2HMZA

The structures of met and azidomet hemerythrin at 1.66 angstroms resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
113
structure length
113
Chain Sequence
GFPIPDPYCWDISFRTFYTIIDDEHKTLFNGILLLSQADNADHLNELRRCTGKHFLNEQQLMQASQYAGYAEHKKAHDDFIHKLDTWDGDVTYAKNWLVNHIKTIDFKYRGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of met and azidomet hemerythrin at 1.66 A resolution.
pubmed doi rcsb
source organism Themiste dyscritum
molecule tags Oxygen transport
molecule keywords HEMERYTHRIN
total genus 50
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1990-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 2hmzA00
2HMQA 3AGTA 4XPXA 3WHNA 1A7DA 4XPWA 3AGUA 4XQ1A 3WAQA 4XPYA 1A7EA 2AVKA 2AWYA 1HMDA 2MHRA 2AWCA 1HMOA 2HMZA 1I4ZA 1I4YA
chains in the Genus database with same CATH superfamily
1SYQA 2J0WA 2Q9CA 2PBEA 1PD0A 2B0JA 2R7QA 3GEIA 1KTMA 1Z6AA 1AUEA 1ST6A 2EPNA 2VC9A 2I15A 2J45A 4JJGA 3SNHA 5L0IA 1D0XA 2ZD9A 4PJNA 3KYJA 3OWTA 1U0BB 5DQZA 1G8XA 3EG9A 3M15A 4EUKB 1OXBA 1VK5A 1NU7D 5DQTA 2QNLA 1T6IA 3LESA 1BR2A 1HMOA 2CGEA 1SZIA 4GQHA 4OD4A 3AOUA 4XEKA 1MMNA 3N2ZB 5COMA 5KYXA 1APCA 4XWJA 4MNDA 5A6KA 2OOCA 5KYUA 2LD6A 4DVYP 5AC5A 4N6HA 2R7WA 3EQLF 2XM0A 2ZXOA 1NBBA 2Y3DA 3S90A 5GPGB 1J8YF 3WAQA 2LFDA 2J46A 3DD7A 1H7IA 2VCAA 2XLWA 3NKDA 1EQ1A 3C18A 2AWCA 4K1OA 1WASA 3RF3A 4GYTA 3HKKA 1RCPA 1FR0A 2IM8A 4C7OB 5F5FA 3FAPB 5DS4A 3ZDLA 1F1MA 1MQVA 2IXMA 4U5HA 3TD7A 3C7JA 2LP4A 1TQGA 2J9WA 1OW6A 2A69F 2F22A 3NG1A 4XLPF 2W4MA 4EIYA 1S7ZA 3DMDA 2CNWD 4KNWA 1Z63A 3SYNA 3W2WA 1HE9A 1JAFA 1MNEA 2LIGA 1VLSA 1ZVZA 1R4TA 1ZU4A 3LLKA 4JTCB 5E3CA 3ZTMA 1E85A 2W4BA 4PFOA 3G50A 3S9OA 4IARA 2VB6A 3NMJA 3ZIBA 1T5OA 2DB4A 3RQEA 1TR2A 4OD5A 1QSPA 4NQFA 1V54C 4YL3A 5IY5C 2OJED 1EI7A 3M4BA 3QZCA 4IAQA 3LAYA 3T6BA 5JP7A 3GWLA 3S28A 1I4YA 3BEHA 1NSGB 2IXPA 2V26A 3KL4A 3ZC4A 1Q0MA 3S27A 2Y3HA 3LNMB 3L8IA 4JURI 3RYLA 1T9KA 3FMSA 4LDQA 5L0DA 3JRMO 4MQ9F 4O6MA 2YL7A 3ATPA 1E86A 2GDCA 2OU6A 4E0IA 3LUTB 4YT8A 3AG1C 1YVIA 3BRJA 2VH3A 4O6YA 4U5EE 2EIKC 4WGZA 3LLIA 1AVOB 3IHUA 5E3AA 4D4XA 5A6BD 2XLMA 3U8VA 3DM9B 1L7CA 1T6QA 1M6TA 1YLMA 3E70C 2PP4A 2QE9A 5JT4A 4JIOA 4EBKA 3B0UX 1FTSA 1T01A 1A7VA 2HZ8A 2KSFA 3A9CA 3EGXA 4PJLA 2A6HF 2XL4A 2HSQA 2NPUA 2YEVA 1FAPB 1JPJA 3C8GD 3H2UA 4DBRA 5L0FA 2JPUA 5B3IA 2C03A 3FDQA 4N6CA 4CSAC 1WATA 2HV7A 1PV3A 2YVKA 3U2MA 4ULWA 4MVZA 4K7BA 3C62A 4CDAA 2QLAA 4KI2A 2A0BA 4QI2A 5B1BC 4IB4A 4E17A 