1S7ZA

Structure of ocr from bacteriophage t7
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
MTYNNVFDHAYEMLKENIRYDDIRDTDDLHDAIHMAADNAVPHYYADIFSVMASEGIDLEFEDSGLMPDTKDVIRILQARIYEQLTIDLWEDAEDLLNEYLEEVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Gene 0.3 protein
publication title Structure of Ocr from Bacteriophage T7, a Protein that Mimics B-Form DNA
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08684 ocr DNA mimic ocr
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.780 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1s7zA01
1S7ZA
chains in the Genus database with same CATH superfamily
4CS7A 4JJFA 3RH3A 2R7XA 4XWJA 3A9CA 4Q5SF 4XEVA 2XS8A 3GORA 1LI5A 5COMA 3SXYA 2DGJA 3HKKA 1YYJA 4JURI 3ZTZA 4AK9A 3KYJA 3K1IA 4MVSA 1AEPA 5A69A 3PDMP 1J8YF 1HE1A 3C62A 3TJ6A 3ZQVA 4K1OA 2XLEA 3FAPB 3ZTMA 5BQHA 2YEVA 3JZ0A 4PFOA 5COFA 1I4YA 1YAUO 4EHPA 4BJ6A 3RQFA 1BR4A 3LLIA 5KYYA 1D0ZA 2W4MA 4C3DA 2QLAA 4Q7CA 1U6HA 2J0XA 3NYMA 4IGGA 2R9RB 1APCA 3GM2A 3KPHA 3RFYA 4C7OB 1HY5A 2HFIA 4N6HA 2XLDA 3EPVA 3JSZA 3Q6NA 1NZEA 2ZXPA 3UMHA 1FTSA 5E3AA 3F46A 1OKKA 3C8ZA 1H9GA 3QVZA 4LDQA 2Q7RA 2CW0F 2KGOA 2R7OA 4U9DA 1YZAA 4XEKA 3TK0A 3DMDA 3M4CA 3V5YA 2EPMX 5JRAA 1MNEA 3MFNA 4MTOA 4BEJA 2NUPA 2DB4A 4K7BA 2LQGA 4KNVA 3ASOC 2AP3A 1LE4A 2J9VA 4O6NA 3SXZA 2XXAA 3AG4C 3U3BA 1E85A 4O79A 3B0UX 4JCHA 4G7OF 1OCCC 4WGZA 4EBBA 1LS1A 3N2ZB 4CSAA 3IQ5A 2EILC 1Q0GA 4ONSA 3AQCA 1R5ID 2W9YA 1T5OA 4IRUA 4MQ9F 1FAPB 1ORJA 2R25A 4N6CA 4XLPF 2NUPB 4YL3A 2KK1A 4KBLA 4XTKA 4C3EA 3DZAA 5EGYA 2GWWA 3ABLC 1ZHYA 4MS2A 2XXAB 4MVOA 3N0TA 2LP4A 3RQGA 1ZU4A 2TMVP 2QY9A 3NMIA 2LCHA 3E70C 4CS8A 2L7AA 1DOVA 2HSBA 1OXKA 3A11A 2YLGA 4IARA 5GPGB 3J06A 2EINC 2L9JA 2R02A 4MW3A 1QSPA 1T9KA 5KYUA 5IY5C 1E83A 5E2QA 1TWGA 5T1DB 5JVEA 4J7YA 3O55A 1SYQA 1MMAA 4WJ0A 3ZIBA 4J32B 5DLJA 2FGYA 4JZAA 4OINF 1JR8A 3G4XA 2NSFA 3B71A 1RJ9B 1WGWA 2QE9A 4G7HF 2ZPAA 3HJCA 3IQTA 3JTLO 3L8JA 4Z9IA 2NPUA 3RKOF 4CBEA 3NG1A 1S7ZA 3K7DA 4MVZA 5L0HA 2J7PA 2OEVA 4BJ5C 3IQ6A 1U89A 1NFOA 1NSGB 2R7QA 1SZIA 2P0NA 3EG9B 2YHSA 5E33A 3T6JA 2YZSA 1KNYA 2A69F 2E87A 2XS1A 4U5BE 2L6HA 4U9EA 2A6EF 2YL7A 4H54A 4JIOA 5L0CA 4MNDA 4DOZA 3K6BA 2RD9A 1Z3IX 3F47A 1M56C 5D92A 3M1CB 3RQEA 4AE4A 4BG0A 5EK0A 1D0YA 2OU6A 3LEOA 4HFKB 2A1DD 2XL8A 1G4US 4U5HA 4A4AA 4CIHA 4E7SA 1OQCA 4GQHA 2C03A 4PJMA 5DS5A 5F5FA 2WVNA 4YT4A 3VAYA 2VCAA 4P9TA 1PD0A 5CI8A 3JYYA 3RVZA 2X0CA 1BBHA 4NTBA 4LACB 4CS9C 3UGOA 5BQGA 5A6KA 1CGNA 3C8GA 3MBGA 2ZD9A 2ZXWC 4D4XA 2OQMA 1PV3A 2KYHA 1D0XA 3QVYA 4W8PA 4AE4B 3LAYA 2EIMC 4H4KC 2DYRC 4XPYA 3AG2C 5A6BA 3LS1A 4MVUA 1HE9A 1Z6AA 2J45A 2XL6A 4DVYP 1TWHA 2XSEA 3B9QA 3O6XA 4YL0A 3UGPA 1PCXA 4O7GA 1M6TA 2JX0A 5JS5A 3HNLA 3HTKC 4WGYA 3W4YA 3I4UA 1T6UA 2D5RB 4PJJA 3LUTB 1NFNA 4LLCA 1NBBA 2C04A 1TR2A 1C03A 4EKWA 3C8GB 4EUKB 1M2OA 3JT1A 4FESA 3S29A 5DS6A 4CDAA 3QW0A 4C7OA 2IXPA 3NYJA 3BRJA 5AC5A 1NG1A 2Y3GA 3M79A 4XLNF 2XLHA 2CNWA 3EFOA 1OR2A 3DAFA 3L1MA 2LD6A 3V5ZA 1OCRC 4BEMJ 3CQZA 4UDVA 2CCYA 3K1HA 3M4BA 5DQZA 1WATA 2AVKA 2EIKC 3FXHA 2H8AA 3R2PA 2Y69C 2OEXA 5F5HA 1ST6A 5CI9A 3X1OA 5A6AA 3WODF 1D1CA 3OEOA 3DJNB 4ER9A 4IJJA 1VMAA 3EH1A 5FCLA 3TQOA 4ZLDA 3NDBB 2Q9CA 4BPMA 2JD3A 3GEHA 3ZQYA 2WVOA 1IZMA 2ZXOA 1V54C 1GM5A 3EGDA 3ABMC 3EFOB 3POVA 1LKXA 3N24A 1JAFA 4MTFA 4NTFA 1NU9C 1RXQA 3IEEA 4P9FA 1CPQA 2AWYA 5T3TA 2Q4FA 4JTDB 4N4WA 4W8KA 3VRCA 3LS0A 3TD7A 1WTYA 4B6IA 3SEOA 3LNRA 5KYXA 2Q9BA 2A0UA 4OIPF 3NRHA 4AL1A 3PHF2 