1S7ZA

Structure of ocr from bacteriophage t7
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
MTYNNVFDHAYEMLKENIRYDDIRDTDDLHDAIHMAADNAVPHYYADIFSVMASEGIDLEFEDSGLMPDTKDVIRILQARIYEQLTIDLWEDAEDLLNEYLEEVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 0.3 protein
publication title Structure of Ocr from Bacteriophage T7, a Protein that Mimics B-Form DNA
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Gene regulation
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08684 ocr DNA mimic ocr
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.780 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1s7zA01
1S7ZA
chains in the Genus database with same CATH superfamily
3HLZA 4EBBA 2QNLA 2CNWD 1TWHA 1QSPA 2CNWA 1HY5A 2EIKC 2AP3A 2IM8A 1Q0DA 3EGXB 3NG1A 3M15A 4P9TA 4BPMA 2YLIA 4JTAB 1BBHA 2XRHA 2Z15A 2YVKA 1HMOA 4E0IA 5EHHA 3C63A 3HJCA 2W4MA 4N6CA 3ATPA 5DLJA 5KYWB 3W8IA 1VLTA 2DB4A 5F5HA 4EHPA 4G7ZF 1GM5A 2YQYA 2R7TA 2Q4FA 2L81A 1Y6DA 1TKNA 2R7VA 3HNLA 5KYUA 4DRHB 4OIQF 4M63A 4XWJA 2ZPAA 4EKWA 2KGOA 3S9OA 3EH1A 3SEOA 2AWYA 4A4AA 2CCYA 2UUHA 2CW0F 4Z9JA 4NTFA 3C62A 3HNJA 1ZYRF 3NKDA 3U8PA 4L6RA 3UGOA 4CBEA 1ZZPA 2PFDA 3JZ0A 4DXWA 5JLIA 4KBLA 1A41A 3FVYA 1PCXA 4UDVA 3RVYA 3ZWIA 1OXKA 3FHDA 2IXPA 3E70C 4JKVA 2XLMA 2YRFA 4GEHA 4JJGA 2PBEA 3DAGA 4A2NB 1H9TA 3LS1A 1MMNA 2KQ9A 4C3DA 4PJJA 2HMQA 2DI3A 1Y4CA 2R02A 3JT1A 4CDYA 1LVKA 3O39A 1MNEA 3RVZA 3JYYA 5B1AC 5DS6A 5FCLA 1SR2A 1BZ4A 4XEKA 3MFNA 1T01A 2YLDA 1G4WR 4W8KA 2H7OA 1UFBA 4PJLA 4G7HF 1JOGA 2HS5A 2VC9A 2XLWA 4PACA 1WOLA 1VK5A 4NC3A 1QLEC 4CS7A 1CPRA 2EPKX 3ABKC 3H2UA 2L6HA 3T6JA 3T4RA 1TQGA 1WN0A 3B9QA 3L8IA 4KNVA 4MS2A 3AGTA 3OEOA 1BR1A 5T3TA 2MWQA 3AG3C 3TD7A 1TWCA 5COGA 2QUPA 1ZHWA 4Z9HA 3R2PA 4LERA 3LUTB 3RW0A 1L3PA 4BJ6C 3NRHA 3DI5A 3LESA 2A0UA 4JTDB 3DWWA 3F46A 4ONSA 5JRAA 1DOWA 3FAPB 4LDQA 3ZC4A 1LS1A 4LACB 1QKRA 4CSAC 4JJFA 2XSEA 3Q7LA 3V5YA 1A7VA 4N4WA 4K7BA 4D4XA 1BDJB 1ORSC 1V74B 1NFOA 2YEVA 1OCOC 4JCZA 2LFFA 2ZXWC 3LNMB 2XL4A 5TJ5E 2XXAB 1RKEB 3PMRA 4U9DA 1LI7A 1LIHA 4GQHA 4BJ6A 5JVEA 1FNTc 2XXAA 3RQEA 5L0GA 1LE2A 4LDKA 1OW8A 1L7CA 2YL7A 3C18A 1M57C 4PR9A 3FMSA 5B1BC 2LD6A 3WHNA 5JT4A 4CSAA 4MTFA 1CPQA 3KYJA 1IZMA 1YA9A 3HNKA 4X0RA 4CJOA 3JYHA 256BA 2J9UA 3CQZA 3GM2A 1RXQA 3K66A 1YZAA 2EILC 2OEVA 1VOMA 1GS9A 4OD4A 4LLCA 4D4NA 3UMHA 3ZSUA 4PK4A 4AL1A 3Q6NA 4DVZA 3JSZA 2EPMX 1Z23A 4JW1A 1NZEA 1Q0MA 1VTMP 4NTAA 2DGJA 1ZU5A 1Q0KA 4XPXA 3FOOA 2XLOA 1M2VA 3O6XA 3AGUA 2WL8A 1J8MF 3L34A 4JC7A 4LDRA 3K6BA 4JRZA 5JSLA 4IWBA 4FX5A 2NUTB 2LSEA 5CIVA 3MLGA 3IQCA 4ER9A 5L0HA 5KYXA 2BC5A 2PNOA 1GGQA 4DJ9A 1D0ZA 3GEEA 3LLKA 4O79A 4YL3A 4XTKA 2VCCA 3OWTA 2XM4A 1V54C 2IOQA 3RH3A 1OCCC 4O6NA 5GPGB 4DOZA 1LI5A 2F22A 2RD9A 3RYLA 2XLEA 3GM1A 2G3VA 4BEMJ 1TWGA 2J9BA 1HW1A 2YHSA 2MHRA 4PFPA 5BQGA 4E17A 2NSFA 3EFOB 4YT5A 2W9YA 3LEVA 4ANJA 2R7OA 2ZXRA 4LLEA 1K04A 3MX3A 2A68F 4U5GA 2R7RA 2P6VA 2D5RB 4MTGA 2W45A 4RDAA 4NY3A 4WJ0A 5JUAA 3NMIA 1NG1A 4U5FE 4KNWA 1H7IA 4CDAA 2G3KA 3PHF2 3LS0A 3T9OA 4AE4B 1WGWA 3S29A 5BQIA 1Q0GA 4JCHA 3JSEO 3ZG1A 1VLSA 1G8XA 1OCZC 5L0JA 1ZW2A 2VCAA 4XEVA 5AGFA 4H4KC 2OU6A 3N24A 1Q0FA 1EI7A 4Q7CA 3TJ6A 5JS5A 1MMDA 3EGXA 4G0HA 5L3VA 4FWVA 2WVQA 5K0IA 1OR2A 1QZXA 1HMDA 2LCHA 3J06A 2OJQA 2GAQA 5KYWA 4IB4A 2ZD9A 4U5EE 2HV6A 2YWAA 1B68A 3GODA 4J7YA 3S90A 1OR3A 2ETSA 4AX2A 5HV9A 1XZQA 2R7XA 2HUJA 3O55A 4PFOA 5DQTA 2PX3A 4QI2A 3U0CA 3DM9B 2HZ8A 3ECSA 3GANA 3B29A 3EZHA 3K33A 4MVSA 4JTCB 