3DJNB

Crystal structure of mouse tis21
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
118
structure length
118
Chain Sequence
DMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSRALQDALTDHYKHHWFPEKPSKGSGYRCIRINHKMDPIISKVASQIGLSQPQLHRLLPSELTLWVDPYEVSYRIGEDGSICVLYEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Protein BTG2
publication title Crystal structures of human BTG2 and mouse TIS21 involved in suppression of CAF1 deadenylase activity
pubmed doi rcsb
source organism Mus musculus
total genus 35
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3djnB00
3DJNB 5CI8A 2Z15A 5CI9A 3E9VA 3DJUB 2D5RB
chains in the Genus database with same CATH superfamily
2OG2A 1YDIA 2EPKX 4U5EE 2BL2A 1SYQA 1IZMA 4MVOA 1RKCA 4DOZA 1NFNA 2GA0A 3GANA 2KC3A 3K66A 4JE9A 1CPQA 1T5OA 4NTAA 2EPOA 2YLIA 4OIPF 5JP7A 1M56C 1ZZPA 5FZTA 2P6VA 1WTYA 3R7CA 4DVZA 4I3MA 4Q5SF 1A7EA 3C7JA 4AX2A 4FAPB 2R03A 1Q0KA 3EHNA 2VCAA 5AGFA 3O10A 5KYXA 2GWWA 2R25A 1SR2A 5B3IA 2W4MA 1HE9A 1LIHA 5KYYB 2PX0A 2OJQA 4Q4ZF 3VF0A 3IPMO 1WGWA 3W8IA 3UMHA 2OKUA 4DRHB 2YL0A 3B0UX 4MW3A 5A6BD 3I5QA 2W45A 4RD9A 3O6XA 4U5HA 4EKWA 3Q7GA 3U2MA 2CW0F 1PCXA 3EZHA 4H4KC 2ASRA 2BC5A 3MLGA 1JPJA 2GDCA 2P61A 4LDRA 3TK0A 2HSBA 4CBEA 2DYRC 5FCLA 2VC9A 2A1DD 4GQHA 1JRAA 4JTAB 4XLNF 2A0BA 4XPWA 4MS2A 3ZIBA 1OXBA 4LLCA 3RVZA 5A69A 1M2OA 3QVZA 2XXAA 4DBQA 2LIGA 3E70C 1TFOB 2DYSC 3IQ6A 1BDJB 1QSPA 3LAYA 3UGPA 1CGME 3Q6MA 4YL3A 4XTKA 1NU7D 3VM6A 4MVZA 5COFA 3WHNA 2LFDA 2VCBA 4KNWA 4KNVA 4LLEA 4MVRA 2NG1A 1UFBA 2PP4A 4LDKA 3LLIA 2WZFA 3EJNA 4JRZA 4MVSA 3ATPA 2L6GA 2IBFA 1QLEC 3MX3A 3DAGA 4J7YA 3TJ5A 3K6BA 2NUTB 3F47A 3Q7LA 3H65A 3U3BA 5DS4A 1AVOB 4N6CA 4KI2A 2J9UA 3GWLA 1PV3A 4HFFB 3RQGA 1Z6AA 3EG9B 2XLEA 3KPHA 5F5HA 4K1OA 4LDQA 4OINF 5EGYA 4G7ZF 1MMGA 4JTCB 5DS5A 2M64A 2ZXOA 5T1DB 1RXQA 1C03A 1OW7A 3EGXB 3LS1A 4MTOA 4C3DA 1E86A 3DJNB 1M57C 3B71A 2E87A 4NTFA 2Q00A 1OKKD 2CYDA 2Q3TA 3T9OA 1JPNA 1GS9A 4PJNA 2YHSA 3U9JA 2WVQA 1SZIA 3EGDA 5IY5C 4ULWA 3SZRA 2G3KA 2H7OA 1V4AA 3MYIA 4AK9A 2J9BA 2X51A 2Y3GA 1G4US 3DM9B 2R7TA 3H2UA 1JR8A 2Y3DA 2A0UA 3JYHA 4CJOA 4Z9IA 1LKXA 4R32A 2D5RB 1APCA 2EIKC 4AE4B 2VH3A 2HZ8A 1VLTA 2IXOA 2KSFA 3W2VA 4OIRF 4E0HA 3PHF2 2W9YA 4QDLA 4YT8A 4JW1A 4Z9HA 1TWCA 1R4TA 2MHRA 3QW1A 4P9FA 1V55C 3UNGC 4A4AA 3FMSA 5B1BC 2C04A 4JZAA 3RKOF 1T01A 1ZW3A 5L3QA 3G50A 4NTBA 1CGOA 1H6GA 4ER9A 3PCVA 1MNDA 3C8GA 4C3BA 2DB4A 3DI5A 3UMKA 1RJ9A 3GM1A 4G78A 4XEVA 3NMIA 3SXMA 3U8VA 3FHDA 3LEVA 3T6BA 1E2XA 3EPVA 1MMNA 4IAQA 5K0IA 4N4WA 5CI8A 2XS1A 5EHHA 3RFYA 2QLAA 3F46A 5JUAA 2L6FA 1LE2A 2R9RB 4JTDB 2ICWG 1OQCA 2HMQA 3EH1A 1MQVA 5B1AC 4EWCA 1T9KA 2YVKA 3VYWA 2Q7RA 1ZU4A 5AC5A 1U89A 3X2QC 2R7OA 2LFFA 3LEOA 4EUKB 2XL8A 3JRTA 3RQFA 2WVOA 3A9CA 1BR1A 3VRCA 3ZQVA 1YA9A 4EIYA 2GAQA 5KYWB 3U9MA 5AC4A 5A6KA 4XQ1A 256BA 1A0BA 2OOCA 3C62A 3DJUB 3N0TA 3JTLO 2CCYA 1XWJA 4OD5A 1ZHWA 3RIPA 3ZTMA 4DBRA 1E85A 4XEFA 2XLWA 4IRUA 3U8PA 5KYUB 1RCPA 1BZ4A 1QQ3A 1VYKA 1ZVZA 4U9DA 2M4EA 1Y6DA 1AUEA 2EIMC 3TULA 3FOOA 2AP3A 1V54C 3MFNA 3FVYA 3EFOA 1LM3B 1YAUO 2H8AA 4O6NA 5L0IA 4JVSA 4JKVA 1TWGA 4BEMJ 2IXMA 2LK4A 2CDQA 3RH3A 2JX0A 1RMVA 1ST6A 1WN0A 1DOVA 1K05A 1RKEB 3G4ZA 4PACA 1FNTc 1XZPA 2IM8A 4GYTA 1WATA 3S28A 4GEHA 1TKNA 1FFTC 2XLHA 3PDMP 3JT1A 1JAFA 2EPLX 2OEVA 2XM4A 4XWJA 1B68A 1TFKB 2WVNA 3ZVRA 1TR2A 3AGUA 1U6HA 3GWNA 3T4RA 3TOLA 5L0FA 2EILC 4O6YA 1G8XA 1PD1A 1R5ID 2Q9BA 4O79A 3T6JA 3HJCA 3IQ5A 1YYJA 3US6A 4CS9C 3W8HA 4YT2A 3KKBA 5HSWA 