2B0JA 1Z7Qc 2Y39A 1LVKA 1T01A 1ZVZA 3ZC4A 1I5NA 1O3UA 4DJ9A 3NMJA 4I1OB 3O10A 3VF0A 2EPNA 3EGDB 4HFFB 1RKEA 3US6A 2XM0A 3AQBA 2LIGA 2NSGA 3DKAA 1A7VA 2LFDA 1M57C 1BR2A 1VOMA 1K04A 3B0PA 5TJ5E 2KQ9A 3ZWIA 4WABA 4C3BA 2A6HF 1D1AA 5KYXB 4CJOA 4E18A 5F28E 1TWAA 3ZDLA 1O5HA 1EA8A 4DRHB 3DXJF 3QZCA 4ULWA 2FAPB 2HZ8A 1RJ9A 1WWPA 5B3IA 1K40A 3L34A 1YYXA 1RKEB 1LS4A 1YLMA 1YZCA 2A68F 3DI5A 1G5ZA 4EBJA 3G50A 1CPRA 2GAQA 1BZ4A 2WZGA 1HW2A 1CGME 3AGUA 3Q7LA 3Q7GA 4ZLCA 4E0IA 4XEFA 2PFDA 3EH2A 1IW7F 2P6VA 3EG9A 4NC3A 1R4TA 1HMOA 1T6IA 5KYNA 1MQVA 1YJGA 1F1MA 3NKDA 1C02A 2YLDA 4J30B 1JMWA 1TWCA 4XPWA 2J46A 2WL8A 2V3CC 4QDLA 2ASRA 5K0IA 3DM5A 3EJNA 4JEBA 4PJNA 3UMKA 4PJLA 3ABKC 1DOWA 3T9OA 3CZ6A 4GYTA 1EQ1A 1NU7D 2CYDA 1CGOA 1QZXA 2OOCA 3L8IA 4E17A 1VTMP 4BJ1A 2ZXRA 2PF4E 3M15A 3U8VA 1K05A 3KH2A 3W2VA 3SNHA 2NUTA 1Q0FA 4YT8A 1C17M 2W4BA 1LI7A 2ETSA 2YL1A 4IAQA 1TKNA 4JTAB 3H2VA 2J0WA 3O39A 3CSKA 4FAPB 2XL4A 4U5DE 5BUOA 4JEAA 3RIPA 4IWBA 1ZW3A 2NG1A 4I3MA 4R32A 4XPXA 1OW7A 2LK4A 2PP4A 1AVOB 2GDCA 1Z23A 2UUHA 4N06A 1V55C 2KNHA 3R7CA 4RBNA 1A7DA 3QW1A 1UG7A 1SMYF 4JC7A 4JCZA 5DVWA 2BE5F 2IOQA 3HNJA 3B29A 3PCVA 3U2MA 2YL3A 4YK5A 3U8PA 2NUTB 4LDKA 1V4AA 2L6GA 1N1CA 3HNIA 3U2LA 3VM6A 1G8XA 1LIHA 5L3QA 1QVXA 2CGEA 3SXKA 1OR3A 4NQFA 2IXOA 3FOPA 3S9OA 1ZYRF 3EQLF 1ORSC 5EHHA 4MW8A 4DRIB 2EPKX 1HMDA 2OG2A 4OD4A 2D4UA 5JUAA 1O87A 1JPNA 3DM9B 5B1AC 1OW6A 2I15A 4F4BA 2Q9AA 1LM3B 4X0RA 4YT5A 1YDIA 3S90A 2R7SA 3KKBA 3GEIA 2XM4A 3DWWA 5L0FA 3UMIA 2Y3DA 2H7VC 3FOOA 5JP7A 3B0VC 4L6RA 5KYWB 2GFHA 2M4EA 2YL0A 1EI7A 1NLXA 2EPOA 1W2WA 2MWQA 4JE9A 1G4WR 256BA 3GODA 1QQ3A 4JW1A 4PACA 4PK4A 5AC4A 4DXWA 1VYIA 2YVKA 4J7TA 4IB4A 2OJQA 3T6BA 2UUIA 2XLWA 2OKUA 4YT2A 2KW3C 4MTGA 4P6IC 4U5GA 3TOMA 4BJTA 1AUEA 1A0BA 2KC3A 3LNMB 4KNWA 4CSAC 1QLEC 1SF8A 2P61A 3JYHA 4M63A 4GEHA 4BJ5A 5A6JA 2PX3A 4JKVA 4YN0B 2F22A 5HV9A 3PMRA 3EGXA 2OJED 2YWAA 3VYWA 3ATPA 3MX3A 2H7OA 1VLSA 4RD9A 2B0HA 2BL2A 2KJGA 4DRJB 1V74B 3EZHA 4LERA 3TULA 1M2VA 1ZU5A 2IYLD 2MYSA 1EKYA 1OCZC 1VYKA 3MLGA 1Q0MA 3CEXA 1I4ZA 2LFFA 3UNGC 4CS8C 1TFKB 4HEAJ 2Q3TA 3U0CA 3C18A 1JOGA 4NCQA 2CDQA 4YJWA 1ZW2A 2P7VA 3JRMO 3FAJA 4JTCB 4Q4ZF 1BDJB 1S05A 1VLTA 3T4RA 2J7PD 2R03A 4U5EE 3EGXB 1Q0DA 1MMDA 4HE8D 4O6YA 4A2NB 3AGTA 4U5CE 4CS9A 1GS9A 1TFOB 2HMZA 3C7JA 4JRZA 4KC9A 3SP1A 1M2VB 2L81A 3DJUB 3MYIA 1L7CA 1GQAA 2HSQA 2XRHA 3HNKA 4LLEA 2G3VA 3EZIA 4CJGA 3Q6MA 4CX9A 2R7RA 1KTMA 2YQYA 4IAOA 1U0BB 2Y3HA 4DVZA 2M64A 5L0JA 3G4ZA 4O6MA 2HS5A 3L0IA 4FX5A 2O9XA 1RKCA 3I5PA 4PFPA 1OCOC 1XZQA 1ZZPA 2A0BA 2XLOA 1BR1A 2J9BA 1RCPA 3GWNA 2BC5A 4Z9HA 2MHRA 2R7VA 2RSEB 5L0GA 3NYLA 1ZHWA 5L3VA 3V7OA 3KMIA 4EIYA 2AWCA 3SXMA 4DBRA 4OIQF 5DQTA 3S84A 4XQ1A 1Q0KA 3W8IA 5KYYB 2R7UA 4AL0A 1KU2A 1MNDA 2Z15A 1GGQA 3C8GD 5DS4A 3NKEA 5FZTA 4ANJA 2PX0A 1FFTC 3ITFA 3K66A 4K0DA 5HSWA 3C63A 1LE2A 3AOUA 2H7BA 4DBQA 3W8HA 5A6BD 2JPUA 3RF3A 2IXNA 3JRTA 4EBKA 3TJ5A 3EHMA 4MVRA 3UR3C 1XWJA 2EPLX 3HLZA 1MMNA 3DE9A 4QI2A 3X2QC 2VH3A 3AG1C 1T6QA 1UFBA 2XLMA 1QPUA 3LESA 2Y3BA 1MMGA 1WASA 2Q00A 3EHNA 2WZLA 3GM1A 3LLKA 3QMKA 4G7ZF 4OIRF 3FVYA 5T3WA 3KL4A 3WG7C 4CDVA 4E0HA 4E7ZA 2WB7A 3FDQA 1PD1A 1E84A 3JCUQ 1Y4CA 4NY3A 2HV6A 2G62A 4ULVA 3U9MA 2R7TA 1ZHTA 4U5FE 2CNWD 3ECSA 4NTAA 3NMKA 3IHUA 1SR2A 2P1AA 1LPEA 5COGA 3JSEO 1ZHXA 2VB6A 2KSFA 2HJ3A 3BEHA 3H65A 5E3CA 5JT4A 1D1BA 1TQGA 2DYSC 4PR9A 1L3PA 3GM3A 3OWTA 5B1BC 3S28A 2DI3A 2X51A 3W2WA 1VB5A 2GA0A 3LEVA 2PNOA 3U5SA 3U9JA 4CIPA 3SYNA 