3M15A

A zn-mediated asymmetric trimer of a cytochrome cb562 variant (d74a-ridc1)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Structural characterization of a microperoxidase inside a metal-directed protein cage.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3m15A00
3ZTZA 4CIPA 2XLMA 2XL6A 2YLGA 3HNKA 3IQ6A 1YYXA 5JP7A 4CX9A 3NMJA 1QPUA 1CGNA 2YLDA 3C62A 4ER9A 2QLAA 4CDAA 1JAFA 2XLWA 2XLDA 4L6RA 1EKYA 5JT4A 1A7VA 3M15A 5B3IA 1MQVA 3M4BA 3M4CA 3TOMA 1E84A 2XL8A 1QQ3A 256BA 3DE9A 4EIYA 3DE8A 4U9DA 3HNIA 3ZQVA 1YYJA 1GQAA 1NBBA 3VRCA 1CGOA 5JUAA 2XLVA 3IQ5A 2YKZA 5JVEA 4CJOA 3C63A 4JEBA 1BBHA 2YL3A 1E86A 4N6HA 5JS5A 4IB4A 1CPQA 1E85A 3M79A 3L1MA 2CCYA 1M6TA 2YLIA 5JRAA 1CPRA 1RCPA 3ZTMA 2YL1A 4U9EA 1E83A 4JEAA 1YZAA 3U8PA 3QVYA 1APCA 4D4NA 2J9BA 3HNLA 3ZWIA 3ZQYA 4CJGA 4WGZA 4ULVA 4JKVA 5JLIA 4JE9A 2XM4A 4N4WA 2J8WA 2XLHA 1YZCA 2YL7A 1LM3B 2BC5A 1S05A 2YL0A 4D4XA 3NMIA 4IARA 4WGYA 2XLEA 2XM0A 3NMKA 3TOLA 5JSLA 3QVZA 3FOPA 4IAQA 4CDYA 3QW0A 4NC3A 3QW1A 2XLOA 3HNJA 5AGFA 3FOOA 4CDVA
chains in the Genus database with same CATH superfamily
4O6YA 1G4WR 1OCCC 2XL4A 3IQ6A 3DXJF 1NFOA 3GEHA 3CZ6A 3AOUA 4C7OB 2OU6A 1CGNA 2ICWG 2HSQA 2FAPB 5E33A 2GWWA 4YL1A 2GFHA 4CSAA 1F1MA 2HJ3A 4IAOA 2QLAA 2VCBA 2AWCA 3M1CB 5GPGB 1JAFA 4CDAA 4ER9A 3QTHA 4MVOA 2XLWA 3QZCA 1JRAA 4YT4A 2J9VA 1EKYA 3X1OA 2X0CA 1OR2A 4G78A 5B3IA 2OQMA 4UDVA 1LKXA 2L7AA 1O87A 256BA 4R32A 2EIJC 1GM5A 2Y69C 5T3TA 3DE8A 3GANA 3S29A 2L6GA 4YN0B 4MTFA 3ZQVA 1BDJB 4NTFA 1LPEA 2DI3A 3AG3C 3K6BA 4ULWA 3F46A 1LIHA 5B1AC 1OQCA 2EIMC 1AEPA 1CGOA 1PD1A 2C03A 4AE4A 4XEKA 5JUAA 3FMSA 4CJOA 4GQHA 1WASA 4ZLCA 2A68F 3GEIA 1YARO 3IHUA 5KYNA 1OXBA 4J7TA 1GGQA 5L0FA 1WGWA 2YZSA 1FMVA 3AQBA 4Z9IA 1HW1A 2CCYA 3IQTA 2H8AA 1M6TA 2CDQA 3W4YA 1Z23A 3EH1A 4EBKA 2Q7RA 3KH2A 4DBRA 3JYYA 1K40A 1ZVZA 2D5RB 3JT1A 5F5HA 2UUIA 1G4US 3DI5A 1C17M 5T1DB 1H6GA 1M56C 2A0BA 4BEJA 4CS8A 4JVSA 4FESA 1OKKD 2LP4A 4CS7A 3EQLF 5BQHA 3HNLA 5E2QA 1Q0MA 2HJMA 4C7OA 4YWQA 3RQEA 3LNMB 3KL4A 5DS6A 1TWAA 3N0TA 2I8BA 2NUTA 5CIVA 1NZEA 5L0IA 5L3VA 5KYUB 4PFOA 2IYLD 2XRHA 1TFOB 1Q0KA 1N1CA 4JJGA 3WG7C 1KTMA 2R7WA 3IEEA 1VYKA 3GWNA 4BJTA 1LI7A 3ZVRA 2IXMA 3TD7A 5L0JA 3FVYA 4JJFA 4BEMJ 3RQFA 2IBFA 4G0HA 1ZHYA 4MVZA 2NG1A 4O7GA 2YWAA 3LNRA 1I4ZA 3EPVA 4XPWA 3EGXB 2AU5A 3V7OA 2BC5A 3DWWA 4OIOF 4XEVA 4DBQA 1KNYA 2P1AA 2CYDA 3K1HA 3GM1A 3Q7GA 4JURI 1JPJA 1RJ9B 1PD0A 1ZHTA 4I1OB 2WZGA 3T4RA 1RKEA 3NMIA 4GEHA 4IARA 5KYYB 5COFA 4YT8A 2XM0A 3TK0A 4MS2A 1EA8A 4WABA 3TOLA 5DQTA 3J06A 2YHSA 3QVZA 2A69F 4IJJA 3S9OA 2VCCA 2LFDA 3L8JA 3W2WA 2J9UA 1M2VA 4EBJA 1L7CA 2YVKA 4XEFA 4AK9A 3QW0A 5L0GA 2R7SA 2R7TA 1MNDA 2J7PD 4LDRA 1ZHXA 3EH2A 3KYIA 4J30B 2EILC 3CAXA 2HMZA 3VAYA 1ZU4A 2FGYA 4JTCB 4A2NB 2Y3GA 4HEAJ 2AP3A 3ABKC 2M64A 4NY3A 