1S7ZA

Structure of ocr from bacteriophage t7
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
MTYNNVFDHAYEMLKENIRYDDIRDTDDLHDAIHMAADNAVPHYYADIFSVMASEGIDLEFEDSGLMPDTKDVIRILQARIYEQLTIDLWEDAEDLLNEYLEEVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Ocr from Bacteriophage T7, a Protein that Mimics B-Form DNA
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Gene regulation
molecule keywords Gene 0.3 protein
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08684 ocr DNA mimic ocr
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.780 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1s7zA01
1S7ZA
chains in the Genus database with same CATH superfamily
4P9FA 3U8PA 2F22A 3IPMO 1RXQA 1T01A 3LS0A 4PFOA 4O6NA 4YJWA 4AL1A 1M2OA 2A0UA 4C3DA 4LDKA 2J8WA 3NYMA 5BQGA 4PR9A 2YZSA 2OQMA 3PDMP 3ZIBA 2PF4E 4CIPA 2C03A 2V26A 2A6EF 1ZYRF 1S7ZA 1TKNA 4X0RA 1BR1A 2NUPA 4ZLCA 1OCRC 5BQHA 4ZLDA 1D0XA 3HNJA 1MMAA 4FX5A 3W8HA 2VCAA 1HMDA 3DWWA 5KYXA 1YYJA 4AE4A 4Q7CA 2R02A 1CGME 3U2MA 3R2PA 1C03A 5COFA 1G4US 4U5CE 2KNHA 2FAPB 4BJ5C 4JC7A 4ER9A 1M56C 4JTAB 1BDJB 5F28E 1VLTA 3S29A 3OA1A 3TQOA 3ZWIA 1VYKA 1ZU5A 2ZPAA 3T4RA 4BJTA 3DJNB 3GEEA 3FDQA 1SYQA 3LJBA 1V55C 2IXMA 4KC9A 2Q7RA 2P7VA 4O7GA 3EPVA 4K7BA 4H4KC 2I15A 1BR4A 3QW0A 4XPWA 4YL3A 5KYNA 1YZCA 2J9BA 2WVOA 3W8IA 3NKDA 1QZXA 3HNKA 1TWHA 1D1BA 3B0UX 2GFHA 1H7IA 4ULVA 1AEPA 2LD6A 2WZFA 3X1OA 4BEMJ 2LCHA 3OWTA 3LEVA 4Q5SF 2R7UA 4U5HA 4YL1A 3NRHA 3J06A 4OIOF 1FMVA 1BBHA 1H6GA 1VYIA 2XLEA 3NKEA 5KYYA 1B68A 1ZHZA 4CDAA 1MMNA 1NU9C 1UG7A 3CQZA 3JYYA 5B1BC 4OIRF 5A6BA 3GM2A 2JPUA 4BG0A 4BJ5A 2J9VA 1IZMA 5L0JA 1J8YF 1ZW2A 3GODA 1L3PA 4I3MA 1G5ZA 4NTAA 2VCBA 4I1MA 4YK5A 3K7DA 4WJ0A 4ANJA 3ASOC 3H2VA 2PP4A 4JEBA 1WN0A 3M1CB 3MYFA 4YT5A 2IBFA 3ASNC 2EILC 3EGDA 4OD5A 3RQGA 4DRHB 2H7VC 2R7OA 2ASRA 4G78A 1J8MF 1LIHA 4MVQA 1ST6A 3M4CA 1TQGA 4ONSA 4Z9IA 3T6JA 5DQZA 1YJGA 1QLEC 1E85A 5F5FA 1PV3A 3U9JA 4BJ6A 2R7QA 2XL4A 5COGA 2MWQA 4AK9A 4M63A 4PJNA 2UUIA 3LNRA 4NCQA 2TMVP 3SNHA 3ABKC 3M4BA 4E18A 1OR2A 2PFDA 3L8JA 1K04A 3I5QA 3UGOA 4DVZA 2LFFA 3NG1A 4YT8A 1A7DA 3TJ5A 4MTGA 1PCXA 4YT4A 1CPRA 1I4ZA 4HEAJ 4J7TA 1JAFA 3GM3A 3EG9B 1D1AA 5FZTA 2WVQA 4WABA 2GDCA 1SZIA 3EH1A 4MVOA 2QUPA 2CGEA 1RKEA 2IOQA 2LIGA 2OJQA 1MNDA 2XM4A 3C18A 1Q0MA 3EG9A 4R32A 4RBNA 3TOMA 4BJ1A 2A68F 2MYSA 1MMDA 1CGOA 1FFTC 3QTHA 3U3FA 5JS5A 1U0BB 3FVYA 2J46A 4D4NA 4DBRA 3POVA 1RMVA 3ZVRA 3Q6MA 2W4BA 3EQLF 3G4ZA 4A4AA 2HV6A 4F4BA 3IHUA 3T6BA 2ZXWC 2P0NA 4CJGA 3V5XA 1KTMA 1TWAA 1I5NA 3AG3C 3EFOB 1QQ3A 3FOOA 4BJ6C 2WL8A 1GM5A 1WATA 1WWPA 2Q4FA 4AE4B 3FHDA 4K0DA 1OXBA 2R9RB 4N4WA 1Y4CA 3S28A 4DOZA 2QTVA 4MVMA 5JP7A 1T6IA 1NLXA 3JTLO 5JT4A 3NMKA 1NSGB 1JPNA 2HUJA 4XEVA 3F47A 3ZSUA 1OKKA 3Q7GA 3U8VA 1AUEA 2OEVA 3NMIA 1BR2A 5DS4A 3RQEA 3GEHA 3R7CA 2FFHA 3LLIA 4E0IA 4WGZA 4O6MA 4YN0B 4NQFA 2XS8A 5BQIA 2CDQA 1U6HA 2YLIA 2KYHA 5IY5C 1OCCC 2Q9AA 1YZAA 3W2VA 4EKWA 2V3CC 5E3AA 4YWQA 3EZIA 3Q7LA 1KNYA 2NSGA 2HJMA 4KNWA 3I5PA 3TJ6A 1VOMA 4JTCB 4U5GA 2IXOA 3HNLA 4DXWA 2B0JA 2LQGA 3V5ZA 4OINF 5L0HA 4U5EE 1KU2A 1T6QA 2GA0A 2XSEA 3I4UA 3TOLA 1TR2A 5GPGB 3L0IA 3LEOA 4IJJA 4IWBA 5L0GA 4G7ZF 1JRAA 1YARO 3QZCA 4LLEA 1WOLA 2J7PA 2BL2A 3AQCA 5CI9A 1ZZPA 1NFOA 1A7EA 2L6FA 2M64A 3SXYA 2AVKA 3HTKC 4CBEA 1Z63A 3UMHA 3RVZA 1D0YA 1OCOC 2KGOA 2XRHA 3X2QC 5BUOA 2ZXRA 3PMRA 3ECSA 3F46A 5CI8A 4CDVA 3VM6A 4BPMA 1LPEA 4DJ9A 2J45A 5KYWB 2AWYA 1NG1A 2YWAA 2XM0A 2Y39A 1TWGA 4IAOA 3MYIA 2R03A 