5JLIA 2AU5A 4FWVA 2EIJC 3IQCA 2OCCC 5B3SC 3DE8A 4QI0A 1JPJA 2VC9A 3K1IC 3OA1A 3S27A 1FR0A 2J9WA 3ZVRA 2J9UA 1JRAA 2HKVA 1ORYA 1ZHZA 1YVIA 4CDYA 4LDRA 1YA7O 1OKKD 3K33A 2L6FA 5KYUB 2HUJA 3FHDA 1YA9A 1FMWA 3E9VA 3AG3C 3WHNA 3FMSA 4JJGA 4BJ6C 3V5XA 1FFHA 2IBFA 2VCBA 1Z5ZA 1HW1A 5KYWA 2R05A 2QNLA 3IPMO 4I1MA 4G78A 5JSLA 4RDAA 4I44A 3GANA 2W45A 2LSEA 2PBEA 1H7IA 1A41A 1E2XA 1Y6DA 2WVQA 2V26A 1H9TA 2ICWG 1A7EA 3RVYA 2FFHA 4YL1A 5CIVA 5L0DA 2R7WA 4Z9JA 3RW0A 2J8WA 4MVQA 4JVSA 4MVMA 5D91A 3DAGA 3RYLA 4OIOF 3ZG1A 5BQIA 2QTVA 5L0IA 2VASA 1B68A 4AX2A 1QKRA 1WN0A 3LJBA 1YARO 2QUPA 1FNTc 1VK5A 2G3KA 1Z63A 2IXMA 3U3FA 4YWQA 2IM8A 3T6GB 4KI2A 3WAQA 2YRFA 3GWLA 3QTHA 3AJMA 3GEEA 1E86A 2YKZA 5AGFA 2I8BA 3MYFA 3TOLA 3KYIA 1RMVA 3ZSUA 2YLIA 1OXBA 1WOLA 1J8MF 4G0HA 2WZFA 4OD5A 1OW8A 1FMVA 3ASNC 3CAXA 2HJMA 3H2UA 1H6GA 3S0XA 2HV7A 1XZPA 4D4NA 2HMQA 3DD7A 4EWCA 3I5QA 2VCCA 2XLVA 3SZRA
chains in the Genus database with same CATH topology
4CS7A 4JJFA 3RH3A 2R7XA 4XWJA 4Q5SF 2DGJA 4JURI 4AK9A 1J8YF 2YEVA 4PFOA 4BJ6A 1BR4A 3LLIA 5KYYA 1D0ZA 2W4MA 4C3DA 4Q7CA 2J0XA 3NYMA 4C7OB 3RFYA 3EPVA 3JSZA 3Q6NA 1NZEA 2ZXPA 3UMHA 1FTSA 5E3AA 3F46A 1OKKA 2CW0F 2KGOA 2R7OA 3DMDA 1MNEA 4BEJA 2NUPA 4K7BA 4KNVA 3ASOC 2XXAA 4O6NA 2J9VA 3AG4C 4O79A 3B0UX 4JCHA 1OCCC 4EBBA 1LS1A 3N2ZB 4CSAA 2EILC 3AQCA 2W9YA 4IRUA 4MQ9F 4XLPF 2NUPB 4KBLA 4XTKA 4C3EA 3DZAA 5EGYA 2XXAB 3ABLC 1ZHYA 3N0TA 1ZU4A 2QY9A 3E70C 4CS8A 2EINC 2L9JA 5IY5C 5KYUA 5E2QA 1TWGA 5T1DB 1MMAA 4WJ0A 3ZIBA 4J32B 5DLJA 2FGYA 4JZAA 4OINF 1RJ9B 1WGWA 4G7HF 2ZPAA 3HJCA 4CBEA 3RKOF 3NG1A 1S7ZA 3K7DA 2J7PA 4BJ5C 2R7QA 1SZIA 3EG9B 2YHSA 5E33A 3T6JA 2YZSA 2A69F 2E87A 4U5BE 2A6EF 4MNDA 4DOZA 3K6BA 1Z3IX 3F47A 1M56C 5D92A 3M1CB 4AE4A 4BG0A 1D0YA 4HFKB 2A1DD 4U5HA 4CIHA 4E7SA 2C03A 4PJMA 5DS5A 5F5FA 2WVNA 4YT4A 3VAYA 1PD0A 5CI8A 4CS9C 3UGOA 4LACB 2ZXWC 1D0XA 4AE4B 3LAYA 2EIMC 4H4KC 2DYRC 3AG2C 3LS1A 1Z6AA 2J45A 4DVYP 1TWHA 2XSEA 3B9QA 3O6XA 3UGPA 1PCXA 4O7GA 3HTKC 3I4UA 2D5RB 4PJJA 4LLCA 2C04A 1TR2A 1M2OA 3JT1A 4FESA 3S29A 4C7OA 2IXPA 3NYJA 1NG1A 2Y3GA 4XLNF 3EFOA 2CNWA 3DAFA 1OCRC 3CQZA 3K1HA 5DQZA 2EIKC 3X1OA 2Y69C 5F5HA 1ST6A 5CI9A 3WODF 1D1CA 3OEOA 3DJNB 4IJJA 1VMAA 3EH1A 5FCLA 4ZLDA 3NDBB 2Q9CA 2JD3A 2WVOA 1IZMA 2ZXOA 1V54C 3EGDA 3ABMC 3EFOB 1LKXA 3N24A 1NU9C 3IEEA 5T3TA 4W8KA 3LS0A 3TD7A 4B6IA 3SEOA 3LNRA 5KYXA 2Q9BA 4OIPF 3NRHA 3PHF2 2B0JA 5DS6A 2Y39A 1LVKA 3ZC4A 4I1OB 3EGDB 4HFFB 3AQBA 1M57C 1BR2A 1VOMA 3B0PA 2KQ9A 4C3BA 2A6HF 1D1AA 5KYXB 1TWAA 1O5HA 3DXJF 3QZCA 4ULWA 1RJ9A 3L34A 2A68F 2WZGA 3Q7LA 3Q7GA 4ZLCA 2PFDA 3EH2A 1IW7F 2P6VA 3EG9A 5KYNA 3NKDA 4J30B 1TWCA 2J46A 2WL8A 2V3CC 4QDLA 3DM5A 3EJNA 4PJNA 3UMKA 4PJLA 3ABKC 3CZ6A 4GYTA 1NU7D 1QZXA 4BJ1A 2ZXRA 2PF4E 3KH2A 3W2VA 3SNHA 2NUTA 4YT8A 2W4BA 1TKNA 2J0WA 3O39A 3CSKA 2XL4A 4U5DE 5BUOA 3RIPA 4IWBA 2NG1A 4I3MA 2PP4A 4N06A 1Z23A 1V55C 2KNHA 4RBNA 1SMYF 5DVWA 2BE5F 2IOQA 2NUTB 1N1CA 1G8XA 5L3QA 2CGEA 2IXOA 1ZYRF 3EQLF 5EHHA 2OG2A 4OD4A 1O87A 1JPNA 3DM9B 5B1AC 4F4BA 2Q9AA 4X0RA 4YT5A 2R7SA 3KKBA 3UMIA 2Y3DA 2H7VC 3B0VC 5KYWB 2GFHA 2M4EA 1W2WA 2MWQA 4PK4A 3GODA 4JW1A 1VYIA 3T6BA 4YT2A 2KW3C 4P6IC 4U5GA 4BJTA 4CSAC 4KNWA 1QLEC 1SF8A 3JYHA 4M63A 4GEHA 4BJ5A 2PX3A 4YN0B 3PMRA 3EGXA 3VYWA 3MX3A 2H7OA 4RD9A 2KJGA 4LERA 3EZHA 1M2VA 1ZU5A 2IYLD 2MYSA 1OCZC 1VYKA 3MLGA 3UNGC 4CS8C 4HEAJ 2Q3TA 2CDQA 4YJWA 2P7VA 3FAJA 4Q4ZF 3T4RA 2J7PD 4U5EE 3EGXB 1MMDA 4HE8D 4O6YA 4A2NB 4CS9A 4U5CE 4KC9A 3SP1A 