2OEXA 2P61A 4CIPA 2XL6A 2EIKC 3RKOF 2ASRA 2HV7A 4U5EE 2QY9A 3K33A 3KYJA 3EFOB 2DYSC 2XXAA 5KYXB 5JP7A 2R7OA 5HV9A 2Q4FA 4CX9A 2YLDA 2OJED 1D0YA 2HUJA 3EG9B 3NYLA 3C8ZA 3I4UA 5EGYA 1NLXA 4JC7A 3IPMO 3NG1A 2TMVP 2L6FA 5A6AA 3LAYA 2PX3A 2XLDA 4NCQA 2G62A 3T6BA 3WAQA 3UMKA 5JT4A 2YQYA 1MQVA 4I44A 2HZ8A 3JSZA 3M4CA 3TOMA 3LS0A 2GDCA 5BQIA 3TJ5A 1QQ3A 3ASNC 2HS5A 4EIYA 2ETSA 1RKCA 4JTAB 4E18A 2PBEA 3V5ZA 1Z6AA 5A6KA 1OR3A 2B0HA 4BJ6C 3CEXA 3HNIA 3GM2A 2J46A 1BR1A 1SYQA 2WVQA 3SNHA 2R03A 3UGOA 1NBBA 3WODF 1OW8A 4AL0A 1FR0A 4LLCA 3H2UA 3O10A 1OCZC 3O39A 5D92A 4XTKA 4J7YA 2R7UA 4DRIB 3ZC4A 5A6BA 3FXHA 2KSFA 1UG7A 2YKZA 1MMGA 1RJ9A 2LK4A 5E3CA 4JEBA 2J9WA 1BBHA 4PFPA 5FZTA 3W8HA 3JYHA 3E70C 3UGPA 2A0UA 3EGDA 5AC5A 4JRZA 4KNVA 4N6HA 4EHPA 4XPXA 4IB4A 3LLKA 3RVZA 1C02A 4WJ0A 1QVXA 2R9RB 3C8GB 3E9VA 1QZXA 3L1MA 1SR2A 4PR9A 3U8VA 4RDAA 3ZG1A 1Y6DA 3L34A 2RSEB 3GORA 2H7VC 4PK4A 2Q9AA 5JRAA 1DOVA 2VC9A 1FNTc 5AC4A 1NSGB 3AGTA 4MVMA 3ZTMA 2YL1A 3BRJA 4U5GA 3B71A 1E83A 4BPMA 2NUPB 3K7DA 3MX3A 5DLJA 1H7IA 3JRMO 1QKRA 3N24A 1IW7F 3AG2C 3QVYA 4I3MA 1HE9A 4D4NA 2HKVA 3DD7A 5DS4A 3FAPB 3C8GD 1G8XA 3KKBA 3ZWIA 3ATPA 2A6HF 2IXOA 3LESA 4WGZA 3U3BA 2IXPA 2UUHA 1Z3IX 3EZHA 4JKVA 4OD5A 1RXQA 4G7HF 5JLIA 4U5HA 3T6GB 4JIOA 4JE9A 2XM4A 3LS1A 3ITFA 4EWCA 2R7RA 4FWVA 4YJWA 1WOLA 2IM8A 1R4TA 3PMRA 1D0XA 4H4KC 2CW0F 4XLPF 3H2VA 3GEEA 1TFKB 1MMNA 4YT5A 3W2VA 1YZCA 4MVUA 2C04A 1EI7A 1FFTC 2H7OA 2P6VA 3DMDA 4DVYP 2YL0A 1BR4A 4NTBA 3MFNA 3U9MA 5L0CA 4OIRF 2L9JA 1T01A 1Z63A 1Q0DA 2Q9CA 2Y39A 4KBLA 4U5BE 4D4XA 2W4BA 2W4MA 1E2XA 4P9FA 2KJGA 2P0NA 2XLEA 1EQ1A 2CGEA 2I15A 2ZXWC 5JSLA 4E7ZA 5B1BC 3FOPA 4NQFA 1H9GA 3K1IC 4IAQA 4CDYA 2JD3A 1LS4A 1VLTA 3FHDA 3T9OA 2WL8A 3HJCA 4O6NA 4NC3A 4G7ZF 4LACB 1OCRC 2NSGA 2P7VA 1A0BA 1Q0GA 5CI8A 4B6IA 1L3PA 2OCCC 3UMHA 3TULA 3ZTZA 4BJ5A 4E0IA 2XLMA 3T6JA 3PCVA 1Z5ZA 2WVNA 1LE2A 3HNKA 1VLSA 2ZXPA 4MVSA 1FTSA 3K66A 3JTLO 4RBNA 2AWYA 1YYXA 3I5QA 4XQ1A 3V5YA 2GA0A 4U5FE 4M63A 3B29A 2KNHA 3LEVA 2VASA 4AX2A 5A6JA 2CNWD 3R2PA 5TJ5E 4HE8D 3SYNA 4C3EA 4BJ6A 1M57C 4Q5SF 2ZXOA 3Q6MA 1LVKA 4HFFB 4Q7CA 4DRJB 1Z7Qc 2ZPAA 4L6RA 1FMWA 4Z9JA 2PNOA 1LE4A 4FAPB 1OKKA 5EHHA 3HTKC 1OXKA 3NRHA 3DE9A 4LERA 1D1CA 1ORYA 4O6MA 2YRFA 4PJNA 5D91A 3U3FA 1YYJA 3VYWA 3SP1A 1ORJA 1J8MF 1TR2A 5FCLA 1K04A 4Q4ZF 3NYMA 2LD6A 1ZHWA 2OJQA 3AGUA 3DAFA 3JZ0A 5A69A 3POVA 1K05A 1A7DA 1HMDA 4X0RA 3G50A 3V5XA 2WVOA 2R05A 4MNDA 4E7SA 3B0PA 1ORSC 2E87A 4MQ9F 4CIHA 1C03A 3C63A 3CQZA 4MVQA 2JPUA 1JPNA 2YL3A 3UNGC 2F22A 3AQCA 3RQGA 2Y3HA 2KQ9A 4BJ5C 2ZD9A 1E86A 2KYHA 1PV3A 3H65A 1CPQA 3SXMA 2EPLX 5JS5A 1I5NA 3M79A 1AUEA 2RD9A 4LLEA 1M2OA 3RVYA 3U2MA 3FDQA 5KYUA 1OW6A 4CBEA 5BQGA 3S0XA 4CS9A 4U5DE 4HFKB 1Y4CA 3UMIA 1RCPA 1V55C 2G3KA 2PFDA 4EKWA 1ZW2A 2WZFA 3LJBA 3Q6NA 2R25A 3TJ6A 5DVWA 