4J7TA

Human ltc4 synthase in complex with product analogs - implications for enzyme catalysis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
148
structure length
148
Chain Sequence
HHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
publication title Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 148
sequence length 148
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4j7tA00
5K0IA 2UUIA 2UUHA 4JC7A 2Q7RA 3HKKA 4YK5A 3PCVA 4YL3A 2PNOA 4J7YA 3B29A 4YL1A 4NTFA 5BQIA 3LEOA 4JCZA 4BPMA 2H8AA 4WABA 4NTAA 4YL0A 5HV9A 4NTBA 3DWWA 5BQGA 5BQHA 4JRZA 4J7TA 4AL1A 4AL0A
chains in the Genus database with same CATH superfamily
4O7GA 2A6EF 2UUHA 2XS8A 3FVYA 5A6JA 3PHF2 2IXNA 2CNWA 4OD5A 1JR8A 3V5YA 5A6AA 1RKCA 3MYFA 4D4XA 2L7AA 1SF8A 2EPNA 2R7VA 2KGOA 1RJ9B 1UFBA 1WGWA 2EIJC 4EBJA 2A68F 3C63A 4J32B 3EH2A 1EQ1A 5AC5A 1ZZPA 5JLIA 4PACA 3LESA 3Q6NA 2QNLA 4LLCA 2XLHA 3S84A 3JYHA 1ORYA 2H7OA 2R05A 3LNMB 1CGOA 4O6YA 3H2UA 3SYNA 2YL7A 5T1DB 1RJ9A 4P6IC 1YA9A 2LD6A 2FFHA 3KYIA 4IJJA 4O6NA 3S27A 1VMAA 2IM8A 1E83A 2XLVA 4BJ5C 3UGOA 1G5ZA 3O6XA 1S7ZA 3DI5A 4BEJA 5JT4A 4G7OF 1OKKA 2UUIA 4MVZA 4E7ZA 2R25A 4DOZA 1AVOB 2A69F 5COMA 2WZLA 3PCVA 1YZCA 4MVQA 1D0YA 2HSQA 1Z6AA 3FAJA 4JTDB 4MVUA 1S05A 5EHHA 3BEHA 4ZLCA 2ZXPA 3T6JA 5DQTA 2RSEB 2ICWG 1LE4A 4DVYP 2LP4A 2XXAB 1A7EA 2LCHA 2R02A 4EUKB 2NUPA 3DM9B 3AOUA 4XQ1A 4WJ0A 3CZ6A 1F1MA 1LVKA 2XLWA 2XXAA 5B3SC 2OKUA 1Z3IX 2YLIA 3VM6A 3ZSUA 2P1AA 2Y39A 1OXKA 1I4YA 1T01A 3PMRA 3AJMA 4GQHA 1YDIA 4PJJA 4PJLA 1E85A 4FAPB 4CJGA 5JP7A 256BA 3I5PA 3DAGA 3R2PA 4ULVA 2YL1A 3MBGA 4DJ9A 3K6BA 3TOLA 3UMIA 5FCLA 3U2LA 1KTMA 2HJMA 2RD9A 3GWNA 2R03A 4YL1A 3W2VA 2Q00A 1J8MF 3RQEA 2NUTB 1TWHA 2LQGA 3EH1A 1ZYRF 4PFPA 1K04A 2KQ9A 4GYTA 4BJ5A 2Z15A 3C18A 5A69A 1V54C 5DLJA 1D1CA 1C17M 3MLGA 4PR9A 4E7SA 5L0CA 3U0CA 1ST6A 2HMZA 3EZIA 2L9JA 1FFHA 3GM2A 3NRHA 4R32A 3ZTMA 1LIHA 2BE5F 3KKBA 4OIOF 1EKYA 5K0IA 1YA7O 2EPKX 3DMDA 2J0XA 4DRJB 5KYUB 4Q7CA 3G4XA 1BR2A 5DS6A 1YLMA 1LS4A 3Q7LA 1SYQA 4E18A 4BJ6C 2OG2A 4IRUA 4JURI 4K7BA 3U8PA 4BEMJ 3FDQA 1NSGB 1Q0FA 1ZVZA 2WVNA 1D0ZA 2A0UA 2W45A 2ZPAA 4N06A 4AE4B 1L3PA 5F28E 2ZXWC 3RKOF 5KYUA 1XZPA 3ABMC 3M4CA 3L1MA 3WODF 4IAQA 5E3AA 2AP3A 3RVYA 1HMDA 4CS7A 2V3CC 2D4UA 5E2QA 2HV6A 3SXZA 4WGYA 4ANJA 5B3IA 1T6QA 4EKWA 2VCBA 5COFA 3N24A 4FX5A 2Q9AA 3MYIA 4L6RA 4XPYA 2DB4A 1W2WA 1GS9A 2G3KA 3GEIA 2KYHA 2P61A 1LI5A 1LPEA 2ZD9A 3FXHA 1T6UA 4JEAA 4JC7A 2MWQA 4EHPA 2YQYA 