1M2VB 2L81A 3DJUB 2XRHA 4LLEA 2R7RA 2G3VA 3EZIA 3Q6MA 4IAOA 2Y3HA 4DVZA 4O6MA 3L0IA 4FX5A 4PFPA 2O9XA 5B1BC 3I5PA 1OCOC 2R7VA 1BR1A 3NYLA 1ZHWA 5L3VA 3V7OA 3KMIA 4DBRA 4OIQF 5DQTA 3W8IA 5KYYB 2R7UA 1KU2A 1MNDA 2Z15A 5DS4A 3NKEA 4ANJA 2PX0A 1FFTC 3ITFA 3K66A 4K0DA 5HSWA 2H7BA 4DBQA 3W8HA 2IXNA 3JRTA 3EHMA 3UR3C 3HLZA 1MMNA 4QI2A 3X2QC 2VH3A 3AG1C 3LESA 2Y3BA 1MMGA 3EHNA 2WZLA 3LLKA 3QMKA 4G7ZF 4OIRF 3FVYA 5T3WA 3KL4A 3WG7C 4E7ZA 2WB7A 3FDQA 1PD1A 3JCUQ 4NY3A 2HV6A 2G62A 2R7TA 1ZHTA 4U5FE 2CNWD 3ECSA 1ZHXA 2VB6A 3H65A 5E3CA 1D1BA 2DYSC 3OWTA 3S28A 3W2WA 2X51A 3LEVA 3POVA 3SYNA 4FWVA 2EIJC 2OCCC 5B3SC 4QI0A 1JPJA 3K1IC 3OA1A 3S27A 2J9WA 3ZVRA 2J9UA 1ZHZA 1OKKD 3K33A 5KYUB 4G7OF 3FHDA 3E9VA 1FMWA 3AG3C 4JJGA 4BJ6C 1FFHA 1Z5ZA 5KYWA 4I1MA 4RDAA 4I44A 3GANA 2W45A 2LSEA 2WVQA 2V26A 2FFHA 2R7WA 4JVSA 5D91A 3DAGA 3RYLA 4OIOF 3ZG1A 2QTVA 2VASA 4AX2A 3LJBA 1VK5A 2G3KA 1Z63A 2IXMA 4YWQA 4KI2A 2I8BA 3ZSUA 4G0HA 1J8MF 2WZFA 4OD5A 1FMVA 3ASNC 3S0XA 2HV7A 3DD7A 4EWCA 3I5QA 3SZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7Z A; 
#chains in the Genus database with same CATH topology
 4CS7 A;  4JJF A;  3RH3 A;  2R7X A;  4XWJ A;  3A9C A;  4Q5S F;  4XEV A;  2XS8 A;  3GOR A;  1LI5 A;  5COM A;  3SXY A;  2DGJ A;  3HKK A;  1YYJ A;  4JUR I;  3ZTZ A;  4AK9 A;  3KYJ A;  3K1I A;  4MVS A;  1AEP A;  5A69 A;  3PDM P;  1J8Y F;  1HE1 A;  3C62 A;  3TJ6 A;  3ZQV A;  4K1O A;  2XLE A;  3FAP B;  3ZTM A;  5BQH A;  2YEV A;  3JZ0 A;  4PFO A;  5COF A;  1I4Y A;  1YAU O;  4EHP A;  4BJ6 A;  3RQF A;  1BR4 A;  3LLI A;  5KYY A;  1D0Z A;  2W4M A;  4C3D A;  2QLA A;  4Q7C A;  1U6H A;  2J0X A;  3NYM A;  4IGG A;  2R9R B;  1APC A;  3GM2 A;  3KPH A;  3RFY A;  4C7O B;  1HY5 A;  2HFI A;  4N6H A;  2XLD A;  3EPV A;  3JSZ A;  3Q6N A;  1NZE A;  2ZXP A;  3UMH A;  1FTS A;  5E3A A;  3F46 A;  1OKK A;  3C8Z A;  1H9G A;  3QVZ A;  4LDQ A;  2Q7R A;  2CW0 F;  2KGO A;  2R7O A;  4U9D A;  1YZA A;  4XEK A;  3TK0 A;  3DMD A;  3M4C A;  3V5Y A;  2EPM X;  5JRA A;  1MNE A;  3MFN A;  4MTO A;  4BEJ A;  2NUP A;  2DB4 A;  4K7B A;  2LQG A;  4KNV A;  3ASO C;  2AP3 A;  1LE4 A;  2J9V A;  4O6N A;  3SXZ A;  2XXA A;  3AG4 C;  3U3B A;  1E85 A;  4O79 A;  3B0U X;  4JCH A;  4G7O F;  1OCC C;  4WGZ A;  4EBB A;  1LS1 A;  3N2Z B;  4CSA A;  3IQ5 A;  2EIL C;  1Q0G A;  4ONS A;  3AQC A;  1R5I D;  2W9Y A;  1T5O A;  4IRU A;  4MQ9 F;  1FAP B;  1ORJ A;  2R25 A;  4N6C A;  4XLP F;  2NUP B;  4YL3 A;  2KK1 A;  4KBL A;  4XTK A;  4C3E A;  3DZA A;  5EGY A;  2GWW A;  3ABL C;  1ZHY A;  4MS2 A;  2XXA B;  4MVO A;  3N0T A;  2LP4 A;  3RQG A;  1ZU4 A;  2TMV P;  2QY9 A;  3NMI A;  2LCH A;  3E70 C;  4CS8 A;  2L7A A;  1DOV A;  2HSB A;  1OXK A;  3A11 A;  2YLG A;  4IAR A;  5GPG B;  3J06 A;  2EIN C;  2L9J A;  2R02 A;  4MW3 A;  1QSP A;  1T9K A;  5KYU A;  5IY5 C;  1E83 A;  5E2Q A;  1TWG A;  5T1D B;  5JVE A;  4J7Y A;  3O55 A;  1SYQ A;  1MMA A;  4WJ0 A;  3ZIB A;  4J32 B;  5DLJ A;  2FGY A;  4JZA A;  4OIN F;  1JR8 A;  3G4X A;  2NSF A;  3B71 A;  1RJ9 B;  1WGW A;  2QE9 A;  4G7H F;  2ZPA A;  3HJC A;  3IQT A;  3JTL O;  3L8J A;  4Z9I A;  2NPU A;  3RKO F;  4CBE A;  3NG1 A;  1S7Z A;  3K7D A;  4MVZ A;  5L0H A;  2J7P A;  2OEV A;  4BJ5 C;  3IQ6 A;  1U89 A;  1NFO A;  1NSG B;  2R7Q A;  1SZI A;  2P0N A;  3EG9 B;  2YHS A;  5E33 A;  3T6J A;  2YZS A;  1KNY A;  2A69 F;  2E87 A;  2XS1 A;  4U5B E;  2L6H A;  4U9E A;  2A6E F;  2YL7 A;  4H54 A;  4JIO A;  5L0C A;  4MND A;  4DOZ A;  3K6B A;  