  3JYH A;  3U9M A;  3K1I C;  2LSE A;  1Z5Z A;  3TD7 A;  4RBN A;  1LM3 B;  5GPG B;  1YAU O;  5T3T A;  1TWC A;  4NY3 A;  2A0B A;  3S84 A;  3ECS A;  1QQ3 A;  2KGO A;  4AL0 A;  2NUT A;  3UGO A;  3KYJ A;  5JP7 A;  3IQT A;  3B0U X;  3GOD A;  2XXA B;  1HW1 A;  3ZDL A;  5KYY A;  3GM2 A;  4LAC B;  1FFH A;  3W8H A;  1D1B A;  5B3I A;  5KYX B;  1CGN A;  5E33 A;  2ZPA A;  256B A;  2HV6 A;  3RIP A;  4ULV A;  2BL2 A;  2X51 A;  3DM5 A;  1M57 C;  2OU6 A;  3N2Z B;  4LDQ A;  4NTB A;  3LEO A;  2J7P A;  4DRH B;  2XLW A;  2EIK C;  4XEF A;  2XSE A;  2ETS A;  2R02 A;  4A2N B;  5F28 E;  3US6 A;  2OKU A;  1ZZP A;  1A7V A;  2H7V C;  3I5Q A;  3GAN A;  3RQE A;  5B3S C;  1VK5 A;  3DI5 A;  2KW3 C;  3EPV A;  4N06 A;  5HV9 A;  3NKE A;  2CYD A;  2R7S A;  3MLG A;  2L6F A;  3MBG A;  1PCX A;  3FXH A;  1Q0F A;  1SF8 A;  3MX3 A;  4PJL A;  3ZWI A;  1ORJ A;  4XPY A;  4LER A;  3MYI A;  1R4T A;  2EIJ C;  4RD9 A;  1EKY A;  3LS0 A;  3O6X A;  2BC5 A;  3JCU Q;  1Q0K A;  2YLD A;  2P1A A;  3C8Z A;  1M56 C;  1TWH A;  3EH2 A;  2OJE D;  4AK9 A;  4XPX A;  3CQZ A;  1W2W A;  5D91 A;  2IXP A;  2R7V A;  4P9F A;  4CS8 C;  3TOM A;  4JTA B;  4MW8 A;  4BJT A;  2YL3 A;  4G7Z F;  3IQC A;  4MVO A;  1QLE C;  3VAY A;  2J0X A;  2LCH A;  3EG9 A;  3Q7L A;  3Q6N A;  3RKO F;  5A69 A;  2R7X A;  3V5X A;  3NYL A;  4H54 A;  4CX9 A;  3JSE O;  5JS5 A;  3U8P A;  3FAJ A;  1ORY A;  4JC7 A;  5L3V A;  4A4A A;  5A6J A;  3EHM A;  1Y4C A;  1YYX A;  5A6A A;  4XEV A;  2FAP B;  3ABM C;  3EGD A;  1G4U S;  2YVK A;  2P61 A;  3A11 A;  4Q7C A;  1NU7 D;  1U89 A;  2YL0 A;  5L0F A;  3F47 A;  3NMK A;  2PF4 E;  4U9E A;  4JEB A;  4E0I A;  3EQL F;  2KSF A;  4C3B A;  1J8Y F;  4PJJ A;  1E83 A;  2DB4 A;  1UG7 A;  4X0R A;  1VLS A;  1Z23 A;  3LLI A;  2G62 A;  3C7J A;  3F46 A;  3S29 A;  1CGM E;  1F1M A;  1NLX A;  4PJN A;  1ZU4 A;  5KYU B;  1V55 C;  1HW2 A;  4AE4 A;  4XQ1 A;  2JX0 A;  3OEO A;  2VH3 A;  4AX2 A;  3BEH A;  1FR0 A;  4Q4Z F;  2EPK X;  3AG2 C;  3VYW A;  2NSF A;  4BG0 A;  2VCC A;  4E7S A;  3C8G A;  4JE9 A;  4CDA A;  3BRJ A;  4WGZ A;  