3LAYA 3EHNA 1R5ID 1Z5ZA 2VCCA 1A7DA 3CEXA 4H4KC 2XL8A 2PNOA 1NFNA 3F46A 3UGPA 4U5BE 4C3BA 3U5SA 3CQZA 1J8YF 5L0DA 3LEOA 4JCZA 2D5RB 1T5OA 1Q0GA 3SXMA 2Y69C 2NG1A 3S9OA 4BG0A 2PX3A 2YLGA 2YWAA 4PFOA 3WHNA 3E9VA 2YHSA 1SZIA 2OU6A 2J7PA 2Y3HA 2G3VA 1M2OA 2XLMA 4MS2A 3RF3A 3TD7A 1TKNA 2GA0A 4OINF 3RQFA 3KYJA 1Y6DA 3SEOA 4BJ6A 3VF0A 3TULA 2VASA 3S90A 2R7XA 2LK4A 4EBBA 5AGFA 2LSEA 4LDKA 2HV7A 3JYYA 4B6IA 2XM0A 2PFDA 4YK5A 3FMSA 3EHMA 4JEBA 2J0WA 4YN0B 3W8IA 2HJ3A 5DS5A 1MNEA 2TMVP 3DM5A 3AG4C 2XL4A 4LACB 2R7QA 1SR2A 4XLNF 1YYJA 3DD7A 2XM4A 3GORA 3K33A 4N4WA 2P6VA 4DVZA 3KH2A 1YZAA 3RYLA 4DRIB 3HTKC 5IY5C 2IYLD 4YL0A 1ZW2A 5HV9A 3TQOA 1RKEB 3GWLA 2B0HA 3KL4A 1MMDA 3EG9B 1AEPA 3NMIA 4E0HA 3ZC4A 1XZQA 3G50A 2GFHA 1YARO 1EA8A 1VB5A 2OEVA 1WWPA 3AG3C 5B1AC 2MHRA 3RVZA 5AC4A 1BBHA 3EG9A 4JE9A 4DBQA 4MVOA 3RH3A 3F47A 1ZHYA 4AX2A 2A0BA 4UDVA 3AQBA 1B68A 2KK1A 2OEXA 2J9BA 4ZLDA 4FESA 1ZHXA 4QI0A 1OW7A 1RMVA 1ZHTA 4AK9A 3NKEA 3QZCA 1YAUO 4LLEA 1V4AA 3U3BA 1M57C 1ZW3A 3O10A 4MW8A 3US6A 5KYYB 4MQ9F 2J7PD 3IQCA 1XWJA 3IQ5A 3X1OA 2L6HA 3IHUA 4A2NB 2P0NA 3MX3A 5L0IA 4CDAA 3AG2C 4U5GA 2X51A 4XEFA 2FAPB 2EIKC 2HMQA 2CCYA 2AVKA 5KYYA 1JMWA 2JD3A 4IWBA 3DJUB 4MW3A 1A7VA 3ZTZA 3GEHA 3DE9A 4HEAJ 2XS1A 1MNDA 3WG7C 4JTAB 4CX9A 3EGXB 3C8GB 1QPUA 1WOLA 2QY9A 2NPUA 3MFNA 3X2QC 1BR1A 4O6MA 5HSWA 3T4RA 1TFKB 3B29A 4J7YA 1FFTC 1M6TA 2LIGA 4JW1A 4NCQA 5D92A 3U3FA 1PD1A 5EGYA 4W8PA 2R7SA 4JKVA 4OIRF 3T9OA 5JSLA 2OCCC 2WL8A 1FNTc 2KNHA 3K1IC 4I44A 1T6IA 3C8GA 3ZWIA 3QVYA 1RCPA 5KYWB 1VYKA 2H7BA 2VC9A 3ASNC 3ABKC 2HZ8A 3K66A 3NYJA 1R4TA 2NUTA 2P7VA 4MTOA 3AQCA 2HUJA 3GEEA 4BJTA 4KI2A 3J06A 3C7JA 3TOMA 3OEOA 1FAPB 4Z9HA 3S0XA 5A6BA 5KYWA 1QLEC 4N6HA 3T6BA 2IXOA 2VB6A 3RFYA 3FOOA 1VLTA 3WAQA 1LM3B 1U89A 2O9XA 3EFOB 3EZHA 4PJMA 3ATPA 3OA1A 3HKKA 4OIPF 2JX0A 1VTMP 4MVRA 3ASOC 4U9EA 2FGYA 1YYXA 5BQIA 1QSPA 3NYMA 1I5NA 4RDAA 2CW0F 3SP1A 4YT8A 3EPVA 3DZAA 3EFOA 3NG1A 4X0RA 2W9YA 1V55C 2J9UA 4LERA 2XL6A 2YL3A 3PDMP 4NTAA 1ZU4A 3C8ZA 4NTBA 3H65A 1DOVA 1MMNA 1OXBA 1TWCA 2H7VC 2HSBA 2XLDA 1IZMA 3QW1A 1A41A 4PK4A 4K0DA 1CGME 3NMKA 4GEHA 2WB7A 3IQTA 4AE4A 2R9RB 1QKRA 1D1AA 1NBBA 2J46A 4IB4A 3U8VA 1OCCC 3B9QA 5JVEA 3B0PA 4CDYA 3ZQVA 3L0IA 4MNDA 2EPLX 1TR2A 3LNRA 3AGUA 1OR2A 4XEKA 3W8HA 5F5HA 3SNHA 3ZIBA 1UG7A 4C3EA 4ER9A 3K1IA 3NYLA 5BUOA 3S29A 1E84A 2Q4FA 3M79A 5F5FA 2NSGA 2XSEA 1VYIA 1V74B 5A6KA 2B0JA 3TJ6A 2OJED 3L34A 4M63A 1Q0MA 4KNVA 4BPMA 3C62A 1APCA 3C8GD 