3FDQA 3DE9A 3DZAA 3E9VA 4M63A 1S05A 4JCZA 4Q7CA 4CS9A 1NU9C 2IOQA 1ZHZA 4CS8C 1MMDA 2YZSA 1Z63A 2Z15A 1EKYA 2L7AA 3K1IC 5DQZA 3M4CA 1Z5ZA 2P0NA 4CS8A 1LS4A 3V5XA 4YWQA 5KYYA 1H9TA 3RF3A 4CDAA 2P7VA 2LSEA 3BRJA 3KYIA 2KNHA 5D91A 3CAXA 3QTHA 3U3FA 4PK4A 1AEPA 5COGA 5TJ5E 1KU2A 3UR3C 3VAYA 4AL0A 3CQZA 3ZQYA 5JLIA 2IXPA 2R7UA 2WZLA 3L1MA 2Y69C 5F28E 3TOMA 3WG7C 1YZAA 3M1CB 1NLXA 2CGEA 4I1OB 4ULVA 1FTSA 2HJ3A 3AQCA 2IYLD 2RD9A 1GQAA 3GEEA 3J06A 1U0BB 5KYNA 3S0XA 3IQCA 3IEEA 3C8GD 1D1CA 2EPMX 1Q0GA 2KGOA 3B0PA 3B9QA 3AG4C 1G4WR 3V7OA 4E17A 4JC7A 2UUIA 3I4UA 1LPEA 2X0CA 3L8IA 1H7IA 1Z3IX 2W4BA 4J7TA 5A6JA 1A41A 1ORSC 3EH2A 3O55A 3U0CA 2V3CC 4PJMA 2R7SA 1D1AA 4LACB 4OIOF 1FAPB 3H2VA 2NUTA 3SYNA 1E84A 3SXZA 2YEVA 3FAJA 1VLSA 3OWTA 4X0RA 2L6HA 5COMA 5BQGA 4DRIB 3EG9A 2LP4A 1OCOC 4FX5A 3U2LA 4U5CE 1V74B 1BBHA 4YT5A 3ZDLA 3LESA 3JCUQ 3EGXA 4BJ5C 2OEXA 1MMAA 1FMVA 1M2VB 4FESA 2C03A 1KNYA 4BJ5A 1ZU5A 5BUOA 1O3UA 2J9WA 2HUJA 3DAFA 1PD0A 2B0JA 1A7VA 1D1BA 3SXYA 2A69F 3IHUA 4AL1A 1HW2A 2QY9A 2J7PA 1OCRC 3FOPA 2KK1A 2HV7A 4IGGA 4OD4A 2YKZA 3EQLF 3PMRA 2Q4FA 2AVKA 4NQFA 3S27A 5B3SC 3V5ZA 1S7ZA 1T6IA 1M6TA 1T6UA 5E2QA 2NSFA 3JSEO 3L34A 1YVIA 2FFHA 4YL0A 4EBKA 2YWAA 4AE4A 4K7BA 1C02A 1QVXA 2YL1A 3S84A 3NG1A 1OR3A 1L3PA 2PF4E 3ZWIA 2NPUA 4CS7A 3GODA 1HE1A 2HV6A 3LUTB 1EI7A 1NSGB 3SNHA 3NYMA 2QE9A 2L81A 3ZG1A 1Z7Qc 4K0DA 1ZW2A 3ASOC 4ANJA 4EBJA 3HNIA 2H7BA 2DI3A 3RVYA 2A6HF 4G7OF 2G62A 4CSAC 3KH2A 4KBLA 3LLKA 1KTMA 4W8KA 4CSAA 3CSKA 1SMYF 3ZC4A 3N2ZB 4MVQA 1D0YA 2ZD9A 4E7ZA 3ZTZA 1CPRA 2R7QA 2LCHA 4RBNA 1I5NA 4JCHA 2J45A 4U5GA 3HNKA 3HKKA 1ZHXA 4C7OB 1I4YA 4P6IC 4DJ9A 3B0VC 1D0ZA 2J46A 3ECSA 4MTGA 2YLGA 1J8MF 3GORA 1WASA 2HS5A 2OCCC 3DM5A 2NUPB 4YJWA 1L7CA 3AG2C 4BG0A 4XPXA 3C8ZA 4JJFA 4BJTA 1FFHA 5KYWA 2YRFA 3GEHA 2R02A 3DMDA 4U9EA 4LERA 1OCCC 2R7VA 4MNDA 4E7SA 3KMIA 3K7DA 4J30B 5JSLA 2KQ9A 4XEKA 5KYUA 3FXHA 2P1AA 4N06A 3RW0A 5L0CA 3EHMA 3X1OA 4G7HF 1HMOA 1K40A 2YL3A 5E3CA 4XLPF 5F5FA 4BJ1A 3MBGA 1Q0MA 2ETSA 2HMZA 4MTFA 1Q0FA 2XLOA 2LQGA 2YQYA 3QMKA 4QI2A 4E18A 5EK0A 1YA7O 1K04A 3B29A 4RDAA 3GM2A 4PJLA 1RKEA 3DE8A 4XPYA 1IW7F 3LJBA 4YN0B 5HV9A 2EPNA 4U5DE 3JRMO 1HW1A 2XM0A 3V5YA 1XZQA 2CNWA 2ZXWC 1F1MA 4ZLDA 1JMWA 4MVUA 1LI7A 2J9VA 4N6HA 3L0IA 4HEAJ 3AQBA 4W8PA 2Q9CA 2XSEA 2LD6A 2VASA 3S90A 4DVYP 2V26A 3AJMA 5KYXB 1LVKA 4EBBA 1OW8A 3I5PA 3N24A 5JVEA 1FR0A 4FWVA 5T3WA 3UGOA 3K1IA 4C3EA 2WB7A 4MVMA 3SXKA 1ZHYA 1QKRA 1YARO 4E0IA 2ZXPA 3EZIA 2J7PD 3O39A 4WJ0A 2ZXRA 4WGZA 1ORJA 4ZLCA 1ORYA 3AGTA 1LI5A 4YT4A 3CZ6A 4CJGA 1BR2A 2G3VA 1D0XA 2YL7A 4DRJB 1YZCA 1TWAA 2XL4A 2XLDA 1QPUA 4A2NB 3DD7A 4JIOA 4DXWA 3DKAA 4JJGA 4P9TA 3WAQA 3ITFA 1YYXA 2Y3HA 4JEBA 4MQ9F 2PFDA 2XXAB 3HNLA 4PFPA 1ZHTA 2XLMA 3L8JA 3POVA 4J32B 2BE5F 3S29A 3G4XA 4B6IA 4NY3A 3M79A 3U5SA 1LE4A 2QUPA 3A11A 4IARA 2JD3A 2QNLA 3M4BA 1VK5A 2I15A 4IJJA 1E83A 1TWHA 1NFOA 4O6MA 4CIHA 1HY5A 4BPMA 1O5HA 3HTKC 1OW6A 1MNEA 1WOLA 3LNRA 1Y4CA 3C63A 4IB4A 5L3VA 4JEAA 4I1MA 1A7DA 3MYFA 5T3TA 1UG7A 5BQHA 1CGNA 3KL4A 3ABMC 1NBBA 3CEXA 5GPGB 3ABLC 2HFIA 3JSZA 5JT4A 4UDVA 1W2WA 4I44A 3LS0A 3K33A 2JPUA 3S9OA 2ZPAA 4NC3A 1G5ZA 3FAPB 4H54A 4ONSA 2PX3A 2AWCA 3NYLA 1I4ZA 2A6EF 2Q9AA 1M2VA 2IXNA 3JYYA 5CI9A 3OA1A 3TQOA 4L6RA 3EGDB 1NZEA 4WGYA 5A6AA 3QW0A 4CIPA 4F4BA 2OQMA 3IQTA 3GEIA 2XLVA 2R05A 5CIVA 1BR4A 2Y3BA 1VB5A 4Z9JA 2AWYA 3RYLA 5JRAA 3SP1A 2EINC 3AG1C 5BQIA 5DQTA 3LNMB 5A6BA 4YK5A 2OU6A 4EHPA 4PR9A 3DWWA 1HMDA 1OXKA 3TD7A 4PFOA 3R2PA 1Q0DA 