1OW8 A;  2DGJ A;  1H9T A;  4JRZ A;  3N24 A;  4N6C A;  4K7B A;  5D92 A;  4DJ9 A;  4OIN F;  2Q7R A;  2KC3 A;  1Q0D A;  1TKN A;  3DXJ F;  3IQ6 A;  5F5F A;  3O55 A;  1EA8 A;  4L6R A;  4YN0 B;  3I4U A;  5L0I A;  3ASO C;  5BUO A;  4KI2 A;  4PK4 A;  2GWW A;  3WOD F;  1S7Z A;  3S0X A;  3NMI A;  3SYN A;  3QW1 A;  3DKA A;  3L0I A;  4C7O A;  4YT4 A;  2XLO A;  3U5S A;  1FMW A;  2YQY A;  5BQI A;  4DBR A;  3DWW A;  3AG4 C;  3QW0 A;  2WZL A;  3HTK C;  1T5O A;  2L6H A;  3FMS A;  5E3C A;  1T6Q A;  2A69 F;  3LUT B;  4D4N A;  1GM5 A;  2MYS A;  4I44 A;  3MFN A;  2XLV A;  3LAY A;  2V3C C;  2CW0 F;  3L8J A;  3AOU A;  3JRT A;  1FAP B;  3ABL C;  1AVO B;  1NU9 C;  2J0W A;  4J7Y A;  1ZW2 A;  1D0Z A;  1LI7 A;  1L7C A;  1IW7 F;  1T01 A;  1M2V B;  1T9K A;  4NQF A;  5AGF A;  2LP4 A;  4R32 A;  1PD1 A;  2X0C A;  1OKK A;  5L0D A;  1EQ1 A;  4IWB A;  4NC3 A;  3PMR A;  1K40 A;  3VRC A;  1G4W R;  5CI9 A;  1FNT c;  4ZLD A;  2Q3T A;  3U2L A;  1I4Y A;  3IQ5 A;  3LNR A;  2WB7 A;  4FES A;  3W2V A;  4QI2 A;  3TQO A;  2IYL D;  1SR2 A;  1GQA A;  5L0G A;  5BQH A;  4JUR I;  4CBE A;  3ZQY A;  2HSB A;  1H9G A;  5E2Q A;  1OW6 A;  2W45 A;  1CGO A;  4NTA A;  3ZG1 A;  4MTO A;  4O7G A;  2FGY A;  4PFP A;  1D1C A;  1I4Z A;  1GGQ A;  3CEX A;  3JYY A;  3W8I A;  4O6M A;  1RKC A;  1A7D A;  1RKE B;  4FAP B;  1FMV A;  1WAS A;  4XEK A;  4MND A;  3KL4 A;  3ZIB A;  4WAB A;  4IAO A;  4PJM A;  2Q9B A;  4DOZ A;  3T9O A;  2EPN A;  4WJ0 A;  1AEP A;  1KNY A;  2GAQ A;  2M64 A;  4MVR A;  4CS7 A;  1R5I D;  3K7D A;  2GDC A;  4WGY A;  4JEA A;  2XL4 A;  4ZLC A;  2H7O A;  2OJQ A;  3SXY A;  3LJB A;  3GM3 A;  1XWJ A;  4YK5 A;  1MMA A;  1ZW3 A;  3H2U A;  3IHU A;  3CAX A;  5B1B C;  3WG7 C;  4U5B E;  3NDB B;  1JOG A;  2NSG A;  3RVZ A;  3B9Q A;  4DRI B;  1C02 A;  1CPR A;  2F22 A;  2XLE A;  5JLI A;  2L6G A;  1BZ4 A;  3L34 A;  3GM1 A;  3V7O A;  1SZI A;  2L7A A;  1HY5 A;  2R03 A;  3S28 A;  3EGX B;  2Y3G A;  4FX5 A;  3RVY A;  5KYW B;  2XLH A;  1JPN A;  1RJ9 B;  3H65 A;  1V54 C;  5EK0 A;  4G7O F;  4OD4 A;  4G78 A;  4QDL A;  