4J7TA

Human ltc4 synthase in complex with product analogs - implications for enzyme catalysis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
148
structure length
148
Chain Sequence
HHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 61
structure length 148
sequence length 148
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4j7tA00
3LEOA 5BQIA 4AL1A 3DWWA 5BQGA 4BPMA 2Q7RA 3HKKA 5HV9A 3PCVA 4NTAA 2PNOA 4WABA 4J7YA 4NTFA 5BQHA 2UUIA 4J7TA 4AL0A 4YL0A 4YK5A 4JCZA 4NTBA 5K0IA 4JC7A 2UUHA 4YL1A 2H8AA 3B29A 4YL3A 4JRZA
chains in the Genus database with same CATH superfamily
4H4KC 4JTDB 2OKUA 4U5EE 1Q0FA 4O6NA 5EHHA 2YVKA 1NBBA 4EKWA 4BG0A 2LCHA 5T3TA 1T9KA 2WB7A 2L9JA 3B0PA 4K1OA 4DRHB 4Z9HA 1OCOC 2R7OA 1Q0MA 3EH1A 1UG7A 2J7PD 4FWVA 2W4BA 4JEBA 4QDLA 3TJ5A 4WABA 3LNRA 4A4AA 4XQ1A 4NTFA 2R7TA 256BA 4CBEA 1S05A 1TQGA 3O55A 5AGFA 1VYIA 2EILC 4XEVA 3RFYA 1WTYA 1RJ9B 2QY9A 2NUPB 2KYHA 4U9DA 3DAGA 3JZ0A 3B0UX 4CJGA 2AWCA 2WVOA 2ZPAA 1FR0A 1VB5A 2XLWA 3DJNB 2R7QA 3RVYA 3DXJF 1WATA 3TOLA 5B3IA 1ORYA 2OEVA 3EQLF 5A69A 4B6IA 1MQVA 1SYQA 5KYXA 1LVKA 2PBEA 3GORA 2J0WA 2XXAA 1LIHA 3IQ5A 3JSEO 1T6IA 5AC4A 1C03A 4XWJA 2VASA 1KTMA 4WJ0A 2BL2A 3RF3A 2GFHA 2P0NA 2A6HF 3FOPA 1ZHZA 5KYYA 1KNYA 1M6TA 1VYKA 3FOOA 2L81A 3L0IA 2YL1A 4JJGA 4XLNF 1QVXA 3LESA 1YYXA 3U3BA 3M15A 1U89A 4MVRA 3QZCA 2QNLA 2D5RB 3T6GB 1M57C 3M1CB 4BEMJ 2CDQA 5L0GA 4AL0A 4G78A 2XLOA 1D1BA 3OA1A 2J7PA 3ZSUA 4AX2A 1K04A 2EPLX 4BJ6A 1H7IA 3KPHA 2DI3A 3RQEA 4E7ZA 3R2PA 3GEEA 3CZ6A 5KYXB 2I15A 2KJGA 3UMHA 1VLSA 4EBJA 1YAUO 2DYRC 3C7JA 1M2VA 4LACB 3K1HA 3U9MA 3DWWA 5BQGA 5KYYB 3ITFA 1ZU4A 2DYSC 2XS1A 4JCHA 3U8PA 2KNHA 3V5YA 4G7ZF 3JRMO 4DBRA 3V7OA 4MVSA 3C18A 4E0IA 4XLPF 3SZRA 3T4RA 2V26A 4ONSA 2MWQA 2HUJA 1XWJA 1C02A 1NZEA 3X1OA 3X2QC 5L0JA 4OD5A 2YLGA 2CNWD 3HNJA 4HFFB 4YK5A 5DS5A 1AVOB 4DOZA 3RQFA 2P1AA 3M4BA 5DQTA 2A69F 3US6A 4PFOA 4C3BA 3GM1A 1JPJA 1VOMA 2ZXRA 4IAQA 2E87A 3AQBA 4QI0A 3RH3A 3GM2A 1ZVZA 4JW1A 3M4CA 3QVZA 4PACA 5DQZA 3KYJA 3MFNA 1LE2A 1LS4A 2KGOA 3NYLA 5KYUA 2Q7RA 3GWLA 3HKKA 2Y39A 3NDBB 2W4MA 4KI2A 3L8IA 2HKVA 1Z5ZA 1R5ID 2IBFA 1TFOB 2AWYA 3KH2A 2UUIA 1BR4A 3EGXA 2BE5F 1LI7A 3N24A 3EZHA 4FESA 2VCBA 1FFHA 1K40A 1Y6DA 2IXOA 3H65A 4IARA 4IB4A 5DVWA 3VM6A 3POVA 2XLMA 4BEJA 5K0IA 1ZU5A 1K05A 4JC7A 4MNDA 3DM5A 3T6BA 5KYWA 1UFBA 4CSAA 3DKAA 4GYTA 3PDMP 1MMDA 2G62A 2W9YA 3E70C 4YT8A 1FTSA 5JLIA 3NYJA 2CNWA 1GGQA 1MMGA 1WWPA 1PD0A 4AL1A 