2OCCC 1YAUO 3FOPA 3V5ZA 5AC5A 2Y3GA 3MYIA 1G4US 4WGZA 1CGME 3CZ6A 3L1MA 2E87A 3IQTA 4OINF 3U9JA 3US6A 3U5SA 3NMKA 5E33A 5A6BD 3EJNA 2WZFA 3SZRA 5A6BA 2AWCA 5COFA 2GFHA 5BQHA 4K0DA 2VCBA 3SXKA 3M79A 2R25A 2Y3BA 1VYKA 2ICWG 2YZSA 4CS8C 5T1DB 3A11A 5HSWA 2GDCA 2W4BA 4CX9A 4IAOA 1U0BB 3DZAA 2I8BA 2EIJC 3C8GB 1RKCA 2DYRC 3M1CB 4WGYA 1Z3IX 3C8GD 4XLPF 5EK0A 2GWWA 1KTMA 3C8GA 3ZTMA 5B3IA 2R7SA 1JPNA 3SP1A 2P0NA 1QPUA 2OJED 2NSGA 4BEJA 1W2WA 4KC9A 4Z9IA 4C3BA 4EUKB 2VB6A 4DRJB 3CSKA 3EG9B 5T3WA 3R7CA 3RF3A 3K7DA 3EGDB 1JMWA 4N06A 4RD9A 2KW3C 1AEPA 3EG9A 1IW7F 1A7DA 4CS8A 1YZCA 2OOCA 1KNYA 1VMAA 2WZLA 1ZHZA 2A69F 3EQLF 1BR4A 2M4EA 1SZIA 3A9CA 3KPHA 4EWCA 1MNDA 1PV3A 3NMJA 2YLGA 2GA0A 2KSFA 4FAPB 2FGYA 4ZLCA 4BJ1A 2XLVA 1LM3B 3TJ5A 5A69A 2HSQA 2NUPB 3IHUA 3JTLO 1U89A 5EGYA 3L8JA 1OXBA 1ZU4A 3WAQA 3TULA 1YA7O 1A0BA 1HW2A 2LK4A 2RSEB 3W2VA 1RKEA 2CGEA 2ZXOA 3S28A 3SXZA 5L0CA 1S7ZA 3RQFA 1OW7A 2KNHA 4YWQA 3ASNC 1MMAA 1V4AA 2LFDA 3VF0A 4ULWA 3EHMA 4J7TA 1T6UA 3H2VA 1KU2A 4G7OF 2ASRA 3AG1C 2Y3HA 3DE9A 2Y39A 1T6QA 3G4ZA 4IRUA 3C7JA 3UNGC 1EQ1A 4GYTA 4YL1A 2J9VA 2XS1A 4YN0B 4U5BE 3ZIBA 1OW6A 2A6EF 1C03A 2HJ3A 4MVMA 2IXNA 3M4BA 5E2QA 3VM6A 2XL8A 1HE9A 2MYSA 2Q3TA 1APCA 1F1MA 3AOUA 2EINC 3LJBA 5E3AA 3U8VA 1E83A 3MBGA 1NBBA 3UR3C 2VASA 1PD0A 3LAYA 2R05A 3ZDLA 1V55C 2OG2A 4W8PA 4CS9C 4JURI 4MQ9F 4EIYA 2HKVA 1R5ID 2HV7A 1E86A 1H6GA 1NU9C 2NUTA 4C7OB 4DRIB 1OQCA 1U6HA 2KC3A 3ABMC 4I44A 3M4CA 4I3MA 3ZQYA 2XLDA 3B71A 3NYMA 2R7QA 3RQGA 4G78A 1ST6A 3GWLA 5CI9A 1O3UA 2P61A 1NU7D 3AG2C 2KYHA 3KL4A 1YLMA 3DD7A 3LNRA 4OD5A 4AL0A 5L0FA 1ORYA 1D1BA 3IQ6A 1MMGA 3G50A 3VAYA 1ZW3A 4AK9A 2OQMA 2C04A 1DOVA 3F47A 4MVQA 2XS8A 3I5PA 2BE5F 4CS9A 1M6TA 4IJJA 3U2MA 3EFOA 3IPMO 1AUEA 2IXOA 3IEEA 1HE1A 3HNIA 1AVOB 1ZHXA 2V3CC 3S84A 3Q7GA 3NKEA 5L0DA 1XWJA 2L6FA 3GORA 2Q9BA 2J9WA 4ULVA 3N2ZB 2D4UA 3SYNA 1NSGB 1R4TA 4AE4A 2WVOA 3EZIA 1TR2A 4IAQA 4JE9A 4E7ZA 3B0UX 3UMKA 1WWPA 2OKUA 2V26A 3DJUB 3FAJA 5D92A 3WG7C 2B0JA 1VYIA 1YVIA 4JEAA 5F5FA 1JPJA 2J8WA 2CYDA 3QVYA 2KK1A 4IARA 2EIMC 3OA1A 3WODF 3ABLC 1LE4A 5F28E 1YJGA 4HFFB 3W4YA 2XM0A 1D0YA 4MVOA 1D1AA 1GQAA 3K1HA 4E18A 1G5ZA 5AC4A 5DS4A 4OIPF 4MVRA 2DYSC 3GWNA 1LKXA 3AJMA 2M64A 4BJ5C 1NFNA 3BRJA 2G62A 1E2XA 2ZXPA 3CAXA 2P7VA 1YARO 2YL3A 4YT4A 1I5NA 1UG7A 4PJNA 4QI0A 2XLHA 5DS5A 1C17M 2Q9CA 2C03A 2EPLX 3IQ5A 4R32A 2A1DD 4Q4ZF 3ZTZA 3CEXA 5A6JA 1XZPA 4J32B 3B0PA 4U5CE 5KYUB 3EH2A 3SNHA 3EHNA 3S0XA 1PD1A 3EPVA 2H8AA 3QW1A 3DMDA 3RKOF 3U3FA 4I1MA 4BJ5A 5A6AA 4PJMA 4CIPA 5KYNA 1O5HA 1RJ9B 4ZLDA 1LS4A 1H9GA 3U2LA 3VRCA 1K05A 1RJ9A 4XEFA 1JRAA 4O6YA 3LLIA 1T5OA 4XPYA 4YJWA 1I4YA 2AU5A 2WVNA 2J7PD 2YL0A 2P1AA 2X0CA 2IYLD 5DQZA 2J7PA 4C3EA 4MVUA 2BL2A 3AG4C 3POVA 2PP4A 3V5XA 4MVZA 1JAFA 4E0HA 3AQCA 3L0IA 3RFYA 3FDQA 1FTSA 3JRTA 5KYYB 4RBNA 3EGDA 4HFKB 3K1IC 4F4BA 2JX0A 2Q9AA 3BEHA 3UMIA 3QTHA 5KYYA 5E3CA 2TMVP 3NDBB 2B0HA 3KKBA 3QMKA 4XQ1A 4HEAJ 5FZTA 1QVXA 2PX0A 5L3QA 3SXMA 2R7UA 4NQFA 4HE8D 3KMIA 5COMA 1FMWA 3I5QA 2EPNA 1CGNA 4YT2A 3DJNB 4KI2A 2QLAA 3S27A 2R9RB 5D91A 2HSBA 1VB5A 1M2OA 2L6GA 1OCRC 2VH3A 2Y69C 2R03A 4N6HA 4YK5A 5JP7A 3KYIA 4WABA 1SYQA 3O10A 4CDVA 4EBJA 1FR0A 3TOMA 2XL6A 2KJGA 2NUPA 3K1IA 5CI8A 3U9MA 5DVWA 4J30B 2UUIA 4MNDA 4DVYP 3N0TA 1EKYA 1WATA 1M56C 4QDLA 1O87A 2A6HF 3X2QC 1S05A 3ZVRA 2LQGA 3TQOA 3VYWA 2EPOA 2HMZA 4H54A 1N1CA 2L7AA 1NLXA 4MW3A 3TOLA 5A6KA 1TFKB 1YDIA 2PF4E 3C8ZA 3PCVA 1E85A 2QY9A 3ASOC 1D1CA 2IBFA 4XPWA 2LIGA 3DXJF 4P6IC 2H7VC 