2NUP A;  2J9B A;  1D0Y A;  1H6G A;  1TWA A;  1NFO A;  2KNH A;  3W4Y A;  4C3D A;  5K0I A;  1SYQ A;  1BR1 A;  4UDV A;  2P0N A;  3DM9 B;  4JCZ A;  4RDA A;  2R7R A;  1EI7 A;  3GEE A;  2LIG A;  4ONS A;  4EIY A;  5DQZ A;  2QNL A;  2KQ9 A;  4KC9 A;  3ASN C;  4H4K C;  1E2X A;  2PFD A;  2A6H F;  4PFO A;  3Q7G A;  2XRH A;  1FTS A;  2QLA A;  3LEV A;  2NUT B;  3T6G B;  3K1I A;  3RYL A;  2AU5 A;  2IM8 A;  2R7T A;  5KYY B;  1C03 A;  3SXZ A;  5CIV A;  3R2P A;  4YT2 A;  3UR3 C;  2CGE A;  1LIH A;  3UMH A;  1A7E A;  1CPQ A;  4IRU A;  4CDV A;  1E86 A;  3FVY A;  4YL3 A;  1DOW A;  5T3W A;  5HSW A;  2J45 A;  3VM6 A;  2OEV A;  2QE9 A;  2YLI A;  2VC9 A;  4U5H A;  3AGU A;  3GWN A;  4U5D E;  1VB5 A;  5A6B A;  4HEA J;  5JUA A;  2PBE A;  3NMJ A;  2JPU A;  1ZU5 A;  3JSZ A;  1Q0G A;  3ZTM A;  5L0J A;  3FHD A;  2TMV P;  2CNW D;  1ZYR F;  2A1D D;  4JJF A;  3L1M A;  1Q0M A;  3SZR A;  4B6I A;  2HZ8 A;  3KKB A;  1ZHX A;  4CJG A;  1NG1 A;  1YZC A;  1TFK B;  2EPL X;  2HKV A;  1XZP A;  2L81 A;  2WZF A;  3EFO A;  2P7V A;  2DYS C;  4DXW A;  1U0B B;  1WGW A;  5DS6 A;  1XZQ A;  2AWY A;  2Q9A A;  2WVN A;  3EZH A;  3HKK A;  4IAQ A;  5JSL A;  1BR4 A;  4JW1 A;  1G5Z A;  1D0X A;  3FAP B;  3GEH A;  3SXK A;  4DBQ A;  2OOC A;  4JZA A;  5L0H A;  2G3V A;  2P6V A;  1G8X A;  1MMN A;  1MND A;  3GWL A;  3JT1 A;  2L9J A;  1WOL A;  3N0T A;  4EBB A;  3M1C B;  2D4U A;  2J9V A;  2GA0 A;  3EG9 B;  4DVY P;  2VB6 A;  3JRM O;  4CS8 A;  4W8P A;  4IGG A;  3S90 A;  2R7U A;  5DS5 A;  3U0C A;  2YHS A;  3K66 A;  3EJN A;  2DI3 A;  3DJU B;  5FCL A;  4O6Y A;  2PX0 A;  2R7W A;  1APC A;  2R05 A;  2YRF A;  1ORS C;  1TWG A;  2WZG A;  3QZC A;  4OD5 A;  5A6K A;  4JTD B;  1PV3 A;  3EGD B;  4BJ6 C;  5EGY A;  1YDI A;  3AG3 C;  1U6H A;  1OCO C;  2Y3D A;  3DMD A;  3U2M A;  3I5P A;  3PHF 2;  2YL7 A;  4IAR A;  3G4Z A;  3PCV A;  1SMY F;  4MS2 A;  2KJG A;  3KPH A;  3UGP A;  4MQ9 F;  1YZA A;  3DJN B;  4K1O A;  3X2Q C;  2R7Q A;  4N6H A;  3C62 A;  5EHH A;  3HLZ A;  3E70 C;  4CIH A;  4YL1 A;  2RD9 A;  4NCQ A;  1M6T A;  3M15 A;  4AE4 