3M15A

A zn-mediated asymmetric trimer of a cytochrome cb562 variant (d74a-ridc1)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a microperoxidase inside a metal-directed protein cage.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3m15A00
4N6HA 4CX9A 1E84A 1MQVA 3L1MA 2XM0A 3HNKA 4JEBA 2XL8A 4D4NA 3ZQYA 1E83A 3DE8A 2YL1A 3QVZA 4NC3A 2XLWA 256BA 4CDYA 4CJGA 4IB4A 4IARA 2QLAA 2YLIA 2XLEA 4CJOA 4D4XA 4EIYA 2XM4A 2CCYA 2YKZA 1A7VA 4N4WA 2BC5A 5JP7A 3ZTMA 5JUAA 4ULVA 4CIPA 3VRCA 4WGYA 2YL3A 3C63A 3DE9A 1GQAA 5JS5A 2XLVA 3FOPA 1APCA 3QVYA 1E86A 2J9BA 3ZWIA 3NMKA 1M6TA 1CPQA 1YYJA 2YLGA 4U9DA 5JRAA 3NMJA 1YYXA 3IQ5A 3TOMA 3HNLA 4U9EA 5B3IA 3HNIA 5JVEA 5AGFA 4JKVA 1LM3B 2J8WA 3QW1A 1EKYA 4JEAA 1RCPA 2XLHA 4L6RA 1NBBA 3M79A 2YL7A 3M15A 5JT4A 2XLOA 4CDVA 2XLMA 3M4BA 1CPRA 1CGNA 1YZCA 2YL0A 3FOOA 2XLDA 3M4CA 1JAFA 4JE9A 5JLIA 4IAQA 1BBHA 1E85A 4ER9A 2YLDA 4CDAA 3HNJA 4WGZA 3NMIA 3ZTZA 1YZAA 3QW0A 1QPUA 5JSLA 3ZQVA 3TOLA 3IQ6A 1QQ3A 1S05A 1CGOA 2XL6A 3C62A 3U8PA
chains in the Genus database with same CATH superfamily
3DM9B 4CS8C 1L3PA 3GM2A 3EZHA 2X0CA 4FAPB 2WVNA 1PV3A 5DS6A 4LDRA 3FHDA 1Z63A 4ZLCA 1MMNA 2JD3A 4EBBA 1M2OA 2QUPA 4KNVA 4LERA 1LPEA 3LEOA 3O39A 4D4NA 4OIRF 5L3VA 1KNYA 3EPVA 2ZXRA 2ZXWC 4PJJA 2J9WA 3SZRA 2HJ3A 2WZFA 3UMIA 4E0HA 1A0BA 3DE8A 3QVZA 3LAYA 256BA 4MVRA 4PK4A 3B0PA 3V7OA 4YJWA 1UG7A 5L0CA 1MMDA 3LLKA 3UNGC 4OIPF 4BJ6A 2LD6A 3ABMC 2XM4A 1T01A 2Y3HA 3GM1A 4EHPA 4E7SA 1ZZPA 4GEHA 2KNHA 1DOWA 4I1MA 2BC5A 4U5EE 3QMKA 1I4YA 3VF0A 4DVZA 5COMA 2IXOA 2TMVP 2YZSA 1VTMP 2YL3A 3C63A 2EPMX 4G0HA 4X0RA 1NZEA 3ZG1A 2GAQA 1GQAA 2KYHA 4FX5A 5JS5A 3BRJA 3J06A 2JPUA 2HUJA 3KH2A 3I4UA 3IQCA 4MVSA 1MMGA 2G3VA 4EBJA 1APCA 4MVUA 1M56C 4E17A 3S9OA 3G4ZA 2R03A 1BR2A 1WOLA 3NMKA 5F28E 1E2XA 2OG2A 1TFKB 2QY9A 1PD0A 2P1AA 2A1DD 5DVWA 4Z9HA 1QLEC 2YLGA 4HE8D 3S28A 5DS4A 3B0UX 3EHNA 4YL0A 3S90A 1VK5A 2FAPB 2HKVA 4JC7A 1L7CA 1M2VA 4JJFA 5CI9A 5EHHA 5JRAA 1LE2A 1TWGA 2R7QA 3DZAA 4Z9IA 5TJ5E 2YQYA 4F4BA 3IEEA 2I15A 1D0YA 2LIGA 3SNHA 2EIMC 5JVEA 5L0DA 3RVYA 1EA8A 4PJMA 3A11A 1HW2A 2FGYA 3W8IA 4BJ5A 3EG9A 2KC3A 2R7SA 3LNRA 3MX3A 4OINF 4I1OB 3ZSUA 2A0BA 2R7VA 2O9XA 2CW0F 3CZ6A 4JZAA 1NBBA 2GFHA 1VMAA 2J7PD 4CBEA 5T1DB 4PACA 3M15A 2OJQA 1ORYA 1H9GA 4XQ1A 1R5ID 4ONSA 1K04A 4NY3A 2AWYA 1HW1A 2A0UA 2PBEA 3AG3C 1D0ZA 4H54A 4A4AA 3EH1A 2J0WA 3M4BA 3GORA 2XXAB 5HV9A 1WASA 4LDKA 1CPRA 3VYWA 1JRAA 1CGME 1ZW3A 1CGNA 2VASA 1PCXA 2OJED 2P61A 2MWQA 2YL0A 4MTGA 3M4CA 2IOQA 1JAFA 3MYFA 5BQIA 2NPUA 