1YYJA 2CDQA 2IXMA 1EA8A 2I15A 1SMYF 1T9KA 4DBQA 1Z7Qc 1Z6AA 2YKZA 4OIOF 4JZAA 2X51A 2NPUA 3HKKA 3GEIA 4E7SA 2J45A 1D0XA 2JPUA 2H7BA 2WZGA 1I4ZA 3G4XA 3ITFA 3B0VC 2Q00A 3UGPA 2HJMA 2OEXA 3E9VA 4JVSA 1WTYA 1TFOB 2JD3A 2YL1A 1ZVZA 3U3BA 2AVKA 4P9FA 2J46A 4MW8A 4YL0A 3X1OA 1FMVA 4C7OA 1QQ3A 1T6IA 3NYJA 3QW0A 1SF8A 3MYFA 4NTBA 3T6BA 3V7OA 2L9JA 1RMVA 3ZQVA 4IGGA 3SXYA 4JIOA 4BG0A 2QE9A 2J0XA 5B3SC 1M2VB 4U5DE 4YT8A 5IY5C 1Z63A 3GEHA 1ZHTA 4CIHA 1E84A 4O6MA 3TK0A 5KYXB 2J0WA 1FAPB 4I1OB 1MQVA 2R7WA 3QZCA 4JEBA 4XLNF 2WB7A 3Q6MA 4OIRF 4DBRA 3KH2A 4NCQA 4Q5SF 1A7EA 4B6IA 3DAFA 1TWAA 3JRMO 3DM5A 1C02A 4EBKA 2HFIA 3H65A 4U5HA 3I4UA 3W2WA 3W8HA 3RIPA 1Z5ZA 1YYXA 2FAPB 3T6GB 2LP4A 1K40A 3HTKC 5L0IA 4O7GA 3JCUQ 2Q7RA 4BJTA 3QVZA 3NYLA 1RCPA 2FFHA 3FXHA 4FESA 4U9EA 1CGOA 2QTVA 1ZHYA 3AQBA 3DE8A 4CJGA 2A0BA 5BUOA 3PDMP 1OKKD 2Y3DA 3GM3A 1LPEA 4MTOA 1OKKA 1WASA 1BR2A 1FFHA 1JR8A 1FFTC 4K1OA 1ORJA 2NG1A 3DKAA 3LEOA 1J8YF 2O9XA
chains in the Genus database with same CATH topology
3HLZA 4EBBA 2CNWD 1TWHA 2CNWA 3NG1A 2EIKC 3EGXB 4EWCA 5EHHA 2XRHA 2Z15A 3HJCA 2W4MA 5DLJA 5KYWB 3W8IA 5F5HA 4G7ZF 2R7TA 2L81A 2R7VA 1TKNA 5KYUA 4OIQF 4M63A 4XWJA 2ZPAA 2KGOA 3SEOA 3EH1A 2CW0F 1ZYRF 3NKDA 4CBEA 2PFDA 4KBLA 3FVYA 1PCXA 3FHDA 2IXPA 3E70C 4GEHA 4JJGA 3DAGA 4A2NB 3LS1A 1MMNA 2KQ9A 4C3DA 4PJJA 3JT1A 1LVKA 3O39A 1MNEA 5B1AC 5DS6A 5FCLA 4W8KA 2H7OA 4PJLA 4G7HF 1VK5A 1QLEC 4CS7A 3ABKC 3T6JA 3T4RA 3B9QA 4KNVA 5T3TA 3OEOA 1BR1A 2MWQA 3AG3C 3TD7A 1TWCA 1ZHWA 4LERA 4BJ6C 3NRHA 3LESA 3F46A 3ZC4A 1LS1A 4LACB 4CSAC 4JJFA 2XSEA 3Q7LA 4K7BA 2YEVA 1OCOC 2ZXWC 2XL4A 2XXAB 3PMRA 4BJ6A 2XXAA 5B1BC 1M57C 4CSAA 1IZMA 4X0RA 3JYHA 2J9UA 3CQZA 3K66A 4OD4A 2EILC 1VOMA 4LLCA 3UMHA 3ZSUA 4PK4A 3Q6NA 4DVZA 3JSZA 1Z23A 4JW1A 1NZEA 2DGJA 1ZU5A 3RKOF 1M2VA 3O6XA 2WL8A 1J8MF 3L34A 3VAYA 3K6BA 4IWBA 4FX5A 2NUTB 2LSEA 5KYXA 3MLGA 1D0ZA 3LLKA 4O79A 4XTKA 3OWTA 1V54C 2IOQA 3RH3A 1OCCC 4O6NA 4DOZA 3RYLA 2G3VA 1TWGA 4PFPA 2YHSA 3EFOB 4YT5A 2W9YA 3LEVA 4ANJA 2R7OA 2ZXRA 4LLEA 4U5GA 3MX3A 2A68F 2R7RA 2P6VA 2D5RB 2W45A 4RDAA 4NY3A 4WJ0A 1NG1A 4U5FE 4KNWA 3PHF2 2G3KA 3LS0A 4AE4B 1WGWA 3S29A 4JCHA 3ZG1A 1G8XA 1OCZC 4H4KC 3N24A 4Q7CA 1MMDA 3EGXA 4G0HA 5L3VA 4FWVA 2WVQA 1QZXA 5KYWA 4U5EE 2HV6A 3GODA 4AX2A 2R7XA 4PFOA 5DQTA 2PX3A 4QI2A 3DM9B 3ECSA 3GANA 3K33A 3EZHA 2OCCC 2Y3GA 3CZ6A 2E87A 4OINF 5E33A 3EJNA 2WZFA 3SZRA 2GFHA 4K0DA 3UGPA 2Y3BA 1VYKA 2YZSA 4CS8C 5T1DB 5HSWA 2W4BA 4IAOA 3DZAA 2I8BA 2EIJC 3M1CB 2DYRC 1Z3IX 4XLPF 2R7SA 1JPNA 3SP1A 4BEJA 1W2WA 4KC9A 4C3BA 2VB6A 3CSKA 3EG9B 5T3WA 3K7DA 3EGDB 4N06A 4RD9A 4CS8A 2KW3C 3EG9A 1IW7F 1VMAA 2WZLA 1ZHZA 2A69F 3EQLF 1BR4A 2M4EA 1SZIA 1MNDA 2FGYA 4ZLCA 4BJ1A 2NUPB 5EGYA 1ZU4A 3W2VA 2ZXOA 2CGEA 3S28A 1S7ZA 2KNHA 4YWQA 3ASNC 1MMAA 4ULWA 3EHMA 1KU2A 4G7OF 3AG1C 3UGOA 2Y3HA 2Y39A 4IRUA 3UNGC 4GYTA 2J9VA 4YN0B 4U5BE 3ZIBA 2A6EF 2IXNA 5E2QA 2MYSA 2Q3TA 5E3AA 2EINC 3LJBA 3UR3C 2VASA 1PD0A 3LAYA 1V55C 2OG2A 4CS9C 4JURI 4MQ9F 2HV7A 1NU9C 2NUTA 4C7OB 3ABMC 4I44A 4I3MA 3NYMA 2R7QA 1ST6A 5CI9A 1NU7D 3AG2C 3LNRA 3KL4A 3DD7A 4OD5A 1D1BA 1MMGA 4AK9A 2C04A 3F47A 3I5PA 2BE5F 4CS9A 4IJJA 3EFOA 2IXOA 3IEEA 2V3CC 1ZHXA 3Q7GA 3NKEA 2Q9BA 2J9WA 3N2ZB 3SYNA 4AE4A 2WVOA 3EZIA 1TR2A 3B0UX 4E7ZA 3UMKA 3FAJA 5D92A 2V26A 3DJUB 3WG7C 2B0JA 1VYIA 5F5FA 1JPJA 2EIMC 3OA1A 3WODF 3ABLC 4HFFB 1D0YA 1D1AA 3K1HA 5DS4A 4OIPF 2DYSC 1LKXA 4BJ5C 2G62A 2ZXPA 2P7VA 4YT4A 4PJNA 4QI0A 5DS5A 2Q9CA 2C03A 4Q4ZF 2A1DD 4J32B 