5FZTA 1Q0DA 3HJCA 2CDQA 4WABA 3Q7GA 4KNWA 3JSZA 3Q6MA 1VLSA 4JVSA 1VOMA 3IPMO 4P9TA 2KC3A 1ORSC 1H9GA 1WASA 5BQHA 2WVQA 3LLKA 4JCHA 5CI9A 2R7UA 4O79A 1OCRC 2C04A 3OWTA 3ZG1A 4ULWA 2GAQA 4DRHB 1NLXA 5A6BD 5KYNA 3DE8A 1JOGA 3S28A 5L3VA 2WZFA 4OD4A 4EIYA 1NU7D 1ZHZA 2YVKA 1MQVA 2DGJA 1D0XA 1E86A 2QLAA 2GWWA 4MTFA 1N1CA 4PJNA 4CIHA 2IOQA 2OJQA 2ZXRA 3TK0A 3RW0A 3DXJF 1Y4CA 4HFFB 5DQZA 2HFIA 3DJNB 2Y3DA 4I1OB 2GDCA 3VRCA 3GM3A 3GODA 1NG1A 2PF4E 1PD0A 3ZQYA 4CJOA 3M15A 2H8AA 2IXMA 4U5EE 4YWQA 1O5HA 2F22A 4HFKB 4CS9A 2NSFA 2W4BA 3G4ZA 2Y3BA 3ZDLA 3HNIA 1GGQA 4W8KA 2A6HF 1LS1A 4RD9A 2CYDA 3RIPA 1DOWA 2LFDA 3K7DA 3ECSA 1BR4A 2YRFA 4MVMA 3V7OA 5JS5A 4AL1A 1OW8A 2PX0A 1NZEA 4EWCA 5L0JA 2R7TA 1RKEA 4G7ZF 4JTCB 3W4YA 4QDLA 3RQGA 3QW0A 1Z23A 1EI7A 3GANA 4RBNA 4XTKA 3U9JA 4D4NA 2Q3TA 4CSAC 2C03A 4CS8C 1GQAA 1M2VB 3IQ6A 1C02A 2J9WA 3H2VA 4DXWA 5T3TA 2CGEA 5EK0A 3UMHA 2ETSA 1QVXA 2AU5A 3A11A 5TJ5E 3O39A 3DKAA 3U9MA 1ZU5A 3LJBA 2QUPA 4CIPA 1BDJB 1H7IA 2IBFA 1H9TA 5DVWA 1M2VA 4C7OB 1TWGA 1KU2A 1WTYA 1WATA 4J7TA 1MMGA 1K05A 3JZ0A 4XPXA 3UMKA 4N6CA 4YT4A 3FOPA 1JAFA 2Q9CA 4LDQA 2J45A 1ORJA 2NUPB 4KC9A 5COGA 1L7CA 4IGGA 4CBEA 1IW7F 1YVIA 4C7OA 3N0TA 4BJ1A 1KNYA 5B1BC 3V5ZA 2KJGA 3A9CA 1HMOA 1QQ3A 4Z9JA 1OCOC 2YL0A 3L8JA 1G4WR 4U5DE 2R7WA 1U6HA 4HE8D 4CDVA 2X0CA 1NFOA 4OIQF 1I4ZA 3EGXA 3GM1A 2BC5A 2PP4A 3DAFA 5E33A 1Z7Qc 1OR3A 2R7OA 2R7RA 4XPWA 5L0GA 2XRHA 2Y3GA 3CAXA 2MYSA 4Z9IA 4A4AA 1M56C 4U5CE 3L8IA 3KMIA 3UNGC 5CI8A 4DBRA 1VK5A 5CIVA 4H54A 2M64A 1HE1A 2E87A 2XLEA 3JRTA 4J30B 5GPGB 3HNKA 4AL0A 4CS8A 4CSAA 2W4MA 4Q5SF 2YLDA 3N2ZB 2CNWD 4I3MA 5JUAA 2KW3C 3I4UA 4LDRA 4WGZA 1FMWA 4NY3A 3EQLF 3NDBB 2DI3A 2EILC 2QE9A 5L0FA 1CGNA 1E2XA 3U2MA 1FR0A 2J8WA 2YZSA 4YJWA 3JCUQ 4NQFA 4QI2A 1LE2A 2ASRA 4E0IA 2WZGA 2L6GA 3LEVA 3VAYA 3POVA 2LFFA 1TQGA 5T3WA 2DYRC 3QVZA 3AGTA 1O3UA 2I15A 1D1BA 4I1MA 3EGDB 4JJGA 5BQGA 4G7HF 3CSKA 4JRZA 1Z63A 1PV3A 1OKKD 1CPQA 4YT5A 2EINC 1T9KA 1Q0KA 1HW1A 3HNJA 3E70C 4CS9C 1FTSA 3JTLO 4F4BA 1GM5A 2EPMX 2Q7RA 2VH3A 5L3QA 2G62A 1G8XA 4JZAA 1NU9C 1MMAA 3EGDA 4FWVA 4P9FA 1PCXA 2PBEA 3M1CB 1ZHWA 4U9DA 4NTFA 1OW6A 3O55A 3QMKA 2J9VA 3QTHA 4IAOA 2ZXOA 2L81A 3HLZA 1JPJA 2BL2A 3LLIA 4JJFA 4U5FE 2Q9BA 2IXPA 1RXQA 4K1OA 3B0UX 4EBKA 5E3CA 3IEEA 2DYSC 5D91A 4YT2A 2VCAA 2YKZA 2EIMC 1HW2A 1CPRA 3T6GB 3SZRA 2XLOA 1H6GA 3JRMO 5KYXB 2YEVA 1U0BB 3DWWA 2OQMA 1HE9A 4JIOA 2HS5A 2V26A 3UR3C 3B0VC 4Q4ZF 5L0HA 1BZ4A 1O87A 3K1HA 4ONSA 