1OQCA 1BBHA 3LUTB 2A6EF 3EJNA 1G5ZA 5BUOA 4CDAA 4LLEA 2IXNA 3NDBB 1Y6DA 2G3KA 1Q0FA 4E0IA 4NCQA 4HEAJ 2MHRA 4CS9A 4P6IC 2LFDA 1OKKA 4MW3A 3NMIA 4O79A 4PJNA 1RMVA 2ICWG 1NFOA 1OXKA 1Q0MA 3EHMA 1YA9A 2PX0A 3EZIA 3Q6NA 4WJ0A 1S7ZA 2JX0A 2ZXPA 3QW0A 1QPUA 2WVOA 1VB5A 4NTBA 1LS4A 2KJGA 5A6BA 3EGXB 2IBFA 3FVYA 1WN0A 4A2NB 1S05A 4ZLDA 1A7EA 2IYLD 2R7WA 3H2VA 3NRHA 3U8PA 1OKKD 3AGTA 3DKAA 3HKKA 4CX9A 2XXAA 4WABA 5L0FA 1Q0GA 2HSBA 4OD4A 3SXZA 1FTSA 4DBQA 1Z23A 4JRZA 1YAUO 3GWNA 2EPNA 1JR8A 3NKDA 3RIPA 4FESA 3K1IC 4OIQF 4C3BA 3K66A 3ITFA 5KYYA 2VB6A 1J8MF 2L9JA 3UGOA 4JCZA 2DYRC 2Q3TA 2Q4FA 2Y3GA 3JCUQ 3KPHA 2OCCC 1PD1A 1HE9A 4XLNF 5T3WA 4EIYA 3ABKC 3OWTA 4NTAA 1A7VA 4DJ9A 2CNWA 5E33A 3IHUA 3KKBA 5JUAA 1LKXA 2KW3C 3DM5A 5E3AA 4CIPA 3GM3A 4QDLA 4DRHB 4G78A 4XPWA 2B0JA 1SMYF 1O3UA 2H8AA 3U9JA 3DE9A 4PFPA 5KYXB 1KTMA 2KK1A 1HE1A 4MS2A 3AOUA 2R02A 2Q00A 2AP3A 4AL0A 1EQ1A 4IWBA 3QVYA 4BJ1A 4C7OB 2YHSA 4RDAA 5FCLA 2H7VC 1CPQA 1M6TA 2KQ9A 2OEXA 2Q9CA 4O6NA 1MNDA 3VAYA 1U0BB 2DB4A 4RBNA 2GA0A 2HSQA 1F1MA 1T6IA 1WWPA 2OKUA 3UMHA 2AVKA 3NYJA 5D91A 1LE4A 3V5XA 1LI7A 4U9DA 5KYXA 4LLCA 3TJ5A 1ST6A 1ZYRF 1I4ZA 3TK0A 2NSGA 1LIHA 3SEOA 2R25A 2L6GA 2Q9AA 2R9RB 4GQHA 4CS7A 2Y69C 3Q7LA 4UDVA 2CGEA 3QTHA 3AQCA 1BR4A 1H6GA 1TFOB 1FFTC 4DOZA 5COGA 3OEOA 1VLSA 4IJJA 4JTAB 2BE5F 4BEMJ 3BEHA 4I3MA 3ABLC 3LS1A 4MTOA 3SXKA 3C8GA 1FAPB 2YEVA 4U5DE 4JEAA 1T6UA 2AU5A 2PFDA 3FAPB 4J30B 4J32B 4XTKA 1W2WA 3I5PA 2Q9BA 4L6RA 4CS9C 1Q0DA 1M2VB 3M79A 2YL7A 4J7YA 5JT4A 1SF8A 2XLOA 3H65A 3PHF2 3E9VA 4MVZA 2GDCA 4G7HF 4C7OA 1FFHA 3R7CA 3I5QA 3CSKA 1VOMA 3RYLA 3K7DA 3U2MA 2LP4A 2P0NA 1BR1A 2DYSC 2L7AA 2HV7A 5HSWA 3TQOA 4DXWA 1SZIA 3GODA 5A6JA 1OCRC 2XLDA 2EPOA 4JTDB 2A68F 3K1IA 3SXMA 1NFNA 2VCCA 1K05A 1HY5A 1T5OA 3X2QC 1OCCC 1RXQA 2A69F 3AQBA 1QKRA 2ASRA 1SR2A 2AWCA 2R05A 3HNJA 3SP1A 3A9CA 3KL4A 3CEXA 4OD5A 1OCOC 1G4US 4BJ5C 2M4EA 3MYIA 4N06A 5KYYB 5JSLA 1B68A 1TWAA 3ZQVA 4Q5SF 1T9KA 4GYTA 2PX3A 2EILC 2Q7RA 4MVOA 3FXHA 4MNDA 3JYYA 2QTVA 3S29A 4O7GA 2VCAA 1E84A 1YDIA 2L81A 1MQVA 3DAFA 3C8GB 4MQ9F 2YWAA 3U3BA 3L1MA 4O6YA 3V5YA 3EG9B 2XM0A 3UR3C 1SYQA 4YT8A 3NKEA 1XZQA 3EFOA 3HJCA 3MFNA 4PFOA 2I8BA 1ZHTA 2ZPAA 5KYNA 3S0XA 4JURI 3G4XA 3ASOC 1WGWA 3U3FA 1NLXA 1C02A 2Y39A 1NU9C 3US6A 4YWQA 3CQZA 4YT4A 1V55C 3GWLA 3GANA 4CJGA 1OXBA 2EIKC 5BQHA 1Y4CA 3DI5A 1AEPA 4IB4A 2ZXOA 4IARA 1IZMA 2R7UA 2J46A 1Z7Qc 2HFIA 1VYIA 4I44A 4CJOA 4D4XA 3UGPA 2R7RA 1YA7O 4K1OA 2RD9A 2LFFA 3KYIA 2Z15A 2YKZA 1Z5ZA 3MBGA 4IGGA 3RW0A 3ZTMA 1C03A 2HZ8A 