3U8PA 4F4BA 3HKKA 5K0IA 3U9JA 1APCA 2A6EF 3FAJA 3MYIA 2EPKX 4AE4B 3EGXA 2J9BA 2Y3BA 2LFFA 3DJUB 3O55A 3B0VC 2J7PA 3ZQYA 4KI2A 2IOQA 4CJGA 3ABLC 4DRHB 2MHRA 5E3AA 3RH3A 4EBBA 2PF4E 1OW7A 1HMOA 4P6IC 4IWBA 1QLEC 4KC9A 5COGA 1YDIA 3AJMA 5KYYA 1OCOC 3GWLA 3MBGA 4N4WA 2J0XA 3DZAA 3OEOA 4RD9A 2OEVA 3CSKA 1D0ZA 5L3QA 3N2ZB 4P9TA 3VF0A 4XPYA 2J8WA 2PX0A 2VB6A 2Q00A 2L6HA 3LLIA 2V26A 2LQGA 2XLHA 3S84A 3S90A 4XLNF 5T3WA 4YT2A 3K1IA 2J0WA 2G3VA 1DOWA 2BE5F 1IZMA 1ST6A 2KGOA 2R7QA 1VOMA 4MW3A 5F5FA 5DS5A 3NDBB 2D4UA 3RYLA 3DM5A 3EFOA 4N06A 4CS9C 3PHF2 1YAUO 5EK0A 1TKNA 5KYXA 1GS9A 2V3CC 1TWCA 2NUTB 1D1BA 2KW3C 3NMKA 2FFHA 3EG9A 1FFHA 4OIPF 1NG1A 3VM6A 1TWHA 3SZRA 3MLGA 4DVZA 2DB4A 2KK1A 4YK5A 1A41A 1T6UA 4PJJA 3EZIA 1AVOB 1B68A 3GODA 3O6XA 4W8KA 2QE9A 2BL2A 2W45A 3HNJA 1JMWA 3FOOA 2KC3A 3JCUQ 3NYJA 4U5CE 4BG0A 2ZXRA 2J45A 2YLGA 5F28E 2L81A 3UR3C 2NSFA 1V54C 3DAGA 1W2WA 1V74B 2Q3TA 2Q9BA 1ZU5A 1RKEB 1ZZPA 3AG1C 4O79A 1T5OA 1RMVA 3NMJA 1QPUA 1VMAA 2EPNA 2VH3A 4JCHA 4JTDB 4W8PA 1T6QA 5IY5C 1UFBA 3C62A 3L0IA 5CI9A 3RIPA 1ZYRF 3A11A 4DJ9A 1MMDA 4DXWA 1M2VB 1VYIA 3HLZA 1G5ZA 2DGJA 1YVIA 2GAQA 2OOCA 3ECSA 3SXKA 1NU9C 3US6A 1CGME 1A7VA 1QSPA 3M15A 4I1MA 3M4BA 4ONSA 1E84A 5COMA 4K7BA 5KYWB 2XL8A 3MYFA 2JX0A 3C8GA 2H7BA 4YL0A 3SXZA 4OINF 3BEHA 5KYWA 1WWPA 2EPOA 4JZAA 1T6IA 1D1AA 4CSAC 2XS1A 4U9DA 4LDQA 3LEOA 1YA7O 2QNLA 3NKEA 2XS8A 4A4AA 2XXAB 1GQAA 1U6HA 1XZPA 2NUPA 1KU2A 3G4ZA 3EHNA 1FAPB 1S7ZA 5L0DA 4KNWA 3VRCA 4H54A 2OG2A 3R7CA 5DQZA 1YLMA 2XLVA 1A7EA 2B0JA 2Z15A 3IQ5A 4MW8A 2HSBA 3ABMC 4OD4A 5JVEA 4OIQF 1ZW3A 2W9YA 4ANJA 1NU7D 2VCAA 4BJ1A 4DOZA 4MTOA 3F47A 3X2QC 5B3SC 1E85A 3I5PA 1T9KA 2LCHA 3EHMA 4XWJA 2EPMX 5HSWA 2MYSA 2YLIA 4ZLDA 4MVRA 3PDMP 3KMIA 1CPRA 2DYRC 1VTMP 3C18A 3OA1A 3U0CA 4FX5A 3B9QA 4U9EA 2LIGA 4JEAA 1HE1A 3RW0A 3U2LA 3QMKA 1YZAA 1NFNA 4C3DA 4GYTA 1U0BB 1V4AA 1JOGA 1BR2A 1LI5A 1VK5A 1O5HA 3NKDA 3DJNB 4JCZA 2QTVA 3A9CA 3SEOA 4C3BA 1TQGA 4PJLA 3ZIBA 1ZHZA 3DM9B 3KPHA 2WZLA 2HMQA 3AG4C 4IGGA 4MTGA 3EGDB 1HW2A 4ULVA 2R7XA 1I4YA 1SF8A 3B0UX 1PCXA 4NTAA 3ZSUA 4CS8C 4E17A 3Q7LA 1U89A 3WHNA 2WB7A 2NPUA 3G4XA 1H9TA 2X51A 1XWJA 4QI2A 3LUTB 5A6BD 3ZDLA 3RFYA 2A1DD 3ASOC 2CNWA 2HV6A 2O9XA 2Y3DA 2HFIA 4K1OA 3SXYA 1HY5A 2YEVA 2R02A 1WATA 2XSEA 1LM3B 2YL7A 3GM3A 1S05A 4QI0A 5BUOA 1LS1A 1BZ4A 2AVKA 3DKAA 1VB5A 2MWQA 2M4EA 3JSEO 4IRUA 1WTYA 4QDLA 3U5SA 2R7VA 3JRTA 3W8IA 2IXNA 1SZIA 1YJGA 3S28A 3TQOA 2EINC 5L0HA 4J32B 4WGYA 4EUKB 3RF3A 1XZQA 1SMYF 1O3UA 4JW1A 4AL1A 2QUPA 1Q0FA 3IQCA 4PACA 1MNEA 1R5ID 2OKUA 4E0HA 1TWGA 4YL3A 4Z9HA 4G7OF 1MMAA 2LSEA 4LDKA 3QW1A 3S27A 3C7JA 2XLOA 1JR8A 2PP4A 3EJNA 1J8YF 3OWTA 4K0DA 4N6CA 1WN0A 1YA9A 4PJMA 5AGFA 4CDVA 3L8IA
chains in the Genus database with same CATH topology