2XS1A 1Y6DA 4YWQA 4EBJA 2GWWA 1E83A 1A41A 2QTVA 1CPRA 1HW1A 2LSEA 3C8GB 3LEVA 1RXQA 4Z9JA 5KYUB 3A11A 1G4WR 4F4BA 1YJGA 2XRHA 4CS8C 5FZTA 2WZGA 4Z9IA 3ITFA 2KC3A 2M4EA 2MWQA 2QUPA 4U5FE 2L81A 5A6JA 1LPEA 1JPNA 3ASOC 1SR2A 2OKUA 1V55C 4C3DA 3EH1A 2E87A 4D4NA 3QW1A 2OCCC 4N06A 3ZQYA 3LNRA 4CIHA 1QKRA 5T3TA 3QTHA 3SZRA 3FVYA 1XZPA 2J9UA 5KYNA 1R5ID 2PX0A 4I1MA 5D92A 3ECSA 4E18A 4QDLA 2XXAB 2KQ9A 2PNOA 2HMQA 2EILC 3AG3C 1Y4CA 4O7GA 2NUTA 3DAGA 5FCLA 4MVRA 2P0NA 1Z3IX 4MVSA 3JSEO 2KW3C 4PJJA 3TK0A 4WJ0A 2R7RA 2YL0A 1N1CA 1OKKA 4AL0A 3EFOB 1VMAA 3NMIA 3B9QA 3C8ZA 3EG9B 2LCHA 4H54A 4JTDB 3ZQVA 4M63A 1G5ZA 2ZXWC 3DAFA 4OIPF 2X51A 4CS7A 2A6EF 3W8HA 1LS1A 1JRAA 1VYKA 1OCCC 2L7AA 3S29A 3QVZA 3Q6NA 4U9EA 2YLGA 2YHSA 3TOMA 1NU9C 3F47A 5COGA 1A7EA 2CW0F 1MMDA 2EPMX 3EHNA 5CI8A 3EJNA 1OCZC 4IAOA 4JCZA 4BJ5A 2HFIA 2BC5A 3FOPA 4A4AA 3Q7GA 2H8AA 3RVZA 4RDAA 4DJ9A 4CBEA 3HNJA 1NFNA 3SXYA 4AX2A 2NSFA 3UMIA 1JMWA 3HNKA 2Z15A 3KMIA 2VASA 2EIJC 2WZFA 3ASNC 2NUTB 4U9DA 5KYWB 2RD9A 4W8KA 4KC9A 2EPKX 5L3QA 4JTAB 4PFPA 2V3CC 3WODF 1ZHZA 3I4UA 3U9MA 2Y3GA 3RFYA 4NTAA 3U8PA 4K0DA 1JR8A 1A7DA 4JEAA 3O10A 5JLIA 1ZHWA 3ABKC 3PCVA 2NG1A 4CDVA 1OR2A 1ZW2A 3ZWIA 3JCUQ 4BPMA 4RD9A 4LERA 1ZZPA 4R32A 2Q7RA 1ORJA 4LLCA 1TWGA 4G7HF 1G4US 3N0TA 1ZHYA 1OKKD 2BE5F 2IBFA 3SP1A 4ER9A 2D4UA 2JD3A 2LFFA 2MYSA 4P6IC 4L6RA 4DRIB 1A0BA 3FXHA 2YL3A 3T4RA 2G3KA 1VYIA 256BA 5A69A 1FNTc 4EKWA 1SMYF 1CGNA 2LQGA 1D1AA 2GA0A 3O55A 1GQAA 1M2VA 2Q9AA 4U5BE 1OCRC 3PHF2 1L3PA 3QW0A 5F28E 1Q0DA 2R02A 1HW2A 4MVUA 3DE8A 1OR3A 2Y69C 2X0CA 3MBGA 4DBQA 3AQBA 5HV9A 3IQTA 3FAJA 4O6NA 3ZSUA 5AC4A 1I4ZA 3PDMP 1D1CA 1VTMP 1FMVA 5CI9A 5B1AC 4XQ1A 1I5NA 1GM5A 1LE4A 4EBBA 1M56C 1V74B 2EINC 2R05A 1Z23A 3O39A 4JCHA 4LACB 5JUAA 3N24A 2TMVP 4YK5A 3GORA 3NDBB 3MLGA 4IWBA 3GM1A 4JKVA 3L0IA 4FESA 4XPXA 4CS9A 2AWYA 4JC7A 1ZHXA 4JRZA 1BR4A 2CYDA 4J30B 2QY9A 2ZXPA 4OIOF 1MMGA 3L8JA 4DOZA 4NTFA 3MYFA 3VYWA 3FHDA 2DI3A 2BL2A 3K1IC 3MYIA 3MX3A 4Z9HA 5F5HA 5L0JA 2CDQA 5DS5A 1IW7F 1ORSC 2HV6A 3M4CA 3EH2A 2AVKA 3C8GA 5TJ5E 3W4YA 1WOLA 3JYYA 2NUPB 1GGQA 3GEEA 3QMKA 1ORYA 2YZSA 4JJFA 4IGGA 4CSAA 3DI5A 3NKEA 5E33A 5KYYA 2A0UA 4JEBA 3U5SA 3V5XA 3KKBA 4E0HA 2VCBA 2XSEA 4XPYA 2HS5A 3DE9A 3AG4C 3W8IA 1O5HA 2IXOA 4Q4ZF 2I8BA 3L1MA 4LLEA 1YYXA 2XLHA 1Z7Qc 4J7TA 3I5QA 2AU5A 2W45A 4NTBA 3EHMA 5A6BA 1H9TA 4AL1A 1C03A 5KYYB 5D91A 4AE4A 5KYWA 2UUIA 4DRJB 3Q7LA 5L0CA 3V5YA 1T6UA 1ZHTA 2EPOA 4MTGA 1V4AA 