3VRCA 3DAGA 3W2VA 3F46A 4WGYA 4AX2A 4YT2A 2EIJC 2D5RB 3T6BA 2Y3DA 3L8JA 3TULA 2KGOA 2CDQA 2P7VA 3ZC4A 1N1CA 1Z6AA 3DD7A 3ECSA 3EGXA 4RD9A 4EWCA 2XLVA 4BJ6C 4CIHA 2RSEB 4E18A 1A41A 4M63A 3NYMA 3U2LA 5L0IA 2J9BA 2XL4A 4JTCB 3ZWIA 5KYUB 1E86A 2R7TA 3LNMB 5DLJA 1YYJA 1J8YF 2LSEA 4BG0A 3RQGA 3DJNB 2Y3BA 5A6KA 1BDJB 5E3CA 2MYSA 3Q6MA 1U6HA 3O10A 1EI7A 3B9QA 4ULWA 1R4TA 5F5HA 3W8HA 3POVA 4P9TA 1H9TA 1XWJA 3B0VC 3RQFA 4CS8A 5E2QA 1YJGA 3C8GD 2J7PA 3RKOF 1QZXA 3JT1A 1TWHA 3ZIBA 5IY5C 3HTKC 3B29A 4AE4B 5K0IA 3HNLA 5B3IA 3HNIA 2W9YA 4HFKB 4B6IA 2HS5A 1V74B 3L34A 1ZHYA 4XPXA 3K1HA 4N6CA 4E7ZA 5AGFA 3LLIA 1OW8A 4JKVA 1LM3B 1O5HA 2J8WA 1JPJA 3QW1A 5FZTA 5AC4A 3E70C 1I5NA 1RCPA 2CYDA 2WZGA 4U5FE 3UMKA 4XWJA 1ORJA 3ZDLA 4AE4A 3FDQA 3TD7A 2J45A 3O6XA 2EPKX 3F47A 3K6BA 4DBRA 2M64A 1U89A 2V3CC 4O6MA 2YRFA 1H7IA 1ZHWA 1RKEA 2IXMA 3M1CB 4R32A 3ZVRA 4KBLA 3DXJF 3T6GB 3WHNA 3MLGA 3Q7GA 2LQGA 4BPMA 4EUKB 1D0XA 1WTYA 4Q4ZF 3K33A 3SYNA 1XZPA 2DGJA 3C7JA 1ZW2A 2NUPA 2R7OA 3WG7C 1ZU5A 5AC5A 1JMWA 5B3SC 4XLPF 5JLIA 1LI5A 5A6BD 3NYLA 3U0CA 1D1CA 4XEVA 2EINC 1O87A 1M57C 1C17M 2VH3A 2YLDA 2ZD9A 3LESA 1KU2A 2KSFA 2PF4E 4H4KC 3JSZA 4CSAC 3OA1A 4WGZA 5CIVA 1ORSC 2H7BA 2QE9A 3SXYA 3JSEO 3LEVA 4QI0A 3AG2C 3B71A 1YZAA 2FFHA 3AGUA 3JTLO 4XEKA 5DS5A 4FWVA 2B0HA 2NG1A 1OR3A 4C3EA 1D1BA 4Q7CA 3AG4C 3TOLA 2W4BA 3IQ6A 3DWWA 3T4RA 3U8VA 2UUIA 1IW7F 1TR2A 2XL6A 5COFA 4LACB 1GM5A 1NSGB 2J9VA 1ZU4A 2EPLX 3GEIA 2OEVA 5A69A 1T6QA 4P9FA 4N6HA 5B1BC 3L0IA 5EK0A 3CAXA 1RKCA 1Z3IX 2PNOA 4YK5A 3N2ZB 2LK4A 3HNKA 1GS9A 4XEFA 4JEBA 2BL2A 2CNWD 2XL8A 3ZQYA 1E83A 1BZ4A 2L6FA 3AJMA 3LS0A 2YL1A 3IPMO 4NC3A 3WODF 1DOVA 2P6VA 2XLWA 2PP4A 3RFYA 3TJ6A 4CDYA 4ANJA 1FNTc 2VCBA 2X51A 3U5SA 5T3TA 3LJBA 3T9OA 4MW8A 2QLAA 1QVXA 2YLIA 2XLEA 4YL1A 3GEHA 1OW7A 4YL3A 1V4AA 4KI2A 2CCYA 4JW1A 2C03A 2G62A 2HMQA 4N4WA 5JP7A 4ULVA 1TWCA 1GGQA 4G7OF 3JYHA 1LS1A 2IXPA 5L0JA 1YLMA 5KYWA 4G7ZF 1TQGA 1OCZC 2HMZA 3FOPA 4W8PA 1Q0KA 4EBKA 3ATPA 2HJMA 4HFFB 3S27A 2NSFA 1ZHZA 2V26A 2F22A 2ETSA 5D92A 4MVQA 1MMAA 5KYUA 3PDMP 1RKEB 4QI2A 4NQFA 1VYKA 1OW6A 4JIOA 2R7XA 4KNWA 5KYWB 5L0HA 1RJ9B 3QZCA 4LDQA 3VM6A 1VLTA 1ZHXA 5L0GA 1FR0A 2YVKA 5BQGA 1G8XA 2VC9A 3FMSA 2W4MA 3C18A 2WB7A 3EGDB 4MVMA 3NMJA 4JVSA 1YYXA 3AG1C 3RF3A 2J0XA 3IQ5A 3ASNC 3TOMA 3IQTA 1YARO 4PR9A 2OQMA 2J9UA 4OIOF 2OU6A 4U9EA 1FMVA 3H2UA 5GPGB 4DRIB 3W4YA 2H7OA 3DJUB 4K7BA 1NG1A 4NTFA 2W45A 3JRMO 2NUPB 3R2PA 3FAJA 3RH3A 5DQZA 1EKYA 1HMDA 3V5ZA 2WL8A 3G50A 3KMIA 4U5HA 4K0DA 3W2WA 4J7TA 2NUTB 2XLHA 2C04A 