1L3PA 3NMIA 3ABMC 2PX3A 2XLEA 3G4XA 4H54A 5KYNA 1KU2A 2OQMA 2J8WA 4MW3A 1HW1A 2Y3BA 3LAYA 1O3UA 3O39A 3RIPA 2KW3C 2VH3A 4YWQA 2A0UA 1V4AA 4CS8A 3RQGA 2HV6A 4G0HA 4JIOA 3ZVRA 2YLIA 4CIPA 4EUKB 1ORJA 2EIJC 4EHPA 4CSAC 4J30B 4N4WA 3KYIA 2Z15A 1VLTA 3DAFA 4L6RA 2IYLD 2O9XA 2P6VA 4JCZA 1OW7A 1SMYF 4MTFA 1HW2A 5JP7A 4JE9A 1RJ9A 2AVKA 2ETSA 2NUPA 4K0DA 3S84A 2CCYA 1OKKD 2IXPA 2IOQA 2J9VA 1NG1A 3BEHA 2WZLA 3I5QA 4N06A 1DOWA 1PD1A 3EFOA 3HTKC 4CS8C 1U0BB 3DE9A 1OXBA 2J9UA 3HJCA 1I5NA 3DD7A 1D1CA 4E0HA 3AGUA 5CI8A 1QPUA 1AUEA 1SZIA 2GAQA 3U9JA 4IJJA 4Z9IA 3S28A 1XZQA 5JVEA 2HZ8A 3AJMA 2L6HA 1L7CA 5COFA 4PFPA 3U3FA 4Q5SF 4YT2A 3ABKC 3M79A 4RDAA 4KBLA 3MYIA 4OINF 1GS9A 1FMVA 1JR8A 1ORSC 2UUHA 1APCA 5F5HA 2QLAA 3RVZA 1TR2A 4YT4A 3SNHA 3UGOA 3IQTA 3R7CA 3EFOB 1YDIA 3ATPA 5B3SC 2R7VA 2YQYA 2B0HA 3UR3C 5A6JA 3LNMB 2R7UA 3NKDA 3T6JA 1QSPA 3MBGA 2HS5A 4RD9A 3W8HA 2A68F 1YZCA 2ZXWC 4PR9A 3AG4C 1ZZPA 4ZLCA 2HSQA 4NTAA 2PNOA 3S0XA 2HV7A 1OKKA 3T9OA 3ASOC 1YYJA 3WHNA 3DI5A 4YN0B 1JMWA 2XM4A 1TWCA 1LKXA 2FGYA 4E7SA 2OG2A 4JTAB 4YL0A 2QE9A 2YWAA 4IAOA 2L6GA 2J46A 2OU6A 3EPVA 2NG1A 5E2QA 3DJUB 3TD7A 4XPWA 3NKEA 3SEOA 5T1DB 2JX0A 1TFKB 3B71A 1G4US 1I4ZA 2Q00A 4LERA 5COGA 2JPUA 5FZTA 4DJ9A 5L3QA 4RBNA 1RCPA 2A6EF 2LIGA 4NQFA 5DLJA 1U6HA 3U2LA 1W2WA 1Z3IX 4GQHA 3ZG1A 3FDQA 4G7OF 2NSFA 1RKEB 1E85A 3JSZA 1EI7A 1QLEC 4NC3A 1J8MF 3A9CA 4M63A 3RKOF 3SP1A 2Y69C 3K33A 2CW0F 1F1MA 1YA9A 1QKRA 1CGNA 2R05A 1TWAA 5L0IA 1HE9A 2EPMX 2H7VC 1T01A 4C3DA 5BQHA 4JVSA 1E86A 3FAJA 4I3MA 3H2UA 4OD4A 5DS6A 5L0DA 1V55C 4KNVA 2GA0A 2MHRA 4P6IC 5JUAA 2F22A 3GEIA 4W8PA 1BBHA 5B1AC 1VK5A 3KMIA 3TOMA 2CGEA 3F47A 1OXKA 2R25A 2B0JA 3JCUQ 2YL3A 4Q4ZF 1O87A 2XL4A 2J45A 3FVYA 4CS9A 1YARO 4U5FE 1H9GA 1OCZC 2J0XA 1BR2A 2PP4A 5L0FA 2XL8A 2YL0A 3JTLO 2R7RA 2LQGA 4KC9A 4MVOA 4MVMA 2RSEB 1VMAA 3OWTA 1G4WR 4U5BE 1Q0GA 1BDJB 4ULVA 4A2NB 2XLHA 3CAXA 3TULA 1BR1A 2NUTB 3NG1A 3Q7GA 5E3CA 4MVQA 3U2MA 2OJQA 2XLVA 3WG7C 1E84A 4K7BA 3QW1A 3DMDA 3L34A 1CPQA 2LD6A 3AGTA 3EZIA 5CIVA 2TMVP 4LDKA 4JURI 3PHF2 4MVUA 3J06A 3ZWIA 1TWHA 1YA7O 3MYFA 3HNIA 4LLCA 5A6AA 4PK4A 4OIQF 1WASA 3RYLA 2RD9A 2H8AA 5COMA 1C17M 2M4EA 1LI5A 1ZHWA 4O6YA 4AE4B 1XZPA 2KSFA 2J9WA 1LPEA 2OJED 2XS8A 3ABLC 2L6FA 3C8ZA 3LJBA 4WGYA 2Q4FA 2I8BA 4Z9JA 2M64A 2IXNA 3ZIBA 3K66A 3PMRA 1T6QA 3SYNA 4IGGA 1IZMA 1JAFA 1MNDA 3L1MA 4J7YA 4JJFA 3AG1C 4U5CE 5B1BC 5T3WA 3V5XA 5D91A 4MVZA 4J32B 1GQAA 3G4ZA 1FMWA 1TWGA 1CGOA 4BJTA 