3B0PA 4U5CE 5KYUB 3EH2A 3SNHA 3EHNA 3S0XA 1PD1A 3EPVA 3DMDA 4I1MA 4BJ5A 4PJMA 5KYNA 1O5HA 1RJ9B 4ZLDA 1RJ9A 4O6YA 3LLIA 4YJWA 2WVNA 2J7PD 4C3EA 3POVA 2IYLD 5DQZA 2J7PA 3AG4C 2PP4A 3AQCA 3L0IA 3RFYA 3FDQA 1FTSA 3JRTA 5KYYB 4RBNA 3EGDA 4HFKB 3K1IC 4F4BA 2Q9AA 3UMIA 5KYYA 5E3CA 3NDBB 3KKBA 3QMKA 4HEAJ 5L3QA 2PX0A 2R7UA 4HE8D 3KMIA 1FMWA 3I5QA 4YT2A 4KI2A 3DJNB 3S27A 5D91A 1M2OA 1OCRC 2VH3A 2Y69C 2KJGA 2NUPA 5CI8A 5DVWA 4J30B 4MNDA 4DVYP 3N0TA 1M56C 4QDLA 1O87A 2A6HF 3X2QC 3ZVRA 3VYWA 1N1CA 2PF4E 2QY9A 3ASOC 1D1CA 3DXJF 4P6IC 2H7VC 2CDQA 2IXMA 1SMYF 4DBQA 1Z6AA 4OIOF 4JZAA 2X51A 4E7SA 2J45A 1D0XA 2WZGA 2H7BA 3ITFA 3B0VC 3E9VA 4JVSA 2JD3A 2J46A 3X1OA 1FMVA 4C7OA 3NYJA 1SF8A 3T6BA 3V7OA 2L9JA 4BG0A 2J0XA 5B3SC 1M2VB 4U5DE 4YT8A 5IY5C 1Z63A 1ZHTA 4CIHA 4O6MA 5KYXB 2J0WA 4I1OB 2R7WA 3QZCA 4XLNF 2WB7A 3Q6MA 4OIRF 4DBRA 3KH2A 4Q5SF 4B6IA 3DAFA 1TWAA 3DM5A 3H65A 4U5HA 3I4UA 3W2WA 3RIPA 1Z5ZA 3HTKC 4O7GA 3JCUQ 4BJTA 3NYLA 2FFHA 4FESA 2QTVA 1ZHYA 3AQBA 5BUOA 1OKKD 2Y3DA 1OKKA 1BR2A 1FFHA 1FFTC 2NG1A 3W8HA 1J8YF 2O9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7Z A; 
#chains in the Genus database with same CATH topology
 3HLZ A;  4EBB A;  2QNL A;  2CNW D;  1TWH A;  1QSP A;  2CNW A;  1HY5 A;  2EIK C;  2AP3 A;  2IM8 A;  1Q0D A;  3EGX B;  3NG1 A;  3M15 A;  4P9T A;  4BPM A;  2YLI A;  4JTA B;  1BBH A;  2XRH A;  2Z15 A;  2YVK A;  1HMO A;  4E0I A;  5EHH A;  3C63 A;  3HJC A;  2W4M A;  4N6C A;  3ATP A;  5DLJ A;  5KYW B;  3W8I A;  1VLT A;  2DB4 A;  5F5H A;  4EHP A;  4G7Z F;  1GM5 A;  2YQY A;  2R7T A;  2Q4F A;  2L81 A;  1Y6D A;  1TKN A;  2R7V A;  3HNL A;  5KYU A;  4DRH B;  4OIQ F;  4M63 A;  4XWJ A;  2ZPA A;  4EKW A;  2KGO A;  3S9O A;  3EH1 A;  3SEO A;  2AWY A;  4A4A A;  2CCY A;  2UUH A;  2CW0 F;  4Z9J A;  4NTF A;  3C62 A;  3HNJ A;  1ZYR F;  3NKD A;  3U8P A;  4L6R A;  3UGO A;  4CBE A;  1ZZP A;  2PFD A;  3JZ0 A;  4DXW A;  5JLI A;  4KBL A;  1A41 A;  3FVY A;  1PCX A;  4UDV A;  3RVY A;  3ZWI A;  1OXK A;  3FHD A;  2IXP A;  3E70 C;  4JKV A;  2XLM A;  2YRF A;  4GEH A;  4JJG A;  2PBE A;  3DAG A;  4A2N B;  1H9T A;  3LS1 A;  1MMN A;  2KQ9 A;  4C3D A;  4PJJ A;  2HMQ A;  2DI3 A;  1Y4C A;  2R02 A;  3JT1 A;  4CDY A;  1LVK A;  3O39 A;  1MNE A;  3RVZ A;  3JYY A;  5B1A C;  5DS6 A;  5FCL A;  1SR2 A;  1BZ4 A;  4XEK A;  3MFN A;  1T01 A;  2YLD A;  1G4W R;  4W8K A;  2H7O A;  1UFB A;  4PJL A;  4G7H F;  1JOG A;  2HS5 A;  2VC9 A;  2XLW A;  4PAC A;  1WOL A;  1VK5 A;  4NC3 A;  1QLE C;  4CS7 A;  1CPR A;  2EPK X;  3ABK C;  3H2U A;  2L6H A;  3T6J A;  3T4R A;  1TQG A;  1WN0 A;  3B9Q A;  3L8I A;  4KNV A;  4MS2 A;  3AGT A;  3OEO A;  1BR1 A;  5T3T A;  2MWQ A;  3AG3 C;  3TD7 A;  1TWC A;  5COG A;  2QUP A;  1ZHW A;  4Z9H A;  3R2P A;  4LER A;  3LUT B;  3RW0 A;  1L3P A;  4BJ6 C;  3NRH A;  3DI5 A;  3LES A;  2A0U A;  4JTD B;  3DWW A;  3F46 A;  4ONS A;  5JRA A;  1DOW A;  3FAP B;  4LDQ A;  3ZC4 A;  1LS1 A;  4LAC B;  1QKR A;  4CSA C;  4JJF A;  2XSE A;  3Q7L A;  3V5Y A;  1A7V A;  4N4W A;  4K7B A;  4D4X A;  1BDJ B;  1ORS C;  1V74 B;  1NFO A;  2YEV A;  1OCO C;  4JCZ A;  2LFF A;  2ZXW C;  3LNM B;  2XL4 A;  5TJ5 E;  2XXA B;  1RKE B;  3PMR A;  4U9D A;  1LI7 A;  1LIH A;  4GQH A;  4BJ6 A;  5JVE A;  1FNT c;  2XXA A;  3RQE A;  5L0G A;  1LE2 A;  4LDK A;  1OW8 A;  1L7C A;  2YL7 A;  3C18 A;  1M57 C;  4PR9 A;  3FMS A;  5B1B C;  2LD6 A;  3WHN A;  5JT4 A;  4CSA A;  4MTF A;  1CPQ A;  3KYJ A;  1IZM A;  1YA9 A;  3HNK A;  4X0R A;  