4CSAA 3DMDA 2HV6A 1UFBA 4EKWA 1WATA 3EFOB 3RVZA 1G4WR 1HMOA 2A6HF 5CI8A 4CDVA 4U5GA 2OOCA 2XLMA 2XRHA 2L6HA 2WZLA 1FMWA 1K40A 1AVOB 3T6JA 3JZ0A 1YZCA 4YT5A 3EH2A 3U9MA 2UUHA 3WAQA 4AL1A 2E87A 2XS1A 1TKNA 3EGDA 3FOOA 3PCVA 2QNLA 4JE9A 4YN0B 2DI3A 3GEEA 4IAQA 4U5CE 4BEJA 3O55A 1E85A 4Z9JA 4ER9A 3KYJA 4C3DA 2D4UA 1RJ9A 3C8ZA 4IRUA 1D1AA 4BJTA 4KC9A 4IAOA 2GWWA 3NG1A 2LCHA 3N0TA 1JPNA 4JCHA 1AUEA 1NU7D 5F5FA 3ZTZA 4U5BE 4JJGA 4PJLA 1A7DA 4W8KA 4AK9A 4XPYA 1MNEA 5L3QA 4DVYP 3EQLF 2XSEA 2IM8A 5B1AC 3N24A 1ZVZA 3JRTA 1OR2A 3PMRA 4MTFA 1LVKA 3X1OA 1QQ3A 1JOGA 2XS8A 3L8IA 1CGOA 1YVIA 5EGYA 5DQTA 3C62A 1V54C 3S84A 3RQEA 5A6AA 1QSPA 4DRJB 2NUTA 3HLZA 2WVQA
chains in the Genus database with same CATH topology
4N6HA 4CX9A 1E84A 1MQVA 3L1MA 2XM0A 3HNKA 4JEBA 2XL8A 4D4NA 3ZQYA 1E83A 3DE8A 2YL1A 3QVZA 4NC3A 2XLWA 256BA 4CDYA 4CJGA 4IB4A 4IARA 2QLAA 2YLIA 2XLEA 4CJOA 4D4XA 4EIYA 2XM4A 2CCYA 2YKZA 1A7VA 4N4WA 2BC5A 5JP7A 3ZTMA 5JUAA 4ULVA 4CIPA 3VRCA 4WGYA 2YL3A 3C63A 3DE9A 1GQAA 5JS5A 2XLVA 3FOPA 1APCA 3QVYA 1E86A 2J9BA 3ZWIA 3NMKA 1M6TA 1CPQA 1YYJA 2YLGA 4U9DA 5JRAA 3NMJA 1YYXA 3IQ5A 3TOMA 3HNLA 4U9EA 5B3IA 3HNIA 5JVEA 5AGFA 4JKVA 1LM3B 2J8WA 3QW1A 1EKYA 4JEAA 1RCPA 2XLHA 4L6RA 1NBBA 3M79A 2YL7A 3M15A 5JT4A 2XLOA 4CDVA 2XLMA 3M4BA 1CPRA 1CGNA 1YZCA 2YL0A 3FOOA 2XLDA 3M4CA 1JAFA 4JE9A 5JLIA 4IAQA 1BBHA 1E85A 4ER9A 2YLDA 4CDAA 3HNJA 4WGZA 3NMIA 3ZTZA 1YZAA 3QW0A 1QPUA 5JSLA 3ZQVA 3TOLA 3IQ6A 1QQ3A 1S05A 1CGOA 2XL6A 3C62A 3U8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6H A;  4CX9 A;  1E84 A;  1MQV A;  3L1M A;  2XM0 A;  3HNK A;  4JEB A;  2XL8 A;  4D4N A;  3ZQY A;  1E83 A;  3DE8 A;  2YL1 A;  3QVZ A;  4NC3 A;  2XLW A;  256B A;  4CDY A;  4CJG A;  4IB4 A;  4IAR A;  2QLA A;  2YLI A;  2XLE A;  4CJO A;  4D4X A;  4EIY A;  2XM4 A;  2CCY A;  2YKZ A;  1A7V A;  4N4W A;  2BC5 A;  5JP7 A;  3ZTM A;  5JUA A;  4ULV A;  4CIP A;  3VRC A;  4WGY A;  2YL3 A;  3C63 A;  3DE9 A;  1GQA A;  5JS5 A;  2XLV A;  3FOP A;  1APC A;  3QVY A;  1E86 A;  2J9B A;  3ZWI A;  3NMK A;  1M6T A;  1CPQ A;  1YYJ A;  2YLG A;  4U9D A;  5JRA A;  3NMJ A;  1YYX A;  3IQ5 A;  3TOM A;  3HNL A;  4U9E A;  5B3I A;  3HNI A;  5JVE A;  5AGF A;  4JKV A;  1LM3 B;  2J8W A;  3QW1 A;  1EKY A;  4JEA A;  1RCP A;  2XLH A;  4L6R A;  1NBB A;  3M79 A;  2YL7 A;  3M15 A;  5JT4 A;  2XLO A;  4CDV A;  2XLM A;  3M4B A;  1CPR A;  1CGN A;  1YZC A;  2YL0 A;  3FOO A;  2XLD A;  3M4C A;  1JAF A;  4JE9 A;  5JLI A;  4IAQ A;  1BBH A;  1E85 A;  4ER9 A;  2YLD A;  4CDA A;  3HNJ A;  4WGZ A;  3NMI A;  3ZTZ A;  1YZA A;  3QW0 A;  1QPU A;  5JSL A;  3ZQV A;  3TOL A;  3IQ6 A;  1QQ3 A;  1S05 A;  1CGO A;  2XL6 A;  3C62 A;  3U8P A; 