3ZTZA 4CIPA 2XLMA 2XL6A 2YLGA 3HNKA 3IQ6A 1YYXA 5JP7A 4CX9A 3NMJA 1QPUA 1CGNA 2YLDA 3C62A 4ER9A 2QLAA 4CDAA 1JAFA 2XLWA 2XLDA 4L6RA 1EKYA 5JT4A 1A7VA 3M15A 5B3IA 1MQVA 3M4BA 3M4CA 3TOMA 1E84A 2XL8A 1QQ3A 256BA 3DE9A 4EIYA 3DE8A 4U9DA 3HNIA 3ZQVA 1YYJA 1GQAA 1NBBA 3VRCA 1CGOA 5JUAA 2XLVA 3IQ5A 2YKZA 5JVEA 4CJOA 3C63A 4JEBA 1BBHA 2YL3A 1E86A 4N6HA 5JS5A 4IB4A 1CPQA 1E85A 3M79A 3L1MA 2CCYA 1M6TA 2YLIA 5JRAA 1CPRA 1RCPA 3ZTMA 2YL1A 4U9EA 1E83A 4JEAA 1YZAA 3U8PA 3QVYA 1APCA 4D4NA 2J9BA 3HNLA 3ZWIA 3ZQYA 4CJGA 4WGZA 4ULVA 4JKVA 5JLIA 4JE9A 2XM4A 4N4WA 2J8WA 2XLHA 1YZCA 2YL7A 1LM3B 2BC5A 1S05A 2YL0A 4D4XA 3NMIA 4IARA 4WGYA 2XLEA 2XM0A 3NMKA 3TOLA 5JSLA 3QVZA 3FOPA 4IAQA 4CDYA 3QW0A 4NC3A 3QW1A 2XLOA 3HNJA 5AGFA 3FOOA 4CDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTZ A;  4CIP A;  2XLM A;  2XL6 A;  2YLG A;  3HNK A;  3IQ6 A;  1YYX A;  5JP7 A;  4CX9 A;  3NMJ A;  1QPU A;  1CGN A;  2YLD A;  3C62 A;  4ER9 A;  2QLA A;  4CDA A;  1JAF A;  2XLW A;  2XLD A;  4L6R A;  1EKY A;  5JT4 A;  1A7V A;  3M15 A;  5B3I A;  1MQV A;  3M4B A;  3M4C A;  3TOM A;  1E84 A;  2XL8 A;  1QQ3 A;  256B A;  3DE9 A;  4EIY A;  3DE8 A;  4U9D A;  3HNI A;  3ZQV A;  1YYJ A;  1GQA A;  1NBB A;  3VRC A;  1CGO A;  5JUA A;  2XLV A;  3IQ5 A;  2YKZ A;  5JVE A;  4CJO A;  3C63 A;  4JEB A;  1BBH A;  2YL3 A;  1E86 A;  4N6H A;  5JS5 A;  4IB4 A;  1CPQ A;  1E85 A;  3M79 A;  3L1M A;  2CCY A;  1M6T A;  2YLI A;  5JRA A;  1CPR A;  1RCP A;  3ZTM A;  2YL1 A;  4U9E A;  1E83 A;  4JEA A;  1YZA A;  3U8P A;  3QVY A;  1APC A;  4D4N A;  2J9B A;  3HNL A;  3ZWI A;  3ZQY A;  4CJG A;  4WGZ A;  4ULV A;  4JKV A;  5JLI A;  4JE9 A;  2XM4 A;  4N4W A;  2J8W A;  2XLH A;  1YZC A;  2YL7 A;  1LM3 B;  2BC5 A;  1S05 A;  2YL0 A;  4D4X A;  3NMI A;  4IAR A;  4WGY A;  2XLE A;  2XM0 A;  3NMK A;  3TOL A;  5JSL A;  3QVZ A;  3FOP A;  4IAQ A;  4CDY A;  3QW0 A;  4NC3 A;  3QW1 A;  2XLO A;  3HNJ A;  5AGF A;  3FOO A;  4CDV A; 
#chains in the Genus database with same CATH topology
 4O6Y A;  1G4W R;  1OCC C;  2XL4 A;  3IQ6 A;  3DXJ F;  1NFO A;  3GEH A;  3CZ6 A;  3AOU A;  4C7O B;  2OU6 A;  1CGN A;  2ICW G;  2HSQ A;  2FAP B;  5E33 A;  2GWW A;  4YL1 A;  2GFH A;  4CSA A;  1F1M A;  2HJ3 A;  4IAO A;  2QLA A;  2VCB A;  2AWC A;  3M1C B;  5GPG B;  1JAF A;  4CDA A;  4ER9 A;  3QTH A;  4MVO A;  2XLW A;  3QZC A;  1JRA A;  4YT4 A;  2J9V A;  1EKY A;  3X1O A;  2X0C A;  1OR2 A;  4G78 A;  5B3I A;  2OQM A;  4UDV A;  1LKX A;  2L7A A;  1O87 A;  256B A;  4R32 A;  2EIJ C;  1GM5 A;  2Y69 C;  5T3T A;  3DE8 A;  3GAN A;  3S29 A;  2L6G A;  4YN0 B;  4MTF A;  3ZQV A;  1BDJ B;  4NTF A;  1LPE A;  2DI3 A;  3AG3 C;  3K6B A;  4ULW A;  3F46 A;  1LIH A;  5B1A C;  1OQC A;  2EIM C;  1AEP A;  1CGO A;  1PD1 A;  2C03 A;  4AE4 A;  4XEK A;  5JUA A;  3FMS A;  4CJO A;  4GQH A;  1WAS A;  4ZLC A;  2A68 F;  3GEI