5EK0A 1VLTA 2P6VA 3HJCA 4W8PA 3UMHA 1EKYA 4NC3A 3W2VA 2ETSA 2CNWA 2Q9BA 2EPLX 2OEXA 3UR3C 2VCCA 3DXJF 1D0YA 1CGME 4J32B 2C04A 4PJMA 5JS5A 3HNLA 3B0VC 1HE1A 1LM3B 3QVYA 1DOWA 2A68F 2DGJA 2XLVA 2GFHA 2Q3TA 4HFFB 4P9TA 4HEAJ 2XL8A 4WABA 1LE2A 1LIHA 1ZU5A 2A1DD 2CCYA 4YT4A 3TJ5A 3S0XA 2XS8A 2NSGA 3OA1A 2M64A 4QI0A 4XTKA 4J7YA 4BEJA 5EHHA 1Q0KA 1NLXA 2HMZA 1OCOC 2B0HA 1FMWA 1M2OA 2XXAA 1NFOA 3RH3A 1BR1A 3ABMC 2P1AA 2R25A 1U89A 4YL0A 1DOVA 3VAYA 4BG0A 4DVZA 5BQIA 3GM3A 4LDKA 2R7TA 3M79A 1YA7O 3TQOA 5DLJA 2OG2A 5BQGA 5KYXB 3RW0A 3SXKA 2L6HA 2Q4FA 4B6IA 2FAPB 2Y39A 2Y3BA 3EGDB 5L0HA 3AJMA 2YRFA 3U9JA 5JSLA 4OIRF 3GEHA 5E2QA 1E2XA 3DJUB 3JYHA 4CJOA 2JX0A 3DM5A 4MVQA 1TWCA 1YZAA 4CDYA 3R2PA 2XLDA 2HJMA 1M57C 3B0PA 1TKNA 4RBNA 3KPHA 1RJ9B 1AEPA 1H9GA 4H4KC 1PD1A 3KH2A 3K1HA 2UUHA 3US6A 2R7XA 2W9YA 3TJ6A 2HSBA 3K66A 4C7OA 3AGTA 4P9FA 5L3VA 2OEVA 4I44A 4G7OF 2IOQA 2J8WA 2LK4A 3DKAA 1TWHA 2KJGA 3Q6MA 1VB5A 2GAQA 3ZTZA 4XEFA 3JZ0A 4DRHB 1UFBA 2L9JA 4Q5SF 5T1DB 2EIMC 3CEXA 1D1BA 1HY5A 3EPVA 3GM2A 4MTOA 3UGPA 3O6XA 1C17M 1NZEA 2J0XA 2MHRA 5T3WA 4N4WA 4PR9A 3V7OA 3NRHA 4BEMJ 1OW7A 5CIVA 4AK9A 3JT1A 4KBLA 1KNYA 4C3EA 2PX3A 4CIPA 2IYLD 3FOOA 3RKOF 3U0CA 3NYJA 1ZW3A 2YKZA 4X0RA 2HUJA 3CQZA 4HE8D 3E9VA 1IZMA 2H7VC 1XWJA 1YDIA 2PFDA 3M1CB 4PACA 2KK1A 3LS1A 3JSZA 3IQCA 4JW1A 3CAXA 4IRUA 1RMVA 1PCXA 3DWWA 4JZAA 3LEOA 3UNGC 4FX5A 1Q0FA 4PK4A 3ZVRA 1W2WA 2R7VA 3I5PA 1OW8A 1SF8A 3ABLC 1D0ZA 1YA9A 1YARO 2P61A 1Z5ZA 1BZ4A 2H7OA 2R7OA 3F46A 2ASRA 2XLOA 3IEEA 4YN0B 3T6GB 4NCQA 2R03A 5K0IA 2WB7A 2HJ3A 1H6GA 2R9RB 4HFKB 4MTFA 1VOMA 2YL1A 4MVMA 3CSKA 1RKEB 1TFKB 1LI7A 2G62A 3K1IA 2FGYA 1CPQA 5DS6A 3SXMA 2WVOA 3S84A 2KGOA 4BJ6A 4CS9C 1RKCA 1K04A 4XPWA 3RQGA 4BJ1A 1LI5A 4FAPB 4LDRA 1TWAA 4YT2A 5A6AA 2XL6A 4NY3A 1YYJA 2WL8A 2XM4A 3L34A 4FWVA 4MS2A 3AG2C 2J7PD 4AE4B 1LKXA 3UGOA 3B71A 4YL1A 1E84A 3IPMO 4C3BA 3OEOA 1FFTC 1YAUO 3GANA 2DYSC 2WVNA 2PF4E 4OIQF 2YLIA 4U5DE 1K05A 1QQ3A 3T6JA 4KNVA 2WVQA 3V5ZA 4DXWA 2KNHA 1O3UA 1KU2A 1JOGA 3KYIA 3JTLO 4JE9A 2ZPAA 4CX9A 4O79A 4ZLCA 1J8MF 1UG7A 1HMDA 4G0HA 5JRAA 2WZLA 2L6GA 3B29A 1WWPA 2OJQA 3NYMA 3DZAA 3NYLA 1FFHA 1C02A 2ICWG 3JRTA 2Q00A 4CS8A 4MW3A 1WN0A 4Q7CA 4XEVA 4IJJA 3HLZA 4YT5A 1WTYA 3VRCA 5L0GA 3G4XA 3U2LA 3VF0A 3TULA 4ZLDA 1QVXA 5JVEA 3IQ5A 2J7PA 4U5GA 4ANJA 1TFOB 3PMRA 1BDJB 4BJTA 1M2VB 3AGUA 3GWNA 2AP3A 1XZQA 3EZHA 3X1OA 4BJ6C 1K40A 4E7SA 1RKEA 3R7CA 3HTKC 3EGDA 4EWCA 4G7ZF 2O9XA 