3DM9B 3EH2A 3JYHA 3N2ZB 2YLDA 3CEXA 4MTOA 1L7CA 3ATPA 3O10A 1C17M 1OXKA 4JEAA 4JJFA 1ORJA 4NTBA 3KYIA 5EHHA 3BEHA 3NDBB 1ORSC 3S90A 1FTSA 3C8GA 2DYRC 1UFBA 3AOUA 1VTMP 4J32B 3V7OA 3S0XA 2IYLD 1JMWA 1HE9A 2DB4A 2YEVA 3FAPB 3K66A 3EGXB 3LESA 3VYWA 1IW7F 1ZVZA 2HSBA 4E7SA 2P6VA 3LUTB 4XPXA 1GGQA 1QVXA 4E17A 2VB6A 3RFYA 3GM1A 3L34A 4YL0A 3JT1A 1F1MA 2ETSA 4XTKA 3KKBA 4Z9HA 4MVUA 2WZGA 4FAPB 2XXAB 3JRTA 3L1MA 3LNMB 1YLMA 2M4EA 1Q0GA 3HKKA 2HV7A 4LDRA 3T9OA 5JSLA 2CNWA 2OG2A 4HFKB 4P9TA 1DOWA 4LACB 2HS5A 3S9OA 3OEOA 4NC3A 1U89A 2KK1A 2GWWA 4CX9A 3M15A 4W8KA 2Z15A 4U5FE 2HJ3A 3IQCA 4JKVA 4C7OB 3UNGC 4KBLA 4P6IC 1VMAA 1I4YA 4HE8D 2RSEB 4JIOA 1YDIA 4B6IA 3AG2C 5K0IA 3RKOF 3UMKA 4EBBA 3U0CA 4G7HF 4G7OF 3ZTMA 2IXNA 4Z9JA 2EIJC 3EJNA 1LE2A 5JVEA 3N0TA 4JCZA 4IGGA 2P61A 3EFOA 2HMQA 2W4MA 3IEEA 3WHNA 4MVZA 1A41A 1M57C 2WZLA 3DKAA 1HW2A 2H7BA 4EIYA 1WGWA 3AG4C 4H54A 2Q00A 3V5YA 3GWLA 2H8AA 4EUKB 4U9DA 1E84A 4Q4ZF 2LK4A 4GQHA 4G0HA 4U5DE 3RH3A 1APCA 2Y69C 4DRIB 2HMZA 5COMA 3B71A 1H9GA 3DM5A 4D4XA 4EBKA 1DOVA 1O5HA 2NUPB 1T5OA 1XWJA 4IRUA 4JTDB 4XLNF 4N6HA 2EIMC 2R7XA 2DGJA 4MTFA 2R7TA 2QNLA 5EGYA 1PD0A 5A6BD 1SF8A 2J0WA 4C3BA 4JURI 1TWCA 2Q3TA 1A7VA 2JD3A 2XLOA 1OW7A 2CCYA 3M79A 4J7YA 5A6AA 1GQAA 1HY5A 1VK5A 2OU6A 1MNEA 2HFIA 1G4WR 3DAGA 4HFFB 2CNWD 1EKYA 3NYLA 4O79A 3PHF2 4NTFA 3QMKA 2VC9A 3ZQVA 4EHPA 4PJMA 3IQ6A 2L81A 1AVOB 1LKXA 1G8XA 2YLGA 3U2LA 4JVSA 2EPLX 3BRJA 1HMOA 4RDAA 2DI3A 3FXHA 5AC5A 5KYYB 3B9QA 1LS1A 3MFNA 4CIHA 3U5SA 1MQVA 4CS8C 4OIQF 3RW0A 1T9KA 2CYDA 1WASA 2PNOA 2YL3A 2WVNA 3ZTZA 1QKRA 3ITFA 4XPYA 256BA 3NMJA 4JZAA 2QLAA 2ZXPA 4K1OA 2EIKC 3C63A 1YVIA 3KPHA 1ZHXA 2YKZA 3EHMA 4MVSA 1Z6AA 4PJJA 5KYWA 1Z7Qc 1EQ1A 2VCCA 4XEFA 5A6JA 3NYJA 1YYXA 3QVZA 1Q0FA 4U9EA 1GS9A 5CIVA 3QW1A 4MW3A 4PFPA 5EK0A 2W45A 3FOPA 5DS5A 4MW8A 3EGXA 1FMWA 2HSQA 5DQTA 2XXAA 3DZAA 1FR0A 4XEKA 5HV9A 3HNIA 5KYUA 2KSFA 1Q0DA 2XS1A 2EPNA 3JCUQ 3PCVA 1RKEB 3B0VC 4PACA 2G3KA 2KQ9A 3O39A 2HKVA 4U5BE 1OCZC 4I44A 3W2WA 4GYTA 3ZG1A 1W2WA 4CS8A 4CJOA 1V74B 2EINC 3DXJF 2L6HA 3KMIA 2YVKA 4JRZA 3UR3C 1K05A 2NPUA 3O6XA 4MQ9F 3TULA 3H2UA 1XZQA 4AL0A 2LP4A 1RCPA 4O6YA 1CGNA 2OKUA 4LDQA 2PX3A 4QDLA 5D92A 3AG1C 2G3VA 3DI5A 4N06A 1Z23A 4IB4A 5B3SC 2Y3DA 3C62A 3H65A 1MMGA 4LLCA 5L0DA 3U3BA 5L0CA 3KYJA 3MBGA 3US6A 3CAXA 3SYNA 1M6TA 2L7AA 3LS1A 2NUTA 2R7VA 3G4XA 3MX3A 2MHRA 3B0PA 4ULWA 1HW1A 2XLHA 1NBBA 5JUAA 2Y3HA 3N24A 1SMYF 2NSFA 3MLGA 1OR3A 3DAFA 2UUHA 1E83A 2A69F 1RKCA 3EHNA 3ZC4A 1Y6DA 3E9VA 1E2XA 4JE9A 1LM3B 4KNVA 3AGUA 2A0BA 3KL4A 4XWJA 4QI0A 3B29A 2XLWA 1T6UA 2OJED 2FGYA 1OQCA 2NUTB 1ZHYA 2YL0A 2YL1A 1QSPA 3DMDA 4MNDA 1VLSA 2VH3A 3JSEO 4JJGA 3RF3A 5DLJA 5L3QA 1H9TA 3VRCA 2A6HF 3G50A 4GEHA 4EWCA 2AU5A 3TD7A 2KJGA 4I1OB 4CS9A 3S27A 4N6CA 4YT2A 2R25A 5E3CA 5A6KA 4KI2A 3AGTA 2CW0F 2XL6A 2Q9CA 4E7ZA 4CSAA 2X51A 4L6RA 2D4UA 2KW3C 1LVKA 3WODF 1YA9A 5T3WA 5B3IA 2ZD9A 2XLMA 3LAYA 3O55A 2ICWG 3GORA 1Q0KA 4BEJA 1SR2A 5KYXB 4NY3A 5L3VA 5HSWA 3DD7A 2R7SA 1EI7A 3SP1A 3GANA 1ZW3A 1R4TA 3K1HA 3KH2A 2BE5F 3DJUB 3RYLA 3WAQA 2X0CA 2VASA 3SXKA 2QY9A 2DYSC 3K33A 3ABMC 4PJLA 5L0FA 4FESA 3AJMA 4IARA 3FAJA 2OOCA 2BC5A 2IM8A 3FMSA 3WG7C 4MVRA 2IXPA 3UMIA 1LI7A 1N1CA 5DS6A 2YHSA 4JW1A 1CPQA 1D0ZA 3C8GD 2C04A 2P1AA 3VAYA 1FNTc 4FWVA 4XLPF 2XL8A 2PX0A 2NG1A 2YQYA 4DRJB 3JZ0A 1OKKD 3DE8A 3GWNA 3HJCA 1JPJA 1ZU4A 3LLKA 2OCCC 4XQ1A 1K40A 3Q6NA 2B0HA 4A2NB 4CS9C 4DVYP 2Y3BA 1E86A 1OW6A 1V54C 2O9XA 2Y3GA 1LS4A 5E2QA 4CDYA 1ZHWA 