3G50A 1R4TA 4OIRF 4CIHA 4C7OB 2R02A 3ZTZA 5GPGB 2GDCA 4CDVA 4BJ5A 4DVYP 3ASNC 4DBQA 4ER9A 3S90A 1ZHXA 3EGDB 1MMNA 2G3VA 2NPUA 1FAPB 1HMOA 2ICWG 2YL7A 1OR3A 2ZXOA 1JPNA 2X51A 4YJWA 2YEVA 2HJ3A 3UGPA 2LSEA 2ZXPA 4N6CA 5E3AA 1EQ1A 1A7EA 3DM9B 4PJLA 3ZTMA 4HE8D 1G5ZA 3TQOA 3OEOA 3EG9B 2WL8A 3HNKA 4W8KA 4EIYA 3VF0A 4O7GA 3QW0A 4DVZA 5HSWA 2DB4A 4BJ5C 5D92A 2LP4A 4XEFA 4LLEA 3NMJA 4LDQA 1E2XA 3TK0A 4MW8A 2PFDA 3U0CA 2WVNA 4EBBA 5L3VA 3DZAA 1ZHYA 2XL6A 3JYYA 4MQ9F 1H9TA 1V74B 2LK4A 3O6XA 3EHMA 4YT5A 2HMQA 2YRFA 1Z7Qc 2W45A 1NSGB 2G3KA 2OEXA 3C8GB 3K1IC 3S29A 3TJ6A 1SR2A 1YLMA 3W8IA 4E17A 5AC5A 2R7XA 5BQIA 2Q3TA 1EKYA 2P7VA 1YZAA 3LLKA 3NRHA 3Q7LA 4JKVA 4F4BA 2R7WA 3NYMA 3GODA 4U9EA 4BJ6C 4N6HA 4BPMA 4NCQA 2IM8A 1EA8A 1NLXA 3EH2A 4NY3A 4O79A 3SXZA 4OIOF 2WZGA 2EPOA 1YVIA 1NFOA 1RKEA 4U5DE 3MX3A 1H6GA 4P9FA 1JRAA 3C62A 2YZSA 4CX9A 1FNTc 2VCAA 4GEHA 3Q6NA 2AP3A 3S9OA 1S7ZA 3VYWA 3O10A 4CS7A 3H2VA 2NSGA 1A7VA 1LE4A 1AEPA 1M2OA 2XM0A 1LM3B 3MLGA 4PJJA 4YL1A 2HMZA 3FXHA 1QQ3A 4YL3A 5CI9A 3SXKA 2KK1A 1N1CA 3FHDA 1CPRA 1T6UA 3UMIA 3VRCA 4C3EA 2R9RB 4CJOA 5JS5A 1WN0A 4XTKA 1Z23A 3U8VA 4G7HF 4HFKB 1D0YA 2AU5A 3S27A 3F46A 2R7SA 1DOVA 3SXMA 2EPNA 2HJMA 3QTHA 4I1MA 5JRAA 5HV9A 3Q6MA 1FFTC 3BRJA 1A7DA 1IW7F 1Q0KA 3L8JA 4UDVA 3I5PA 2YHSA 4J7TA 4EWCA 3IQCA 4CDYA 4MS2A 1MMAA 3GM3A 4Q7CA 1PV3A 3CSKA 2NUTA 3AG2C 5F5FA 1JOGA 1Z63A 1D1AA 2V3CC 1HE1A 1NFNA 3K6BA 4D4XA 3NMKA 4IWBA 3IPMO 2XXAB 4U5GA 3IQ6A 5F28E 2KQ9A 1BZ4A 2VCCA 4CDAA 3WAQA 4X0RA 2D4UA 5L0HA 2BC5A 5FCLA 1G8XA 3JT1A 5EGYA 4AE4A 2CYDA 4R32A 4XEKA 2ASRA 1E83A 4D4NA 2Q9AA 3EHNA 1SF8A 1O5HA 3LS1A 3IEEA 3LEVA 1Q0DA 2Q9CA 2A0BA 3B9QA 3C63A 2XLDA 3QMKA 4I1OB 4JEAA 4KNWA 4O6MA 4WGZA 2L7AA 2GWWA 3KKBA 2A1DD 2FAPB 2QUPA 4JTCB 3V5ZA 1WGWA 4PJMA 5A6KA 4QI2A 3EJNA 4EBKA 1PCXA 2Q9BA 3C8GD 1LS1A 5E33A 1Y4CA 1D0XA 1RKCA 4C7OA 3E9VA 1M2VB 5A6BD 3HNLA 5TJ5E 1QZXA 4IRUA 3W2WA 1ZW3A 3EGDA 1OR2A 1T5OA 3GEHA 2HFIA 3I4UA 3LEOA 1I4YA 4BJ1A 3W4YA 1MNEA 2H7BA 2Y3HA 3SXYA 1A41A 1NU9C 1TKNA 3DE8A 3LUTB 4HEAJ 3FMSA 3LLIA 3N2ZB 2IXMA 5JT4A 1ZYRF 2HSBA 4ZLDA 2R03A 2LFFA 1OW8A 2C03A 3A11A 1NU7D 4I44A 1RMVA 2WVQA 5BUOA 4AK9A 2EPKX 1M56C 2XRHA 1ZW2A 1HMDA 3EG9A 3IHUA 4XPXA 4JZAA 1Z6AA 5L0CA 2DGJA 5DS4A 3CQZA 2FFHA 2WZFA 3N0TA 3ZDLA 1B68A 3AG3C 1ST6A 3ZQVA 2LFDA 4DXWA 2Y3DA 2QTVA 3AQCA 3B29A 2X0CA 4E18A 1OCRC 3CEXA 4JRZA 2JD3A 5KYUB 1GM5A 2C04A 2VC9A 3FAPB 3ECSA 1V54C 4DRIB 3C8GA 1ZHTA 1WOLA 4LDRA 3VAYA 