4XLNF 3H2VA 3U3FA 2J9VA 3VM6A 4WGYA 3EGXB 2DYRC 3CZ6A 3IQ6A 4BJ5C 1QLEC 1OQCA 1YZCA 4A2NB 3LS0A 5BQHA 2NUPA 1MMAA 4E7ZA 1MNDA 5AGFA 2L6FA 1B68A 3SEOA 2R7UA 3G4ZA 1O87A 3C63A 4ULVA 1U6HA 3X2QC 4CJGA 4GEHA 3H65A 4OINF 2FFHA 3WHNA 5HSWA 2R7SA 1Q0GA 2D5RB 2H7BA 4ONSA 3SXZA 2G3VA 1QPUA 4UDVA 2RSEB 2XLEA 1QZXA 2IXNA 3RIPA 4G78A 1LS4A 1CGOA 3EFOA 3UMKA 3AQCA 5BUOA 4MVOA 1ZYRF 3MFNA 5DVWA 2YLDA 2YQYA 3K7DA 3K33A 4YJWA 3POVA 3K6BA 2HKVA 5EGYA 2OQMA 4EHPA 1OXKA 5COFA 3NMKA 2KYHA 4MW8A 3WG7C 2YWAA 3EZIA 1WGWA 3RVYA 2P7VA 4I3MA 3ZG1A 1S05A 3U3BA 3DJNB 1EA8A 3TOLA 3RQFA 2J9BA 1GS9A 1NG1A 3GODA 5B3SC 2ZXRA 3LJBA 1BBHA 3J06A 3T9OA 4U5CE 3HNIA 1LVKA 4JVSA 1RJ9A 4I1OB
chains in the Genus database with same CATH topology
2HMQA 3AGTA 4XPXA 3WHNA 1A7DA 4XPWA 3AGUA 4XQ1A 3WAQA 4XPYA 1A7EA 2AVKA 2AWYA 1HMDA 2MHRA 2AWCA 1HMOA 2HMZA 1I4ZA 1I4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMQ A;  3AGT A;  4XPX A;  3WHN A;  1A7D A;  4XPW A;  3AGU A;  4XQ1 A;  3WAQ A;  4XPY A;  1A7E A;  2AVK A;  2AWY A;  1HMD A;  2MHR A;  2AWC A;  1HMO A;  2HMZ A;  1I4Z A;  1I4Y A; 
#chains in the Genus database with same CATH topology
 1SYQ A;  2J0W A;  2Q9C A;  2PBE A;  1PD0 A;  2B0J A;  2R7Q A;  3GEI A;  1KTM A;  1Z6A A;  1AUE A;  1ST6 A;  2EPN A;  2VC9 A;  2I15 A;  2J45 A;  4JJG A;  3SNH A;  5L0I A;  1D0X A;  2ZD9 A;  4PJN A;  3KYJ A;  3OWT A;  1U0B B;  5DQZ A;  1G8X A;  3EG9 A;  3M15 A;  4EUK B;  1OXB A;  1VK5 A;  1NU7 D;  5DQT A;  2QNL A;  1T6I A;  3LES A;  1BR2 A;  1HMO A;  2CGE A;  1SZI A;  4GQH A;  4OD4 A;  3AOU A;  4XEK A;  1MMN A;  3N2Z B;  5COM A;  5KYX A;  1APC A;  4XWJ A;  4MND A;  5A6K A;  2OOC A;  5KYU A;  2LD6 A;  4DVY P;  5AC5 A;  4N6H A;  2R7W A;  3EQL F;  2XM0 A;  2ZXO A;  1NBB A;  2Y3D A;  3S90 A;  5GPG B;  1J8Y F;  3WAQ A;  2LFD A;  2J46 A;  3DD7 A;  1H7I A;  2VCA A;  2XLW A;  3NKD A;  1EQ1 A;  3C18 A;  2AWC A;  4K1O A;  1WAS A;  3RF3 A;  4GYT A;  3HKK A;  1RCP A;  1FR0 A;  2IM8 A;  4C7O B;  5F5F A;  3FAP B;  5DS4 A;  3ZDL A;  1F1M A;  1MQV A;  2IXM A;  4U5H A;  3TD7 A;  3C7J A;  2LP4 A;  1TQG A;  2J9W A;  1OW6 A;  2A69 F;  2F22 A;  3NG1 A;  4XLP F;  2W4M A;  4EIY A;  1S7Z A;  3DMD A;  2CNW D;  4KNW A;  1Z63 A;  3SYN A;  3W2W A;  1HE9 A;  1JAF A;  1MNE A;  2LIG A;  1VLS A;  1ZVZ A;  1R4T A;  1ZU4 A;  3LLK A;  4JTC B;  5E3C A;  3ZTM A;  1E85 A;  2W4B A;  4PFO A;  3G50 A;  3S9O A;  4IAR A;  2VB6 A;  3NMJ A;  3ZIB A;  