4CJO A;  3JYH A;  256B A;  2J9U A;  3CQZ A;  3GM2 A;  1RXQ A;  3K66 A;  1YZA A;  2EIL C;  2OEV A;  1VOM A;  1GS9 A;  4OD4 A;  4LLC A;  4D4N A;  3UMH A;  3ZSU A;  4PK4 A;  4AL1 A;  3Q6N A;  4DVZ A;  3JSZ A;  2EPM X;  1Z23 A;  4JW1 A;  1NZE A;  1Q0M A;  1VTM P;  4NTA A;  2DGJ A;  1ZU5 A;  1Q0K A;  4XPX A;  3FOO A;  2XLO A;  1M2V A;  3O6X A;  3AGU A;  2WL8 A;  1J8M F;  3L34 A;  4JC7 A;  4LDR A;  3K6B A;  4JRZ A;  5JSL A;  4IWB A;  4FX5 A;  2NUT B;  2LSE A;  5CIV A;  3MLG A;  3IQC A;  4ER9 A;  5L0H A;  5KYX A;  2BC5 A;  2PNO A;  1GGQ A;  4DJ9 A;  1D0Z A;  3GEE A;  3LLK A;  4O79 A;  4YL3 A;  4XTK A;  2VCC A;  3OWT A;  2XM4 A;  1V54 C;  2IOQ A;  3RH3 A;  1OCC C;  4O6N A;  5GPG B;  4DOZ A;  1LI5 A;  2F22 A;  2RD9 A;  3RYL A;  2XLE A;  3GM1 A;  2G3V A;  4BEM J;  1TWG A;  2J9B A;  1HW1 A;  2YHS A;  2MHR A;  4PFP A;  5BQG A;  4E17 A;  2NSF A;  3EFO B;  4YT5 A;  2W9Y A;  3LEV A;  4ANJ A;  2R7O A;  2ZXR A;  4LLE A;  1K04 A;  3MX3 A;  2A68 F;  4U5G A;  2R7R A;  2P6V A;  2D5R B;  4MTG A;  2W45 A;  4RDA A;  4NY3 A;  4WJ0 A;  5JUA A;  3NMI A;  1NG1 A;  4U5F E;  4KNW A;  1H7I A;  4CDA A;  2G3K A;  3PHF 2;  3LS0 A;  3T9O A;  4AE4 B;  1WGW A;  3S29 A;  5BQI A;  1Q0G A;  4JCH A;  3JSE O;  3ZG1 A;  1VLS A;  1G8X A;  1OCZ C;  5L0J A;  1ZW2 A;  2VCA A;  4XEV A;  5AGF A;  4H4K C;  2OU6 A;  3N24 A;  1Q0F A;  1EI7 A;  4Q7C A;  3TJ6 A;  5JS5 A;  1MMD A;  3EGX A;  4G0H A;  5L3V A;  4FWV A;  2WVQ A;  5K0I A;  1OR2 A;  1QZX A;  1HMD A;  2LCH A;  3J06 A;  2OJQ A;  2GAQ A;  5KYW A;  4IB4 A;  2ZD9 A;  4U5E E;  2HV6 A;  2YWA A;  1B68 A;  3GOD A;  4J7Y A;  3S90 A;  1OR3 A;  2ETS A;  4AX2 A;  5HV9 A;  1XZQ A;  2R7X A;  2HUJ A;  3O55 A;  4PFO A;  5DQT A;  2PX3 A;  4QI2 A;  3U0C A;  3DM9 B;  2HZ8 A;  3ECS A;  3GAN A;  3B29 A;  3EZH A;  3K33 A;  4MVS A;  4JTC B;  2OCC C;  1YAU O;  3FOP A;  3V5Z A;  5AC5 A;  2Y3G A;  3MYI A;  1G4U S;  4WGZ A;  1CGM E;  3CZ6 A;  3L1M A;  2E87 A;  3IQT A;  4OIN F;  3U9J A;  3US6 A;  3U5S A;  3NMK A;  5E33 A;  5A6B D;  3EJN A;  2WZF A;  3SZR A;  5A6B A;  2AWC A;  5COF A;  2GFH A;  5BQH A;  4K0D A;  2VCB A;  3SXK A;  3M79 A;  2R25 A;  2Y3B A;  1VYK A;  2ICW G;  2YZS A;  4CS8 C;  5T1D B;  3A11 A;  5HSW A;  2GDC A;  2W4B A;  4CX9 A;  4IAO A;  1U0B B;  3DZA A;  2I8B A;  2EIJ C;  3C8G B;  1RKC A;  2DYR C;  3M1C B;  4WGY A;  1Z3I X;  3C8G D;  4XLP F;  5EK0 A;  2GWW A;  1KTM A;  3C8G A;  3ZTM A;  5B3I A;  2R7S A;  1JPN A;  3SP1 A;  2P0N A;  1QPU A;  2OJE D;  2NSG A;  4BEJ A;  1W2W A;  4KC9 A;  4Z9I A;  4C3B A;  4EUK B;  2VB6 A;  4DRJ B;  3CSK A;  3EG9 B;  5T3W A;  3R7C A;  3RF3 A;  3K7D A;  3EGD B;  1JMW A;  4N06 A;  4RD9 A;  2KW3 C;  1AEP A;  3EG9 A;  1IW7 F;  1A7D A;  4CS8 A;  1YZC A;  2OOC A;  1KNY A;  1VMA A;  2WZL A;  1ZHZ A;  2A69 F;  3EQL F;  1BR4 A;  2M4E A;  1SZI A;  3A9C A;  3KPH A;  4EWC A;  1MND A;  1PV3 A;  3NMJ A;  2YLG A;  2GA0 A;  2KSF A;  4FAP B;  2FGY A;  4ZLC A;  4BJ1 A;  2XLV A;  1LM3 B;  3TJ5 A;  5A69 A;  2HSQ A;  2NUP B;  3IHU A;  3JTL O;  1U89 A;  5EGY A;  3L8J A;  1OXB A;  1ZU4 A;  3WAQ A;  3TUL A;  1YA7 O;  1A0B A;  1HW2 A;  2LK4 A;  2RSE B;  3W2V A;  1RKE A;  2CGE A;  2ZXO A;  3S28 A;  3SXZ A;  5L0C A;  1S7Z A;  3RQF A;  1OW7 A;  2KNH A;  4YWQ A;  3ASN C;  1MMA A;  1V4A A;  2LFD A;  3VF0 A;  4ULW A;  3EHM A;  4J7T A;  1T6U A;  3H2V A;  1KU2 A;  4G7O F;  2ASR A;  3AG1 C;  2Y3H A;  3DE9 A;  2Y39 A;  1T6Q A;  3G4Z A;  4IRU A;  3C7J A;  3UNG C;  1EQ1 