4D4XA 3Q6NA 4O7GA 4D4NA 5L0GA 1ZYRF 2TMVP 4OIQF 1EA8A 2XRHA 3HNJA 2CNWD 2HSQA 1OCZC 4BJ6C 4BEJA 4WABA 4CDVA 3NKDA 2NSGA 3NDBB 1SF8A 1T6QA 2MWQA 2KYHA 2R7XA 4MW8A 3AG3C 3GM3A 4YL1A 2H7VC 4BJ6A 3ZSUA 3KYJA 1WWPA 3C8GB 1GGQA 1RJ9B 5D92A 2WZGA 1EQ1A 2WL8A 4U5FE 4HE8D 3NMJA 3T6GB 2J0WA 1YLMA 4CX9A 1JOGA 2KJGA 1O87A 1QZXA 4PJJA 1OR2A 1VOMA 1VMAA 2J8WA 2J0XA 4HFKB 2R7RA 4KC9A 4NCQA 2MYSA 4G0HA 4JURI 4U5BE 3QZCA 3ASNC 1TQGA 2O9XA 1H9GA 2PBEA 2A68F 3NMKA 3JZ0A 2GFHA 2B0HA 2HKVA 1C17M 1GM5A 2AU5A 5E33A 5DS6A 1LS1A 2UUHA 2OJED 2Y39A 2R7WA 3W2WA 1J8YF 4CDYA 4IWBA 5L0DA 2PNOA 4C7OA 1DOWA 1VTMP 3C18A 3AOUA 3HLZA 5DVWA 2YLDA 3QVYA 2FAPB 3DXJF 2DGJA 3NKEA 2VCCA 1OKKA 2F22A 2RSEB 2D4UA 2EIJC 2XS8A 2NUPA 3M15A 2KW3C 3BEHA 3W4YA 2VB6A 5JS5A 3WODF 3NRHA 2HJMA 3K1HA 3OEOA 3EFOB 1YJGA 3NYJA 1FMWA 2QTVA 2FGYA 3SEOA 2XL6A 3ABKC 2I8BA 5E3AA 1VYIA 1Z23A 5L0JA 3TJ6A 2L9JA 5L0HA 3UMIA 4QI0A 1NG1A 5DLJA 4IAOA 1N1CA 3RQEA
chains in the Genus database with same CATH topology
2OG2A 4U5EE 1IZMA 4DOZA 3GANA 4OIPF 1M56C 2P6VA 4DVZA 4I3MA 4Q5SF 4AX2A 3EHNA 5KYXA 2W4MA 5KYYB 2PX0A 4Q4ZF 1WGWA 3W8IA 3UMHA 3B0UX 3I5QA 2W45A 4RD9A 3O6XA 4U5HA 3Q7GA 2CW0F 1PCXA 3EZHA 4H4KC 3MLGA 1JPJA 4CBEA 2DYRC 5FCLA 2A1DD 4XLNF 3ZIBA 4LLCA 2XXAA 1M2OA 4DBQA 3E70C 2DYSC 3LAYA 3UGPA 3Q6MA 4XTKA 1NU7D 4KNWA 4KNVA 4LLEA 2NG1A 2PP4A 3LLIA 2WZFA 3EJNA 1QLEC 3MX3A 3DAGA 3K6BA 2NUTB 3F47A 3Q7LA 3H65A 5DS4A 4KI2A 2J9UA 4HFFB 1Z6AA 3EG9B 5F5HA 5EGYA 4G7ZF 1MMGA 5DS5A 2ZXOA 5T1DB 3LS1A 4C3DA 3EGXB 3DJNB 1M57C 2E87A 1OKKD 2Q3TA 1JPNA 4PJNA 2YHSA 2WVQA 1SZIA 3EGDA 5IY5C 4ULWA 3SZRA 2G3KA 2H7OA 4AK9A 2X51A 2Y3GA 3DM9B 2R7TA 2Y3DA 3JYHA 1LKXA 2D5RB 2EIKC 4AE4B 2VH3A 2IXOA 3W2VA 4OIRF 2W9YA 4QDLA 4YT8A 4JW1A 1TWCA 3UNGC 1V55C 5B1BC 2C04A 4JZAA 3RKOF 5L3QA 1MNDA 4C3BA 3UMKA 1RJ9A 3LEVA 3FHDA 3T6BA 3EPVA 1MMNA 5CI8A 5EHHA 3RFYA 3F46A 5B1AC 3EH1A 4EWCA 3VYWA 1ZU4A 3X2QC 2R7OA 3JRTA 2WVOA 1BR1A 5KYWB 4OINF 3DJUB 4OD5A 3N0TA 3RIPA 4DBRA 1ZHWA 4IRUA 5KYUB 1VYKA 2M4EA 2EIMC 1V54C 3FVYA 3EFOA 4O6NA 4JVSA 1TWGA 2IXMA 2CDQA 3RH3A 1ST6A 4GYTA 3S28A 4GEHA 1TKNA 1FFTC 3JT1A 4XWJA 2WVNA 3ZVRA 1TR2A 3T4RA 2EILC 4O6YA 1G8XA 1PD1A 2Q9BA 3T6JA 4O79A 4CS9C 3HJCA 3PHF2 3W8HA 4YT2A 3KKBA 5HSWA 3FDQA 3DZAA 3E9VA 4M63A 4Q7CA 4CS9A 1NU9C 2IOQA 1ZHZA 4CS8C 1MMDA 2YZSA 1Z63A 2Z15A 3K1IC 5DQZA 1Z5ZA 4CS8A 5KYYA 2P7VA 2LSEA 2KNHA 5D91A 4PK4A 3UR3C 1KU2A 3VAYA 3CQZA 2IXPA 2R7UA 2WZLA 2Y69C 3WG7C 3M1CB 2CGEA 4I1OB 1FTSA 3AQCA 2IYLD 5KYNA 3S0XA 3IEEA 1D1CA 2KGOA 3B0PA 3B9QA 3AG4C 3V7OA 3I4UA 1Z3IX 2W4BA 3EH2A 2V3CC 4PJMA 2R7SA 1D1AA 4LACB 4OIOF 2NUTA 3SYNA 2YEVA 3FAJA 3OWTA 4X0RA 3EG9A 4FX5A 1OCOC 4U5CE 4YT5A 3LESA 3JCUQ 3EGXA 4BJ5C 1MMAA 1FMVA 1M2VB 4FESA 2C03A 4BJ5A 5BUOA 1ZU5A 2J9WA 3DAFA 1PD0A 2B0JA 1D1BA 2A69F 2QY9A 2J7PA 1OCRC 2HV7A 4OD4A 3EQLF 3PMRA 3S27A 5B3SC 1S7ZA 5E2QA 3L34A 2FFHA 4AE4A 4K7BA 3NG1A 2PF4E 4CS7A 3GODA 3SNHA 2HV6A 3NYMA 2L81A 3ZG1A 4K0DA 3ASOC 4ANJA 4YWQA 2H7BA 2A6HF 4G7OF 2G62A 4CSAC 3KH2A 4KBLA 3LLKA 4W8KA 4CSAA 3CSKA 1SMYF 3ZC4A 3N2ZB 4E7ZA 1D0YA 2R7QA 4RBNA 4JCHA 2J45A 4U5GA 1ZHXA 4C7OB 4P6IC 3B0VC 1D0ZA 2J46A 3ECSA 1J8MF 4YJWA 3DM5A 2OCCC 2NUPB 3AG2C 4BG0A 4BJTA 4JJFA 5KYWA 1FFHA 3DMDA 4LERA 1OCCC 2R7VA 4MNDA 4E7SA 3KMIA 3K7DA 4J30B 2KQ9A 5KYUA 4N06A 3EHMA 3X1OA 4G7HF 5E3CA 4XLPF 5F5FA 4BJ1A 3QMKA 4QI2A 4RDAA 4PJLA 1IW7F 3LJBA 4YN0B 4U5DE 2CNWA 2ZXWC 4ZLDA 2J9VA 3L0IA 4HEAJ 3AQBA 2Q9CA 2XSEA 2VASA 4DVYP 2V26A 5KYXB 1LVKA 4EBBA 3I5PA 3N24A 4FWVA 5T3WA 3UGOA 4C3EA 2WB7A 1ZHYA 2ZXPA 3EZIA 2J7PD 3O39A 4WJ0A 2ZXRA 4ZLCA 4YT4A 3CZ6A 1BR2A 2G3VA 1D0XA 2XL4A 1TWAA 4A2NB 3DD7A 4JJGA 3ITFA 2Y3HA 4MQ9F 2PFDA 2XXAB 4PFPA 1ZHTA 3POVA 4J32B 2BE5F 3S29A 4B6IA 4NY3A 2JD3A 4IJJA 1VK5A 1TWHA 4O6MA 4CIHA 1O5HA 3HTKC 1MNEA 3LNRA 5L3VA 4I1MA 5T3TA 3KL4A 3ABMC 3ABLC 3JSZA 1W2WA 4I44A 3LS0A 3K33A 2ZPAA 2PX3A 3NYLA 2A6EF 2Q9AA 1M2VA 2IXNA 5CI9A 3OA1A 3EGDB 1NZEA 4F4BA 1BR4A 2Y3BA 3RYLA 3SP1A 2EINC 3AG1C 5DQTA 3TD7A 4PFOA 3Q6NA 4O7GA 1ZYRF 4OIQF 2XRHA 2CNWD 4BEJA 1OCZC 4BJ6C 2R7XA 3NKDA 3NDBB 1SF8A 2MWQA 3AG3C 2H7VC 4BJ6A 3ZSUA 1RJ9B 5D92A 2WZGA 2WL8A 4U5FE 4HE8D 2J0WA 2KJGA 1O87A 1QZXA 4PJJA 1VOMA 1VMAA 4HFKB 2J0XA 2R7RA 4KC9A 2MYSA 4G0HA 4JURI 4U5BE 3QZCA 3ASNC 2O9XA 2A68F 2GFHA 5E33A 5DS6A 1LS1A 2Y39A 2R7WA 3W2WA 1J8YF 4C7OA 4IWBA 5DVWA 3HLZA 3DXJF 2DGJA 3NKEA 1OKKA 2EIJC 2NUPA 2KW3C 2VB6A 3WODF 3NRHA 3K1HA 3OEOA 3EFOB 3NYJA 1FMWA 2QTVA 1N1CA 2FGYA 3SEOA 3ABKC 2I8BA 5E3AA 1VYIA 1Z23A 2L9JA 3UMIA 4QI0A 1NG1A 5DLJA 4IAOA 3K66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJN B;  5CI8 A;  2Z15 A;  5CI9 A;  3E9V A;  3DJU B;  2D5R B; 
#chains in the Genus database with same CATH topology
 2OG2 A;  1YDI A;  2EPK X;  4U5E E;  2BL2 A;  1SYQ A;  1IZM A;  4MVO A;  1RKC A;  4DOZ A;  1NFN A;  2GA0 A;  3GAN A;  2KC3 A;  3K66 A;  4JE9 A;  1CPQ A;  1T5O A;  4NTA A;  2EPO A;  2YLI A;  4OIP F;  5JP7 A;  1M56 C;  1ZZP A;  5FZT A;  2P6V A;  1WTY A;  3R7C A;  4DVZ A;  4I3M A;  4Q5S F;  1A7E A;  3C7J A;  4AX2 A;  4FAP B;  2R03 A;  1Q0K A;  3EHN A;  2VCA A;  5AGF A;  3O10 A;  5KYX A;  2GWW A;  2R25 A;  1SR2 A;  5B3I A;  2W4M A;  1HE9 A;  1LIH A;  5KYY B;  2PX0 A;  2OJQ A;  4Q4Z F;  3VF0 A;  3IPM O;  1WGW A;  3W8I A;  3UMH A;  2OKU A;  4DRH B;  2YL0 A;  3B0U X;  4MW3 A;  5A6B D;  3I5Q A;  2W45 A;  4RD9 A;  3O6X A;  4U5H A;  4EKW A;  3Q7G A;  3U2M A;  2CW0 F;  1PCX A;  3EZH A;  4H4K C;  2ASR A;  2BC5 A;  3MLG A;  1JPJ A;  2GDC A;  2P61 A;  4LDR A;  3TK0 A;  2HSB A;  4CBE A;  2DYR C;  5FCL A;  2VC9 A;  2A1D D;  4GQH A;  1JRA A;  4JTA B;  4XLN F;  2A0B A;  4XPW A;  4MS2 A;  3ZIB A;  1OXB A;  4LLC A;  3RVZ A;  5A69 A;  1M2O A;  3QVZ A;  2XXA A;  4DBQ A;  2LIG A;  3E70 C;  1TFO B;  2DYS C;  3IQ6 A;  1BDJ B;  1QSP A;  3LAY A;  3UGP A;  1CGM E;  3Q6M A;  4YL3 A;  4XTK A;  1NU7 D;  3VM6 A;  4MVZ A;  5COF A;  3WHN A;  2LFD A;  2VCB A;  4KNW A;  4KNV A;  4LLE A;  4MVR A;  2NG1 A;  1UFB A;  2PP4 A;  4LDK A;  3LLI A;  2WZF A;  3EJN A;  4JRZ A;  4MVS A;  3ATP A;  2L6G A;  2IBF A;  1QLE C;  3MX3 A;  3DAG A;  4J7Y A;  3TJ5 A;  3K6B A;  2NUT B;  3F47 A;  3Q7L A;  3H65 A;  3U3B A;  5DS4 A;  1AVO B;  4N6C A;  4KI2 A;  2J9U A;  3GWL A;  1PV3 A;  4HFF B;  3RQG A;  1Z6A A;  3EG9 B;  2XLE A;  3KPH A;  5F5H A;  4K1O A;  4LDQ A;  4OIN F;  5EGY A;  4G7Z F;  1MMG A;  4JTC B;  5DS5 A;  2M64 A;  2ZXO A;  5T1D B;  1RXQ A;  1C03 A;  1OW7 A;  3EGX B;  3LS1 A;  4MTO A;  4C3D A;  1E86 A;  3DJN B;  1M57 C;  3B71 A;  2E87 A;  4NTF A;  2Q00 A;  1OKK D;  2CYD A;  2Q3T A;  3T9O A;  1JPN A;  1GS9 A;  4PJN A;  2YHS A;  3U9J A;  2WVQ A;  1SZI A;  3EGD A;  5IY5 C;  4ULW A;  3SZR A;  2G3K A;  2H7O A;  1V4A A;  3MYI A;  4AK9 A;  2J9B A;  2X51 A;  2Y3G A;  1G4U S;  3DM9 B;  2R7T A;  3H2U A;  1JR8 A;  2Y3D A;  2A0U A;  3JYH A;  4CJO A;  4Z9I A;  1LKX A;  4R32 A;  2D5R B;  1APC A;  2EIK C;  4AE4 B;  2VH3 A;  2HZ8 A;  1VLT A;  2IXO A;  2KSF A;  3W2V A;  4OIR F;  4E0H