1T5O A;  2DB4 A;  3RQE A;  1TR2 A;  4OD5 A;  1QSP A;  4NQF A;  1V54 C;  4YL3 A;  5IY5 C;  2OJE D;  1EI7 A;  3M4B A;  3QZC A;  4IAQ A;  3LAY A;  3T6B A;  5JP7 A;  3GWL A;  3S28 A;  1I4Y A;  3BEH A;  1NSG B;  2IXP A;  2V26 A;  3KL4 A;  3ZC4 A;  1Q0M A;  3S27 A;  2Y3H A;  3LNM B;  3L8I A;  4JUR I;  3RYL A;  1T9K A;  3FMS A;  4LDQ A;  5L0D A;  3JRM O;  4MQ9 F;  4O6M A;  2YL7 A;  3ATP A;  1E86 A;  2GDC A;  2OU6 A;  4E0I A;  3LUT B;  4YT8 A;  3AG1 C;  1YVI A;  3BRJ A;  2VH3 A;  4O6Y A;  4U5E E;  2EIK C;  4WGZ A;  3LLI A;  1AVO B;  3IHU A;  5E3A A;  4D4X A;  5A6B D;  2XLM A;  3U8V A;  3DM9 B;  1L7C A;  1T6Q A;  1M6T A;  1YLM A;  3E70 C;  2PP4 A;  2QE9 A;  5JT4 A;  4JIO A;  4EBK A;  3B0U X;  1FTS A;  1T01 A;  1A7V A;  2HZ8 A;  2KSF A;  3A9C A;  3EGX A;  4PJL A;  2A6H F;  2XL4 A;  2HSQ A;  2NPU A;  2YEV A;  1FAP B;  1JPJ A;  3C8G D;  3H2U A;  4DBR A;  5L0F A;  2JPU A;  5B3I A;  2C03 A;  3FDQ A;  4N6C A;  4CSA C;  1WAT A;  2HV7 A;  1PV3 A;  2YVK A;  3U2M A;  4ULW A;  4MVZ A;  4K7B A;  3C62 A;  4CDA A;  2QLA A;  4KI2 A;  2A0B A;  4QI2 A;  5B1B C;  4IB4 A;  4E17 A;  2XS1 A;  1Y6D A;  4YWQ A;  4EBJ A;  2GWW A;  1E83 A;  1A41 A;  2QTV A;  1CPR A;  1HW1 A;  2LSE A;  3C8G B;  3LEV A;  1RXQ A;  4Z9J A;  5KYU B;  3A11 A;  1G4W R;  4F4B A;  1YJG A;  2XRH A;  4CS8 C;  5FZT A;  2WZG A;  4Z9I A;  3ITF A;  2KC3 A;  2M4E A;  2MWQ A;  2QUP A;  4U5F E;  2L81 A;  5A6J A;  1LPE A;  1JPN A;  3ASO C;  1SR2 A;  2OKU A;  1V55 C;  4C3D A;  3EH1 A;  2E87 A;  4D4N A;  3QW1 A;  2OCC C;  4N06 A;  3ZQY A;  3LNR A;  4CIH A;  1QKR A;  5T3T A;  3QTH A;  3SZR A;  3FVY A;  1XZP A;  2J9U A;  5KYN A;  1R5I D;  2PX0 A;  4I1M A;  5D92 A;  3ECS A;  4E18 A;  4QDL A;  2XXA B;  2KQ9 A;  2PNO A;  2HMQ A;  2EIL C;  3AG3 C;  1Y4C A;  4O7G A;  2NUT A;  3DAG A;  5FCL A;  4MVR A;  2P0N A;  1Z3I X;  4MVS A;  3JSE O;  2KW3 C;  4PJJ A;  3TK0 A;  4WJ0 A;  2R7R A;  2YL0 A;  1N1C A;  1OKK A;  4AL0 A;  3EFO B;  1VMA A;  3NMI A;  3B9Q A;  3C8Z A;  3EG9 B;  2LCH A;  4H54 A;  4JTD B;  3ZQV A;  4M63 A;  1G5Z A;  2ZXW C;  3DAF A;  4OIP F;  2X51 A;  4CS7 A;  2A6E F;  3W8H A;  1LS1 A;  1JRA A;  1VYK A;  1OCC C;  2L7A A;  3S29 A;  3QVZ A;  3Q6N A;  4U9E A;  2YLG A;  2YHS A;  3TOM A;  1NU9 C;  3F47 A;  5COG A;  1A7E A;  2CW0 F;  1MMD A;  2EPM X;  3EHN A;  5CI8 A;  3EJN A;  1OCZ C;  4IAO A;  4JCZ A;  4BJ5 A;  2HFI A;  2BC5 A;  3FOP A;  4A4A A;  3Q7G A;  2H8A A;  3RVZ A;  