A;  4GYT A;  4YL1 A;  2J9V A;  2XS1 A;  4YN0 B;  4U5B E;  3ZIB A;  1OW6 A;  2A6E F;  1C03 A;  2HJ3 A;  4MVM A;  2IXN A;  3M4B A;  5E2Q A;  3VM6 A;  2XL8 A;  1HE9 A;  2MYS A;  2Q3T A;  1APC A;  1F1M A;  3AOU A;  2EIN C;  3LJB A;  5E3A A;  3U8V A;  1E83 A;  3MBG A;  1NBB A;  3UR3 C;  2VAS A;  1PD0 A;  3LAY A;  2R05 A;  3ZDL A;  1V55 C;  2OG2 A;  4W8P A;  4CS9 C;  4JUR I;  4MQ9 F;  4EIY A;  2HKV A;  1R5I D;  2HV7 A;  1E86 A;  1H6G A;  1NU9 C;  2NUT A;  4C7O B;  4DRI B;  1OQC A;  1U6H A;  2KC3 A;  3ABM C;  4I44 A;  3M4C A;  4I3M A;  3ZQY A;  2XLD A;  3B71 A;  3NYM A;  2R7Q A;  3RQG A;  4G78 A;  1ST6 A;  3GWL A;  5CI9 A;  1O3U A;  2P61 A;  1NU7 D;  3AG2 C;  2KYH A;  3KL4 A;  1YLM A;  3DD7 A;  3LNR A;  4OD5 A;  4AL0 A;  5L0F A;  1ORY A;  1D1B A;  3IQ6 A;  1MMG A;  3G50 A;  3VAY A;  1ZW3 A;  4AK9 A;  2OQM A;  2C04 A;  1DOV A;  3F47 A;  4MVQ A;  2XS8 A;  3I5P A;  2BE5 F;  4CS9 A;  1M6T A;  4IJJ A;  3U2M A;  3EFO A;  3IPM O;  1AUE A;  2IXO A;  3IEE A;  1HE1 A;  3HNI A;  1AVO B;  1ZHX A;  2V3C C;  3S84 A;  3Q7G A;  3NKE A;  5L0D A;  1XWJ A;  2L6F A;  3GOR A;  2Q9B A;  2J9W A;  4ULV A;  3N2Z B;  2D4U A;  3SYN A;  1NSG B;  1R4T A;  4AE4 A;  2WVO A;  3EZI A;  1TR2 A;  4IAQ A;  4JE9 A;  4E7Z A;  3B0U X;  3UMK A;  1WWP A;  2OKU A;  2V26 A;  3DJU B;  3FAJ A;  5D92 A;  3WG7 C;  2B0J A;  1VYI A;  1YVI A;  4JEA A;  5F5F A;  1JPJ A;  2J8W A;  2CYD A;  3QVY A;  2KK1 A;  4IAR A;  2EIM C;  3OA1 A;  3WOD F;  3ABL C;  1LE4 A;  5F28 E;  1YJG A;  4HFF B;  3W4Y A;  2XM0 A;  1D0Y A;  4MVO A;  1D1A A;  1GQA A;  3K1H A;  4E18 A;  1G5Z A;  5AC4 A;  5DS4 A;  4OIP F;  4MVR A;  2DYS C;  3GWN A;  1LKX A;  3AJM A;  2M64 A;  4BJ5 C;  1NFN A;  3BRJ A;  2G62 A;  1E2X A;  2ZXP A;  3CAX A;  2P7V A;  1YAR O;  2YL3 A;  4YT4 A;  1I5N A;  1UG7 A;  4PJN A;  4QI0 A;  2XLH A;  5DS5 A;  1C17 M;  2Q9C A;  2C03 A;  2EPL X;  3IQ5 A;  4R32 A;  2A1D D;  4Q4Z F;  3ZTZ A;  3CEX A;  5A6J A;  1XZP A;  4J32 B;  3B0P A;  4U5C E;  5KYU B;  3EH2 A;  3SNH A;  3EHN A;  3S0X A;  1PD1 A;  3EPV A;  2H8A A;  3QW1 A;  3DMD A;  3RKO F;  3U3F A;  4I1M A;  4BJ5 A;  5A6A A;  4PJM A;  4CIP A;  5KYN A;  1O5H A;  1RJ9 B;  4ZLD A;  1LS4 A;  1H9G A;  3U2L A;  3VRC A;  1K05 A;  1RJ9 A;  4XEF A;  1JRA A;  4O6Y A;  3LLI A;  1T5O A;  4XPY A;  4YJW A;  1I4Y A;  2AU5 A;  2WVN A;  2J7P D;  2YL0 A;  2P1A A;  2X0C A;  2IYL D;  5DQZ A;  2J7P A;  4C3E A;  4MVU A;  2BL2 A;  3AG4 C;  3POV A;  2PP4 A;  3V5X A;  4MVZ A;  1JAF A;  4E0H A;  3AQC A;  3L0I A;  3RFY A;  3FDQ A;  1FTS A;  3JRT A;  5KYY B;  4RBN A;  3EGD A;  4HFK B;  3K1I C;  4F4B A;  2JX0 A;  2Q9A A;  3BEH A;  3UMI A;  3QTH A;  5KYY A;  5E3C A;  2TMV P;  3NDB B;  2B0H A;  3KKB A;  3QMK A;  4XQ1 A;  4HEA J;  5FZT A;  1QVX A;  2PX0 A;  5L3Q A;  3SXM A;  2R7U A;  4NQF A;  4HE8 D;  3KMI A;  5COM A;  1FMW A;  3I5Q A;  2EPN A;  1CGN A;  4YT2 A;  3DJN B;  4KI2 A;  2QLA A;  3S27 A;  2R9R B;  5D91 A;  2HSB A;  1VB5 A;  1M2O A;  2L6G A;  1OCR C;  2VH3 A;  2Y69 C;  2R03 A;  4N6H A;  4YK5 A;  5JP7 A;  3KYI A;  4WAB A;  1SYQ A;  3O10 A;  4CDV A;  4EBJ A;  1FR0 A;  3TOM A;  2XL6 A;  2KJG A;  2NUP A;  3K1I A;  5CI8 A;  3U9M A;  5DVW A;  4J30 B;  2UUI A;  4MND A;  4DVY P;  3N0T A;  1EKY A;  1WAT A;  1M56 C;  4QDL A;  1O87 A;  2A6H F;  3X2Q C;  1S05 A;  3ZVR A;  2LQG A;  3TQO A;  3VYW A;  2EPO A;  2HMZ A;  4H54 A;  1N1C A;  2L7A A;  1NLX A;  4MW3 A;  3TOL A;  5A6K A;  1TFK B;  1YDI A;  2PF4 E;  3C8Z