2RD9 A;  1Z3I X;  3F47 A;  1M56 C;  5D92 A;  3M1C B;  3RQE A;  4AE4 A;  4BG0 A;  5EK0 A;  1D0Y A;  2OU6 A;  3LEO A;  4HFK B;  2A1D D;  2XL8 A;  1G4U S;  4U5H A;  4A4A A;  4CIH A;  4E7S A;  1OQC A;  4GQH A;  2C03 A;  4PJM A;  5DS5 A;  5F5F A;  2WVN A;  4YT4 A;  3VAY A;  2VCA A;  4P9T A;  1PD0 A;  5CI8 A;  3JYY A;  3RVZ A;  2X0C A;  1BBH A;  4NTB A;  4LAC B;  4CS9 C;  3UGO A;  5BQG A;  5A6K A;  1CGN A;  3C8G A;  3MBG A;  2ZD9 A;  2ZXW C;  4D4X A;  2OQM A;  1PV3 A;  2KYH A;  1D0X A;  3QVY A;  4W8P A;  4AE4 B;  3LAY A;  2EIM C;  4H4K C;  2DYR C;  4XPY A;  3AG2 C;  5A6B A;  3LS1 A;  4MVU A;  1HE9 A;  1Z6A A;  2J45 A;  2XL6 A;  4DVY P;  1TWH A;  2XSE A;  3B9Q A;  3O6X A;  4YL0 A;  3UGP A;  1PCX A;  4O7G A;  1M6T A;  2JX0 A;  5JS5 A;  3HNL A;  3HTK C;  4WGY A;  3W4Y A;  3I4U A;  1T6U A;  2D5R B;  4PJJ A;  3LUT B;  1NFN A;  4LLC A;  1NBB A;  2C04 A;  1TR2 A;  1C03 A;  4EKW A;  3C8G B;  4EUK B;  1M2O A;  3JT1 A;  4FES A;  3S29 A;  5DS6 A;  4CDA A;  3QW0 A;  4C7O A;  2IXP A;  3NYJ A;  3BRJ A;  5AC5 A;  1NG1 A;  2Y3G A;  3M79 A;  4XLN F;  2XLH A;  2CNW A;  3EFO A;  1OR2 A;  3DAF A;  3L1M A;  2LD6 A;  3V5Z A;  1OCR C;  4BEM J;  3CQZ A;  4UDV A;  2CCY A;  3K1H A;  3M4B A;  5DQZ A;  1WAT A;  2AVK A;  2EIK C;  3FXH A;  2H8A A;  3R2P A;  2Y69 C;  2OEX A;  5F5H A;  1ST6 A;  5CI9 A;  3X1O A;  5A6A A;  3WOD F;  1D1C A;  3OEO A;  3DJN B;  4ER9 A;  4IJJ A;  1VMA A;  3EH1 A;  5FCL A;  3TQO A;  4ZLD A;  3NDB B;  2Q9C A;  4BPM A;  2JD3 A;  3GEH A;  3ZQY A;  2WVO A;  1IZM A;  2ZXO A;  1V54 C;  1GM5 A;  3EGD A;  3ABM C;  3EFO B;  3POV A;  1LKX A;  3N24 A;  1JAF A;  4MTF A;  4NTF A;  1NU9 C;  1RXQ A;  3IEE A;  4P9F A;  1CPQ A;  2AWY A;  5T3T A;  2Q4F A;  4JTD B;  4N4W A;  4W8K A;  3VRC A;  3LS0 A;  3TD7 A;  1WTY A;  4B6I A;  3SEO A;  3LNR A;  5KYX A;  2Q9B A;  2A0U A;  4OIP F;  3NRH A;  4AL1 A;  3PHF 2;  2B0J A;  1Z7Q c;  2Y39 A;  1LVK A;  1T01 A;  1ZVZ A;  3ZC4 A;  1I5N A;  1O3U A;  4DJ9 A;  3NMJ A;  4I1O B;  3O10 A;  3VF0 A;  2EPN A;  3EGD B;  4HFF B;  1RKE A;  3US6 A;  2XM0 A;  3AQB A;  2LIG A;  2NSG A;  3DKA A;  1A7V A;  2LFD A;  1M57 C;  1BR2 A;  1VOM A;  1K04 A;  3B0P A;  5TJ5 E;  2KQ9 A;  3ZWI A;  4WAB A;  4C3B A;  2A6H F;  1D1A A;  5KYX B;  4CJO A;  4E18 A;  5F28 E;  1TWA A;  3ZDL A;  1O5H A;  1EA8 A;  4DRH B;  3DXJ F;  3QZC A;  4ULW A;  2FAP B;  2HZ8 A;  1RJ9 A;  1WWP A;  5B3I A;  1K40 A;  3L34 A;  1YYX A;  1RKE B;  1LS4 A;  1YLM A;  1YZC A;  2A68 F;  3DI5 A;  1G5Z A;  4EBJ A;  3G50 A;  1CPR A;  2GAQ A;  1BZ4 A;  2WZG A;  1HW2 A;  1CGM E;  3AGU A;  3Q7L A;  3Q7G A;  4ZLC A;  4E0I A;  4XEF A;  2PFD A;  3EH2 A;  1IW7 F;  2P6V A;  3EG9 A;  4NC3 A;  1R4T A;  1HMO A;  1T6I A;  5KYN A;  1MQV A;  1YJG A;  1F1M A;  3NKD A;  1C02 A;  2YLD A;  4J30 B;  1JMW A;  1TWC A;  4XPW A;  2J46 A;  2WL8 A;  2V3C C;  4QDL A;  2ASR A;  5K0I A;  3DM5 A;  3EJN A;  4JEB A;  4PJN A;  3UMK A;  4PJL A;  3ABK C;  1DOW A;  3T9O A;  3CZ6 A;  4GYT A;  1EQ1 A;  1NU7 D;  2CYD A;  1CGO A;  1QZX A;  2OOC A;  3L8I A;  4E17 A;  1VTM P;  4BJ1 A;  2ZXR A;  2PF4 E;  3M15 A;  3U8V A;  1K05 A;  3KH2 A;  3W2V A;  3SNH A;  2NUT A;  1Q0F A;  4YT8 A;  1C17 M;  2W4B A;  1LI7 A;  2ETS A;  2YL1 A;  4IAQ A;  1TKN A;  4JTA B;  3H2V A;  2J0W A;  3O39 A;  3CSK A;  4FAP B;  2XL4 A;  4U5D E;  5BUO A;  4JEA A;  3RIP A;  4IWB A;  1ZW3 A;  2NG1 A;  4I3M A;  4R32 A;  4XPX A;  1OW7 A;  2LK4 A;  2PP4 A;  1AVO B;  2GDC A;  