3ZC4A 5IY5C 3UMKA 5A6BA 2MYSA 4ULWA 3ZQYA 2EIKC 3EGXB 2EINC 3GANA 3K1IA 4U5HA 1OW6A 1OCCC 2XSEA 3PCVA 4ANJA 4CS9C 1J8YF 2KC3A 3KL4A 3LS0A 2PX0A 3GWNA 4PJNA 4DRJB 2OCCC 2ZD9A 2YKZA 3WODF 3UNGC 4MTOA 1YJGA 2Y3GA 2YLDA 4XPYA 5JSLA 4FX5A 5KYWB 1D0ZA 2OOCA 2H7OA 3HLZA 2P61A 4MTGA 3JYHA 3U5SA 1A0BA 2J9BA 4NTBA 1CGME 3QVYA 4OIPF 3RW0A 3B0VC 3JRTA 1VTMP 4P9TA 3W2VA 2VB6A 1HY5A 1OQCA 1RXQA 3AOUA 4FAPB 2PF4E 3K7DA 5EK0A 2EIMC
chains in the Genus database with same CATH topology
3LEOA 5BQIA 4AL1A 3DWWA 5BQGA 4BPMA 2Q7RA 3HKKA 5HV9A 3PCVA 4NTAA 2PNOA 4WABA 4J7YA 4NTFA 5BQHA 2UUIA 4J7TA 4AL0A 4YL0A 4YK5A 4JCZA 4NTBA 5K0IA 4JC7A 2UUHA 4YL1A 2H8AA 3B29A 4YL3A 4JRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEO A;  5BQI A;  4AL1 A;  3DWW A;  5BQG A;  4BPM A;  2Q7R A;  3HKK A;  5HV9 A;  3PCV A;  4NTA A;  2PNO A;  4WAB A;  4J7Y A;  4NTF A;  5BQH A;  2UUI A;  4J7T A;  4AL0 A;  4YL0 A;  4YK5 A;  4JCZ A;  4NTB A;  5K0I A;  4JC7 A;  2UUH A;  4YL1 A;  2H8A A;  3B29 A;  4YL3 A;  4JRZ A; 
#chains in the Genus database with same CATH topology
 4H4K C;  4JTD B;  2OKU A;  4U5E E;  1Q0F A;  4O6N A;  5EHH A;  2YVK A;  1NBB A;  4EKW A;  4BG0 A;  2LCH A;  5T3T A;  1T9K A;  2WB7 A;  2L9J A;  3B0P A;  4K1O A;  4DRH B;  4Z9H A;  1OCO C;  2R7O A;  1Q0M A;  3EH1 A;  1UG7 A;  2J7P D;  4FWV A;  2W4B A;  4JEB A;  4QDL A;  3TJ5 A;  4WAB A;  3LNR A;  4A4A A;  4XQ1 A;  4NTF A;  2R7T A;  256B A;  4CBE A;  1S05 A;  1TQG A;  3O55 A;  5AGF A;  1VYI A;  2EIL C;  4XEV A;  3RFY A;  1WTY A;  1RJ9 B;  2QY9 A;  2NUP B;  2KYH A;  4U9D A;  3DAG A;  3JZ0 A;  3B0U X;  4CJG A;  2AWC A;  2WVO A;  2ZPA A;  1FR0 A;  1VB5 A;  2XLW A;  3DJN B;  2R7Q A;  3RVY A;  3DXJ F;  1WAT A;  3TOL A;  5B3I A;  1ORY A;  2OEV A;  3EQL F;  5A69 A;  4B6I A;  1MQV A;  1SYQ A;  5KYX A;  1LVK A;  2PBE A;  3GOR A;  2J0W A;  2XXA A;  1LIH A;  3IQ5 A;  3JSE O;  1T6I A;  5AC4 A;  1C03 A;  4XWJ A;  2VAS A;  1KTM A;  4WJ0 A;  2BL2 A;  3RF3 A;  2GFH A;  2P0N A;  2A6H F;  3FOP A;  1ZHZ A;  5KYY A;  1KNY A;  1M6T A;  1VYK A;  3FOO A;  2L81 A;  3L0I A;  2YL1 A;  4JJG A;  4XLN F;  1QVX A;  3LES A;  1YYX A;  3U3B A;  3M15 A;  1U89 A;  4MVR A;  3QZC A;  2QNL A;  2D5R B;  3T6G B;  1M57 C;  3M1C B;  4BEM J;  2CDQ A;  5L0G A;  4AL0 A;  4G78 A;  2XLO A;  1D1B A;  3OA1 A;  2J7P A;  3ZSU A;  4AX2 A;  1K04 A;  2EPL X;  4BJ6 A;  1H7I A;  3KPH A;  2DI3 A;  3RQE A;  4E7Z A;  3R2P A;  3GEE A;  3CZ6 