4CS7A 4EBJA 4CSAC 1NZEA 3E70C 4MS2A 2L6GA 4W8PA 3S84A 3EGDB 3SXMA 3UGPA 5F5HA 3CSKA 3K6BA 3RQFA 2W9YA 3IQ5A 1TFOB 1OW8A 2H7OA 4C3EA 1A0BA 2D5RB 1O87A 2LSEA 2OEXA 2AWCA 2QE9A 5JLIA 2WB7A 2EPKX 1FFHA 3C8ZA 3A11A 1YAUO 5AGFA 2R7RA 4OIPF 3JSZA 3EZHA 1VB5A 1JR8A 1Z5ZA 4PK4A 1V4AA 2JX0A 3ABLC 2PBEA 2XLVA 5KYUB 1FAPB 1O3UA 3K1IC 1S05A 3JRMO 5DVWA 1JOGA 1LI5A 2A1DD 5T1DB 3RIPA 3SXZA 5T3TA 3SEOA 2J7PD 3T6GB 1ORYA 3VF0A 1D1CA 1NU7D 3QVYA 4DBQA 1XZPA 5JRAA 4JCHA 5FCLA 1C02A 3C7JA 3CZ6A 4OD4A 3ZQYA 4E0HA 4UDVA 5D91A 3RVYA 5B1AC 3ZDLA 3C8GB 4AX2A 1BZ4A 1M2VB 2J9WA 4IAQA 2E87A 5L0IA 2J0XA 5A69A 1PD1A 4J30B 2J9UA 1ZHTA 3W4YA 5AC4A 1WTYA 2RD9A 2R7WA 5TJ5E 1QPUA 4LERA 3TK0A 2EPOA 2L9JA 1Z3IX 2EPMX 2G62A 2HZ8A 3L8IA 4C7OA 1RJ9A 1HE1A 4WGYA 1YA7O 1M2VA 1EA8A 1NFNA 1RJ9B 4RD9A 2I8BA 2GAQA 1TFKB 2KC3A 2R05A 2XLDA 2ZXOA 3DE9A 1LE4A 3AQBA 3GEIA 3IQTA 2LFDA 3HLZA 3K1IA 5E33A 2YRFA 2AP3A 3SZRA 4QI2A 3A9CA 3U9MA 2YL7A 1R5ID 2Q9BA
chains in the Genus database with same CATH topology
3LS0A 4YJWA 4PFOA 4O6NA 4C3DA 5DS6A 1M2OA 3NYMA 2YZSA 3ZIBA 2PF4E 2C03A 2V26A 2A6EF 1ZYRF 1S7ZA 1TKNA 4X0RA 1BR1A 2NUPA 4ZLCA 1OCRC 4ZLDA 1D0XA 1MMAA 4FX5A 3W8HA 5KYXA 4AE4A 4Q7CA 4U5CE 2KNHA 4BJ5C 1M56C 3S29A 3OA1A 1VYKA 1ZU5A 2ZPAA 3T4RA 4BJTA 3DJNB 3LJBA 1V55C 2IXMA 4KC9A 2P7VA 4O7GA 3EPVA 4K7BA 4H4KC 1BR4A 5KYNA 2WVOA 3W8IA 3NKDA 1QZXA 1TWHA 1D1BA 3B0UX 2GFHA 2WZFA 3X1OA 3OWTA 3LEVA 4Q5SF 2R7UA 4U5HA 3NRHA 1FMVA 3NKEA 1VYIA 5KYYA 1ZHZA 1NU9C 1MMNA 5B1BC 3CQZA 4OIRF 4BG0A 4BJ5A 2J9VA 1IZMA 1J8YF 3GODA 4I3MA 4ANJA 4I1MA 3K7DA 4WJ0A 3ASOC 2PP4A 3M1CB 4YT5A 3ASNC 3EGDA 2EILC 4OD5A 2H7VC 2R7OA 1J8MF 3T6JA 1ST6A 5DQZA 1QLEC 5F5FA 4BJ6A 2R7QA 2XL4A 2MWQA 4M63A 4PJNA 3LNRA 3SNHA 3ABKC 2PFDA 3UGOA 3I5QA 4DVZA 3NG1A 4YT8A 1PCXA 4YT4A 4HEAJ 3EG9B 1D1AA 2WVQA 1SZIA 3EH1A 2CGEA 2IOQA 4RBNA 1MNDA 4OIOF 3EG9A 4BJ1A 2A68F 2MYSA 1MMDA 1FFTC 3FVYA 2J46A 4DBRA 3POVA 3Q6MA 2W4BA 3EQLF 2HV6A 4F4BA 3T6BA 2ZXWC 1TWAA 3EFOB 3AG3C 4BJ6C 2WL8A 4AE4B 3FHDA 4K0DA 3S28A 4DOZA 2QTVA 1JPNA 4AK9A 3F47A 3ZSUA 1OKKA 3Q7GA 1BR2A 5DS4A 2FFHA 3LLIA 4O6MA 4YN0B 2CDQA 5IY5C 1OCCC 2Q9AA 3W2VA 2V3CC 5E3AA 4YWQA 3EZIA 3Q7LA 4KNWA 3I5PA 1VOMA 4U5GA 2IXOA 2B0JA 4OINF 4U5EE 1KU2A 2XSEA 3I4UA 1TR2A 4IWBA 3L0IA 4IJJA 4G7ZF 4LLEA 3QZCA 2J7PA 3AQCA 5CI9A 3HTKC 4CBEA 3UMHA 1D0YA 1OCOC 2KGOA 2XRHA 3X2QC 5BUOA 2ZXRA 3PMRA 3ECSA 3F46A 5CI8A 5KYWB 2J45A 1NG1A 4IAOA 2Y39A 1TWGA 3DM9B 3N2ZB 3EH2A 3JYHA 4JJFA 3NDBB 5EHHA 1FTSA 2DYRC 4J32B 3V7OA 3S0XA 2IYLD 3LESA 2YEVA 3K66A 3EGXB 3VYWA 1IW7F 4E7SA 2P6VA 2VB6A 3RFYA 3L34A 3JT1A 4XTKA 3KKBA 2WZGA 2XXAB 3JRTA 2M4EA 2HV7A 2CNWA 2OG2A 4HFKB 4LACB 3OEOA 4W8KA 2Z15A 4U5FE 4C7OB 3UNGC 4KBLA 4P6IC 1VMAA 4HE8D 4B6IA 3AG2C 3RKOF 3UMKA 4G7HF 4G7OF 2IXNA 2EIJC 3EJNA 3N0TA 3EFOA 2W4MA 3IEEA 1M57C 2WZLA 2H7BA 1WGWA 3AG4C 4G0HA 4U5DE 3RH3A 2Y69C 3DM5A 2NUPB 1O5HA 4IRUA 4XLNF 2R7XA 2EIMC 2DGJA 2R7TA 5EGYA 1PD0A 1SF8A 2J0WA 4C3BA 4JURI 1TWCA 2Q3TA 2JD3A 1VK5A 1MNEA 3DAGA 4HFFB 2CNWD 3NYLA 4O79A 3PHF2 3QMKA 4PJMA 2L81A 1LKXA 1G8XA 4JVSA 4RDAA 5KYYB 3B9QA 1LS1A 4CIHA 4CS8C 4OIQF 2WVNA 3ITFA 4JZAA 2ZXPA 2EIKC 4PJJA 1ZHXA 3EHMA 1Z6AA 5KYWA 3NYJA 4PFPA 2W45A 5DS5A 3EGXA 1FMWA 5DQTA 2XXAA 3DZAA 5KYUA 3JCUQ 3B0VC 2G3KA 2KQ9A 3O39A 4U5BE 1OCZC 4I44A 3W2WA 4GYTA 3ZG1A 1W2WA 4CS8A 2EINC 3DXJF 3KMIA 3UR3C 4MQ9F 3O6XA 4KI2A 4O6YA 5D92A 4EBBA 2PX3A 4QDLA 3AG1C 2G3VA 4N06A 5B3SC 1Z23A 2Y3DA 3H65A 4LLCA 1MMGA 3SYNA 3LS1A 2NUTA 2R7VA 