4KBLA 1HY5A 3ITFA 1TFOB 2A1DD 3B71A 3HNLA 4XEVA 1JPNA 1K40A 3FAPB 4MVSA 3JT1A 1A0BA 1C03A 3NKDA 3V5XA 5KYXA 2L6FA 2M4EA 3ABLC 3ZVRA 4XLPF 1LKXA 3I5QA 1OQCA 4YL3A 1WN0A 4U5HA 3EJNA 3AG1C 3NMJA 3TJ5A 3SXKA 3VYWA 3W2WA 2JPUA 1LI7A 1TWAA 3FHDA 3JSEO 1YJGA 2AWCA 2KSFA 4E17A 2I8BA 4C3DA 5JRAA 3KPHA 4NC3A 1JRAA 2OOCA 4G0HA 5DS4A 3R7CA 1AUEA 2QTVA 3BRJA 1QZXA 4MTGA 1G4US 3LUTB 1FMVA 4G78A 3LS1A 1SMYF 3M4BA 2WVOA 3SXYA 2AWYA 2HKVA 1OCZC 3LS0A 4XWJA 2EPOA 4IARA
chains in the Genus database with same CATH topology
5K0IA 2UUIA 2UUHA 4JC7A 2Q7RA 3HKKA 4YK5A 3PCVA 4YL3A 2PNOA 4J7YA 3B29A 4YL1A 4NTFA 5BQIA 3LEOA 4JCZA 4BPMA 2H8AA 4WABA 4NTAA 4YL0A 5HV9A 4NTBA 3DWWA 5BQGA 5BQHA 4JRZA 4J7TA 4AL1A 4AL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K0I A;  2UUI A;  2UUH A;  4JC7 A;  2Q7R A;  3HKK A;  4YK5 A;  3PCV A;  4YL3 A;  2PNO A;  4J7Y A;  3B29 A;  4YL1 A;  4NTF A;  5BQI A;  3LEO A;  4JCZ A;  4BPM A;  2H8A A;  4WAB A;  4NTA A;  4YL0 A;  5HV9 A;  4NTB A;  3DWW A;  5BQG A;  5BQH A;  4JRZ A;  4J7T A;  4AL1 A;  4AL0 A; 
#chains in the Genus database with same CATH topology
 4O7G A;  2A6E F;  2UUH A;  2XS8 A;  3FVY A;  5A6J A;  3PHF 2;  2IXN A;  2CNW A;  4OD5 A;  1JR8 A;  3V5Y A;  5A6A A;  1RKC A;  3MYF A;  4D4X A;  2L7A A;  1SF8 A;  2EPN A;  2R7V A;  2KGO A;  1RJ9 B;  1UFB A;  1WGW A;  2EIJ C;  4EBJ A;  2A68 F;  3C63 A;  4J32 B;  3EH2 A;  1EQ1 A;  5AC5 A;  1ZZP A;  5JLI A;  4PAC A;  3LES A;  3Q6N A;  2QNL A;  4LLC A;  2XLH A;  3S84 A;  3JYH A;  1ORY A;  2H7O A;  2R05 A;  3LNM B;  1CGO A;  4O6Y A;  3H2U A;  3SYN A;  2YL7 A;  5T1D B;  1RJ9 A;  4P6I C;  1YA9 A;  2LD6 A;  2FFH A;  3KYI A;  4IJJ A;  4O6N A;  3S27 A;  1VMA A;  2IM8 A;  1E83 A;  2XLV A;  4BJ5 C;  3UGO A;  1G5Z A;  3O6X A;  1S7Z A;  3DI5 A;  4BEJ A;  5JT4 A;  4G7O F;  1OKK A;  2UUI A;  4MVZ A;  4E7Z A;  2R25 A;  4DOZ A;  1AVO B;  2A69 F;  5COM A;  2WZL A;  3PCV A;  1YZC A;  4MVQ A;  1D0Y A;  2HSQ A;  1Z6A A;  3FAJ A;  4JTD B;  4MVU A;  1S05 A;  5EHH A;  3BEH A;  4ZLC A;  2ZXP A;  3T6J A;  5DQT A;  2RSE B;  2ICW G;  1LE4 A;  4DVY P;  2LP4 A;  2XXA B;  1A7E A;  2LCH A;  2R02 A;  4EUK B;  2NUP A;  3DM9 B;  3AOU A;  4XQ1 A;  4WJ0 A;  3CZ6 A;  1F1M A;  1LVK A;  2XLW A;  2XXA A;  5B3S C;  2OKU A;  1Z3I X;  2YLI A;  3VM6 A;  3ZSU A;  2P1A A;  2Y39 A;  1OXK A;  1I4Y A;  1T01 A;  3PMR A;  3AJM A;  4GQH A;  1YDI A;  4PJJ A;  4PJL A;  1E85 A;  4FAP B;  4CJG A;  5JP7 A;  256B