A;  3PHF 2;  2W9Y A;  4QDL A;  4YT8 A;  4JW1 A;  4Z9H A;  1TWC A;  1R4T A;  2MHR A;  3QW1 A;  4P9F A;  1V55 C;  3UNG C;  4A4A A;  3FMS A;  5B1B C;  2C04 A;  4JZA A;  3RKO F;  1T01 A;  1ZW3 A;  5L3Q A;  3G50 A;  4NTB A;  1CGO A;  1H6G A;  4ER9 A;  3PCV A;  1MND A;  3C8G A;  4C3B A;  2DB4 A;  3DI5 A;  3UMK A;  1RJ9 A;  3GM1 A;  4G78 A;  4XEV A;  3NMI A;  3SXM A;  3U8V A;  3FHD A;  3LEV A;  3T6B A;  1E2X A;  3EPV A;  1MMN A;  4IAQ A;  5K0I A;  4N4W A;  5CI8 A;  2XS1 A;  5EHH A;  3RFY A;  2QLA A;  3F46 A;  5JUA A;  2L6F A;  1LE2 A;  2R9R B;  4JTD B;  2ICW G;  1OQC A;  2HMQ A;  3EH1 A;  1MQV A;  5B1A C;  4EWC A;  1T9K A;  2YVK A;  3VYW A;  2Q7R A;  1ZU4 A;  5AC5 A;  1U89 A;  3X2Q C;  2R7O A;  2LFF A;  3LEO A;  4EUK B;  2XL8 A;  3JRT A;  3RQF A;  2WVO A;  3A9C A;  1BR1 A;  3VRC A;  3ZQV A;  1YA9 A;  4EIY A;  2GAQ A;  5KYW B;  3U9M A;  5AC4 A;  5A6K A;  4XQ1 A;  256B A;  1A0B A;  2OOC A;  3C62 A;  3DJU B;  3N0T A;  3JTL O;  2CCY A;  1XWJ A;  4OD5 A;  1ZHW A;  3RIP A;  3ZTM A;  4DBR A;  1E85 A;  4XEF A;  2XLW A;  4IRU A;  3U8P A;  5KYU B;  1RCP A;  1BZ4 A;  1QQ3 A;  1VYK A;  1ZVZ A;  4U9D A;  2M4E A;  1Y6D A;  1AUE A;  2EIM C;  3TUL A;  3FOO A;  2AP3 A;  1V54 C;  3MFN A;  3FVY A;  3EFO A;  1LM3 B;  1YAU O;  2H8A A;  4O6N A;  5L0I A;  4JVS A;  4JKV A;  1TWG A;  4BEM J;  2IXM A;  2LK4 A;  2CDQ A;  3RH3 A;  2JX0 A;  1RMV A;  1ST6 A;  1WN0 A;  1DOV A;  1K05 A;  1RKE B;  3G4Z A;  4PAC A;  1FNT c;  1XZP A;  2IM8 A;  4GYT A;  1WAT A;  3S28 A;  4GEH A;  1TKN A;  1FFT C;  2XLH A;  3PDM P;  3JT1 A;  1JAF A;  2EPL X;  2OEV A;  2XM4 A;  4XWJ A;  1B68 A;  1TFK B;  2WVN A;  3ZVR A;  1TR2 A;  3AGU A;  1U6H A;  3GWN A;  3T4R A;  3TOL A;  5L0F A;  2EIL C;  4O6Y A;  1G8X A;  1PD1 A;  1R5I D;  2Q9B A;  4O79 A;  3T6J A;  3HJC A;  3IQ5 A;  1YYJ A;  3US6 A;  4CS9 C;  3W8H A;  4YT2 A;  3KKB A;  5HSW A;  3FDQ A;  3DE9 A;  3DZA A;  3E9V A;  4M63 A;  1S05 A;  4JCZ A;  4Q7C A;  4CS9 A;  1NU9 C;  2IOQ A;  1ZHZ A;  4CS8 C;  1MMD A;  2YZS A;  1Z63 A;  2Z15 A;  1EKY A;  2L7A A;  3K1I C;  5DQZ A;  3M4C A;  1Z5Z A;  2P0N A;  4CS8 A;  1LS4 A;  3V5X A;  4YWQ A;  5KYY A;  1H9T A;  3RF3 A;  4CDA A;  2P7V A;  2LSE A;  3BRJ A;  3KYI A;  2KNH A;  5D91 A;  3CAX A;  3QTH A;  3U3F A;  4PK4 A;  1AEP A;  5COG A;  5TJ5 E;  1KU2 A;  3UR3 C;  3VAY A;  4AL0 A;  3CQZ A;  3ZQY A;  5JLI A;  2IXP A;  2R7U A;  2WZL A;  3L1M A;  2Y69 C;  5F28 E;  3TOM A;  3WG7 C;  1YZA A;  3M1C B;  1NLX A;  2CGE A;  4I1O B;  4ULV A;  1FTS A;  2HJ3 A;  3AQC A;  2IYL D;  2RD9 A;  1GQA A;  3GEE A;  3J06 A;  1U0B B;  5KYN A;  3S0X A;  3IQC A;  3IEE A;  3C8G D;  1D1C A;  2EPM X;  1Q0G A;  2KGO A;  3B0P A;  3B9Q A;  3AG4 C;  1G4W R;  3V7O A;  4E17 A;  4JC7 A;  2UUI A;  3I4U A;  1LPE A;  2X0C A;  3L8I A;  1H7I A;  1Z3I X;  2W4B A;  4J7T A;  5A6J A;  1A41 A;  1ORS C;  3EH2 A;  3O55 A;  3U0C A;  2V3C C;  4PJM A;  2R7S A;  1D1A A;  4LAC B;  4OIO F;  1FAP B;  3H2V A;  2NUT A;  3SYN A;  1E84 A;  3SXZ A;  2YEV A;  3FAJ A;  1VLS A;  3OWT A;  4X0R A;  2L6H A;  5COM A;  5BQG A;  4DRI B;  3EG9 A;  2LP4 A;  1OCO C;  4FX5 A;  3U2L A;  4U5C E;  1V74 B;  1BBH A;  4YT5 A;  3ZDL A;  3LES A;  3JCU Q;  3EGX A;  4BJ5 C;  2OEX A;  1MMA A;  1FMV A;  1M2V B;  4FES A;  2C03 A;  1KNY A;  4BJ5 A;  1ZU5 A;  5BUO A;  1O3U A;  2J9W A;  2HUJ A;  3DAF A;  1PD0 A;  2B0J A;  1A7V A;  1D1B A;  3SXY A;  2A69 F;  3IHU A;  4AL1 A;  1HW2 A;  2QY9 A;  2J7P A;  1OCR C;  3FOP A;  2KK1 