3MX3A 3B0PA 4ULWA 2Y3HA 3N24A 1SMYF 3MLGA 3DAFA 2A69F 3EHNA 3ZC4A 3E9VA 4KNVA 3KL4A 4XWJA 4QI0A 3DMDA 2FGYA 2NUTB 1ZHYA 4MNDA 5DLJA 5L3QA 2VH3A 4JJGA 2A6HF 4GEHA 4EWCA 3TD7A 2KJGA 4I1OB 4CS9A 3S27A 4YT2A 5E3CA 4E7ZA 2CW0F 4CSAA 2Q9CA 2X51A 3WODF 2KW3C 1LVKA 5T3WA 3LAYA 4BEJA 5KYXB 4NY3A 5L3VA 5HSWA 3DD7A 2R7SA 3SP1A 3GANA 3KH2A 3K1HA 2BE5F 3DJUB 3RYLA 2VASA 2QY9A 2DYSC 3K33A 3ABMC 4PJLA 4FESA 3FAJA 3WG7C 2IXPA 3UMIA 1N1CA 2YHSA 4JW1A 1D0ZA 2C04A 3VAYA 4FWVA 4XLPF 2PX0A 2NG1A 1OKKD 3FDQA 3HJCA 1JPJA 1ZU4A 3LLKA 2OCCC 4A2NB 4DVYP 3Q6NA 4CS9C 2Y3BA 1V54C 2O9XA 2Y3GA 5E2QA 4CSAC 1ZHWA 4CS7A 1NZEA 3E70C 3UGPA 3EGDB 5F5HA 3CSKA 3K6BA 2W9YA 2H7OA 4C3EA 2D5RB 1O87A 2LSEA 2WB7A 1FFHA 2R7RA 4OIPF 3JSZA 3EZHA 1Z5ZA 4PK4A 3ABLC 5KYUB 3K1IC 5DVWA 2A1DD 5T1DB 3RIPA 5T3TA 2J7PD 1D1CA 1NU7D 4DBQA 4JCHA 5FCLA 3CZ6A 4OD4A 5D91A 5B1AC 4AX2A 1M2VB 2J9WA 2E87A 2J0XA 1PD1A 4J30B 2J9UA 1ZHTA 2R7WA 4LERA 2L9JA 1Z3IX 4C7OA 2G62A 1RJ9A 1M2VA 1RJ9B 4RD9A 2I8BA 3SEOA 1Z63A 4Q4ZF 2ZXOA 3AQBA 3ZVRA 4QI2A 3HLZA 5E33A 3SZRA 2Q9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7Z A; 
#chains in the Genus database with same CATH topology
 4P9F A;  3U8P A;  2F22 A;  3IPM O;  1RXQ A;  1T01 A;  3LS0 A;  4PFO A;  4O6N A;  4YJW A;  4AL1 A;  1M2O A;  2A0U A;  4C3D A;  4LDK A;  2J8W A;  3NYM A;  5BQG A;  4PR9 A;  2YZS A;  2OQM A;  3PDM P;  3ZIB A;  2PF4 E;  4CIP A;  2C03 A;  2V26 A;  2A6E F;  1ZYR F;  1S7Z A;  1TKN A;  4X0R A;  1BR1 A;  2NUP A;  4ZLC A;  1OCR C;  5BQH A;  4ZLD A;  1D0X A;  3HNJ A;  1MMA A;  4FX5 A;  3W8H A;  2VCA A;  1HMD A;  3DWW A;  5KYX A;  1YYJ A;  4AE4 A;  4Q7C A;  2R02 A;  1CGM E;  3U2M A;  3R2P A;  1C03 A;  5COF A;  1G4U S;  4U5C E;  2KNH A;  2FAP B;  4BJ5 C;  4JC7 A;  4ER9 A;  1M56 C;  4JTA B;  1BDJ B;  5F28 E;  1VLT A;  3S29 A;  3OA1 A;  3TQO A;  3ZWI A;  1VYK A;  1ZU5 A;  2ZPA A;  3T4R A;  4BJT A;  3DJN B;  3GEE A;  3FDQ A;  1SYQ A;  3LJB A;  1V55 C;  2IXM A;  4KC9 A;  2Q7R A;  2P7V A;  4O7G A;  3EPV A;  4K7B A;  4H4K C;  2I15 A;  1BR4 A;  3QW0 A;  4XPW A;  4YL3 A;  5KYN A;  1YZC A;  2J9B A;  2WVO A;  3W8I A;  3NKD A;  1QZX A;  3HNK A;  1TWH A;  1D1B A;  3B0U X;  2GFH A;  1H7I A;  4ULV A;  1AEP A;  2LD6 A;  2WZF A;  3X1O A;  4BEM J;  2LCH A;  3OWT A;  3LEV A;  4Q5S F;  2R7U A;  4U5H A;  4YL1 A;  3NRH A;  3J06 A;  4OIO F;  1FMV A;  1BBH A;  1H6G A;  1VYI A;  2XLE A;  3NKE A;  5KYY A;  1B68 A;  1ZHZ A;  4CDA A;  1MMN A;  1NU9 C;  1UG7 A;  3CQZ A;  3JYY A;  5B1B C;  4OIR F;  5A6B A;  3GM2 A;  2JPU A;  4BG0 A;  4BJ5 A;  2J9V A;  1IZM A;  5L0J A;  1J8Y F;  1ZW2 A;  3GOD A;  1L3P A;  4I3M A;  1G5Z A;  4NTA A;  2VCB A;  4I1M A;  4YK5 A;  3K7D A;  4WJ0 A;  4ANJ A;  3ASO C;  3H2V A;  2PP4 A;  4JEB A;  1WN0 A;  3M1C B;  3MYF A;  4YT5 A;  2IBF A;  3ASN C;  2EIL C;  3EGD A;  4OD5 A;  3RQG A;  4DRH B;  2H7V C;  2R7O A;  2ASR A;  4G78 A;  1J8M F;  1LIH A;  4MVQ A;  1ST6 A;  3M4C A;  1TQG A;  4ONS A;  4Z9I A;  3T6J A;  5DQZ A;  1YJG A;  1QLE C;  1E85 A;  5F5F A;  1PV3 A;  3U9J A;  4BJ6 A;  2R7Q A;  2XL4 A;  5COG A;  2MWQ A;  4AK9 A;  4M63 A;  4PJN A;  2UUI A;  3LNR A;  4NCQ A;  2TMV P;  3SNH A;  3ABK C;  3M4B A;  4E18 A;  1OR2 A;  2PFD A;  3L8J A;  1K04 A;  3I5Q A;  3UGO A;  4DVZ A;  2LFF A;  3NG1 A;  4YT8 A;  1A7D A;  3TJ5 A;  4MTG A;  1PCX A;  4YT4 A;  1CPR A;  1I4Z A;  4HEA J;  4J7T A;  1JAF A;  3GM3 A;  3EG9 B;  1D1A A;  5FZT A;  2WVQ A;  4WAB A;  2GDC A;  1SZI A;  3EH1 