A;  3I5P A;  3DAG A;  3R2P A;  4ULV A;  2YL1 A;  3MBG A;  4DJ9 A;  3K6B A;  3TOL A;  3UMI A;  5FCL A;  3U2L A;  1KTM A;  2HJM A;  2RD9 A;  3GWN A;  2R03 A;  4YL1 A;  3W2V A;  2Q00 A;  1J8M F;  3RQE A;  2NUT B;  1TWH A;  2LQG A;  3EH1 A;  1ZYR F;  4PFP A;  1K04 A;  2KQ9 A;  4GYT A;  4BJ5 A;  2Z15 A;  3C18 A;  5A69 A;  1V54 C;  5DLJ A;  1D1C A;  1C17 M;  3MLG A;  4PR9 A;  4E7S A;  5L0C A;  3U0C A;  1ST6 A;  2HMZ A;  3EZI A;  2L9J A;  1FFH A;  3GM2 A;  3NRH A;  4R32 A;  3ZTM A;  1LIH A;  2BE5 F;  3KKB A;  4OIO F;  1EKY A;  5K0I A;  1YA7 O;  2EPK X;  3DMD A;  2J0X A;  4DRJ B;  5KYU B;  4Q7C A;  3G4X A;  1BR2 A;  5DS6 A;  1YLM A;  1LS4 A;  3Q7L A;  1SYQ A;  4E18 A;  4BJ6 C;  2OG2 A;  4IRU A;  4JUR I;  4K7B A;  3U8P A;  4BEM J;  3FDQ A;  1NSG B;  1Q0F A;  1ZVZ A;  2WVN A;  1D0Z A;  2A0U A;  2W45 A;  2ZPA A;  4N06 A;  4AE4 B;  1L3P A;  5F28 E;  2ZXW C;  3RKO F;  5KYU A;  1XZP A;  3ABM C;  3M4C A;  3L1M A;  3WOD F;  4IAQ A;  5E3A A;  2AP3 A;  3RVY A;  1HMD A;  4CS7 A;  2V3C C;  2D4U A;  5E2Q A;  2HV6 A;  3SXZ A;  4WGY A;  4ANJ A;  5B3I A;  1T6Q A;  4EKW A;  2VCB A;  5COF A;  3N24 A;  4FX5 A;  2Q9A A;  3MYI A;  4L6R A;  4XPY A;  2DB4 A;  1W2W A;  1GS9 A;  2G3K A;  3GEI A;  2KYH A;  2P61 A;  1LI5 A;  1LPE A;  2ZD9 A;  3FXH A;  1T6U A;  4JEA A;  4JC7 A;  2MWQ A;  4EHP A;  2YQY A;  3LAY A;  3EHN A;  1R5I D;  1Z5Z A;  2VCC A;  1A7D A;  3CEX A;  4H4K C;  2XL8 A;  2PNO A;  1NFN A;  3F46 A;  3UGP A;  4U5B E;  4C3B A;  3U5S A;  3CQZ A;  1J8Y F;  5L0D A;  3LEO A;  4JCZ A;  2D5R B;  1T5O A;  1Q0G A;  3SXM A;  2Y69 C;  2NG1 A;  3S9O A;  4BG0 A;  2PX3 A;  2YLG A;  2YWA A;  4PFO A;  3WHN A;  3E9V A;  2YHS A;  1SZI A;  2OU6 A;  2J7P A;  2Y3H A;  2G3V A;  1M2O A;  2XLM A;  4MS2 A;  3RF3 A;  3TD7 A;  1TKN A;  2GA0 A;  4OIN F;  3RQF A;  3KYJ A;  1Y6D A;  3SEO A;  4BJ6 A;  3VF0 A;  3TUL A;  2VAS A;  3S90 A;  2R7X A;  2LK4 A;  4EBB A;  5AGF A;  2LSE A;  4LDK A;  2HV7 A;  3JYY A;  4B6I A;  2XM0 A;  2PFD A;  4YK5 A;  3FMS A;  3EHM A;  4JEB A;  2J0W A;  4YN0 B;  3W8I A;  2HJ3 A;  5DS5 A;  1MNE A;  2TMV P;  3DM5 A;  3AG4 C;  2XL4 A;  4LAC B;  2R7Q A;  1SR2 A;  4XLN F;  1YYJ A;  3DD7 A;  2XM4 A;  3GOR A;  3K33 A;  4N4W A;  2P6V A;  4DVZ A;  3KH2 A;  1YZA A;  3RYL A;  4DRI B;  3HTK C;  5IY5 C;  2IYL D;  4YL0 A;  1ZW2 A;  5HV9 A;  3TQO A;  1RKE B;  3GWL A;  2B0H A;  3KL4 A;  1MMD A;  3EG9 B;  1AEP A;  3NMI A;  4E0H A;  3ZC4 A;  1XZQ A;  3G50 A;  