B;  1TFO B;  2J9W A;  3EH1 A;  4E18 A;  5JRA A;  3S9O A;  3FOO A;  4GYT A;  2Z15 A;  4CJO A;  1TQG A;  3H2V A;  4MVS A;  2XXA A;  1V74 B;  2YL1 A;  3C8G B;  4MVU A;  4XPW A;  1E85 A;  1WN0 A;  4IB4 A;  5TJ5 E;  3FOP A;  2EIN C;  3RW0 A;  4EBJ A;  1K04 A;  4BEJ A;  2KK1 A;  4ANJ A;  5KYX A;  5AC4 A;  3DD7 A;  2OG2 A;  3C63 A;  4YWQ A;  4NTF A;  5DVW A;  1QKR A;  1NZE A;  1T6U A;  3AJM A;  3W2W A;  2VCA A;  3SXM A;  3E9V A;  3KYI A;  3LLK A;  3EZI A;  5CI8 A;  2AWC A;  5F5H A;  3VF0 A;  2XM0 A;  3LNM B;  3WHN A;  4Q5S F;  2Q4F A;  4C7O B;  4P6I C;  4ER9 A;  2J9U A;  5DQT A;  1J8M F;  4C3E A;  1PD0 A;  3B0P A;  4N4W A;  2PX3 A;  4P9T A;  4PAC A;  5L0C A;  2VAS A;  2ZD9 A;  4E7Z A;  2M4E A;  2OEX A;  3O39 A;  1Z6A A;  1BDJ B;  4GQH A;  3NYJ A;  4J32 B;  2LFF A;  3AQC A;  3RF3 A;  1OW7 A;  3PDM P;  1M2O A;  1D1A A;  3ABK C;  3NKD A;  2GFH A;  2UUI A;  4QI0 A;  1ST6 A;  2PNO A;  4EBK A;  2ZXW C;  1YVI A;  2YZS A;  4G7H F;  2QY9 A;  3X1O A;  4JTC B;  2J8W A;  5DLJ A;  3AG1 C;  1N1C A;  3CZ6 A;  1GS9 A;  3O10 A;  4MVZ A;  1I5N A;  4AL1 A;  4I1O B;  3FDQ A;  5JT4 A;  2Y39 A;  4U5C E;  3KMI A;  2LD6 A;  4MTF A;  3ZVR A;  2NPU A;  1WTY A;  3TOL A;  4OIQ F;  1OXK A;  4HFK B;  2G3K A;  1YLM A;  4LLC A;  1E84 A;  4EKW A;  5AC5 A;  2LFD A;  3DE9 A;  3C8G D;  3POV A;  3K33 A;  3QVZ A;  4MW3 A;  1YAR O;  3J06 A;  3B29 A;  1A41 A;  4HE8 D;  4BJ1 A;  4YJW A;  2JD3 A;  3QTH A;  3OA1 A;  3NYM A;  2KYH A;  1FFT C;  1MMD A;  2AVK A;  1WAT A;  2ZXP A;  3U8V A;  3HJC A;  3QVY A;  3UMK A;  2LK4 A;  2A6E F;  3ATP A;  2HMQ A;  2HJ3 A;  4D4X A;  1VLT A;  1L3P A;  1Y6D A;  2VCB A;  2H8A A;  1IZM A;  5DS4 A;  2H7B A;  1UFB A;  2O9X A;  2W4B A;  1ZHZ A;  1HE1 A;  1NFN A;  3NRH A;  1JPJ A;  2Y3B A;  4GEH A;  4K0D A;  5BQG A;  1LI5 A;  5KYU A;  4BJ5 C;  4JJG A;  2YLG A;  3G50 A;  3JZ0 A;  4EHP A;  3KH2 A;  3LS1 A;  1JRA A;  3M79 A;  4ULW A;  1HMD A;  3HNI A;  4U9D A;  2FFH A;  5JVE A;  2IBF A;  2IOQ A;  4XTK A;  2HS5 A;  2XS8 A;  1T6I A;  2YWA A;  1ZHY A;  3GOR A;  3ZSU