1Z23 A;  2UUH A;  4N06 A;  1V55 C;  2KNH A;  3R7C A;  4RBN A;  1A7D A;  3QW1 A;  1UG7 A;  1SMY F;  4JC7 A;  4JCZ A;  5DVW A;  2BE5 F;  2IOQ A;  3HNJ A;  3B29 A;  3PCV A;  3U2M A;  2YL3 A;  4YK5 A;  3U8P A;  2NUT B;  4LDK A;  1V4A A;  2L6G A;  1N1C A;  3HNI A;  3U2L A;  3VM6 A;  1G8X A;  1LIH A;  5L3Q A;  1QVX A;  2CGE A;  3SXK A;  1OR3 A;  4NQF A;  2IXO A;  3FOP A;  3S9O A;  1ZYR F;  3EQL F;  1ORS C;  5EHH A;  4MW8 A;  4DRI B;  2EPK X;  1HMD A;  2OG2 A;  4OD4 A;  2D4U A;  5JUA A;  1O87 A;  1JPN A;  3DM9 B;  5B1A C;  1OW6 A;  2I15 A;  4F4B A;  2Q9A A;  1LM3 B;  4X0R A;  4YT5 A;  1YDI A;  3S90 A;  2R7S A;  3KKB A;  3GEI A;  2XM4 A;  3DWW A;  5L0F A;  3UMI A;  2Y3D A;  2H7V C;  3FOO A;  5JP7 A;  3B0V C;  4L6R A;  5KYW B;  2GFH A;  2M4E A;  2YL0 A;  1EI7 A;  1NLX A;  2EPO A;  1W2W A;  2MWQ A;  4JE9 A;  1G4W R;  256B A;  3GOD A;  1QQ3 A;  4JW1 A;  4PAC A;  4PK4 A;  5AC4 A;  4DXW A;  1VYI A;  2YVK A;  4J7T A;  4IB4 A;  2OJQ A;  3T6B A;  2UUI A;  2XLW A;  2OKU A;  4YT2 A;  2KW3 C;  4MTG A;  4P6I C;  4U5G A;  3TOM A;  4BJT A;  1AUE A;  1A0B A;  2KC3 A;  3LNM B;  4KNW A;  4CSA C;  1QLE C;  1SF8 A;  2P61 A;  3JYH A;  4M63 A;  4GEH A;  4BJ5 A;  5A6J A;  2PX3 A;  4JKV A;  4YN0 B;  2F22 A;  5HV9 A;  3PMR A;  3EGX A;  2OJE D;  2YWA A;  3VYW A;  3ATP A;  3MX3 A;  2H7O A;  1VLS A;  4RD9 A;  2B0H A;  2BL2 A;  2KJG A;  4DRJ B;  1V74 B;  3EZH A;  4LER A;  3TUL A;  1M2V A;  1ZU5 A;  2IYL D;  2MYS A;  1EKY A;  1OCZ C;  1VYK A;  3MLG A;  1Q0M A;  3CEX A;  1I4Z A;  2LFF A;  3UNG C;  4CS8 C;  1TFK B;  4HEA J;  2Q3T A;  3U0C A;  3C18 A;  1JOG A;  4NCQ A;  2CDQ A;  4YJW A;  1ZW2 A;  2P7V A;  3JRM O;  3FAJ A;  4JTC B;  4Q4Z F;  1BDJ B;  1S05 A;  1VLT A;  3T4R A;  2J7P D;  2R03 A;  4U5E E;  3EGX B;  1Q0D A;  1MMD A;  4HE8 D;  4O6Y A;  4A2N B;  3AGT A;  4U5C E;  4CS9 A;  1GS9 A;  1TFO B;  2HMZ A;  3C7J A;  4JRZ A;  4KC9 A;  3SP1 A;  1M2V B;  2L81 A;  3DJU B;  3MYI A;  1L7C A;  1GQA A;  2HSQ A;  2XRH A;  3HNK A;  4LLE A;  2G3V A;  3EZI A;  4CJG A;  3Q6M A;  4CX9 A;  2R7R A;  1KTM A;  2YQY A;  4IAO A;  1U0B B;  2Y3H A;  4DVZ A;  2M64 A;  5L0J A;  3G4Z A;  4O6M A;  2HS5 A;  3L0I A;  4FX5 A;  2O9X A;  1RKC A;  3I5P A;  4PFP A;  1OCO C;  1XZQ A;  1ZZP A;  2A0B A;  2XLO A;  1BR1 A;  2J9B A;  1RCP A;  3GWN A;  2BC5 A;  4Z9H A;  2MHR A;  2R7V A;  2RSE B;  5L0G A;  3NYL A;  1ZHW A;  5L3V A;  3V7O A;  3KMI A;  4EIY A;  2AWC A;  3SXM A;  4DBR A;  4OIQ F;  5DQT A;  3S84 A;  4XQ1 A;  1Q0K A;  3W8I A;  5KYY B;  2R7U A;  4AL0 A;  1KU2 A;  1MND A;  2Z15 A;  1GGQ A;  3C8G D;  5DS4 A;  3NKE A;  5FZT A;  4ANJ A;  2PX0 A;  1FFT C;  3ITF A;  3K66 A;  4K0D A;  5HSW A;  3C63 A;  1LE2 A;  3AOU A;  2H7B A;  4DBQ A;  3W8H A;  5A6B D;  2JPU A;  3RF3 A;  2IXN A;  3JRT A;  4EBK A;  3TJ5 A;  3EHM A;  4MVR A;  3UR3 C;  1XWJ A;  2EPL X;  3HLZ A;  1MMN A;  3DE9 A;  4QI2 A;  3X2Q C;  2VH3 A;  3AG1 C;  1T6Q A;  1UFB A;  2XLM A;  1QPU A;  3LES A;  2Y3B A;  1MMG A;  1WAS A;  2Q00 A;  3EHN A;  2WZL A;  3GM1 A;  3LLK A;  3QMK A;  4G7Z F;  4OIR F;  3FVY A;  5T3W A;  3KL4 A;  3WG7 C;  4CDV A;  4E0H A;  4E7Z A;  2WB7 A;  3FDQ A;  1PD1 A;  1E84 A;  3JCU Q;  1Y4C A;  4NY3 A;  2HV6 A;  2G62 A;  4ULV A;  3U9M A;  2R7T A;  1ZHT A;  4U5F E;  2CNW D;  3ECS A;  4NTA A;  3NMK A;  3IHU A;  1SR2 A;  2P1A A;  1LPE A;  5COG A;  3JSE O;  1ZHX A;  2VB6 A;  2KSF A;  2HJ3 A;  3BEH A;  3H65 A;  5E3C A;  5JT4 A;  1D1B A;  1TQG A;  