A;  4MVO A;  2QUP A;  2CGE A;  1RKE A;  2IOQ A;  2LIG A;  2OJQ A;  1MND A;  2XM4 A;  3C18 A;  1Q0M A;  3EG9 A;  4R32 A;  4RBN A;  3TOM A;  4BJ1 A;  2A68 F;  2MYS A;  1MMD A;  1CGO A;  1FFT C;  3QTH A;  3U3F A;  5JS5 A;  1U0B B;  3FVY A;  2J46 A;  4D4N A;  4DBR A;  3POV A;  1RMV A;  3ZVR A;  3Q6M A;  2W4B A;  3EQL F;  3G4Z A;  4A4A A;  2HV6 A;  4F4B A;  3IHU A;  3T6B A;  2ZXW C;  2P0N A;  4CJG A;  3V5X A;  1KTM A;  1TWA A;  1I5N A;  3AG3 C;  3EFO B;  1QQ3 A;  3FOO A;  4BJ6 C;  2WL8 A;  1GM5 A;  1WAT A;  1WWP A;  2Q4F A;  4AE4 B;  3FHD A;  4K0D A;  1OXB A;  2R9R B;  4N4W A;  1Y4C A;  3S28 A;  4DOZ A;  2QTV A;  4MVM A;  5JP7 A;  1T6I A;  1NLX A;  3JTL O;  5JT4 A;  3NMK A;  1NSG B;  1JPN A;  2HUJ A;  4XEV A;  3F47 A;  3ZSU A;  1OKK A;  3Q7G A;  3U8V A;  1AUE A;  2OEV A;  3NMI A;  1BR2 A;  5DS4 A;  3RQE A;  3GEH A;  3R7C A;  2FFH A;  3LLI A;  4E0I A;  4WGZ A;  4O6M A;  4YN0 B;  4NQF A;  2XS8 A;  5BQI A;  2CDQ A;  1U6H A;  2YLI A;  2KYH A;  5IY5 C;  1OCC C;  2Q9A A;  1YZA A;  3W2V A;  4EKW A;  2V3C C;  5E3A A;  4YWQ A;  3EZI A;  3Q7L A;  1KNY A;  2NSG A;  2HJM A;  4KNW A;  3I5P A;  3TJ6 A;  1VOM A;  4JTC B;  4U5G A;  2IXO A;  3HNL A;  4DXW A;  2B0J A;  2LQG A;  3V5Z A;  4OIN F;  5L0H A;  4U5E E;  1KU2 A;  1T6Q A;  2GA0 A;  2XSE A;  3I4U A;  3TOL A;  1TR2 A;  5GPG B;  3L0I A;  3LEO A;  4IJJ A;  4IWB A;  5L0G A;  4G7Z F;  1JRA A;  1YAR O;  3QZC A;  4LLE A;  1WOL A;  2J7P A;  2BL2 A;  3AQC A;  5CI9 A;  1ZZP A;  1NFO A;  1A7E A;  2L6F A;  2M64 A;  3SXY A;  2AVK A;  3HTK C;  4CBE A;  1Z63 A;  3UMH A;  3RVZ A;  1D0Y A;  1OCO C;  2KGO A;  2XRH A;  3X2Q C;  5BUO A;  2ZXR A;  3PMR A;  3ECS A;  3F46 A;  5CI8 A;  4CDV A;  3VM6 A;  4BPM A;  1LPE A;  4DJ9 A;  2J45 A;  5KYW B;  2AWY A;  1NG1 A;  2YWA A;  2XM0 A;  2Y39 A;  1TWG A;  4IAO A;  3MYI A;  2R03 A;  3DM9 B;  3EH2 A;  3JYH A;  3N2Z B;  2YLD A;  3CEX A;  4MTO A;  1L7C A;  3ATP A;  3O10 A;  1C17 M;  1OXK A;  4JEA A;  4JJF A;  1ORJ A;  4NTB A;  3KYI A;  5EHH A;  3BEH A;  3NDB B;  1ORS C;  3S90 A;  1FTS A;  3C8G A;  2DYR C;  1UFB A;  3AOU A;  1VTM P;  4J32 B;  3V7O A;  3S0X A;  2IYL D;  1JMW A;  1HE9 A;  2DB4 A;  2YEV A;  3FAP B;  3K66 A;  3EGX B;  3LES A;  3VYW A;  1IW7 F;  1ZVZ A;  2HSB A;  4E7S A;  2P6V A;  3LUT B;  4XPX A;  1GGQ A;  1QVX A;  4E17 A;  2VB6 A;  3RFY A;  3GM1 A;  3L34 A;  4YL0 A;  3JT1 A;  1F1M A;  2ETS A;  4XTK A;  3KKB A;  4Z9H A;  4MVU A;  2WZG A;  4FAP B;  2XXA B;  3JRT A;  3L1M A;  3LNM B;  1YLM A;  2M4E A;  1Q0G A;  3HKK A;  2HV7 A;  4LDR A;  3T9O A;  5JSL A;  2CNW A;  2OG2 A;  4HFK B;  4P9T A;  1DOW A;  4LAC B;  2HS5 A;  3S9O A;  3OEO A;  4NC3 A;  1U89 A;  2KK1 A;  2GWW A;  4CX9 A;  3M15 A;  4W8K A;  2Z15 A;  4U5F E;  2HJ3 A;  3IQC A;  4JKV A;  4C7O B;  3UNG C;  4KBL A;  4P6I C;  1VMA A;  1I4Y A;  4HE8 D;  2RSE B;  4JIO A;  1YDI A;  4B6I A;  3AG2 C;  5K0I A;  3RKO F;  3UMK A;  4EBB A;  3U0C A;  4G7H F;  4G7O F;  3ZTM A;  2IXN A;  4Z9J A;  2EIJ C;  3EJN A;  1LE2 A;  5JVE A;  3N0T A;  4JCZ A;  4IGG A;  2P61 A;  3EFO A;  2HMQ A;  2W4M A;  3IEE A;  3WHN A;  4MVZ A;  1A41 A;  1M57 C;  2WZL A;  3DKA A;  1HW2 A;  2H7B A;  4EIY A;  1WGW A;  3AG4 C;  4H54 A;  2Q00 A;  3V5Y A;  3GWL A;  2H8A A;  4EUK B;  4U9D A;  1E84 A;  4Q4Z F;  2LK4 A;  4GQH A;  4G0H A;  4U5D E;  3RH3 A;  1APC A;  2Y69 C;  4DRI B;  2HMZ A;  5COM A;  3B71 A;  1H9G A;  3DM5 A;  4D4X A;  4EBK A;  1DOV A;  1O5H A;  2NUP B;  1T5O A;  1XWJ A;  4IRU A;  4JTD B;  4XLN F;  4N6H A;  2EIM C;  2R7X A;  2DGJ A;  4MTF A;  2R7T A;  2QNL A;  5EGY A;  1PD0 A;  5A6B D;  1SF8 A;  2J0W A;  4C3B A;  4JUR I;  1TWC A;  2Q3T A;  1A7V A;  2JD3 A;  2XLO A;  1OW7 A;  2CCY A;  3M79 A;  4J7Y A;  5A6A A;  1GQA A;  1HY5 A;  1VK5 A;  2OU6 A;  1MNE A;  2HFI A;  1G4W R;  3DAG A;  4HFF B;  2CNW D;  1EKY A;  3NYL A;  4O79 A;  3PHF 2;  4NTF A;  3QMK A;  2VC9 A;  3ZQV A;  4EHP A;  4PJM A;  3IQ6 A;  2L81 A;  1AVO B;  1LKX A;  1G8X A;  2YLG A;  3U2L A;  4JVS A;  2EPL X;  3BRJ A;  1HMO A;  4RDA A;  2DI3 A;  3FXH A;  5AC5 A;  5KYY B;  3B9Q A;  1LS1 A;  3MFN A;  4CIH A;  3U5S A;  1MQV A;  4CS8 C;  4OIQ F;  3RW0 A;  1T9K A;  2CYD A;  1WAS A;  2PNO A;  2YL3 A;  2WVN A;  3ZTZ A;  1QKR A;  3ITF A;  4XPY A;  256B A;  3NMJ A;  4JZA A;  2QLA A;  2ZXP A;  4K1O A;  2EIK C;  3C63 A;  1YVI A;  3KPH A;  1ZHX A;  2YKZ A;  3EHM A;  4MVS A;  1Z6A A;  4PJJ A;  5KYW A;  1Z7Q c;  1EQ1 A;  2VCC A;  4XEF A;  5A6J A;  3NYJ A;  1YYX A;  3QVZ A;  1Q0F A;  4U9E A;  1GS9 A;  5CIV A;  3QW1 A;  4MW3 A;  4PFP A;  5EK0 A;  2W45 A;  3FOP A;  5DS5 A;  4MW8 A;  3EGX A;  1FMW A;  2HSQ A;  5DQT A;  2XXA A;  3DZA A;  1FR0 A;  4XEK A;  5HV9 A;  3HNI A;  5KYU A;  2KSF A;  1Q0D A;  2XS1 A;  2EPN A;  3JCU Q;  3PCV A;  1RKE B;  3B0V C;  4PAC A;  2G3K A;  2KQ9 A;  3O39 A;  2HKV A;  4U5B E;  1OCZ C;  4I44 A;  3W2W A;  4GYT A;  3ZG1 A;  1W2W A;  4CS8 A;  4CJO A;  1V74 B;  2EIN C;  3DXJ F;  2L6H A;  3KMI A;  2YVK A;  4JRZ A;  3UR3 C;  1K05 A;  2NPU A;  3O6X A;  4MQ9 F;  3TUL A;  3H2U A;  1XZQ A;  4AL0 A;  2LP4 A;  1RCP A;  4O6Y A;  1CGN A;  2OKU A;  4LDQ A;  2PX3 A;  4QDL A;  5D92 A;  3AG1 C;  2G3V A;  3DI5 A;  4N06 A;  1Z23 A;  4IB4 A;  5B3S C;  2Y3D A;  3C62 A;  3H65 A;  1MMG A;  4LLC A;  5L0D A;  3U3B A;  5L0C A;  3KYJ A;  3MBG A;  3US6 A;  3CAX A;  3SYN A;  1M6T A;  2L7A A;  3LS1 A;  2NUT A;  2R7V A;  3G4X A;  3MX3 A;  2MHR A;  3B0P A;  4ULW A;  1HW1 A;  2XLH A;  1NBB A;  5JUA A;  2Y3H A;  3N24 A;  1SMY F;  2NSF A;  3MLG A;  1OR3 A;  3DAF A;  2UUH A;  1E83 A;  2A69 F;  1RKC A;  3EHN A;  3ZC4 A;  1Y6D A;  3E9V A;  1E2X A;  4JE9 A;  1LM3 B;  4KNV A;  3AGU A;  2A0B A;  3KL4 A;  4XWJ A;  4QI0 A;  3B29 A;  2XLW A;  1T6U A;  2OJE D;  2FGY A;  1OQC A;  2NUT B;  1ZHY A;  2YL0 A;  2YL1 A;  1QSP A;  3DMD A;  4MND A;  1VLS A;  2VH3 A;  3JSE O;  4JJG A;  3RF3 A;  5DLJ A;  5L3Q A;  1H9T A;  3VRC A;  2A6H F;  3G50 A;  4GEH A;  4EWC A;  2AU5 A;  3TD7 A;  2KJG A;  4I1O B;  4CS9 A;  3S27 A;  4N6C A;  4YT2 A;  2R25 A;  5E3C A;  5A6K A;  4KI2 A;  3AGT A;  2CW0 F;  2XL6 A;  2Q9C A;  4E7Z A;  4CSA A;  2X51 A;  4L6R A;  2D4U A;  2KW3 C;  1LVK A;  3WOD F;  1YA9 A;  5T3W A;  5B3I A;  2ZD9 A;  2XLM A;  3LAY A;  3O55 A;  2ICW G;  3GOR A;  1Q0K A;  4BEJ A;  1SR2 A;  5KYX B;  4NY3 A;  5L3V A;  5HSW A;  3DD7 A;  2R7S A;  1EI7 A;  3SP1 A;  3GAN A;  1ZW3 A;  1R4T A;  3K1H A;  3KH2 A;  2BE5 F;  3DJU B;  3RYL A;  3WAQ A;  2X0C A;  2VAS A;  3SXK A;  2QY9 A;  2DYS C;  3K33 A;  3ABM C;  4PJL A;  5L0F A;  4FES A;  3AJM A;  4IAR A;  3FAJ A;  2OOC A;  2BC5 A;  2IM8 A;  3FMS A;  3WG7 C;  4MVR A;  2IXP A;  3UMI A;  1LI7 A;  1N1C A;  5DS6 A;  2YHS A;  4JW1 A;  1CPQ A;  1D0Z A;  3C8G D;  2C04 A;  2P1A A;  3VAY A;  1FNT c;  4FWV A;  4XLP F;  2XL8 A;  2PX0 A;  2NG1 A;  2YQY A;  4DRJ B;  3JZ0 A;  1OKK D;  3DE8 A;  3GWN A;  3HJC A;  1JPJ A;  1ZU4 A;  3LLK A;  2OCC C;  4XQ1 A;  1K40 A;  3Q6N A;  2B0H A;  4A2N