A;  1YAR O;  3IHU A;  5KYN A;  1OXB A;  4J7T A;  1GGQ A;  5L0F A;  1WGW A;  2YZS A;  1FMV A;  3AQB A;  4Z9I A;  1HW1 A;  2CCY A;  3IQT A;  2H8A A;  1M6T A;  2CDQ A;  3W4Y A;  1Z23 A;  3EH1 A;  4EBK A;  2Q7R A;  3KH2 A;  4DBR A;  3JYY A;  1K40 A;  1ZVZ A;  2D5R B;  3JT1 A;  5F5H A;  2UUI A;  1G4U S;  3DI5 A;  1C17 M;  5T1D B;  1H6G A;  1M56 C;  2A0B A;  4BEJ A;  4CS8 A;  4JVS A;  4FES A;  1OKK D;  2LP4 A;  4CS7 A;  3EQL F;  5BQH A;  3HNL A;  5E2Q A;  1Q0M A;  2HJM A;  4C7O A;  4YWQ A;  3RQE A;  3LNM B;  3KL4 A;  5DS6 A;  1TWA A;  3N0T A;  2I8B A;  2NUT A;  5CIV A;  1NZE A;  5L0I A;  5L3V A;  5KYU B;  4PFO A;  2IYL D;  2XRH A;  1TFO B;  1Q0K A;  1N1C A;  4JJG A;  3WG7 C;  1KTM A;  2R7W A;  3IEE A;  1VYK A;  3GWN A;  4BJT A;  1LI7 A;  3ZVR A;  2IXM A;  3TD7 A;  5L0J A;  3FVY A;  4JJF A;  4BEM J;  3RQF A;  2IBF A;  4G0H A;  1ZHY A;  4MVZ A;  2NG1 A;  4O7G A;  2YWA A;  3LNR A;  1I4Z A;  3EPV A;  4XPW A;  3EGX B;  2AU5 A;  3V7O A;  2BC5 A;  3DWW A;  4OIO F;  4XEV A;  4DBQ A;  1KNY A;  2P1A A;  2CYD A;  3K1H A;  3GM1 A;  3Q7G A;  4JUR I;  1JPJ A;  1RJ9 B;  1PD0 A;  1ZHT A;  4I1O B;  2WZG A;  3T4R A;  1RKE A;  3NMI A;  4GEH A;  4IAR A;  5KYY B;  5COF A;  4YT8 A;  2XM0 A;  3TK0 A;  4MS2 A;  1EA8 A;  4WAB A;  3TOL A;  5DQT A;  3J06 A;  2YHS A;  3QVZ A;  2A69 F;  4IJJ A;  3S9O A;  2VCC A;  2LFD A;  3L8J A;  3W2W A;  2J9U A;  1M2V A;  4EBJ A;  1L7C A;  2YVK A;  4XEF A;  4AK9 A;  3QW0 A;  5L0G A;  2R7S A;  2R7T A;  1MND A;  2J7P D;  4LDR A;  1ZHX A;  3EH2 A;  3KYI A;  4J30 B;  2EIL C;  3CAX A;  2HMZ A;  3VAY A;  1ZU4 A;  2FGY A;  4JTC B;  4A2N B;  2Y3G A;  4HEA J;  2AP3 A;  3ABK C;  2M64 A;  4NY3 A;  2OEX A;  2P61 A;  4CIP A;  2XL6 A;  2EIK C;  3RKO F;  2ASR A;  2HV7 A;  4U5E E;  2QY9 A;  3K33 A;  3KYJ A;  3EFO B;  2DYS C;  2XXA A;  5KYX B;  5JP7 A;  2R7O A;  5HV9 A;  2Q4F A;  4CX9 A;  2YLD A;  2OJE D;  1D0Y A;  2HUJ A;  3EG9 B;  3NYL A;  3C8Z A;  3I4U A;  5EGY A;  1NLX A;  4JC7 A;  3IPM O;  3NG1 A;  2TMV P;  2L6F A;  5A6A A;  3LAY A;  2PX3 A;  2XLD A;  4NCQ A;  2G62 A;  3T6B A;  3WAQ A;  3UMK A;  5JT4 A;  2YQY A;  1MQV A;  4I44 A;  2HZ8 A;  3JSZ A;  3M4C A;  3TOM A;  3LS0 A;  2GDC A;  5BQI A;  3TJ5 A;  1QQ3 A;  3ASN C;  2HS5 A;  4EIY A;  2ETS A;  1RKC A;  4JTA B;  4E18 A;  2PBE A;  3V5Z A;  1Z6A A;  5A6K A;  1OR3 A;  2B0H A;  4BJ6 C;  3CEX A;  3HNI A;  3GM2 A;  2J46 A;  1BR1 A;  1SYQ A;  2WVQ A;  3SNH A;  2R03 A;  3UGO A;  1NBB A;  3WOD F;  1OW8 A;  4AL0 A;  1FR0 A;  4LLC A;  3H2U A;  3O10 A;  1OCZ C;  3O39 A;  5D92 A;  4XTK A;  4J7Y A;  2R7U A;  4DRI B;  3ZC4 A;  5A6B A;  3FXH A;  2KSF A;  1UG7 A;  2YKZ A;  1MMG A;  1RJ9 A;  2LK4 A;  5E3C A;  4JEB A;  2J9W A;  1BBH A;  4PFP A;  5FZT A;  3W8H A;  3JYH A;  3E70 C;  3UGP A;  2A0U A;  3EGD