4RDA A;  4DJ9 A;  4CBE A;  3HNJ A;  1NFN A;  3SXY A;  4AX2 A;  2NSF A;  3UMI A;  1JMW A;  3HNK A;  2Z15 A;  3KMI A;  2VAS A;  2EIJ C;  2WZF A;  3ASN C;  2NUT B;  4U9D A;  5KYW B;  2RD9 A;  4W8K A;  4KC9 A;  2EPK X;  5L3Q A;  4JTA B;  4PFP A;  2V3C C;  3WOD F;  1ZHZ A;  3I4U A;  3U9M A;  2Y3G A;  3RFY A;  4NTA A;  3U8P A;  4K0D A;  1JR8 A;  1A7D A;  4JEA A;  3O10 A;  5JLI A;  1ZHW A;  3ABK C;  3PCV A;  2NG1 A;  4CDV A;  1OR2 A;  1ZW2 A;  3ZWI A;  3JCU Q;  4BPM A;  4RD9 A;  4LER A;  1ZZP A;  4R32 A;  2Q7R A;  1ORJ A;  4LLC A;  1TWG A;  4G7H F;  1G4U S;  3N0T A;  1ZHY A;  1OKK D;  2BE5 F;  2IBF A;  3SP1 A;  4ER9 A;  2D4U A;  2JD3 A;  2LFF A;  2MYS A;  4P6I C;  4L6R A;  4DRI B;  1A0B A;  3FXH A;  2YL3 A;  3T4R A;  2G3K A;  1VYI A;  256B A;  5A69 A;  1FNT c;  4EKW A;  1SMY F;  1CGN A;  2LQG A;  1D1A A;  2GA0 A;  3O55 A;  1GQA A;  1M2V A;  2Q9A A;  4U5B E;  1OCR C;  3PHF 2;  1L3P A;  3QW0 A;  5F28 E;  1Q0D A;  2R02 A;  1HW2 A;  4MVU A;  3DE8 A;  1OR3 A;  2Y69 C;  2X0C A;  3MBG A;  4DBQ A;  3AQB A;  5HV9 A;  3IQT A;  3FAJ A;  4O6N A;  3ZSU A;  5AC4 A;  1I4Z A;  3PDM P;  1D1C A;  1VTM P;  1FMV A;  5CI9 A;  5B1A C;  4XQ1 A;  1I5N A;  1GM5 A;  1LE4 A;  4EBB A;  1M56 C;  1V74 B;  2EIN C;  2R05 A;  1Z23 A;  3O39 A;  4JCH A;  4LAC B;  5JUA A;  3N24 A;  2TMV P;  4YK5 A;  3GOR A;  3NDB B;  3MLG A;  4IWB A;  3GM1 A;  4JKV A;  3L0I A;  4FES A;  4XPX A;  4CS9 A;  2AWY A;  4JC7 A;  1ZHX A;  4JRZ A;  1BR4 A;  2CYD A;  4J30 B;  2QY9 A;  2ZXP A;  4OIO F;  1MMG A;  3L8J A;  4DOZ A;  4NTF A;  3MYF A;  3VYW A;  3FHD A;  2DI3 A;  2BL2 A;  3K1I C;  3MYI A;  3MX3 A;  4Z9H A;  5F5H A;  5L0J A;  2CDQ A;  5DS5 A;  1IW7 F;  1ORS C;  2HV6 A;  3M4C A;  3EH2 A;  2AVK A;  3C8G A;  5TJ5 E;  3W4Y A;  1WOL A;  3JYY A;  2NUP B;  1GGQ A;  3GEE A;  3QMK A;  1ORY A;  2YZS A;  4JJF A;  4IGG A;  4CSA A;  3DI5 A;  3NKE A;  5E33 A;  5KYY A;  2A0U A;  4JEB A;  3U5S A;  3V5X A;  3KKB A;  4E0H A;  2VCB A;  2XSE A;  4XPY A;  2HS5 A;  3DE9 A;  3AG4 C;  3W8I A;  1O5H A;  2IXO A;  4Q4Z F;  2I8B A;  3L1M A;  4LLE A;  1YYX A;  2XLH A;  1Z7Q c;  4J7T A;  3I5Q A;  2AU5 A;  2W45 A;  4NTB A;  3EHM A;  5A6B A;  1H9T A;  4AL1 A;  1C03 A;  5KYY B;  5D91 A;  4AE4 A;  5KYW A;  2UUI A;  4DRJ B;  3Q7L A;  5L0C A;  3V5Y A;  1T6U A;  1ZHT A;  2EPO A;  4MTG A;  1V4A A;  5EK0 A;  1VLT A;  2P6V A;  3HJC A;  4W8P A;  3UMH A;  1EKY A;  4NC3 A;  3W2V A;  2ETS A;  2CNW A;  