#chains in the Genus database with same CATH topology
 3DM9 B;  4CS8 C;  1L3P A;  3GM2 A;  3EZH A;  2X0C A;  4FAP B;  2WVN A;  1PV3 A;  5DS6 A;  4LDR A;  3FHD A;  1Z63 A;  4ZLC A;  1MMN A;  2JD3 A;  4EBB A;  1M2O A;  2QUP A;  4KNV A;  4LER A;  1LPE A;  3LEO A;  3O39 A;  4D4N A;  4OIR F;  5L3V A;  1KNY A;  3EPV A;  2ZXR A;  2ZXW C;  4PJJ A;  2J9W A;  3SZR A;  2HJ3 A;  2WZF A;  3UMI A;  4E0H A;  1A0B A;  3DE8 A;  3QVZ A;  3LAY A;  256B A;  4MVR A;  4PK4 A;  3B0P A;  3V7O A;  4YJW A;  1UG7 A;  5L0C A;  1MMD A;  3LLK A;  3UNG C;  4OIP F;  4BJ6 A;  2LD6 A;  3ABM C;  2XM4 A;  1T01 A;  2Y3H A;  3GM1 A;  4EHP A;  4E7S A;  1ZZP A;  4GEH A;  2KNH A;  1DOW A;  4I1M A;  2BC5 A;  4U5E E;  3QMK A;  1I4Y A;  3VF0 A;  4DVZ A;  5COM A;  2IXO A;  2TMV P;  2YZS A;  1VTM P;  2YL3 A;  3C63 A;  2EPM X;  4G0H A;  4X0R A;  1NZE A;  3ZG1 A;  2GAQ A;  1GQA A;  2KYH A;  4FX5 A;  5JS5 A;  3BRJ A;  3J06 A;  2JPU A;  2HUJ A;  3KH2 A;  3I4U A;  3IQC A;  4MVS A;  1MMG A;  2G3V A;  4EBJ A;  1APC A;  4MVU A;  1M56 C;  4E17 A;  3S9O A;  3G4Z A;  2R03 A;  1BR2 A;  1WOL A;  3NMK A;  5F28 E;  1E2X A;  2OG2 A;  1TFK B;  2QY9 A;  1PD0 A;  2P1A A;  2A1D D;  5DVW A;  4Z9H A;  1QLE C;  2YLG A;  4HE8 D;  3S28 A;  5DS4 A;  3B0U X;  3EHN A;  4YL0 A;  3S90 A;  1VK5 A;  2FAP B;  2HKV A;  4JC7 A;  1L7C A;  1M2V A;  4JJF A;  5CI9 A;  5EHH A;  5JRA A;  1LE2 A;  1TWG A;  2R7Q A;  3DZA A;  4Z9I A;  5TJ5 E;  2YQY A;  4F4B A;  3IEE A;  2I15 A;  1D0Y A;  2LIG A;  3SNH A;  2EIM C;  5JVE A;  5L0D A;  3RVY A;  1EA8 A;  4PJM A;  3A11 A;  1HW2 A;  2FGY A;  3W8I A;  4BJ5 A;  3EG9 A;  2KC3 A;  2R7S A;  3LNR A;  3MX3 A;  4OIN F;  4I1O B;  3ZSU A;  2A0B A;  2R7V A;  2O9X A;  2CW0 F;  3CZ6 A;  4JZA A;  1NBB A;  2GFH A;  1VMA A;  2J7P D;  4CBE A;  5T1D B;  4PAC A;  3M15 A;  2OJQ A;  1ORY A;  1H9G A;  4XQ1 A;  1R5I D;  4ONS A;  1K04 A;  4NY3 A;  2AWY A;  1HW1 A;  2A0U A;  2PBE A;  3AG3 C;  1D0Z A;  4H54 A;  4A4A A;  3EH1 A;  2J0W A;  3M4B A;  3GOR A;  2XXA B;  5HV9 A;  1WAS A;  4LDK A;  1CPR A;  3VYW A;  1JRA A;  1CGM E;  1ZW3 A;  1CGN A;  2VAS A;  1PCX A;  2OJE D;  2P61 A;  2MWQ A;  2YL0 A;  4MTG A;  3M4C A;  2IOQ A;  1JAF A;  3MYF A;  5BQI A;  2NPU A;  1OQC A;  1BBH A;  3LUT B;  2A6E F;  3EJN A;  1G5Z A;  5BUO A;  4CDA A;  4LLE A;  2IXN A;  3NDB B;  1Y6D A;  2G3K A;  1Q0F A;  4E0I