A;  5AC5 A;  4JRZ A;  4KNV A;  4N6H A;  4EHP A;  4XPX A;  4IB4 A;  3LLK A;  3RVZ A;  1C02 A;  4WJ0 A;  1QVX A;  2R9R B;  3C8G B;  3E9V A;  1QZX A;  3L1M A;  1SR2 A;  4PR9 A;  3U8V A;  4RDA A;  3ZG1 A;  1Y6D A;  3L34 A;  2RSE B;  3GOR A;  2H7V C;  4PK4 A;  2Q9A A;  5JRA A;  1DOV A;  2VC9 A;  1FNT c;  5AC4 A;  1NSG B;  3AGT A;  4MVM A;  3ZTM A;  2YL1 A;  3BRJ A;  4U5G A;  3B71 A;  1E83 A;  4BPM A;  2NUP B;  3K7D A;  3MX3 A;  5DLJ A;  1H7I A;  3JRM O;  1QKR A;  3N24 A;  1IW7 F;  3AG2 C;  3QVY A;  4I3M A;  1HE9 A;  4D4N A;  2HKV A;  3DD7 A;  5DS4 A;  3FAP B;  3C8G D;  1G8X A;  3KKB A;  3ZWI A;  3ATP A;  2A6H F;  2IXO A;  3LES A;  4WGZ A;  3U3B A;  2IXP A;  2UUH A;  1Z3I X;  3EZH A;  4JKV A;  4OD5 A;  1RXQ A;  4G7H F;  5JLI A;  4U5H A;  3T6G B;  4JIO A;  4JE9 A;  2XM4 A;  3LS1 A;  3ITF A;  4EWC A;  2R7R A;  4FWV A;  4YJW A;  1WOL A;  2IM8 A;  1R4T A;  3PMR A;  1D0X A;  4H4K C;  2CW0 F;  4XLP F;  3H2V A;  3GEE A;  1TFK B;  1MMN A;  4YT5 A;  3W2V A;  1YZC A;  4MVU A;  2C04 A;  1EI7 A;  1FFT C;  2H7O A;  2P6V A;  3DMD A;  4DVY P;  2YL0 A;  1BR4 A;  4NTB A;  3MFN A;  3U9M A;  5L0C A;  4OIR F;  2L9J A;  1T01 A;  1Z63 A;  1Q0D A;  2Q9C A;  2Y39 A;  4KBL A;  4U5B E;  4D4X A;  2W4B A;  2W4M A;  1E2X A;  4P9F A;  2KJG A;  2P0N A;  2XLE A;  1EQ1 A;  2CGE A;  2I15 A;  2ZXW C;  5JSL A;  4E7Z A;  5B1B C;  3FOP A;  4NQF A;  1H9G A;  3K1I C;  4IAQ A;  4CDY A;  2JD3 A;  1LS4 A;  1VLT A;  3FHD A;  3T9O A;  2WL8 A;  3HJC A;  4O6N A;  4NC3 A;  4G7Z F;  4LAC B;  1OCR C;  2NSG A;  2P7V A;  1A0B A;  1Q0G A;  5CI8 A;  4B6I A;  1L3P A;  2OCC C;  3UMH A;  3TUL A;  3ZTZ A;  4BJ5 A;  4E0I A;  2XLM A;  3T6J A;  3PCV A;  1Z5Z A;  2WVN A;  1LE2 A;  3HNK A;  1VLS A;  2ZXP A;  4MVS A;  1FTS A;  3K66 A;  3JTL O;  4RBN A;  2AWY A;  1YYX A;  3I5Q A;  4XQ1 A;  3V5Y A;  2GA0 A;  4U5F E;  4M63 A;  3B29 A;  2KNH A;  3LEV A;  2VAS A;  4AX2 A;  5A6J A;  2CNW D;  3R2P A;  5TJ5 E;  4HE8 D;  3SYN A;  4C3E A;  4BJ6 A;  1M57 C;  4Q5S F;  2ZXO A;  3Q6M A;  1LVK A;  4HFF B;  4Q7C A;  4DRJ B;  1Z7Q c;  2ZPA A;  4L6R A;  1FMW A;  4Z9J A;  2PNO A;  1LE4 A;  4FAP B;  1OKK A;  5EHH A;  3HTK C;  1OXK A;  3NRH A;  3DE9 A;  4LER A;  1D1C A;  1ORY A;  4O6M A;  2YRF A;  4PJN A;  5D91 A;  3U3F A;  1YYJ A;  3VYW A;  3SP1 A;  1ORJ A;  1J8M F;  1TR2 A;  5FCL A;  1K04 A;  4Q4Z F;  3NYM A;  2LD6 A;  1ZHW A;  2OJQ A;  3AGU A;  3DAF A;  3JZ0 A;  5A69 A;  3POV A;  1K05 A;  1A7D A;  1HMD A;  4X0R A;  3G50 A;  3V5X A;  2WVO A;  2R05 A;  4MND A;  4E7S A;  3B0P A;  1ORS C;  2E87 A;  4MQ9 F;  4CIH A;  1C03 A;  3C63 A;  3CQZ A;  4MVQ A;  2JPU A;  1JPN A;  2YL3 A;  3UNG C;  2F22 A;  3AQC A;  3RQG A;  2Y3H A;  2KQ9 A;  4BJ5 C;  2ZD9 A;  1E86 A;  2KYH A;  1PV3 A;  3H65 A;  1CPQ A;  3SXM A;  2EPL X;  5JS5 