A;  2HV7 A;  4IGG A;  4OD4 A;  2YKZ A;  3EQL F;  3PMR A;  2Q4F A;  2AVK A;  4NQF A;  3S27 A;  5B3S C;  3V5Z A;  1S7Z A;  1T6I A;  1M6T A;  1T6U A;  5E2Q A;  2NSF A;  3JSE O;  3L34 A;  1YVI A;  2FFH A;  4YL0 A;  4EBK A;  2YWA A;  4AE4 A;  4K7B A;  1C02 A;  1QVX A;  2YL1 A;  3S84 A;  3NG1 A;  1OR3 A;  1L3P A;  2PF4 E;  3ZWI A;  2NPU A;  4CS7 A;  3GOD A;  1HE1 A;  2HV6 A;  3LUT B;  1EI7 A;  1NSG B;  3SNH A;  3NYM A;  2QE9 A;  2L81 A;  3ZG1 A;  1Z7Q c;  4K0D A;  1ZW2 A;  3ASO C;  4ANJ A;  4EBJ A;  3HNI A;  2H7B A;  2DI3 A;  3RVY A;  2A6H F;  4G7O F;  2G62 A;  4CSA C;  3KH2 A;  4KBL A;  3LLK A;  1KTM A;  4W8K A;  4CSA A;  3CSK A;  1SMY F;  3ZC4 A;  3N2Z B;  4MVQ A;  1D0Y A;  2ZD9 A;  4E7Z A;  3ZTZ A;  1CPR A;  2R7Q A;  2LCH A;  4RBN A;  1I5N A;  4JCH A;  2J45 A;  4U5G A;  3HNK A;  3HKK A;  1ZHX A;  4C7O B;  1I4Y A;  4P6I C;  4DJ9 A;  3B0V C;  1D0Z A;  2J46 A;  3ECS A;  4MTG A;  2YLG A;  1J8M F;  3GOR A;  1WAS A;  2HS5 A;  2OCC C;  3DM5 A;  2NUP B;  4YJW A;  1L7C A;  3AG2 C;  4BG0 A;  4XPX A;  3C8Z A;  4JJF A;  4BJT A;  1FFH A;  5KYW A;  2YRF A;  3GEH A;  2R02 A;  3DMD A;  4U9E A;  4LER A;  1OCC C;  2R7V A;  4MND A;  4E7S A;  3KMI A;  3K7D A;  4J30 B;  5JSL A;  2KQ9 A;  4XEK A;  5KYU A;  3FXH A;  2P1A A;  4N06 A;  3RW0 A;  5L0C A;  3EHM A;  3X1O A;  4G7H F;  1HMO A;  1K40 A;  2YL3 A;  5E3C A;  4XLP F;  5F5F A;  4BJ1 A;  3MBG A;  1Q0M A;  2ETS A;  2HMZ A;  4MTF A;  1Q0F A;  2XLO A;  2LQG A;  2YQY A;  3QMK A;  4QI2 A;  4E18 A;  5EK0 A;  1YA7 O;  1K04 A;  3B29 A;  4RDA A;  3GM2 A;  4PJL A;  1RKE A;  3DE8 A;  4XPY A;  1IW7 F;  3LJB A;  4YN0 B;  5HV9 A;  2EPN A;  4U5D E;  3JRM O;  1HW1 A;  2XM0 A;  3V5Y A;  1XZQ A;  2CNW A;  2ZXW C;  1F1M A;  4ZLD A;  1JMW A;  4MVU A;  1LI7 A;  2J9V A;  4N6H A;  3L0I A;  4HEA J;  3AQB A;  4W8P A;  2Q9C A;  2XSE A;  2LD6 A;  2VAS A;  3S90 A;  4DVY P;  2V26 A;  3AJM A;  5KYX B;  1LVK A;  4EBB A;  1OW8 A;  3I5P A;  3N24 A;  5JVE A;  1FR0 A;  4FWV A;  5T3W A;  3UGO A;  3K1I A;  4C3E A;  2WB7 A;  4MVM A;  3SXK A;  1ZHY A;  1QKR A;  1YAR O;  4E0I A;  2ZXP A;  3EZI A;  2J7P D;  3O39 A;  4WJ0 A;  2ZXR A;  4WGZ A;  1ORJ A;  4ZLC A;  1ORY A;  3AGT A;  1LI5 A;  4YT4 A;  3CZ6 A;  4CJG A;  1BR2 A;  2G3V A;  1D0X A;  2YL7 A;  4DRJ B;  1YZC A;  1TWA A;  2XL4 A;  2XLD A;  1QPU A;  4A2N B;  3DD7 A;  4JIO A;  4DXW A;  3DKA A;  4JJG A;  4P9T A;  3WAQ A;  3ITF A;  1YYX A;  2Y3H A;  4JEB A;  4MQ9 F;  2PFD A;  2XXA B;  3HNL A;  4PFP A;  1ZHT A;  2XLM A;  3L8J A;  3POV A;  4J32 B;  2BE5 F;  3S29 A;  3G4X A;  4B6I A;  4NY3 A;  3M79 A;  3U5S A;  1LE4 A;  2QUP A;  3A11 A;  4IAR A;  2JD3 A;  2QNL A;  3M4B A;  1VK5 A;  2I15 A;  4IJJ A;  1E83 A;  1TWH A;  1NFO A;  4O6M A;  4CIH A;  1HY5 A;  4BPM A;  1O5H A;  3HTK C;  1OW6 A;  1MNE A;  1WOL A;  3LNR A;  1Y4C A;  3C63 A;  4IB4 A;  5L3V A;  4JEA A;  4I1M A;  1A7D A;  3MYF A;  5T3T A;  1UG7 A;  5BQH A;  1CGN A;  3KL4 A;  3ABM C;  1NBB A;  3CEX A;  5GPG B;  3ABL C;  2HFI A;  3JSZ A;  5JT4 A;  4UDV A;  1W2W A;  4I44 A;  3LS0 A;  3K33 A;  2JPU A;  3S9O A;  2ZPA A;  4NC3 A;  1G5Z A;  3FAP B;  4H54 A;  4ONS A;  2PX3 A;  2AWC A;  3NYL A;  1I4Z A;  2A6E F;  2Q9A A;  1M2V A;  2IXN A;  3JYY A;  5CI9 A;  3OA1 A;  3TQO A;  4L6R A;  3EGD B;  1NZE A;  4WGY A;  5A6A A;  3QW0 A;  4CIP A;  4F4B A;  2OQM A;  3IQT A;  3GEI A;  2XLV A;  2R05 A;  5CIV A;  1BR4 A;  2Y3B A;  1VB5 A;  4Z9J A;  2AWY A;  3RYL A;  5JRA A;  3SP1 A;  2EIN C;  