A;  5KYX B;  2I15 A;  2KJG A;  3UMH A;  1VLS A;  4EBJ A;  1YAU O;  2DYR C;  3C7J A;  1M2V A;  4LAC B;  3K1H A;  3U9M A;  3DWW A;  5BQG A;  5KYY B;  3ITF A;  1ZU4 A;  2DYS C;  2XS1 A;  4JCH A;  3U8P A;  2KNH A;  3V5Y A;  4G7Z F;  3JRM O;  4DBR A;  3V7O A;  4MVS A;  3C18 A;  4E0I A;  4XLP F;  3SZR A;  3T4R A;  2V26 A;  4ONS A;  2MWQ A;  2HUJ A;  1XWJ A;  1C02 A;  1NZE A;  3X1O A;  3X2Q C;  5L0J A;  4OD5 A;  2YLG A;  2CNW D;  3HNJ A;  4HFF B;  4YK5 A;  5DS5 A;  1AVO B;  4DOZ A;  3RQF A;  2P1A A;  3M4B A;  5DQT A;  2A69 F;  3US6 A;  4PFO A;  4C3B A;  3GM1 A;  1JPJ A;  1VOM A;  2ZXR A;  4IAQ A;  2E87 A;  3AQB A;  4QI0 A;  3RH3 A;  3GM2 A;  1ZVZ A;  4JW1 A;  3M4C A;  3QVZ A;  4PAC A;  5DQZ A;  3KYJ A;  3MFN A;  1LE2 A;  1LS4 A;  2KGO A;  3NYL A;  5KYU A;  2Q7R A;  3GWL A;  3HKK A;  2Y39 A;  3NDB B;  2W4M A;  4KI2 A;  3L8I A;  2HKV A;  1Z5Z A;  1R5I D;  2IBF A;  1TFO B;  2AWY A;  3KH2 A;  2UUI A;  1BR4 A;  3EGX A;  2BE5 F;  1LI7 A;  3N24 A;  3EZH A;  4FES A;  2VCB A;  1FFH A;  1K40 A;  1Y6D A;  2IXO A;  3H65 A;  4IAR A;  4IB4 A;  5DVW A;  3VM6 A;  3POV A;  2XLM A;  4BEJ A;  5K0I A;  1ZU5 A;  1K05 A;  4JC7 A;  4MND A;  3DM5 A;  3T6B A;  5KYW A;  1UFB A;  4CSA A;  3DKA A;  4GYT A;  3PDM P;  1MMD A;  2G62 A;  2W9Y A;  3E70 C;  4YT8 A;  1FTS A;  5JLI A;  3NYJ A;  2CNW A;  1GGQ A;  1MMG A;  1WWP A;  1PD0 A;  4AL1 A;  1L3P A;  3NMI A;  3ABM C;  2PX3 A;  2XLE A;  3G4X A;  4H54 A;  5KYN A;  1KU2 A;  2OQM A;  2J8W A;  4MW3 A;  1HW1 A;  2Y3B A;  3LAY A;  1O3U A;  3O39 A;  3RIP A;  2KW3 C;  2VH3 A;  4YWQ A;  2A0U A;  1V4A A;  4CS8 A;  3RQG A;  2HV6 A;  4G0H A;  4JIO A;  3ZVR A;  2YLI A;  4CIP A;  4EUK B;  1ORJ A;  2EIJ C;  4EHP A;  4CSA C;  4J30 B;  4N4W A;  3KYI A;  2Z15 A;  1VLT A;  3DAF A;  4L6R A;  2IYL D;  2O9X A;  2P6V A;  4JCZ A;  1OW7 A;  1SMY F;  4MTF A;  1HW2 A;  5JP7 A;  4JE9 A;  1RJ9 A;  2AVK A;  2ETS A;  2NUP A;  4K0D A;  3S84 A;  2CCY A;  1OKK D;  2IXP A;  2IOQ A;  2J9V A;  1NG1 A;  3BEH A;  2WZL A;  3I5Q A;  4N06 A;  1DOW A;  1PD1 A;  3EFO A;  3HTK C;  4CS8 C;  1U0B B;  3DE9 A;  1OXB A;  2J9U A;  3HJC A;  1I5N A;  3DD7 A;  1D1C A;  4E0H A;  3AGU A;  5CI8 A;  1QPU A;  1AUE A;  1SZI A;  2GAQ A;  3U9J A;  4IJJ A;  4Z9I A;  3S28 A;  1XZQ A;  5JVE A;  2HZ8 A;  3AJM A;  2L6H A;  1L7C A;  5COF A;  4PFP A;  3U3F A;  4Q5S F;  4YT2 A;  3ABK C;  3M79 A;  4RDA A;  4KBL A;  3MYI A;  4OIN F;  1GS9 A;  1FMV A;  1JR8 A;  