A;  1I5N A;  3M79 A;  1AUE A;  2RD9 A;  4LLE A;  1M2O A;  3RVY A;  3U2M A;  3FDQ A;  5KYU A;  1OW6 A;  4CBE A;  5BQG A;  3S0X A;  4CS9 A;  4U5D E;  4HFK B;  1Y4C A;  3UMI A;  1RCP A;  1V55 C;  2G3K A;  2PFD A;  4EKW A;  1ZW2 A;  2WZF A;  3LJB A;  3Q6N A;  2R25 A;  3TJ6 A;  5DVW A;  3U8P A;  4F4B A;  3HKK A;  5K0I A;  3U9J A;  1APC A;  2A6E F;  3FAJ A;  3MYI A;  2EPK X;  4AE4 B;  3EGX A;  2J9B A;  2Y3B A;  2LFF A;  3DJU B;  3O55 A;  3B0V C;  2J7P A;  3ZQY A;  4KI2 A;  2IOQ A;  4CJG A;  3ABL C;  4DRH B;  2MHR A;  5E3A A;  3RH3 A;  4EBB A;  2PF4 E;  1OW7 A;  1HMO A;  4P6I C;  4IWB A;  1QLE C;  4KC9 A;  5COG A;  1YDI A;  3AJM A;  5KYY A;  1OCO C;  3GWL A;  3MBG A;  4N4W A;  2J0X A;  3DZA A;  3OEO A;  4RD9 A;  2OEV A;  3CSK A;  1D0Z A;  5L3Q A;  3N2Z B;  4P9T A;  3VF0 A;  4XPY A;  2J8W A;  2PX0 A;  2VB6 A;  2Q00 A;  2L6H A;  3LLI A;  2V26 A;  2LQG A;  2XLH A;  3S84 A;  3S90 A;  4XLN F;  5T3W A;  4YT2 A;  3K1I A;  2J0W A;  2G3V A;  1DOW A;  2BE5 F;  1IZM A;  1ST6 A;  2KGO A;  2R7Q A;  1VOM A;  4MW3 A;  5F5F A;  5DS5 A;  3NDB B;  2D4U A;  3RYL A;  3DM5 A;  3EFO A;  4N06 A;  4CS9 C;  3PHF 2;  1YAU O;  5EK0 A;  1TKN A;  5KYX A;  1GS9 A;  2V3C C;  1TWC A;  2NUT B;  1D1B A;  2KW3 C;  3NMK A;  2FFH A;  3EG9 A;  1FFH A;  4OIP F;  1NG1 A;  3VM6 A;  1TWH A;  3SZR A;  3MLG A;  4DVZ A;  2DB4 A;  2KK1 A;  4YK5 A;  1A41 A;  1T6U A;  4PJJ A;  3EZI A;  1AVO B;  1B68 A;  3GOD A;  3O6X A;  4W8K A;  2QE9 A;  2BL2 A;  2W45 A;  3HNJ A;  1JMW A;  3FOO A;  2KC3 A;  3JCU Q;  3NYJ A;  4U5C E;  4BG0 A;  2ZXR A;  2J45 A;  2YLG A;  5F28 E;  2L81 A;  3UR3 C;  2NSF A;  1V54 C;  3DAG A;  1W2W A;  1V74 B;  2Q3T A;  2Q9B A;  1ZU5 A;  1RKE B;  1ZZP A;  3AG1 C;  4O79 A;  1T5O A;  1RMV A;  3NMJ A;  1QPU A;  1VMA A;  2EPN A;  2VH3 A;  4JCH A;  4JTD B;  4W8P A;  1T6Q A;  5IY5 C;  1UFB A;  3C62 A;  3L0I A;  5CI9 A;  3RIP A;  1ZYR F;  3A11 A;  4DJ9 A;  1MMD A;  4DXW A;  1M2V B;  1VYI A;  3HLZ A;  1G5Z A;  2DGJ A;  1YVI A;  2GAQ A;  2OOC A;  3ECS A;  3SXK A;  1NU9 C;  3US6 A;  1CGM E;  1A7V A;  1QSP A;  3M15 A;  4I1M A;  3M4B A;  4ONS A;  1E84 A;  5COM A;  4K7B A;  5KYW B;  2XL8 A;  3MYF A;  2JX0 A;  3C8G A;  2H7B A;  4YL0 A;  3SXZ A;  4OIN F;  3BEH A;  5KYW A;  1WWP A;  2EPO A;  4JZA A;  1T6I A;  1D1A A;  4CSA C;  2XS1 A;  4U9D A;  4LDQ A;  3LEO A;  1YA7 O;  2QNL A;  3NKE A;  2XS8 A;  4A4A A;  2XXA B;  1GQA A;  1U6H A;  1XZP A;  2NUP A;  1KU2 A;  3G4Z A;  3EHN A;  1FAP B;  1S7Z A;  5L0D A;  4KNW A;  3VRC A;  4H54 A;  2OG2 A;  3R7C A;  5DQZ A;  1YLM A;  2XLV A;  1A7E A;  2B0J A;  2Z15 A;  3IQ5 A;  4MW8 A;  2HSB A;  3ABM C;  4OD4 A;  5JVE A;  4OIQ F;  1ZW3 A;  2W9Y A;  4ANJ A;  1NU7 D;  2VCA A;  4BJ1 A;  4DOZ A;  4MTO A;  3F47 A;  3X2Q C;  5B3S C;  1E85 A;  3I5P A;  1T9K