2Q9B A;  2EPL X;  2OEX A;  3UR3 C;  2VCC A;  3DXJ F;  1D0Y A;  1CGM E;  4J32 B;  2C04 A;  4PJM A;  5JS5 A;  3HNL A;  3B0V C;  1HE1 A;  1LM3 B;  3QVY A;  1DOW A;  2A68 F;  2DGJ A;  2XLV A;  2GFH A;  2Q3T A;  4HFF B;  4P9T A;  4HEA J;  2XL8 A;  4WAB A;  1LE2 A;  1LIH A;  1ZU5 A;  2A1D D;  2CCY A;  4YT4 A;  3TJ5 A;  3S0X A;  2XS8 A;  2NSG A;  3OA1 A;  2M64 A;  4QI0 A;  4XTK A;  4J7Y A;  4BEJ A;  5EHH A;  1Q0K A;  1NLX A;  2HMZ A;  1OCO C;  2B0H A;  1FMW A;  1M2O A;  2XXA A;  1NFO A;  3RH3 A;  1BR1 A;  3ABM C;  2P1A A;  2R25 A;  1U89 A;  4YL0 A;  1DOV A;  3VAY A;  4BG0 A;  4DVZ A;  5BQI A;  3GM3 A;  4LDK A;  2R7T A;  3M79 A;  1YA7 O;  3TQO A;  5DLJ A;  2OG2 A;  5BQG A;  5KYX B;  3RW0 A;  3SXK A;  2L6H A;  2Q4F A;  4B6I A;  2FAP B;  2Y39 A;  2Y3B A;  3EGD B;  5L0H A;  3AJM A;  2YRF A;  3U9J A;  5JSL A;  4OIR F;  3GEH A;  5E2Q A;  1E2X A;  3DJU B;  3JYH A;  4CJO A;  2JX0 A;  3DM5 A;  4MVQ A;  1TWC A;  1YZA A;  4CDY A;  3R2P A;  2XLD A;  2HJM A;  1M57 C;  3B0P A;  1TKN A;  4RBN A;  3KPH A;  1RJ9 B;  1AEP A;  1H9G A;  4H4K C;  1PD1 A;  3KH2 A;  3K1H A;  2UUH A;  3US6 A;  2R7X A;  2W9Y A;  3TJ6 A;  2HSB A;  3K66 A;  4C7O A;  3AGT A;  4P9F A;  5L3V A;  2OEV A;  4I44 A;  4G7O F;  2IOQ A;  2J8W A;  2LK4 A;  3DKA A;  1TWH A;  2KJG A;  3Q6M A;  1VB5 A;  2GAQ A;  3ZTZ A;  4XEF A;  3JZ0 A;  4DRH B;  1UFB A;  2L9J A;  4Q5S F;  5T1D B;  2EIM C;  3CEX A;  1D1B A;  1HY5 A;  3EPV A;  3GM2 A;  4MTO A;  3UGP A;  3O6X A;  1C17 M;  1NZE A;  2J0X A;  2MHR A;  5T3W A;  4N4W A;  4PR9 A;  3V7O A;  3NRH A;  4BEM J;  1OW7 A;  5CIV A;  4AK9 A;  3JT1 A;  4KBL A;  1KNY A;  4C3E A;  2PX3 A;  4CIP A;  2IYL D;  3FOO A;  3RKO F;  3U0C A;  3NYJ A;  1ZW3 A;  2YKZ A;  4X0R A;  2HUJ A;  3CQZ A;  4HE8 D;  3E9V A;  1IZM A;  2H7V C;  1XWJ A;  1YDI A;  2PFD A;  3M1C B;  4PAC A;  2KK1 A;  3LS1 A;  3JSZ A;  3IQC A;  4JW1 A;  3CAX A;  4IRU A;  1RMV A;  1PCX A;  3DWW A;  4JZA A;  3LEO A;  3UNG C;  4FX5 A;  1Q0F A;  4PK4 A;  3ZVR A;  1W2W A;  2R7V A;  3I5P A;  1OW8 A;  1SF8 A;  3ABL C;  1D0Z A;  1YA9 A;  1YAR O;  2P61 A;  1Z5Z A;  1BZ4 A;  2H7O A;  2R7O A;  3F46 A;  2ASR A;  2XLO A;  3IEE A;  4YN0 B;  3T6G B;  4NCQ A;  2R03 A;  5K0I A;  2WB7 A;  2HJ3 A;  1H6G A;  2R9R B;  4HFK B;  4MTF A;  1VOM A;  2YL1 A;  4MVM A;  3CSK A;  1RKE B;  1TFK B;  1LI7 A;  2G62 A;  3K1I A;  2FGY A;  1CPQ A;  5DS6 A;  3SXM A;  2WVO A;  3S84 A;  2KGO A;  4BJ6 A;  4CS9 C;  