A;  3JTL O;  1AUE A;  3ITF A;  3HNK A;  4PR9 A;  2ZXO A;  4Z9I A;  4OIR F;  5KYN A;  2EPO A;  1HMO A;  1TR2 A;  1MMG A;  2IXN A;  1OKK D;  1YJG A;  2J46 A;  1VTM P;  3TK0 A;  3U3F A;  4EWC A;  3RH3 A;  2V26 A;  2HUJ A;  4CIP A;  2WL8 A;  1OCZ C;  4E0H A;  4I1M A;  1QSP A;  1WWP A;  2ASR A;  1NSG B;  1LKX A;  4YL0 A;  3RFY A;  1KTM A;  4XLN F;  2Q9C A;  3MYF A;  4LDR A;  4FWV A;  4XWJ A;  2HJM A;  1A0B A;  4CSA C;  3RQG A;  3B71 A;  4J30 B;  2NUP B;  3TJ6 A;  4DVZ A;  4I3M A;  1OQC A;  2R7O A;  2LQG A;  1Z7Q c;  4XLP F;  5B1A C;  5L3Q A;  4KNW A;  3LES A;  2W4M A;  5T1D B;  3S27 A;  3SEO A;  2HSQ A;  2CCY A;  4JCH A;  1KU2 A;  3A9C A;  3RQF A;  3B0V C;  2XL8 A;  2OQM A;  1RXQ A;  1M2V A;  2I15 A;  3DAF A;  4U5F E;  3UMI A;  3C18 A;  2YEV A;  4CS9 C;  4LLE A;  4MVM A;  2YKZ A;  4EUK B;  2A68 F;  2B0H A;  2HV7 A;  1VYI A;  2XLM A;  1YA7 O;  4G0H A;  2HMZ A;  4U5G A;  5COM A;  1OR3 A;  5IY5 C;  1JMW A;  4JIO A;  2EIM C;  1YA9 A;  2QUP A;  1LE4 A;  1S05 A;  1VOM A;  2XM4 A;  4LDK A;  4W8K A;  4F4B A;  3AGT A;  4BJ5 A;  1LE2 A;  3U9J A;  1ZHW A;  3TJ5 A;  2E87 A;  2B0J A;  3ZQV A;  1NBB A;  2IXO A;  1QPU A;  2OCC C;  2XL6 A;  2AP3 A;  2J7P D;  2HFI A;  1B68 A;  3TUL A;  2XLD A;  1DOV A;  2EIL C;  2Y69 C;  4MVQ A;  2RSE B;  2IXM A;  1OCR C;  1ZVZ A;  1MQV A;  2I8B A;  4BEM J;  1RKE A;  2Y3H A;  2BE5 F;  4U5E E;  3R7C A;  1QZX A;  5COF A;  3QMK A;  3EFO B;  2C04 A;  3V5Z A;  1O5H A;  2EPM X;  3AQB A;  3HNL A;  4O79 A;  5COG A;  3ZC4 A;  1H7I A;  3SNH A;  2ICW G;  1BR2 A;  1K05 A;  2R25 A;  3Q6M A;  2MHR A;  2Q00 A;  3GEI A;  2UUH A;  2WVQ A;  3HNJ A;  4BPM A;  3UNG C;  4OIP F;  4KNV A;  1V4A A;  3SP1 A;  3T6J A;  3ZTZ A;  4KBL A;  3K6B A;  1BBH A;  1LS1 A;  2CDQ A; 
#chains in the Genus database with same CATH homology
 1I4Z A;  3AGT A;  2AWY A;  1A7D A;  2AWC A;  3WHN A;  1A7E A;  4XPY A;  3WAQ A;  1HMD A;  2HMQ A;  3AGU A;  1I4Y A;  4XPX A;  1HMO A;  2AVK A;  4XPW A;  2MHR A;  4XQ1 A;  2HMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...