A;  2LCH A;  3EHM A;  4XWJ A;  2EPM X;  5HSW A;  2MYS A;  2YLI A;  4ZLD A;  4MVR A;  3PDM P;  3KMI A;  1CPR A;  2DYR C;  1VTM P;  3C18 A;  3OA1 A;  3U0C A;  4FX5 A;  3B9Q A;  4U9E A;  2LIG A;  4JEA A;  1HE1 A;  3RW0 A;  3U2L A;  3QMK A;  1YZA A;  1NFN A;  4C3D A;  4GYT A;  1U0B B;  1V4A A;  1JOG A;  1BR2 A;  1LI5 A;  1VK5 A;  1O5H A;  3NKD A;  3DJN B;  4JCZ A;  2QTV A;  3A9C A;  3SEO A;  4C3B A;  1TQG A;  4PJL A;  3ZIB A;  1ZHZ A;  3DM9 B;  3KPH A;  2WZL A;  2HMQ A;  3AG4 C;  4IGG A;  4MTG A;  3EGD B;  1HW2 A;  4ULV A;  2R7X A;  1I4Y A;  1SF8 A;  3B0U X;  1PCX A;  4NTA A;  3ZSU A;  4CS8 C;  4E17 A;  3Q7L A;  1U89 A;  3WHN A;  2WB7 A;  2NPU A;  3G4X A;  1H9T A;  2X51 A;  1XWJ A;  4QI2 A;  3LUT B;  5A6B D;  3ZDL A;  3RFY A;  2A1D D;  3ASO C;  2CNW A;  2HV6 A;  2O9X A;  2Y3D A;  2HFI A;  4K1O A;  3SXY A;  1HY5 A;  2YEV A;  2R02 A;  1WAT A;  2XSE A;  1LM3 B;  2YL7 A;  3GM3 A;  1S05 A;  4QI0 A;  5BUO A;  1LS1 A;  1BZ4 A;  2AVK A;  3DKA A;  1VB5 A;  2MWQ A;  2M4E A;  3JSE O;  4IRU A;  1WTY A;  4QDL A;  3U5S A;  2R7V A;  3JRT A;  3W8I A;  2IXN A;  1SZI A;  1YJG A;  3S28 A;  3TQO A;  2EIN C;  5L0H A;  4J32 B;  4WGY A;  4EUK B;  3RF3 A;  1XZQ A;  1SMY F;  1O3U A;  4JW1 A;  4AL1 A;  2QUP A;  1Q0F A;  3IQC A;  4PAC A;  1MNE A;  1R5I D;  2OKU A;  4E0H A;  1TWG A;  4YL3 A;  4Z9H A;  4G7O F;  1MMA A;  2LSE A;  4LDK A;  3QW1 A;  3S27 A;  3C7J A;  2XLO A;  1JR8 A;  2PP4 A;  3EJN A;  1J8Y F;  3OWT A;  4K0D A;  4N6C A;  1WN0 A;  1YA9 A;  4PJM A;  5AGF A;  4CDV A;  3L8I A; 
#chains in the Genus database with same CATH homology
 3ZTZ A;  4CIP A;  2XLM A;  2XL6 A;  2YLG A;  3HNK A;  3IQ6 A;  1YYX A;  5JP7 A;  4CX9 A;  3NMJ A;  1QPU A;  1CGN A;  2YLD A;  3C62 A;  4ER9 A;  2QLA A;  4CDA A;  1JAF A;  2XLW A;  2XLD A;  4L6R A;  1EKY A;  5JT4 A;  1A7V A;  3M15 A;  5B3I A;  1MQV A;  3M4B A;  3M4C A;  3TOM A;  1E84 A;  2XL8 A;  1QQ3 A;  256B A;  3DE9 A;  4EIY A;  3DE8 A;  4U9D A;  3HNI A;  3ZQV A;  1YYJ A;  1GQA A;  1NBB A;  3VRC A;  1CGO A;  5JUA A;  2XLV A;  3IQ5 A;  2YKZ A;  5JVE A;  4CJO A;  3C63 A;  4JEB A;  1BBH A;  2YL3 A;  1E86 A;  4N6H A;  5JS5 A;  4IB4 A;  1CPQ A;  1E85 A;  3M79 A;  3L1M A;  2CCY A;  1M6T A;  2YLI A;  5JRA A;  1CPR A;  1RCP A;  3ZTM A;  2YL1 A;  4U9E A;  1E83 A;  4JEA A;  1YZA A;  3U8P A;  3QVY A;  1APC A;  4D4N A;  2J9B A;  3HNL A;  3ZWI A;  3ZQY A;  4CJG A;  4WGZ A;  4ULV A;  4JKV A;  5JLI A;  4JE9 A;  2XM4 A;  4N4W A;  2J8W A;  2XLH A;  1YZC A;  2YL7 A;  1LM3 B;  2BC5 A;  1S05 A;  2YL0 A;  4D4X A;  3NMI A;  4IAR A;  4WGY A;  2XLE A;  2XM0 A;  3NMK A;  3TOL A;  5JSL A;  3QVZ A;  3FOP A;  4IAQ A;  4CDY A;  3QW0 A;  4NC3 A;  3QW1 A;  2XLO A;  3HNJ A;  5AGF A;  3FOO A;  4CDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...