2DYS C;  4PR9 A;  1L3P A;  3GM3 A;  3OWT A;  5B1B C;  3S28 A;  2DI3 A;  2X51 A;  3W2W A;  1VB5 A;  2GA0 A;  3LEV A;  2PNO A;  3U5S A;  3U9J A;  4CIP A;  3SYN A;  5JLI A;  2AU5 A;  4FWV A;  2EIJ C;  3IQC A;  2OCC C;  5B3S C;  3DE8 A;  4QI0 A;  1JPJ A;  2VC9 A;  3K1I C;  3OA1 A;  3S27 A;  1FR0 A;  2J9W A;  3ZVR A;  2J9U A;  1JRA A;  2HKV A;  1ORY A;  1ZHZ A;  1YVI A;  4CDY A;  4LDR A;  1YA7 O;  1OKK D;  3K33 A;  2L6F A;  5KYU B;  2HUJ A;  3FHD A;  1YA9 A;  1FMW A;  3E9V A;  3AG3 C;  3WHN A;  3FMS A;  4JJG A;  4BJ6 C;  3V5X A;  1FFH A;  2IBF A;  2VCB A;  1Z5Z A;  1HW1 A;  5KYW A;  2R05 A;  2QNL A;  3IPM O;  4I1M A;  4G78 A;  5JSL A;  4RDA A;  4I44 A;  3GAN A;  2W45 A;  2LSE A;  2PBE A;  1H7I A;  1A41 A;  1E2X A;  1Y6D A;  2WVQ A;  2V26 A;  1H9T A;  2ICW G;  1A7E A;  3RVY A;  2FFH A;  4YL1 A;  5CIV A;  5L0D A;  2R7W A;  4Z9J A;  3RW0 A;  2J8W A;  4MVQ A;  4JVS A;  4MVM A;  5D91 A;  3DAG A;  3RYL A;  4OIO F;  3ZG1 A;  5BQI A;  2QTV A;  5L0I A;  2VAS A;  1B68 A;  4AX2 A;  1QKR A;  1WN0 A;  3LJB A;  1YAR O;  2QUP A;  1FNT c;  1VK5 A;  2G3K A;  1Z63 A;  2IXM A;  3U3F A;  4YWQ A;  2IM8 A;  3T6G B;  4KI2 A;  3WAQ A;  2YRF A;  3GWL A;  3QTH A;  3AJM A;  3GEE A;  1E86 A;  2YKZ A;  5AGF A;  2I8B A;  3MYF A;  3TOL A;  3KYI A;  1RMV A;  3ZSU A;  2YLI A;  1OXB A;  1WOL A;  1J8M F;  4G0H A;  2WZF A;  4OD5 A;  1OW8 A;  1FMV A;  3ASN C;  3CAX A;  2HJM A;  3H2U A;  1H6G A;  3S0X A;  2HV7 A;  1XZP A;  4D4N A;  2HMQ A;  3DD7 A;  4EWC A;  3I5Q A;  2VCC A;  2XLV A;  3SZR A; 
#chains in the Genus database with same CATH homology
 4CS7 A;  4JJF A;  3RH3 A;  2R7X A;  4XWJ A;  4Q5S F;  2DGJ A;  4JUR I;  4AK9 A;  1J8Y F;  2YEV A;  4PFO A;  4BJ6 A;  1BR4 A;  3LLI A;  5KYY A;  1D0Z A;  2W4M A;  4C3D A;  4Q7C A;  2J0X A;  3NYM A;  4C7O B;  3RFY A;  3EPV A;  3JSZ A;  3Q6N A;  1NZE A;  2ZXP A;  3UMH A;  1FTS A;  5E3A A;  3F46 A;  1OKK A;  2CW0 F;  2KGO A;  2R7O A;  3DMD A;  1MNE A;  4BEJ A;  2NUP A;  4K7B A;  4KNV A;  3ASO C;  2XXA A;  4O6N A;  2J9V A;  3AG4 C;  4O79 A;  3B0U X;  4JCH A;  1OCC C;  4EBB A;  1LS1 A;  3N2Z B;  4CSA A;  2EIL C;  3AQC A;  2W9Y A;  4IRU A;  4MQ9 F;  4XLP F;  2NUP B;  4KBL A;  4XTK A;  4C3E A;  3DZA A;  5EGY A;  2XXA B;  3ABL C;  1ZHY A;  3N0T A;  1ZU4 A;  2QY9 A;  3E70 C;  4CS8 A;  2EIN C;  2L9J A;  5IY5 C;  5KYU A;  5E2Q A;  1TWG A;  5T1D B;  1MMA A;  4WJ0 A;  3ZIB A;  4J32 B;  5DLJ A;  2FGY A;  4JZA A;  4OIN F;  1RJ9 B;  1WGW A;  4G7H F;  2ZPA A;  3HJC A;  4CBE A;  3RKO F;  3NG1 A;  1S7Z A;  3K7D A;  2J7P A;  4BJ5 C;  2R7Q A;  1SZI A;  3EG9 B;  2YHS A;  5E33 A;  3T6J A;  2YZS A;  2A69 F;  2E87 A;  4U5B E;  2A6E F;  4MND A;  4DOZ A;  3K6B A;  1Z3I X;  3F47 A;  1M56 C;  5D92 A;  3M1C B;  4AE4 A;  4BG0 A;  1D0Y A;  4HFK B;  2A1D D;  4U5H A;  4CIH A;  4E7S A;  2C03 A;  4PJM A;  5DS5 A;  5F5F A;  2WVN A;  4YT4 A;  3VAY A;  1PD0 A;  5CI8 A;  4CS9 C;  3UGO A;  4LAC B;  2ZXW C;  1D0X A;  4AE4 B;  3LAY A;  2EIM C;  4H4K C;  2DYR C;  3AG2 C;  3LS1 A;  1Z6A A;  2J45 A;  4DVY P;  1TWH A;  2XSE A;  3B9Q A;  3O6X A;  3UGP A;  1PCX A;  4O7G A;  3HTK C;  3I4U A;  2D5R B;  4PJJ A;  4LLC A;  2C04 A;  1TR2 A;  1M2O A;  3JT1 A;  4FES A;  3S29 A;  4C7O A;  2IXP A;  3NYJ A;  1NG1 A;  2Y3G A;  4XLN F;  3EFO A;  2CNW A;  3DAF A;  1OCR C;  3CQZ A;  3K1H A;  5DQZ A;  2EIK C;  3X1O A;  2Y69 C;  5F5H A;  1ST6 A;  5CI9 A;  3WOD F;  1D1C A;  3OEO A;  3DJN B;  4IJJ A;  1VMA A;  3EH1 