1ORS C;  2UUH A;  1APC A;  5F5H A;  2QLA A;  3RVZ A;  1TR2 A;  4YT4 A;  3SNH A;  3UGO A;  3IQT A;  3R7C A;  3EFO B;  1YDI A;  3ATP A;  5B3S C;  2R7V A;  2YQY A;  2B0H A;  3UR3 C;  5A6J A;  3LNM B;  2R7U A;  3NKD A;  3T6J A;  1QSP A;  3MBG A;  2HS5 A;  4RD9 A;  3W8H A;  2A68 F;  1YZC A;  2ZXW C;  4PR9 A;  3AG4 C;  1ZZP A;  4ZLC A;  2HSQ A;  4NTA A;  2PNO A;  3S0X A;  2HV7 A;  1OKK A;  3T9O A;  3ASO C;  1YYJ A;  3WHN A;  3DI5 A;  4YN0 B;  1JMW A;  2XM4 A;  1TWC A;  1LKX A;  2FGY A;  4E7S A;  2OG2 A;  4JTA B;  4YL0 A;  2QE9 A;  2YWA A;  4IAO A;  2L6G A;  2J46 A;  2OU6 A;  3EPV A;  2NG1 A;  5E2Q A;  3DJU B;  3TD7 A;  4XPW A;  3NKE A;  3SEO A;  5T1D B;  2JX0 A;  1TFK B;  3B71 A;  1G4U S;  1I4Z A;  2Q00 A;  4LER A;  5COG A;  2JPU A;  5FZT A;  4DJ9 A;  5L3Q A;  4RBN A;  1RCP A;  2A6E F;  2LIG A;  4NQF A;  5DLJ A;  1U6H A;  3U2L A;  1W2W A;  1Z3I X;  4GQH A;  3ZG1 A;  3FDQ A;  4G7O F;  2NSF A;  1RKE B;  1E85 A;  3JSZ A;  1EI7 A;  1QLE C;  4NC3 A;  1J8M F;  3A9C A;  4M63 A;  3RKO F;  3SP1 A;  2Y69 C;  3K33 A;  2CW0 F;  1F1M A;  1YA9 A;  1QKR A;  1CGN A;  2R05 A;  1TWA A;  5L0I A;  1HE9 A;  2EPM X;  2H7V C;  1T01 A;  4C3D A;  5BQH A;  4JVS A;  1E86 A;  3FAJ A;  4I3M A;  3H2U A;  4OD4 A;  5DS6 A;  5L0D A;  1V55 C;  4KNV A;  2GA0 A;  2MHR A;  4P6I C;  5JUA A;  2F22 A;  3GEI A;  4W8P A;  1BBH A;  5B1A C;  1VK5 A;  3KMI A;  3TOM A;  2CGE A;  3F47 A;  1OXK A;  2R25 A;  2B0J A;  3JCU Q;  2YL3 A;  4Q4Z F;  1O87 A;  2XL4 A;  2J45 A;  3FVY A;  4CS9 A;  1YAR O;  4U5F E;  1H9G A;  1OCZ C;  2J0X A;  1BR2 A;  2PP4 A;  5L0F A;  2XL8 A;  2YL0 A;  3JTL O;  2R7R A;  2LQG A;  4KC9 A;  4MVO A;  4MVM A;  2RSE B;  1VMA A;  3OWT A;  1G4W R;  4U5B E;  1Q0G A;  1BDJ B;  4ULV A;  4A2N B;  2XLH A;  3CAX A;  3TUL A;  1BR1 A;  2NUT B;  3NG1 A;  3Q7G A;  5E3C A;  4MVQ A;  3U2M A;  2OJQ A;  2XLV A;  3WG7 C;  1E84 A;  4K7B A;  3QW1 A;  3DMD A;  3L34 A;  1CPQ A;  2LD6 A;  3AGT A;  3EZI A;  5CIV A;  2TMV P;  4LDK A;  4JUR I;  3PHF 2;  4MVU A;  3J06 A;  3ZWI A;  1TWH A;  1YA7 O;  3MYF A;  3HNI A;  4LLC A;  5A6A A;  4PK4 A;  4OIQ F;  1WAS A;  3RYL A;  2RD9 A;  2H8A A;  5COM A;  1C17 M;  2M4E A;  1LI5 A;  1ZHW A;  4O6Y A;  4AE4 B;  1XZP A;  2KSF A;  2J9W A;  1LPE A;  2OJE D;  2XS8 A;  3ABL C;  2L6F A;  3C8Z A;  3LJB A;  4WGY A;  2Q4F A;  2I8B A;  4Z9J A;  2M64 A;  2IXN A;  3ZIB A;  3K66 A;  3PMR A;  1T6Q A;  3SYN A;  4IGG A;  1IZM A;  1JAF A;  1MND