3AG1 C;  5BQI A;  5DQT A;  3LNM B;  5A6B A;  4YK5 A;  2OU6 A;  4EHP A;  4PR9 A;  3DWW A;  1HMD A;  1OXK A;  3TD7 A;  4PFO A;  3R2P A;  1Q0D A;  4D4X A;  3Q6N A;  4O7G A;  4D4N A;  5L0G A;  1ZYR F;  2TMV P;  4OIQ F;  1EA8 A;  2XRH A;  3HNJ A;  2CNW D;  2HSQ A;  1OCZ C;  4BJ6 C;  4BEJ A;  4WAB A;  4CDV A;  3NKD A;  2NSG A;  3NDB B;  1SF8 A;  1T6Q A;  2MWQ A;  2KYH A;  2R7X A;  4MW8 A;  3AG3 C;  3GM3 A;  4YL1 A;  2H7V C;  4BJ6 A;  3ZSU A;  3KYJ A;  1WWP A;  3C8G B;  1GGQ A;  1RJ9 B;  5D92 A;  2WZG A;  1EQ1 A;  2WL8 A;  4U5F E;  4HE8 D;  3NMJ A;  3T6G B;  2J0W A;  1YLM A;  4CX9 A;  1JOG A;  2KJG A;  1O87 A;  1QZX A;  4PJJ A;  1OR2 A;  1VOM A;  1VMA A;  2J8W A;  2J0X A;  4HFK B;  2R7R A;  4KC9 A;  4NCQ A;  2MYS A;  4G0H A;  4JUR I;  4U5B E;  3QZC A;  3ASN C;  1TQG A;  2O9X A;  1H9G A;  2PBE A;  2A68 F;  3NMK A;  3JZ0 A;  2GFH A;  2B0H A;  2HKV A;  1C17 M;  1GM5 A;  2AU5 A;  5E33 A;  5DS6 A;  1LS1 A;  2UUH A;  2OJE D;  2Y39 A;  2R7W A;  3W2W A;  1J8Y F;  4CDY A;  4IWB A;  5L0D A;  2PNO A;  4C7O A;  1DOW A;  1VTM P;  3C18 A;  3AOU A;  3HLZ A;  5DVW A;  2YLD A;  3QVY A;  2FAP B;  3DXJ F;  2DGJ A;  3NKE A;  2VCC A;  1OKK A;  2F22 A;  2RSE B;  2D4U A;  2EIJ C;  2XS8 A;  2NUP A;  3M15 A;  2KW3 C;  3BEH A;  3W4Y A;  2VB6 A;  5JS5 A;  3WOD F;  3NRH A;  2HJM A;  3K1H A;  3OEO A;  3EFO B;  1YJG A;  3NYJ A;  1FMW A;  2QTV A;  2FGY A;  3SEO A;  2XL6 A;  3ABK C;  2I8B A;  5E3A A;  1VYI A;  1Z23 A;  5L0J A;  3TJ6 A;  2L9J A;  5L0H A;  3UMI A;  4QI0 A;  1NG1 A;  5DLJ A;  4IAO A;  1N1C A;  3RQE A; 
#chains in the Genus database with same CATH homology
 2OG2 A;  4U5E E;  1IZM A;  4DOZ A;  3GAN A;  4OIP F;  1M56 C;  2P6V A;  4DVZ A;  4I3M A;  4Q5S F;  4AX2 A;  3EHN A;  5KYX A;  2W4M A;  5KYY B;  2PX0 A;  4Q4Z F;  1WGW A;  3W8I A;  3UMH A;  3B0U X;  3I5Q A;  2W45 A;  4RD9 A;  3O6X A;  4U5H A;  3Q7G A;  2CW0 F;  1PCX A;  3EZH A;  4H4K C;  3MLG A;  1JPJ A;  4CBE A;  2DYR C;  5FCL A;  2A1D D;  4XLN F;  3ZIB A;  4LLC A;  2XXA A;  1M2O A;  4DBQ A;  3E70 C;  2DYS C;  3LAY A;  3UGP A;  3Q6M A;  4XTK A;  1NU7 D;  4KNW A;  4KNV A;  4LLE A;  2NG1 A;  2PP4 A;  3LLI A;  2WZF A;  3EJN A;  1QLE C;  3MX3 A;  3DAG A;  3K6B A;  2NUT B;  3F47 A;  3Q7L A;  3H65 A;  5DS4 A;  4KI2 A;  2J9U A;  4HFF B;  1Z6A A;  3EG9 B;  5F5H A;  5EGY A;  4G7Z F;  1MMG A;  5DS5 A;  2ZXO A;  5T1D B;  3LS1 A;  4C3D A;  3EGX B;  3DJN B;  1M57 C;  2E87 A;  1OKK D;  2Q3T A;  1JPN A;  4PJN A;  2YHS A;  2WVQ A;  1SZI A;  3EGD A;  5IY5 C;  4ULW A;  3SZR A;  2G3K A;  2H7O A;  4AK9 A;  2X51 A;  2Y3G A;  3DM9 B;  2R7T A;  2Y3D A;  3JYH A;  1LKX A;  2D5R B;  2EIK C;  4AE4 B;  2VH3 A;  2IXO A;  3W2V A;  4OIR F;  2W9Y A;  4QDL A;  4YT8 A;  4JW1 A;  1TWC A;  3UNG C;  1V55 C;  5B1B C;  2C04 A;  4JZA A;  3RKO F;  5L3Q A;  1MND A;  4C3B A;  3UMK A;  1RJ9 A;  3LEV A;  3FHD A;  3T6B A;  3EPV A;  1MMN A;  5CI8 A;  5EHH A;  3RFY A;  3F46 A;  5B1A C;  3EH1 A;  4EWC A;  3VYW A;  1ZU4 A;  3X2Q C;  2R7O A;  3JRT A;  2WVO A;  1BR1 A;  5KYW B;  4OIN F;  3DJU B;  4OD5 A;  3N0T A;  3RIP A;  4DBR A;  1ZHW A;  4IRU A;  5KYU B;  1VYK A;  2M4E A;  2EIM C;  1V54 C;  3FVY A;  3EFO A;  4O6N A;  4JVS A;  1TWG A;  2IXM A;  2CDQ A;  3RH3 A;  1ST6 A;  4GYT A;  3S28 A;  4GEH A;  1TKN A;  1FFT C;  3JT1 A;  4XWJ A;  2WVN A;  3ZVR A;  1TR2 A;  3T4R A;  2EIL C;  4O6Y A;  1G8X A;  1PD1 A;  2Q9B A;  3T6J A;  4O79 A;  4CS9 C;  3HJC A;  3PHF 2;  3W8H A;  4YT2 A;  3KKB A;  