A;  4NCQ A;  4HEA J;  2MHR A;  4CS9 A;  4P6I C;  2LFD A;  1OKK A;  4MW3 A;  3NMI A;  4O79 A;  4PJN A;  1RMV A;  2ICW G;  1NFO A;  1OXK A;  1Q0M A;  3EHM A;  1YA9 A;  2PX0 A;  3EZI A;  3Q6N A;  4WJ0 A;  1S7Z A;  2JX0 A;  2ZXP A;  3QW0 A;  1QPU A;  2WVO A;  1VB5 A;  4NTB A;  1LS4 A;  2KJG A;  5A6B A;  3EGX B;  2IBF A;  3FVY A;  1WN0 A;  4A2N B;  1S05 A;  4ZLD A;  1A7E A;  2IYL D;  2R7W A;  3H2V A;  3NRH A;  3U8P A;  1OKK D;  3AGT A;  3DKA A;  3HKK A;  4CX9 A;  2XXA A;  4WAB A;  5L0F A;  1Q0G A;  2HSB A;  4OD4 A;  3SXZ A;  1FTS A;  4DBQ A;  1Z23 A;  4JRZ A;  1YAU O;  3GWN A;  2EPN A;  1JR8 A;  3NKD A;  3RIP A;  4FES A;  3K1I C;  4OIQ F;  4C3B A;  3K66 A;  3ITF A;  5KYY A;  2VB6 A;  1J8M F;  2L9J A;  3UGO A;  4JCZ A;  2DYR C;  2Q3T A;  2Q4F A;  2Y3G A;  3JCU Q;  3KPH A;  2OCC C;  1PD1 A;  1HE9 A;  4XLN F;  5T3W A;  4EIY A;  3ABK C;  3OWT A;  4NTA A;  1A7V A;  4DJ9 A;  2CNW A;  5E33 A;  3IHU A;  3KKB A;  5JUA A;  1LKX A;  2KW3 C;  3DM5 A;  5E3A A;  4CIP A;  3GM3 A;  4QDL A;  4DRH B;  4G78 A;  4XPW A;  2B0J A;  1SMY F;  1O3U A;  2H8A A;  3U9J A;  3DE9 A;  4PFP A;  5KYX B;  1KTM A;  2KK1 A;  1HE1 A;  4MS2 A;  3AOU A;  2R02 A;  2Q00 A;  2AP3 A;  4AL0 A;  1EQ1 A;  4IWB A;  3QVY A;  4BJ1 A;  4C7O B;  2YHS A;  4RDA A;  5FCL A;  2H7V C;  1CPQ A;  1M6T A;  2KQ9 A;  2OEX A;  2Q9C A;  4O6N A;  1MND A;  3VAY A;  1U0B B;  2DB4 A;  4RBN A;  2GA0 A;  2HSQ A;  1F1M A;  1T6I A;  1WWP A;  2OKU A;  3UMH A;  2AVK A;  3NYJ A;  5D91 A;  1LE4 A;  3V5X A;  1LI7 A;  4U9D A;  5KYX A;  4LLC A;  3TJ5 A;  1ST6 A;  1ZYR F;  1I4Z A;  3TK0 A;  2NSG A;  1LIH A;  3SEO A;  2R25 A;  2L6G A;  2Q9A A;  2R9R B;  4GQH A;  4CS7 A;  2Y69 C;  3Q7L A;  4UDV A;  2CGE A;  3QTH A;  3AQC A;  1BR4 A;  1H6G A;  1TFO B;  1FFT C;  4DOZ A;  5COG A;  3OEO A;  1VLS A;  4IJJ A;  4JTA B;  2BE5 F;  4BEM J;  3BEH A;  4I3M A;  3ABL C;  3LS1 A;  4MTO A;  3SXK A;  3C8G A;  1FAP B;  2YEV A;  4U5D E;  4JEA A;  1T6U A;  2AU5 A;  2PFD A;  3FAP B;  4J30 B;  4J32 B;  4XTK A;  1W2W A;  3I5P A;  2Q9B A;  4L6R A;  4CS9 C;  1Q0D A;  1M2V B;  3M79 A;  2YL7 A;  4J7Y A;  5JT4 A;  1SF8 A;  2XLO A;  3H65 A;  3PHF 2;  3E9V A;  4MVZ A;  2GDC A;  4G7H F;  4C7O A;  1FFH A;  3R7C A;  3I5Q A;  3CSK A;  1VOM A;  3RYL A;  3K7D A;  3U2M A;  2LP4 A;  2P0N A;  1BR1 A;  2DYS C;  2L7A A;  2HV7 A;  5HSW A;  3TQO A;  4DXW A;  1SZI A;  3GOD A;  5A6J A;  1OCR C;  2XLD A;  2EPO A;  4JTD B;  2A68 F;  3K1I A;  3SXM A;  1NFN A;  2VCC A;  1K05 A;  1HY5 A;  1T5O A;  3X2Q