A;  3L1M A;  4J7Y A;  4JJF A;  3AG1 C;  4U5C E;  5B1B C;  5T3W A;  3V5X A;  5D91 A;  4MVZ A;  4J32 B;  1GQA A;  3G4Z A;  1FMW A;  1TWG A;  1CGO A;  4BJT A;  3G50 A;  1R4T A;  4OIR F;  4CIH A;  4C7O B;  2R02 A;  3ZTZ A;  5GPG B;  2GDC A;  4CDV A;  4BJ5 A;  4DVY P;  3ASN C;  4DBQ A;  4ER9 A;  3S90 A;  1ZHX A;  3EGD B;  1MMN A;  2G3V A;  2NPU A;  1FAP B;  1HMO A;  2ICW G;  2YL7 A;  1OR3 A;  2ZXO A;  1JPN A;  2X51 A;  4YJW A;  2YEV A;  2HJ3 A;  3UGP A;  2LSE A;  2ZXP A;  4N6C A;  5E3A A;  1EQ1 A;  1A7E A;  3DM9 B;  4PJL A;  3ZTM A;  4HE8 D;  1G5Z A;  3TQO A;  3OEO A;  3EG9 B;  2WL8 A;  3HNK A;  4W8K A;  4EIY A;  3VF0 A;  4O7G A;  3QW0 A;  4DVZ A;  5HSW A;  2DB4 A;  4BJ5 C;  5D92 A;  2LP4 A;  4XEF A;  4LLE A;  3NMJ A;  4LDQ A;  1E2X A;  3TK0 A;  4MW8 A;  2PFD A;  3U0C A;  2WVN A;  4EBB A;  5L3V A;  3DZA A;  1ZHY A;  2XL6 A;  3JYY A;  4MQ9 F;  1H9T A;  1V74 B;  2LK4 A;  3O6X A;  3EHM A;  4YT5 A;  2HMQ A;  2YRF A;  1Z7Q c;  2W45 A;  1NSG B;  2G3K A;  2OEX A;  3C8G B;  3K1I C;  3S29 A;  3TJ6 A;  1SR2 A;  1YLM A;  3W8I A;  4E17 A;  5AC5 A;  2R7X A;  5BQI A;  2Q3T A;  1EKY A;  2P7V A;  1YZA A;  3LLK A;  3NRH A;  3Q7L A;  4JKV A;  4F4B A;  2R7W A;  3NYM A;  3GOD A;  4U9E A;  4BJ6 C;  4N6H A;  4BPM A;  4NCQ A;  2IM8 A;  1EA8 A;  1NLX A;  3EH2 A;  4NY3 A;  4O79 A;  3SXZ A;  4OIO F;  2WZG A;  2EPO A;  1YVI A;  1NFO A;  1RKE A;  4U5D E;  3MX3 A;  1H6G A;  4P9F A;  1JRA A;  3C62 A;  2YZS A;  4CX9 A;  1FNT c;  2VCA A;  4GEH A;  3Q6N A;  2AP3 A;  3S9O A;  1S7Z A;  3VYW A;  3O10 A;  4CS7 A;  3H2V A;  2NSG A;  1A7V A;  1LE4 A;  1AEP A;  1M2O A;  2XM0 A;  1LM3 B;  3MLG A;  4PJJ A;  4YL1 A;  2HMZ A;  3FXH A;  1QQ3 A;  4YL3 A;  5CI9 A;  3SXK A;  2KK1 A;  1N1C A;  3FHD A;  1CPR A;  1T6U A;  3UMI A;  3VRC A;  4C3E A;  2R9R B;  4CJO A;  5JS5 A;  1WN0 A;  4XTK A;  1Z23 A;  3U8V A;  4G7H F;  4HFK B;  1D0Y A;  2AU5 A;  3S27 A;  3F46 A;  2R7S A;  1DOV A;  3SXM A;  2EPN A;  2HJM A;  3QTH A;  4I1M A;  5JRA A;  5HV9 A;  3Q6M A;  1FFT C;  3BRJ A;  1A7D A;  1IW7 F;  1Q0K A;  3L8J A;  4UDV A;  3I5P A;  2YHS A;  4J7T A;  4EWC A;  3IQC A;  4CDY A;  4MS2 A;  1MMA A;  3GM3 A;  4Q7C A;  1PV3 A;  3CSK A;  2NUT A;  3AG2 C;  5F5F A;  1JOG A;  1Z63 A;  1D1A A;  2V3C C;  1HE1 A;  1NFN A;  3K6B A;  4D4X A;  3NMK A;  4IWB A;  3IPM O;  2XXA B;  4U5G A;  3IQ6 A;  5F28 E;  2KQ9 A;  1BZ4 A;  2VCC A;  4CDA A;  3WAQ A;  4X0R A;  2D4U A;  5L0H A;  2BC5 A;  