2GFH A;  1YAR O;  1EA8 A;  1VB5 A;  2OEV A;  1WWP A;  3AG3 C;  5B1A C;  2MHR A;  3RVZ A;  5AC4 A;  1BBH A;  3EG9 A;  4JE9 A;  4DBQ A;  4MVO A;  3RH3 A;  3F47 A;  1ZHY A;  4AX2 A;  2A0B A;  4UDV A;  3AQB A;  1B68 A;  2KK1 A;  2OEX A;  2J9B A;  4ZLD A;  4FES A;  1ZHX A;  4QI0 A;  1OW7 A;  1RMV A;  1ZHT A;  4AK9 A;  3NKE A;  3QZC A;  1YAU O;  4LLE A;  1V4A A;  3U3B A;  1M57 C;  1ZW3 A;  3O10 A;  4MW8 A;  3US6 A;  5KYY B;  4MQ9 F;  2J7P D;  3IQC A;  1XWJ A;  3IQ5 A;  3X1O A;  2L6H A;  3IHU A;  4A2N B;  2P0N A;  3MX3 A;  5L0I A;  4CDA A;  3AG2 C;  4U5G A;  2X51 A;  4XEF A;  2FAP B;  2EIK C;  2HMQ A;  2CCY A;  2AVK A;  5KYY A;  1JMW A;  2JD3 A;  4IWB A;  3DJU B;  4MW3 A;  1A7V A;  3ZTZ A;  3GEH A;  3DE9 A;  4HEA J;  2XS1 A;  1MND A;  3WG7 C;  4JTA B;  4CX9 A;  3EGX B;  3C8G B;  1QPU A;  1WOL A;  2QY9 A;  2NPU A;  3MFN A;  3X2Q C;  1BR1 A;  4O6M A;  5HSW A;  3T4R A;  1TFK B;  3B29 A;  4J7Y A;  1FFT C;  1M6T A;  2LIG A;  4JW1 A;  4NCQ A;  5D92 A;  3U3F A;  1PD1 A;  5EGY A;  4W8P A;  2R7S A;  4JKV A;  4OIR F;  3T9O A;  5JSL A;  2OCC C;  2WL8 A;  1FNT c;  2KNH A;  3K1I C;  4I44 A;  1T6I A;  3C8G A;  3ZWI A;  3QVY A;  1RCP A;  5KYW B;  1VYK A;  2H7B A;  2VC9 A;  3ASN C;  3ABK C;  2HZ8 A;  3K66 A;  3NYJ A;  1R4T A;  2NUT A;  2P7V A;  4MTO A;  3AQC A;  2HUJ A;  3GEE A;  4BJT A;  4KI2 A;  3J06 A;  3C7J A;  3TOM A;  3OEO A;  1FAP B;  4Z9H A;  3S0X A;  5A6B A;  5KYW A;  1QLE C;  4N6H A;  3T6B A;  2IXO A;  2VB6 A;  3RFY A;  3FOO A;  1VLT A;  3WAQ A;  1LM3 B;  1U89 A;  2O9X A;  3EFO B;  3EZH A;  4PJM A;  3ATP A;  3OA1 A;  3HKK A;  4OIP F;  2JX0 A;  1VTM P;  4MVR A;  3ASO C;  4U9E A;  2FGY A;  1YYX A;  5BQI A;  1QSP A;  3NYM A;  1I5N A;  4RDA A;  2CW0 F;  3SP1 A;  4YT8 A;  3EPV A;  3DZA A;  3EFO A;  3NG1 A;  4X0R A;  2W9Y A;  1V55 C;  2J9U A;  4LER A;  2XL6 A;  2YL3 A;  3PDM P;  4NTA A;  1ZU4 A;  3C8Z A;  4NTB A;  3H65 A;  1DOV A;  1MMN A;  1OXB A;  1TWC A;  2H7V C;  2HSB A;  2XLD A;  1IZM A;  3QW1 A;  1A41 A;  4PK4 A;  4K0D A;  1CGM E;  3NMK A;  4GEH A;  2WB7 A;  3IQT A;  4AE4 A;  2R9R B;  1QKR A;  1D1A A;  1NBB A;  2J46 A;  4IB4 A;  3U8V A;  1OCC C;  3B9Q A;  5JVE A;  3B0P A;  4CDY A;  3ZQV A;  3L0I A;  4MND A;  2EPL X;  1TR2 A;  3LNR A;  3AGU A;  1OR2 A;  4XEK A;  3W8H A;  5F5H A;  3SNH A;  3ZIB A;  1UG7 A;  4C3E A;  4ER9 A;  3K1I A;  3NYL A;  5BUO A;  3S29 A;  1E84 A;  2Q4F A;  3M79 A;  5F5F A;  2NSG A;  2XSE A;  1VYI A;  