5HSW A;  3FDQ A;  3DZA A;  3E9V A;  4M63 A;  4Q7C A;  4CS9 A;  1NU9 C;  2IOQ A;  1ZHZ A;  4CS8 C;  1MMD A;  2YZS A;  1Z63 A;  2Z15 A;  3K1I C;  5DQZ A;  1Z5Z A;  4CS8 A;  5KYY A;  2P7V A;  2LSE A;  2KNH A;  5D91 A;  4PK4 A;  3UR3 C;  1KU2 A;  3VAY A;  3CQZ A;  2IXP A;  2R7U A;  2WZL A;  2Y69 C;  3WG7 C;  3M1C B;  2CGE A;  4I1O B;  1FTS A;  3AQC A;  2IYL D;  5KYN A;  3S0X A;  3IEE A;  1D1C A;  2KGO A;  3B0P A;  3B9Q A;  3AG4 C;  3V7O A;  3I4U A;  1Z3I X;  2W4B A;  3EH2 A;  2V3C C;  4PJM A;  2R7S A;  1D1A A;  4LAC B;  4OIO F;  2NUT A;  3SYN A;  2YEV A;  3FAJ A;  3OWT A;  4X0R A;  3EG9 A;  4FX5 A;  1OCO C;  4U5C E;  4YT5 A;  3LES A;  3JCU Q;  3EGX A;  4BJ5 C;  1MMA A;  1FMV A;  1M2V B;  4FES A;  2C03 A;  4BJ5 A;  5BUO A;  1ZU5 A;  2J9W A;  3DAF A;  1PD0 A;  2B0J A;  1D1B A;  2A69 F;  2QY9 A;  2J7P A;  1OCR C;  2HV7 A;  4OD4 A;  3EQL F;  3PMR A;  3S27 A;  5B3S C;  1S7Z A;  5E2Q A;  3L34 A;  2FFH A;  4AE4 A;  4K7B A;  3NG1 A;  2PF4 E;  4CS7 A;  3GOD A;  3SNH A;  2HV6 A;  3NYM A;  2L81 A;  3ZG1 A;  4K0D A;  3ASO C;  4ANJ A;  4YWQ A;  2H7B A;  2A6H F;  4G7O F;  2G62 A;  4CSA C;  3KH2 A;  4KBL A;  3LLK A;  4W8K A;  4CSA A;  3CSK A;  1SMY F;  3ZC4 A;  3N2Z B;  4E7Z A;  1D0Y A;  2R7Q A;  4RBN A;  4JCH A;  2J45 A;  4U5G A;  1ZHX A;  4C7O B;  4P6I C;  3B0V C;  1D0Z A;  2J46 A;  3ECS A;  1J8M F;  4YJW A;  3DM5 A;  2OCC C;  2NUP B;  3AG2 C;  4BG0 A;  4BJT A;  4JJF A;  5KYW A;  1FFH A;  3DMD A;  4LER A;  1OCC C;  2R7V A;  4MND A;  4E7S A;  3KMI A;  3K7D A;  4J30 B;  2KQ9 A;  5KYU A;  4N06 A;  3EHM A;  3X1O A;  4G7H F;  5E3C A;  4XLP F;  5F5F A;  4BJ1 A;  3QMK A;  4QI2 A;  4RDA A;  4PJL A;  1IW7 F;  3LJB A;  4YN0 B;  4U5D E;  2CNW A;  2ZXW C;  4ZLD A;  2J9V A;  3L0I A;  4HEA J;  3AQB A;  2Q9C A;  2XSE A;  2VAS A;  4DVY P;  2V26 A;  5KYX B;  1LVK A;  4EBB A;  3I5P A;  3N24 A;  4FWV A;  5T3W A;  3UGO A;  4C3E A;  2WB7 A;  1ZHY A;  2ZXP A;  3EZI A;  2J7P D;  3O39 A;  4WJ0 A;  2ZXR A;  4ZLC A;  4YT4 A;  3CZ6 A;  1BR2 A;  2G3V A;  1D0X A;  2XL4 A;  1TWA A;  4A2N B;  3DD7 A;  4JJG A;  3ITF A;  2Y3H A;  4MQ9 F;  2PFD A;  2XXA B;  4PFP A;  1ZHT A;  3POV A;  4J32 B;  2BE5 F;  3S29 A;  4B6I A;  4NY3 A;  2JD3 A;  4IJJ A;  1VK5 A;  1TWH A;  4O6M A;  4CIH A;  1O5H A;  3HTK C;  1MNE A;  3LNR A;  5L3V A;  4I1M A;  5T3T A;  3KL4 A;  3ABM C;  3ABL C;  3JSZ A;  1W2W A;  4I44 A;  3LS0 A;  3K33 A;  2ZPA A;  2PX3 A;  3NYL A;  2A6E F;  2Q9A A;  1M2V A;  2IXN A;  5CI9 A;  3OA1 A;  3EGD B;  1NZE A;  4F4B A;  1BR4 A;  2Y3B A;  3RYL A;  3SP1 A;  2EIN C;  3AG1 C;  5DQT A;  3TD7 A;  4PFO A;  3Q6N A;  4O7G A;  1ZYR F;  4OIQ F;  2XRH A;  2CNW D;  4BEJ A;  1OCZ C;  4BJ6 C;  2R7X A;  3NKD A;  3NDB B;  1SF8 A;  2MWQ A;  3AG3 C;  2H7V C;  4BJ6 A;  3ZSU A;  1RJ9 B;  5D92 A;  2WZG A;  2WL8 A;  4U5F E;  4HE8 D;  2J0W A;  2KJG A;  1O87 A;  1QZX A;  4PJJ A;  1VOM A;  1VMA A;  4HFK B;  2J0X A;  2R7R A;  4KC9 A;  2MYS A;  4G0H A;  4JUR I;  4U5B E;  3QZC A;  3ASN C;  2O9X A;  2A68 F;  2GFH A;  5E33 A;  5DS6 A;  1LS1 A;  2Y39 A;  2R7W A;  3W2W A;  1J8Y F;  4C7O A;  4IWB A;  5DVW A;  3HLZ A;  3DXJ F;  2DGJ A;  3NKE A;  1OKK A;  2EIJ C;  2NUP A;  2KW3 C;  2VB6 A;  3WOD F;  3NRH A;  3K1H A;  3OEO A;  3EFO B;  3NYJ A;  1FMW A;  2QTV A;  1N1C A;  2FGY A;  3SEO A;  3ABK C;  2I8B A;  5E3A A;  1VYI A;  1Z23 A;  2L9J A;  3UMI A;  4QI0 A;  1NG1 A;  5DLJ A;  4IAO A;  3K66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...