5FCL A;  1G8X A;  3JT1 A;  5EGY A;  4AE4 A;  2CYD A;  4R32 A;  4XEK A;  2ASR A;  1E83 A;  4D4N A;  2Q9A A;  3EHN A;  1SF8 A;  1O5H A;  3LS1 A;  3IEE A;  3LEV A;  1Q0D A;  2Q9C A;  2A0B A;  3B9Q A;  3C63 A;  2XLD A;  3QMK A;  4I1O B;  4JEA A;  4KNW A;  4O6M A;  4WGZ A;  2L7A A;  2GWW A;  3KKB A;  2A1D D;  2FAP B;  2QUP A;  4JTC B;  3V5Z A;  1WGW A;  4PJM A;  5A6K A;  4QI2 A;  3EJN A;  4EBK A;  1PCX A;  2Q9B A;  3C8G D;  1LS1 A;  5E33 A;  1Y4C A;  1D0X A;  1RKC A;  4C7O A;  3E9V A;  1M2V B;  5A6B D;  3HNL A;  5TJ5 E;  1QZX A;  4IRU A;  3W2W A;  1ZW3 A;  3EGD A;  1OR2 A;  1T5O A;  3GEH A;  2HFI A;  3I4U A;  3LEO A;  1I4Y A;  4BJ1 A;  3W4Y A;  1MNE A;  2H7B A;  2Y3H A;  3SXY A;  1A41 A;  1NU9 C;  1TKN A;  3DE8 A;  3LUT B;  4HEA J;  3FMS A;  3LLI A;  3N2Z B;  2IXM A;  5JT4 A;  1ZYR F;  2HSB A;  4ZLD A;  2R03 A;  2LFF A;  1OW8 A;  2C03 A;  3A11 A;  1NU7 D;  4I44 A;  1RMV A;  2WVQ A;  5BUO A;  4AK9 A;  2EPK X;  1M56 C;  2XRH A;  1ZW2 A;  1HMD A;  3EG9 A;  3IHU A;  4XPX A;  4JZA A;  1Z6A A;  5L0C A;  2DGJ A;  5DS4 A;  3CQZ A;  2FFH A;  2WZF A;  3N0T A;  3ZDL A;  1B68 A;  3AG3 C;  1ST6 A;  3ZQV A;  2LFD A;  4DXW A;  2Y3D A;  2QTV A;  3AQC A;  3B29 A;  2X0C A;  4E18 A;  1OCR C;  3CEX A;  4JRZ A;  2JD3 A;  5KYU B;  1GM5 A;  2C04 A;  2VC9 A;  3FAP B;  3ECS A;  1V54 C;  4DRI B;  3C8G A;  1ZHT A;  1WOL A;  4LDR A;  3VAY A;  3ZC4 A;  5IY5 C;  3UMK A;  5A6B A;  2MYS A;  4ULW A;  3ZQY A;  2EIK C;  3EGX B;  2EIN C;  3GAN A;  3K1I A;  4U5H A;  1OW6 A;  1OCC C;  2XSE A;  3PCV A;  4ANJ A;  4CS9 C;  1J8Y F;  2KC3 A;  3KL4 A;  3LS0 A;  2PX0 A;  3GWN A;  4PJN A;  4DRJ B;  2OCC C;  2ZD9 A;  2YKZ A;  3WOD F;  3UNG C;  4MTO A;  1YJG A;  2Y3G A;  2YLD A;  4XPY A;  5JSL A;  4FX5 A;  5KYW B;  1D0Z A;  2OOC A;  2H7O A;  3HLZ A;  2P61 A;  4MTG A;  3JYH A;  3U5S A;  1A0B A;  2J9B A;  4NTB A;  1CGM E;  3QVY A;  4OIP F;  3RW0 A;  3B0V C;  3JRT A;  1VTM P;  4P9T A;  3W2V A;  2VB6 A;  1HY5 A;  1OQC A;  1RXQ A;  3AOU A;  4FAP B;  2PF4 E;  3K7D A;  5EK0 A;  2EIM C; 
#chains in the Genus database with same CATH homology
 3LEO A;  5BQI A;  4AL1 A;  3DWW A;  5BQG A;  4BPM A;  2Q7R A;  3HKK A;  5HV9 A;  3PCV A;  4NTA A;  2PNO A;  4WAB A;  4J7Y A;  4NTF A;  5BQH A;  2UUI A;  4J7T A;  4AL0 A;  4YL0 A;  4YK5 A;  4JCZ A;  4NTB A;  5K0I A;  4JC7 A;  2UUH A;  4YL1 A;  2H8A A;  3B29 A;  4YL3 A;  4JRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...