C;  1OCC C;  1RXQ A;  2A69 F;  3AQB A;  1QKR A;  2ASR A;  1SR2 A;  2AWC A;  2R05 A;  3HNJ A;  3SP1 A;  3A9C A;  3KL4 A;  3CEX A;  4OD5 A;  1OCO C;  1G4U S;  4BJ5 C;  2M4E A;  3MYI A;  4N06 A;  5KYY B;  5JSL A;  1B68 A;  1TWA A;  3ZQV A;  4Q5S F;  1T9K A;  4GYT A;  2PX3 A;  2EIL C;  2Q7R A;  4MVO A;  3FXH A;  4MND A;  3JYY A;  2QTV A;  3S29 A;  4O7G A;  2VCA A;  1E84 A;  1YDI A;  2L81 A;  1MQV A;  3DAF A;  3C8G B;  4MQ9 F;  2YWA A;  3U3B A;  3L1M A;  4O6Y A;  3V5Y A;  3EG9 B;  2XM0 A;  3UR3 C;  1SYQ A;  4YT8 A;  3NKE A;  1XZQ A;  3EFO A;  3HJC A;  3MFN A;  4PFO A;  2I8B A;  1ZHT A;  2ZPA A;  5KYN A;  3S0X A;  4JUR I;  3G4X A;  3ASO C;  1WGW A;  3U3F A;  1NLX A;  1C02 A;  2Y39 A;  1NU9 C;  3US6 A;  4YWQ A;  3CQZ A;  4YT4 A;  1V55 C;  3GWL A;  3GAN A;  4CJG A;  1OXB A;  2EIK C;  5BQH A;  1Y4C A;  3DI5 A;  1AEP A;  4IB4 A;  2ZXO A;  4IAR A;  1IZM A;  2R7U A;  2J46 A;  1Z7Q c;  2HFI A;  1VYI A;  4I44 A;  4CJO A;  4D4X A;  3UGP A;  2R7R A;  1YA7 O;  4K1O A;  2RD9 A;  2LFF A;  3KYI A;  2Z15 A;  2YKZ A;  1Z5Z A;  3MBG A;  4IGG A;  3RW0 A;  3ZTM A;  1C03 A;  2HZ8 A;  3VRC A;  3DAG A;  3W2V A;  3F46 A;  4WGY A;  4AX2 A;  4YT2 A;  2EIJ C;  2D5R B;  3T6B A;  2Y3D A;  3L8J A;  3TUL A;  2KGO A;  2CDQ A;  2P7V A;  3ZC4 A;  1N1C A;  1Z6A A;  3DD7 A;  3ECS A;  3EGX A;  4RD9 A;  4EWC A;  2XLV A;  4BJ6 C;  4CIH A;  2RSE B;  4E18 A;  1A41 A;  4M63 A;  3NYM A;  3U2L A;  5L0I A;  2J9B A;  2XL4 A;  4JTC B;  3ZWI A;  5KYU B;  1E86 A;  2R7T A;  3LNM B;  5DLJ A;  1YYJ A;  1J8Y F;  2LSE A;  4BG0 A;  3RQG A;  3DJN B;  2Y3B A;  5A6K A;  1BDJ B;  5E3C A;  2MYS A;  3Q6M A;  1U6H A;  3O10 A;  1EI7 A;  3B9Q A;  4ULW A;  1R4T A;  5F5H A;  3W8H A;  3POV A;  4P9T A;  1H9T A;  1XWJ A;  3B0V C;  3RQF A;  4CS8 A;  5E2Q A;  1YJG A;  3C8G D;  2J7P A;  3RKO F;  1QZX A;  3JT1 A;  1TWH A;  3ZIB A;  5IY5 C;  3HTK C;  3B29 A;  4AE4 B;  5K0I A;  3HNL A;  5B3I A;  3HNI A;  2W9Y A;  4HFK B;  4B6I A;  2HS5 A;  1V74 B;  3L34 A;  1ZHY A;  4XPX A;  3K1H A;  4N6C A;  4E7Z A;  5AGF A;  3LLI A;  1OW8 A;  4JKV A;  1LM3 B;  1O5H A;  2J8W A;  1JPJ A;  3QW1 A;  5FZT A;  5AC4 A;  3E70 C;  1I5N A;  1RCP A;  2CYD A;  2WZG A;  4U5F E;  3UMK A;  4XWJ A;  1ORJ A;  3ZDL A;  4AE4 A;  3FDQ A;  3TD7 A;  2J45 A;  3O6X A;  2EPK X;  3F47 A;  3K6B A;  4DBR A;  2M64 A;  1U89 A;  2V3C C;  4O6M A;  2YRF A;  1H7I A;  1ZHW A;  1RKE A;  2IXM A;  3M1C B;  4R32 A;  3ZVR A;  4KBL A;  3DXJ F;  3T6G B;  3WHN A;  3MLG A;  3Q7G A;  2LQG A;  4BPM A;  4EUK B;  