1RKC A;  1K04 A;  4XPW A;  3RQG A;  4BJ1 A;  1LI5 A;  4FAP B;  4LDR A;  1TWA A;  4YT2 A;  5A6A A;  2XL6 A;  4NY3 A;  1YYJ A;  2WL8 A;  2XM4 A;  3L34 A;  4FWV A;  4MS2 A;  3AG2 C;  2J7P D;  4AE4 B;  1LKX A;  3UGO A;  3B71 A;  4YL1 A;  1E84 A;  3IPM O;  4C3B A;  3OEO A;  1FFT C;  1YAU O;  3GAN A;  2DYS C;  2WVN A;  2PF4 E;  4OIQ F;  2YLI A;  4U5D E;  1K05 A;  1QQ3 A;  3T6J A;  4KNV A;  2WVQ A;  3V5Z A;  4DXW A;  2KNH A;  1O3U A;  1KU2 A;  1JOG A;  3KYI A;  3JTL O;  4JE9 A;  2ZPA A;  4CX9 A;  4O79 A;  4ZLC A;  1J8M F;  1UG7 A;  1HMD A;  4G0H A;  5JRA A;  2WZL A;  2L6G A;  3B29 A;  1WWP A;  2OJQ A;  3NYM A;  3DZA A;  3NYL A;  1FFH A;  1C02 A;  2ICW G;  3JRT A;  2Q00 A;  4CS8 A;  4MW3 A;  1WN0 A;  4Q7C A;  4XEV A;  4IJJ A;  3HLZ A;  4YT5 A;  1WTY A;  3VRC A;  5L0G A;  3G4X A;  3U2L A;  3VF0 A;  3TUL A;  4ZLD A;  1QVX A;  5JVE A;  3IQ5 A;  2J7P A;  4U5G A;  4ANJ A;  1TFO B;  3PMR A;  1BDJ B;  4BJT A;  1M2V B;  3AGU A;  3GWN A;  2AP3 A;  1XZQ A;  3EZH A;  3X1O A;  4BJ6 C;  1K40 A;  4E7S A;  1RKE A;  3R7C A;  3HTK C;  3EGD A;  4EWC A;  4G7Z F;  2O9X A;  4XLN F;  3H2V A;  3U3F A;  2J9V A;  3VM6 A;  4WGY A;  3EGX B;  2DYR C;  3CZ6 A;  3IQ6 A;  4BJ5 C;  1QLE C;  1OQC A;  1YZC A;  4A2N B;  3LS0 A;  5BQH A;  2NUP A;  1MMA A;  4E7Z A;  1MND A;  5AGF A;  2L6F A;  1B68 A;  3SEO A;  2R7U A;  3G4Z A;  1O87 A;  3C63 A;  4ULV A;  1U6H A;  3X2Q C;  4CJG A;  4GEH A;  3H65 A;  4OIN F;  2FFH A;  3WHN A;  5HSW A;  2R7S A;  1Q0G A;  2D5R B;  2H7B A;  4ONS A;  3SXZ A;  2G3V A;  1QPU A;  4UDV A;  2RSE B;  2XLE A;  1QZX A;  2IXN A;  3RIP A;  4G78 A;  1LS4 A;  1CGO A;  3EFO A;  3UMK A;  3AQC A;  5BUO A;  4MVO A;  1ZYR F;  3MFN A;  5DVW A;  2YLD A;  2YQY A;  3K7D A;  3K33 A;  4YJW A;  3POV A;  3K6B A;  2HKV A;  5EGY A;  2OQM A;  4EHP A;  1OXK A;  5COF A;  3NMK A;  2KYH A;  4MW8 A;  3WG7 C;  2YWA A;  3EZI A;  1WGW A;  3RVY A;  2P7V A;  4I3M A;  3ZG1 A;  1S05 A;  3U3B A;  3DJN B;  1EA8 A;  3TOL A;  3RQF A;  2J9B A;  1GS9 A;  1NG1 A;  3GOD A;  5B3S C;  2ZXR A;  3LJB A;  1BBH A;  3J06 A;  3T9O A;  4U5C E;  3HNI A;  1LVK A;  4JVS A;  1RJ9 A;  4I1O B; 
#chains in the Genus database with same CATH homology
 2HMQ A;  3AGT A;  4XPX A;  3WHN A;  1A7D A;  4XPW A;  3AGU A;  4XQ1 A;  3WAQ A;  4XPY A;  1A7E A;  2AVK A;  2AWY A;  1HMD A;  2MHR A;  2AWC A;  1HMO A;  2HMZ A;  1I4Z A;  1I4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...