B;  4CS9 C;  4DVY P;  2Y3B A;  1E86 A;  1OW6 A;  1V54 C;  2O9X A;  2Y3G A;  1LS4 A;  5E2Q A;  4CDY A;  1ZHW A;  4CS7 A;  4EBJ A;  4CSA C;  1NZE A;  3E70 C;  4MS2 A;  2L6G A;  4W8P A;  3S84 A;  3EGD B;  3SXM A;  3UGP A;  5F5H A;  3CSK A;  3K6B A;  3RQF A;  2W9Y A;  3IQ5 A;  1TFO B;  1OW8 A;  2H7O A;  4C3E A;  1A0B A;  2D5R B;  1O87 A;  2LSE A;  2OEX A;  2AWC A;  2QE9 A;  5JLI A;  2WB7 A;  2EPK X;  1FFH A;  3C8Z A;  3A11 A;  1YAU O;  5AGF A;  2R7R A;  4OIP F;  3JSZ A;  3EZH A;  1VB5 A;  1JR8 A;  1Z5Z A;  4PK4 A;  1V4A A;  2JX0 A;  3ABL C;  2PBE A;  2XLV A;  5KYU B;  1FAP B;  1O3U A;  3K1I C;  1S05 A;  3JRM O;  5DVW A;  1JOG A;  1LI5 A;  2A1D D;  5T1D B;  3RIP A;  3SXZ A;  5T3T A;  3SEO A;  2J7P D;  3T6G B;  1ORY A;  3VF0 A;  1D1C A;  1NU7 D;  3QVY A;  4DBQ A;  1XZP A;  5JRA A;  4JCH A;  5FCL A;  1C02 A;  3C7J A;  3CZ6 A;  4OD4 A;  3ZQY A;  4E0H A;  4UDV A;  5D91 A;  3RVY A;  5B1A C;  3ZDL A;  3C8G B;  4AX2 A;  1BZ4 A;  1M2V B;  2J9W A;  4IAQ A;  2E87 A;  5L0I A;  2J0X A;  5A69 A;  1PD1 A;  4J30 B;  2J9U A;  1ZHT A;  3W4Y A;  5AC4 A;  1WTY A;  2RD9 A;  2R7W A;  5TJ5 E;  1QPU A;  4LER A;  3TK0 A;  2EPO A;  2L9J A;  1Z3I X;  2EPM X;  2G62 A;  2HZ8 A;  3L8I A;  4C7O A;  1RJ9 A;  1HE1 A;  4WGY A;  1YA7 O;  1M2V A;  1EA8 A;  1NFN A;  1RJ9 B;  4RD9 A;  2I8B A;  2GAQ A;  1TFK B;  2KC3 A;  2R05 A;  2XLD A;  2ZXO A;  3DE9 A;  1LE4 A;  3AQB A;  3GEI A;  3IQT A;  2LFD A;  3HLZ A;  3K1I A;  5E33 A;  2YRF A;  2AP3 A;  3SZR A;  4QI2 A;  3A9C A;  3U9M A;  2YL7 A;  1R5I D;  2Q9B A; 
#chains in the Genus database with same CATH homology
 3LS0 A;  4YJW A;  4PFO A;  4O6N A;  4C3D A;  5DS6 A;  1M2O A;  3NYM A;  2YZS A;  3ZIB A;  2PF4 E;  2C03 A;  2V26 A;  2A6E F;  1ZYR F;  1S7Z A;  1TKN A;  4X0R A;  1BR1 A;  2NUP A;  4ZLC A;  1OCR C;  4ZLD A;  1D0X A;  1MMA A;  4FX5 A;  3W8H A;  5KYX A;  4AE4 A;  4Q7C A;  4U5C E;  2KNH A;  4BJ5 C;  1M56 C;  3S29 A;  3OA1 A;  1VYK A;  1ZU5 A;  2ZPA A;  3T4R A;  4BJT A;  3DJN B;  3LJB A;  1V55 C;  2IXM A;  4KC9 A;  2P7V A;  4O7G A;  3EPV A;  4K7B A;  4H4K C;  1BR4 A;  5KYN A;  2WVO A;  3W8I A;  3NKD A;  1QZX A;  1TWH A;  1D1B A;  3B0U X;  2GFH A;  2WZF A;  3X1O A;  3OWT A;  3LEV A;  4Q5S F;  2R7U A;  4U5H A;  3NRH A;  1FMV A;  3NKE A;  1VYI A;  5KYY A;  1ZHZ A;  1NU9 C;  1MMN A;  5B1B C;  3CQZ A;  4OIR F;  4BG0 A;  4BJ5 A;  2J9V A;  1IZM A;  1J8Y F;  3GOD A;  4I3M A;  4ANJ A;  4I1M A;  3K7D A;  4WJ0 A;  3ASO C;  2PP4 A;  3M1C B;  4YT5 A;  3ASN C;  3EGD A;  2EIL C;  4OD5 A;  2H7V C;  2R7O A;  1J8M F;  3T6J A;  1ST6 A;  5DQZ A;  1QLE C;  5F5F A;  4BJ6 A;  2R7Q A;  2XL4 A;  2MWQ A;  4M63 A;  4PJN A;  3LNR A;  3SNH A;  3ABK C;  2PFD A;  3UGO A;  3I5Q A;  4DVZ A;  3NG1 A;  4YT8 A;  1PCX A;  4YT4 A;  4HEA J;  3EG9 B;  1D1A A;  2WVQ A;  1SZI A;  3EH1 A;  2CGE A;  2IOQ A;  4RBN A;  1MND A;  4OIO F;  3EG9 A;  4BJ1 A;  2A68 F;  2MYS A;  1MMD A;  1FFT C;  3FVY A;  2J46 A;  4DBR A;  3POV A;  3Q6M A;  2W4B A;  3EQL F;  2HV6 A;  4F4B A;  3T6B A;  2ZXW C;  1TWA A;  3EFO B;  3AG3 C;  4BJ6 C;  2WL8 A;  4AE4 B;  3FHD A;  4K0D A;  3S28 A;  4DOZ A;  2QTV A;  1JPN A;  4AK9 A;  3F47 A;  3ZSU A;  1OKK A;  3Q7G A;  1BR2 A;  5DS4 A;  2FFH A;  3LLI A;  4O6M A;  4YN0 B;  2CDQ A;  5IY5 C;  1OCC C;  2Q9A A;  3W2V A;  2V3C C;  5E3A A;  4YWQ A;  3EZI A;  3Q7L A;  4KNW A;  3I5P A;  1VOM A;  4U5G A;  2IXO A;  2B0J A;  4OIN F;  4U5E E;  1KU2 A;  2XSE A;  3I4U A;  1TR2 A;  4IWB