A;  3PCV A;  1E85 A;  2QY9 A;  3ASO C;  1D1C A;  2IBF A;  4XPW A;  2LIG A;  3DXJ F;  4P6I C;  2H7V C;  1YYJ A;  2CDQ A;  2IXM A;  1EA8 A;  2I15 A;  1SMY F;  1T9K A;  4DBQ A;  1Z7Q c;  1Z6A A;  2YKZ A;  4OIO F;  4JZA A;  2X51 A;  2NPU A;  3HKK A;  3GEI A;  4E7S A;  2J45 A;  1D0X A;  2JPU A;  2H7B A;  2WZG A;  1I4Z A;  3G4X A;  3ITF A;  3B0V C;  2Q00 A;  3UGP A;  2HJM A;  2OEX A;  3E9V A;  4JVS A;  1WTY A;  1TFO B;  2JD3 A;  2YL1 A;  1ZVZ A;  3U3B A;  2AVK A;  4P9F A;  2J46 A;  4MW8 A;  4YL0 A;  3X1O A;  1FMV A;  4C7O A;  1QQ3 A;  1T6I A;  3NYJ A;  3QW0 A;  1SF8 A;  3MYF A;  4NTB A;  3T6B A;  3V7O A;  2L9J A;  1RMV A;  3ZQV A;  4IGG A;  3SXY A;  4JIO A;  4BG0 A;  2QE9 A;  2J0X A;  5B3S C;  1M2V B;  4U5D E;  4YT8 A;  5IY5 C;  1Z63 A;  3GEH A;  1ZHT A;  4CIH A;  1E84 A;  4O6M A;  3TK0 A;  5KYX B;  2J0W A;  1FAP B;  4I1O B;  1MQV A;  2R7W A;  3QZC A;  4JEB A;  4XLN F;  2WB7 A;  3Q6M A;  4OIR F;  4DBR A;  3KH2 A;  4NCQ A;  4Q5S F;  1A7E A;  4B6I A;  3DAF A;  1TWA A;  3JRM O;  3DM5 A;  1C02 A;  4EBK A;  2HFI A;  3H65 A;  4U5H A;  3I4U A;  3W2W A;  3W8H A;  3RIP A;  1Z5Z A;  1YYX A;  2FAP B;  3T6G B;  2LP4 A;  1K40 A;  3HTK C;  5L0I A;  4O7G A;  3JCU Q;  2Q7R A;  4BJT A;  3QVZ A;  3NYL A;  1RCP A;  2FFH A;  3FXH A;  4FES A;  4U9E A;  1CGO A;  2QTV A;  1ZHY A;  3AQB A;  3DE8 A;  4CJG A;  2A0B A;  5BUO A;  3PDM P;  1OKK D;  2Y3D A;  3GM3 A;  1LPE A;  4MTO A;  1OKK A;  1WAS A;  1BR2 A;  1FFH A;  1JR8 A;  1FFT C;  4K1O A;  1ORJ A;  2NG1 A;  3DKA A;  3LEO A;  1J8Y F;  2O9X A; 
#chains in the Genus database with same CATH homology
 3HLZ A;  4EBB A;  2CNW D;  1TWH A;  2CNW A;  3NG1 A;  2EIK C;  3EGX B;  4EWC A;  5EHH A;  2XRH A;  2Z15 A;  3HJC A;  2W4M A;  5DLJ A;  5KYW B;  3W8I A;  5F5H A;  4G7Z F;  2R7T A;  2L81 A;  2R7V A;  1TKN A;  5KYU A;  4OIQ F;  4M63 A;  4XWJ A;  2ZPA A;  2KGO A;  3SEO A;  3EH1 A;  2CW0 F;  1ZYR F;  3NKD A;  4CBE A;  2PFD A;  4KBL A;  3FVY A;  1PCX A;  3FHD A;  2IXP A;  3E70 C;  4GEH A;  4JJG A;  3DAG A;  4A2N B;  3LS1 A;  1MMN A;  2KQ9 A;  4C3D A;  4PJJ A;  3JT1 A;  1LVK A;  3O39 A;  1MNE A;  5B1A C;  5DS6 A;  5FCL A;  4W8K A;  2H7O A;  4PJL A;  4G7H F;  1VK5 A;  1QLE C;  4CS7 A;  3ABK C;  3T6J A;  3T4R A;  3B9Q A;  4KNV A;  5T3T A;  3OEO A;  1BR1 A;  2MWQ A;  3AG3 C;  3TD7 A;  1TWC A;  1ZHW A;  4LER A;  4BJ6 C;  3NRH A;  3LES A;  3F46 A;  3ZC4 A;  1LS1 A;  4LAC B;  4CSA C;  4JJF A;  2XSE A;  3Q7L A;  4K7B A;  2YEV A;  1OCO C;  2ZXW C;  2XL4 A;  2XXA B;  3PMR A;  4BJ6 A;  2XXA A;  5B1B C;  1M57 C;  4CSA A;  1IZM A;  4X0R A;  3JYH A;  2J9U A;  3CQZ A;  3K66 A;  4OD4 A;  2EIL C;  1VOM A;  4LLC A;  3UMH A;  3ZSU A;  4PK4 A;  3Q6N A;  4DVZ A;  3JSZ A;  1Z23 A;  4JW1 A;  1NZE A;  2DGJ A;  1ZU5 A;  3RKO F;  1M2V A;  3O6X A;  2WL8 A;  1J8M F;  3L34 A;  3VAY A;  3K6B A;  4IWB A;  4FX5 A;  2NUT B;  2LSE A;  5KYX A;  3MLG A;  1D0Z A;  3LLK A;  4O79 A;  4XTK A;  3OWT A;  1V54 C;  2IOQ A;  3RH3 A;  1OCC C;  4O6N A;  4DOZ A;  3RYL A;  2G3V A;  1TWG A;  4PFP A;  2YHS A;  3EFO B;  4YT5 A;  2W9Y A;  3LEV A;  4ANJ A;  2R7O A;  2ZXR A;  4LLE A;  4U5G A;  3MX3 A;  2A68 F;  2R7R A;  2P6V A;  2D5R B;  2W45 A;  4RDA A;  4NY3 A;  4WJ0 A;  1NG1 A;  4U5F E;  4KNW A;  3PHF 2;  2G3K A;  3LS0 A;  4AE4 B;  1WGW A;  3S29 A;  4JCH A;  3ZG1 A;  1G8X A;  1OCZ C;  4H4K C;  3N24 A;  4Q7C A;  1MMD A;  3EGX A;  4G0H A;  5L3V A;  4FWV A;  2WVQ A;  1QZX A;  5KYW A;  4U5E E;  2HV6 