1V74 B;  5A6K A;  2B0J A;  3TJ6 A;  2OJE D;  3L34 A;  4M63 A;  1Q0M A;  4KNV A;  4BPM A;  3C62 A;  1APC A;  3C8G D;  5FZT A;  1Q0D A;  3HJC A;  2CDQ A;  4WAB A;  3Q7G A;  4KNW A;  3JSZ A;  3Q6M A;  1VLS A;  4JVS A;  1VOM A;  3IPM O;  4P9T A;  2KC3 A;  1ORS C;  1H9G A;  1WAS A;  5BQH A;  2WVQ A;  3LLK A;  4JCH A;  5CI9 A;  2R7U A;  4O79 A;  1OCR C;  2C04 A;  3OWT A;  3ZG1 A;  4ULW A;  2GAQ A;  4DRH B;  1NLX A;  5A6B D;  5KYN A;  3DE8 A;  1JOG A;  3S28 A;  5L3V A;  2WZF A;  4OD4 A;  4EIY A;  1NU7 D;  1ZHZ A;  2YVK A;  1MQV A;  2DGJ A;  1D0X A;  1E86 A;  2QLA A;  2GWW A;  4MTF A;  1N1C A;  4PJN A;  4CIH A;  2IOQ A;  2OJQ A;  2ZXR A;  3TK0 A;  3RW0 A;  3DXJ F;  1Y4C A;  4HFF B;  5DQZ A;  2HFI A;  3DJN B;  2Y3D A;  4I1O B;  2GDC A;  3VRC A;  3GM3 A;  3GOD A;  1NG1 A;  2PF4 E;  1PD0 A;  3ZQY A;  4CJO A;  3M15 A;  2H8A A;  2IXM A;  4U5E E;  4YWQ A;  1O5H A;  2F22 A;  4HFK B;  4CS9 A;  2NSF A;  2W4B A;  3G4Z A;  2Y3B A;  3ZDL A;  3HNI A;  1GGQ A;  4W8K A;  2A6H F;  1LS1 A;  4RD9 A;  2CYD A;  3RIP A;  1DOW A;  2LFD A;  3K7D A;  3ECS A;  1BR4 A;  2YRF A;  4MVM A;  3V7O A;  5JS5 A;  4AL1 A;  1OW8 A;  2PX0 A;  1NZE A;  4EWC A;  5L0J A;  2R7T A;  1RKE A;  4G7Z F;  4JTC B;  3W4Y A;  4QDL A;  3RQG A;  3QW0 A;  1Z23 A;  1EI7 A;  3GAN A;  4RBN A;  4XTK A;  3U9J A;  4D4N A;  2Q3T A;  4CSA C;  2C03 A;  4CS8 C;  1GQA A;  1M2V B;  3IQ6 A;  1C02 A;  2J9W A;  3H2V A;  4DXW A;  5T3T A;  2CGE A;  5EK0 A;  3UMH A;  2ETS A;  1QVX A;  2AU5 A;  3A11 A;  5TJ5 E;  3O39 A;  3DKA A;  3U9M A;  1ZU5 A;  3LJB A;  2QUP A;  4CIP A;  1BDJ B;  1H7I A;  2IBF A;  1H9T A;  5DVW A;  1M2V A;  4C7O B;  1TWG A;  1KU2 A;  1WTY A;  1WAT A;  4J7T A;  1MMG A;  1K05 A;  3JZ0 A;  4XPX A;  3UMK A;  4N6C A;  4YT4 A;  3FOP A;  1JAF A;  2Q9C A;  4LDQ A;  2J45 A;  1ORJ A;  2NUP B;  4KC9 A;  5COG A;  1L7C A;  4IGG A;  4CBE A;  1IW7 F;  1YVI A;  4C7O A;  3N0T A;  4BJ1 A;  1KNY A;  5B1B C;  3V5Z A;  2KJG A;  3A9C A;  1HMO A;  1QQ3 A;  4Z9J A;  1OCO C;  2YL0 A;  3L8J A;  1G4W R;  4U5D E;  2R7W A;  1U6H A;  4HE8 D;  4CDV A;  2X0C A;  1NFO A;  4OIQ F;  1I4Z A;  3EGX A;  3GM1 A;  2BC5 A;  2PP4 A;  3DAF A;  5E33 A;  1Z7Q c;  1OR3 A;  2R7O A;  2R7R A;  4XPW A;  5L0G A;  2XRH A;  2Y3G A;  3CAX A;  2MYS A;  4Z9I A;  4A4A A;  1M56 C;  4U5C E;  3L8I A;  3KMI A;  3UNG C;  5CI8 A;  4DBR A;  1VK5 A;  5CIV A;  4H54 A;  2M64 A;  1HE1 A;  2E87 A;  2XLE A;  3JRT A;  4J30 B;  5GPG B;  3HNK