A;  5FCL A;  4ZLD A;  3NDB B;  2Q9C A;  2JD3 A;  2WVO A;  1IZM A;  2ZXO A;  1V54 C;  3EGD A;  3ABM C;  3EFO B;  1LKX A;  3N24 A;  1NU9 C;  3IEE A;  5T3T A;  4W8K A;  3LS0 A;  3TD7 A;  4B6I A;  3SEO A;  3LNR A;  5KYX A;  2Q9B A;  4OIP F;  3NRH A;  3PHF 2;  2B0J A;  5DS6 A;  2Y39 A;  1LVK A;  3ZC4 A;  4I1O B;  3EGD B;  4HFF B;  3AQB A;  1M57 C;  1BR2 A;  1VOM A;  3B0P A;  2KQ9 A;  4C3B A;  2A6H F;  1D1A A;  5KYX B;  1TWA A;  1O5H A;  3DXJ F;  3QZC A;  4ULW A;  1RJ9 A;  3L34 A;  2A68 F;  2WZG A;  3Q7L A;  3Q7G A;  4ZLC A;  2PFD A;  3EH2 A;  1IW7 F;  2P6V A;  3EG9 A;  5KYN A;  3NKD A;  4J30 B;  1TWC A;  2J46 A;  2WL8 A;  2V3C C;  4QDL A;  3DM5 A;  3EJN A;  4PJN A;  3UMK A;  4PJL A;  3ABK C;  3CZ6 A;  4GYT A;  1NU7 D;  1QZX A;  4BJ1 A;  2ZXR A;  2PF4 E;  3KH2 A;  3W2V A;  3SNH A;  2NUT A;  4YT8 A;  2W4B A;  1TKN A;  2J0W A;  3O39 A;  3CSK A;  2XL4 A;  4U5D E;  5BUO A;  3RIP A;  4IWB A;  2NG1 A;  4I3M A;  2PP4 A;  4N06 A;  1Z23 A;  1V55 C;  2KNH A;  4RBN A;  1SMY F;  5DVW A;  2BE5 F;  2IOQ A;  2NUT B;  1N1C A;  1G8X A;  5L3Q A;  2CGE A;  2IXO A;  1ZYR F;  3EQL F;  5EHH A;  2OG2 A;  4OD4 A;  1O87 A;  1JPN A;  3DM9 B;  5B1A C;  4F4B A;  2Q9A A;  4X0R A;  4YT5 A;  2R7S A;  3KKB A;  3UMI A;  2Y3D A;  2H7V C;  3B0V C;  5KYW B;  2GFH A;  2M4E A;  1W2W A;  2MWQ A;  4PK4 A;  3GOD A;  4JW1 A;  1VYI A;  3T6B A;  4YT2 A;  2KW3 C;  4P6I C;  4U5G A;  4BJT A;  4CSA C;  4KNW A;  1QLE C;  1SF8 A;  3JYH A;  4M63 A;  4GEH A;  4BJ5 A;  2PX3 A;  4YN0 B;  3PMR A;  3EGX A;  3VYW A;  3MX3 A;  2H7O A;  4RD9 A;  2KJG A;  4LER A;  3EZH A;  1M2V A;  1ZU5 A;  2IYL D;  2MYS A;  1OCZ C;  1VYK A;  3MLG A;  3UNG C;  4CS8 C;  4HEA J;  2Q3T A;  2CDQ A;  4YJW A;  2P7V A;  3FAJ A;  4Q4Z F;  3T4R A;  2J7P D;  4U5E E;  3EGX B;  1MMD A;  4HE8 D;  4O6Y A;  4A2N B;  4CS9 A;  4U5C E;  4KC9 A;  3SP1 A;  1M2V B;  2L81 A;  3DJU B;  2XRH A;  4LLE A;  2R7R A;  2G3V A;  3EZI A;  3Q6M A;  4IAO A;  2Y3H A;  4DVZ A;  4O6M A;  3L0I A;  4FX5 A;  4PFP A;  2O9X A;  5B1B C;  3I5P A;  1OCO C;  2R7V A;  1BR1 A;  3NYL A;  1ZHW A;  5L3V A;  3V7O A;  3KMI A;  4DBR A;  4OIQ F;  5DQT A;  3W8I A;  5KYY B;  2R7U A;  1KU2 A;  1MND A;  2Z15 A;  5DS4 A;  3NKE A;  4ANJ A;  2PX0 A;  1FFT C;  3ITF A;  3K66 A;  4K0D A;  5HSW A;  2H7B A;  4DBQ A;  3W8H A;  2IXN A;  3JRT A;  3EHM A;  3UR3 C;  3HLZ A;  1MMN A;  4QI2 A;  3X2Q C;  2VH3 A;  3AG1 C;  3LES A;  2Y3B A;  1MMG A;  3EHN A;  2WZL A;  3LLK A;  3QMK A;  4G7Z F;  4OIR F;  3FVY A;  5T3W A;  3KL4 A;  3WG7 C;  4E7Z A;  2WB7 A;  3FDQ A;  1PD1 A;  3JCU Q;  4NY3 A;  2HV6 A;  2G62 A;  2R7T A;  1ZHT A;  4U5F E;  2CNW D;  3ECS A;  1ZHX A;  2VB6 A;  3H65 A;  5E3C A;  1D1B A;  2DYS C;  3OWT A;  3S28 A;  3W2W A;  2X51 A;  3LEV A;  3POV A;  3SYN A;  4FWV A;  2EIJ C;  2OCC C;  5B3S C;  4QI0 A;  1JPJ A;  3K1I C;  3OA1 A;  3S27 A;  2J9W A;  3ZVR A;  2J9U A;  1ZHZ A;  1OKK D;  3K33 A;  5KYU B;  4G7O F;  3FHD A;  3E9V A;  1FMW A;  3AG3 C;  4JJG A;  4BJ6 C;  1FFH A;  1Z5Z A;  5KYW A;  4I1M A;  4RDA A;  4I44 A;  3GAN A;  2W45 A;  2LSE A;  2WVQ A;  2V26 A;  2FFH A;  2R7W A;  4JVS A;  5D91 A;  3DAG A;  3RYL A;  4OIO F;  3ZG1 A;  2QTV A;  2VAS A;  4AX2 A;  3LJB A;  1VK5 A;  2G3K A;  1Z63 A;  2IXM A;  4YWQ A;  4KI2 A;  2I8B A;  3ZSU A;  4G0H A;  1J8M F;  2WZF A;  4OD5 A;  1FMV A;  3ASN C;  3S0X A;  2HV7 A;  3DD7 A;  4EWC A;  3I5Q A;  3SZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...