A;  3L0I A;  4IJJ A;  4G7Z F;  4LLE A;  3QZC A;  2J7P A;  3AQC A;  5CI9 A;  3HTK C;  4CBE A;  3UMH A;  1D0Y A;  1OCO C;  2KGO A;  2XRH A;  3X2Q C;  5BUO A;  2ZXR A;  3PMR A;  3ECS A;  3F46 A;  5CI8 A;  5KYW B;  2J45 A;  1NG1 A;  4IAO A;  2Y39 A;  1TWG A;  3DM9 B;  3N2Z B;  3EH2 A;  3JYH A;  4JJF A;  3NDB B;  5EHH A;  1FTS A;  2DYR C;  4J32 B;  3V7O A;  3S0X A;  2IYL D;  3LES A;  2YEV A;  3K66 A;  3EGX B;  3VYW A;  1IW7 F;  4E7S A;  2P6V A;  2VB6 A;  3RFY A;  3L34 A;  3JT1 A;  4XTK A;  3KKB A;  2WZG A;  2XXA B;  3JRT A;  2M4E A;  2HV7 A;  2CNW A;  2OG2 A;  4HFK B;  4LAC B;  3OEO A;  4W8K A;  2Z15 A;  4U5F E;  4C7O B;  3UNG C;  4KBL A;  4P6I C;  1VMA A;  4HE8 D;  4B6I A;  3AG2 C;  3RKO F;  3UMK A;  4G7H F;  4G7O F;  2IXN A;  2EIJ C;  3EJN A;  3N0T A;  3EFO A;  2W4M A;  3IEE A;  1M57 C;  2WZL A;  2H7B A;  1WGW A;  3AG4 C;  4G0H A;  4U5D E;  3RH3 A;  2Y69 C;  3DM5 A;  2NUP B;  1O5H A;  4IRU A;  4XLN F;  2R7X A;  2EIM C;  2DGJ A;  2R7T A;  5EGY A;  1PD0 A;  1SF8 A;  2J0W A;  4C3B A;  4JUR I;  1TWC A;  2Q3T A;  2JD3 A;  1VK5 A;  1MNE A;  3DAG A;  4HFF B;  2CNW D;  3NYL A;  4O79 A;  3PHF 2;  3QMK A;  4PJM A;  2L81 A;  1LKX A;  1G8X A;  4JVS A;  4RDA A;  5KYY B;  3B9Q A;  1LS1 A;  4CIH A;  4CS8 C;  4OIQ F;  2WVN A;  3ITF A;  4JZA A;  2ZXP A;  2EIK C;  4PJJ A;  1ZHX A;  3EHM A;  1Z6A A;  5KYW A;  3NYJ A;  4PFP A;  2W45 A;  5DS5 A;  3EGX A;  1FMW A;  5DQT A;  2XXA A;  3DZA A;  5KYU A;  3JCU Q;  3B0V C;  2G3K A;  2KQ9 A;  3O39 A;  4U5B E;  1OCZ C;  4I44 A;  3W2W A;  4GYT A;  3ZG1 A;  1W2W A;  4CS8 A;  2EIN C;  3DXJ F;  3KMI A;  3UR3 C;  4MQ9 F;  3O6X A;  4KI2 A;  4O6Y A;  5D92 A;  4EBB A;  2PX3 A;  4QDL A;  3AG1 C;  2G3V A;  4N06 A;  5B3S C;  1Z23 A;  2Y3D A;  3H65 A;  4LLC A;  1MMG A;  3SYN A;  3LS1 A;  2NUT A;  2R7V A;  3MX3 A;  3B0P A;  4ULW A;  2Y3H A;  3N24 A;  1SMY F;  3MLG A;  3DAF A;  2A69 F;  3EHN A;  3ZC4 A;  3E9V A;  4KNV A;  3KL4 A;  4XWJ A;  4QI0 A;  3DMD A;  2FGY A;  2NUT B;  1ZHY A;  4MND A;  5DLJ A;  5L3Q A;  2VH3 A;  4JJG A;  2A6H F;  4GEH A;  4EWC A;  3TD7 A;  2KJG A;  4I1O B;  4CS9 A;  3S27 A;  4YT2 A;  5E3C A;  4E7Z A;  2CW0 F;  4CSA A;  2Q9C A;  2X51 A;  3WOD F;  2KW3 C;  1LVK A;  5T3W A;  3LAY A;  4BEJ A;  5KYX B;  4NY3 A;  5L3V A;  5HSW A;  3DD7 A;  2R7S A;  3SP1 A;  3GAN A;  3KH2 A;  3K1H A;  2BE5 F;  3DJU B;  3RYL A;  2VAS A;  2QY9 A;  2DYS C;  3K33 A;  3ABM C;  4PJL A;  4FES A;  3FAJ A;  3WG7 C;  2IXP A;  3UMI A;  1N1C A;  2YHS A;  4JW1 A;  1D0Z A;  2C04 A;  3VAY A;  4FWV A;  4XLP F;  2PX0 A;  2NG1 A;  1OKK D;  3FDQ A;  3HJC A;  1JPJ A;  1ZU4 A;  3LLK A;  2OCC C;  4A2N B;  4DVY P;  3Q6N A;  4CS9 C;  2Y3B A;  1V54 C;  2O9X A;  2Y3G A;  5E2Q A;  4CSA C;  1ZHW A;  4CS7 A;  1NZE A;  3E70 C;  3UGP A;  3EGD B;  5F5H A;  3CSK A;  3K6B A;  2W9Y A;  2H7O A;  4C3E A;  2D5R B;  1O87 A;  2LSE A;  2WB7 A;  1FFH A;  2R7R A;  4OIP F;  3JSZ A;  3EZH A;  1Z5Z A;  4PK4 A;  3ABL C;  5KYU B;  3K1I C;  5DVW A;  2A1D D;  5T1D B;  3RIP A;  5T3T A;  2J7P D;  1D1C A;  1NU7 D;  4DBQ A;  4JCH A;  5FCL A;  3CZ6 A;  4OD4 A;  5D91 A;  5B1A C;  4AX2 A;  1M2V B;  2J9W A;  2E87 A;  2J0X A;  1PD1 A;  4J30 B;  2J9U A;  1ZHT A;  2R7W A;  4LER A;  2L9J A;  1Z3I X;  4C7O A;  2G62 A;  1RJ9 A;  1M2V A;  1RJ9 B;  4RD9 A;  2I8B A;  3SEO A;  1Z63 A;  4Q4Z F;  2ZXO A;  3AQB A;  3ZVR A;  4QI2 A;  3HLZ A;  5E33 A;  3SZR A;  2Q9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...