A;  3GOD A;  4AX2 A;  2R7X A;  4PFO A;  5DQT A;  2PX3 A;  4QI2 A;  3DM9 B;  3ECS A;  3GAN A;  3K33 A;  3EZH A;  2OCC C;  2Y3G A;  3CZ6 A;  2E87 A;  4OIN F;  5E33 A;  3EJN A;  2WZF A;  3SZR A;  2GFH A;  4K0D A;  3UGP A;  2Y3B A;  1VYK A;  2YZS A;  4CS8 C;  5T1D B;  5HSW A;  2W4B A;  4IAO A;  3DZA A;  2I8B A;  2EIJ C;  3M1C B;  2DYR C;  1Z3I X;  4XLP F;  2R7S A;  1JPN A;  3SP1 A;  4BEJ A;  1W2W A;  4KC9 A;  4C3B A;  2VB6 A;  3CSK A;  3EG9 B;  5T3W A;  3K7D A;  3EGD B;  4N06 A;  4RD9 A;  4CS8 A;  2KW3 C;  3EG9 A;  1IW7 F;  1VMA A;  2WZL A;  1ZHZ A;  2A69 F;  3EQL F;  1BR4 A;  2M4E A;  1SZI A;  1MND A;  2FGY A;  4ZLC A;  4BJ1 A;  2NUP B;  5EGY A;  1ZU4 A;  3W2V A;  2ZXO A;  2CGE A;  3S28 A;  1S7Z A;  2KNH A;  4YWQ A;  3ASN C;  1MMA A;  4ULW A;  3EHM A;  1KU2 A;  4G7O F;  3AG1 C;  3UGO A;  2Y3H A;  2Y39 A;  4IRU A;  3UNG C;  4GYT A;  2J9V A;  4YN0 B;  4U5B E;  3ZIB A;  2A6E F;  2IXN A;  5E2Q A;  2MYS A;  2Q3T A;  5E3A A;  2EIN C;  3LJB A;  3UR3 C;  2VAS A;  1PD0 A;  3LAY A;  1V55 C;  2OG2 A;  4CS9 C;  4JUR I;  4MQ9 F;  2HV7 A;  1NU9 C;  2NUT A;  4C7O B;  3ABM C;  4I44 A;  4I3M A;  3NYM A;  2R7Q A;  1ST6 A;  5CI9 A;  1NU7 D;  3AG2 C;  3LNR A;  3KL4 A;  3DD7 A;  4OD5 A;  1D1B A;  1MMG A;  4AK9 A;  2C04 A;  3F47 A;  3I5P A;  2BE5 F;  4CS9 A;  4IJJ A;  3EFO A;  2IXO A;  3IEE A;  2V3C C;  1ZHX A;  3Q7G A;  3NKE A;  2Q9B A;  2J9W A;  3N2Z B;  3SYN A;  4AE4 A;  2WVO A;  3EZI A;  1TR2 A;  3B0U X;  4E7Z A;  3UMK A;  3FAJ A;  5D92 A;  2V26 A;  3DJU B;  3WG7 C;  2B0J A;  1VYI A;  5F5F A;  1JPJ A;  2EIM C;  3OA1 A;  3WOD F;  3ABL C;  4HFF B;  1D0Y A;  1D1A A;  3K1H A;  5DS4 A;  4OIP F;  2DYS C;  1LKX A;  4BJ5 C;  2G62 A;  2ZXP A;  2P7V A;  4YT4 A;  4PJN A;  4QI0 A;  5DS5 A;  2Q9C A;  2C03 A;  4Q4Z F;  2A1D D;  4J32 B;  3B0P A;  4U5C E;  5KYU B;  3EH2 A;  3SNH A;  3EHN A;  3S0X A;  1PD1 A;  3EPV A;  3DMD A;  4I1M A;  4BJ5 A;  4PJM A;  5KYN A;  1O5H A;  1RJ9 B;  4ZLD A;  1RJ9 A;  4O6Y A;  3LLI A;  4YJW A;  2WVN A;  2J7P D;  4C3E A;  3POV A;  2IYL D;  5DQZ A;  2J7P A;  3AG4 C;  2PP4 A;  3AQC A;  3L0I A;  3RFY A;  3FDQ A;  1FTS A;  3JRT A;  5KYY B;  4RBN A;  3EGD A;  4HFK B;  3K1I C;  4F4B A;  2Q9A A;  3UMI A;  5KYY A;  5E3C A;  3NDB B;  3KKB A;  3QMK A;  4HEA J;  5L3Q A;  2PX0 A;  2R7U A;  4HE8 D;  3KMI A;  1FMW A;  3I5Q A;  4YT2 A;  4KI2 A;  3DJN B;  3S27 A;  5D91 A;  1M2O A;  1OCR C;  2VH3 A;  2Y69 C;  2KJG A;  2NUP A;  5CI8 A;  5DVW A;  4J30 B;  4MND A;  4DVY P;  3N0T A;  1M56 C;  4QDL A;  1O87 A;  2A6H F;  3X2Q C;  3ZVR A;  3VYW A;  1N1C A;  2PF4 E;  2QY9 A;  3ASO C;  1D1C A;  3DXJ F;  4P6I C;  2H7V C;  2CDQ A;  2IXM A;  1SMY F;  4DBQ A;  1Z6A A;  4OIO F;  4JZA A;  2X51 A;  4E7S A;  2J45 A;  1D0X A;  2WZG A;  2H7B A;  3ITF A;  3B0V C;  3E9V A;  4JVS A;  2JD3 A;  2J46 A;  3X1O A;  1FMV A;  4C7O A;  3NYJ A;  1SF8 A;  3T6B A;  3V7O A;  2L9J A;  4BG0 A;  2J0X A;  5B3S C;  1M2V B;  4U5D E;  4YT8 A;  5IY5 C;  1Z63 A;  1ZHT A;  4CIH A;  4O6M A;  5KYX B;  2J0W A;  4I1O B;  2R7W A;  3QZC A;  4XLN F;  2WB7 A;  3Q6M A;  4OIR F;  4DBR A;  3KH2 A;  4Q5S F;  4B6I A;  3DAF A;  1TWA A;  3DM5 A;  3H65 A;  4U5H A;  3I4U A;  3W2W A;  3RIP A;  1Z5Z A;  3HTK C;  4O7G A;  3JCU Q;  4BJT A;  3NYL A;  2FFH A;  4FES A;  2QTV A;  1ZHY A;  3AQB A;  5BUO A;  1OKK D;  2Y3D A;  1OKK A;  1BR2 A;  1FFH A;  1FFT C;  2NG1 A;  3W8H A;  1J8Y F;  2O9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...