A;  4AL0 A;  4CS8 A;  4CSA A;  2W4M A;  4Q5S F;  2YLD A;  3N2Z B;  2CNW D;  4I3M A;  5JUA A;  2KW3 C;  3I4U A;  4LDR A;  4WGZ A;  1FMW A;  4NY3 A;  3EQL F;  3NDB B;  2DI3 A;  2EIL C;  2QE9 A;  5L0F A;  1CGN A;  1E2X A;  3U2M A;  1FR0 A;  2J8W A;  2YZS A;  4YJW A;  3JCU Q;  4NQF A;  4QI2 A;  1LE2 A;  2ASR A;  4E0I A;  2WZG A;  2L6G A;  3LEV A;  3VAY A;  3POV A;  2LFF A;  1TQG A;  5T3W A;  2DYR C;  3QVZ A;  3AGT A;  1O3U A;  2I15 A;  1D1B A;  4I1M A;  3EGD B;  4JJG A;  5BQG A;  4G7H F;  3CSK A;  4JRZ A;  1Z63 A;  1PV3 A;  1OKK D;  1CPQ A;  4YT5 A;  2EIN C;  1T9K A;  1Q0K A;  1HW1 A;  3HNJ A;  3E70 C;  4CS9 C;  1FTS A;  3JTL O;  4F4B A;  1GM5 A;  2EPM X;  2Q7R A;  2VH3 A;  5L3Q A;  2G62 A;  1G8X A;  4JZA A;  1NU9 C;  1MMA A;  3EGD A;  4FWV A;  4P9F A;  1PCX A;  2PBE A;  3M1C B;  1ZHW A;  4U9D A;  4NTF A;  1OW6 A;  3O55 A;  3QMK A;  2J9V A;  3QTH A;  4IAO A;  2ZXO A;  2L81 A;  3HLZ A;  1JPJ A;  2BL2 A;  3LLI A;  4JJF A;  4U5F E;  2Q9B A;  2IXP A;  1RXQ A;  4K1O A;  3B0U X;  4EBK A;  5E3C A;  3IEE A;  2DYS C;  5D91 A;  4YT2 A;  2VCA A;  2YKZ A;  2EIM C;  1HW2 A;  1CPR A;  3T6G B;  3SZR A;  2XLO A;  1H6G A;  3JRM O;  5KYX B;  2YEV A;  1U0B B;  3DWW A;  2OQM A;  1HE9 A;  4JIO A;  2HS5 A;  2V26 A;  3UR3 C;  3B0V C;  4Q4Z F;  5L0H A;  1BZ4 A;  1O87 A;  3K1H A;  4ONS A;  4KBL A;  1HY5 A;  3ITF A;  1TFO B;  2A1D D;  3B71 A;  3HNL A;  4XEV A;  1JPN A;  1K40 A;  3FAP B;  4MVS A;  3JT1 A;  1A0B A;  1C03 A;  3NKD A;  3V5X A;  5KYX A;  2L6F A;  2M4E A;  3ABL C;  3ZVR A;  4XLP F;  1LKX A;  3I5Q A;  1OQC A;  4YL3 A;  1WN0 A;  4U5H A;  3EJN A;  3AG1 C;  3NMJ A;  3TJ5 A;  3SXK A;  3VYW A;  3W2W A;  2JPU A;  1LI7 A;  1TWA A;  3FHD A;  3JSE O;  1YJG A;  2AWC A;  2KSF A;  4E17 A;  2I8B A;  4C3D A;  5JRA A;  3KPH A;  4NC3 A;  1JRA A;  2OOC A;  4G0H A;  5DS4 A;  3R7C A;  1AUE A;  2QTV A;  3BRJ A;  1QZX A;  4MTG A;  1G4U S;  3LUT B;  1FMV A;  4G78 A;  3LS1 A;  1SMY F;  3M4B A;  2WVO A;  3SXY A;  2AWY A;  2HKV A;  1OCZ C;  3LS0 A;  4XWJ A;  2EPO A;  4IAR A; 
#chains in the Genus database with same CATH homology
 5K0I A;  2UUI A;  2UUH A;  4JC7 A;  2Q7R A;  3HKK A;  4YK5 A;  3PCV A;  4YL3 A;  2PNO A;  4J7Y A;  3B29 A;  4YL1 A;  4NTF A;  5BQI A;  3LEO A;  4JCZ A;  4BPM A;  2H8A A;  4WAB A;  4NTA A;  4YL0 A;  5HV9 A;  4NTB A;  3DWW A;  5BQG A;  5BQH A;  4JRZ A;  4J7T A;  4AL1 A;  4AL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...