1D0X A;  1WTY A;  4Q4Z F;  3K33 A;  3SYN A;  1XZP A;  2DGJ A;  3C7J A;  1ZW2 A;  2NUP A;  2R7O A;  3WG7 C;  1ZU5 A;  5AC5 A;  1JMW A;  5B3S C;  4XLP F;  5JLI A;  1LI5 A;  5A6B D;  3NYL A;  3U0C A;  1D1C A;  4XEV A;  2EIN C;  1O87 A;  1M57 C;  1C17 M;  2VH3 A;  2YLD A;  2ZD9 A;  3LES A;  1KU2 A;  2KSF A;  2PF4 E;  4H4K C;  3JSZ A;  4CSA C;  3OA1 A;  4WGZ A;  5CIV A;  1ORS C;  2H7B A;  2QE9 A;  3SXY A;  3JSE O;  3LEV A;  4QI0 A;  3AG2 C;  3B71 A;  1YZA A;  2FFH A;  3AGU A;  3JTL O;  4XEK A;  5DS5 A;  4FWV A;  2B0H A;  2NG1 A;  1OR3 A;  4C3E A;  1D1B A;  4Q7C A;  3AG4 C;  3TOL A;  2W4B A;  3IQ6 A;  3DWW A;  3T4R A;  3U8V A;  2UUI A;  1IW7 F;  1TR2 A;  2XL6 A;  5COF A;  4LAC B;  1GM5 A;  1NSG B;  2J9V A;  1ZU4 A;  2EPL X;  3GEI A;  2OEV A;  5A69 A;  1T6Q A;  4P9F A;  4N6H A;  5B1B C;  3L0I A;  5EK0 A;  3CAX A;  1RKC A;  1Z3I X;  2PNO A;  4YK5 A;  3N2Z B;  2LK4 A;  3HNK A;  1GS9 A;  4XEF A;  4JEB A;  2BL2 A;  2CNW D;  2XL8 A;  3ZQY A;  1E83 A;  1BZ4 A;  2L6F A;  3AJM A;  3LS0 A;  2YL1 A;  3IPM O;  4NC3 A;  3WOD F;  1DOV A;  2P6V A;  2XLW A;  2PP4 A;  3RFY A;  3TJ6 A;  4CDY A;  4ANJ A;  1FNT c;  2VCB A;  2X51 A;  3U5S A;  5T3T A;  3LJB A;  3T9O A;  4MW8 A;  2QLA A;  1QVX A;  2YLI A;  2XLE A;  4YL1 A;  3GEH A;  1OW7 A;  4YL3 A;  1V4A A;  4KI2 A;  2CCY A;  4JW1 A;  2C03 A;  2G62 A;  2HMQ A;  4N4W A;  5JP7 A;  4ULV A;  1TWC A;  1GGQ A;  4G7O F;  3JYH A;  1LS1 A;  2IXP A;  5L0J A;  1YLM A;  5KYW A;  4G7Z F;  1TQG A;  1OCZ C;  2HMZ A;  3FOP A;  4W8P A;  1Q0K A;  4EBK A;  3ATP A;  2HJM A;  4HFF B;  3S27 A;  2NSF A;  1ZHZ A;  2V26 A;  2F22 A;  2ETS A;  5D92 A;  4MVQ A;  1MMA A;  5KYU A;  3PDM P;  1RKE B;  4QI2 A;  4NQF A;  1VYK A;  1OW6 A;  4JIO A;  2R7X A;  4KNW A;  5KYW B;  5L0H A;  1RJ9 B;  3QZC A;  4LDQ A;  3VM6 A;  1VLT A;  1ZHX A;  5L0G A;  1FR0 A;  2YVK A;  5BQG A;  1G8X A;  2VC9 A;  3FMS A;  2W4M A;  3C18 A;  2WB7 A;  3EGD B;  4MVM A;  3NMJ A;  4JVS A;  1YYX A;  3AG1 C;  3RF3 A;  2J0X A;  3IQ5 A;  3ASN C;  3TOM A;  3IQT A;  1YAR O;  4PR9 A;  2OQM A;  2J9U A;  4OIO F;  2OU6 A;  4U9E A;  1FMV A;  3H2U A;  5GPG B;  4DRI B;  3W4Y A;  2H7O A;  3DJU B;  4K7B A;  1NG1 A;  4NTF A;  2W45 A;  3JRM O;  2NUP B;  3R2P A;  3FAJ A;  3RH3 A;  5DQZ A;  1EKY A;  1HMD A;  3V5Z A;  2WL8 A;  3G50 A;  3KMI A;  4U5H A;  4K0D A;  3W2W A;  4J7T A;  2NUT B;  2XLH A;  2C04 A;  4CSA A;  3DMD A;  2HV6 A;  1UFB A;  4EKW A;  1WAT A;  3EFO B;  3RVZ A;  1G4W R;  1HMO A;  2A6H F;  5CI8 A;  4CDV A;  4U5G A;  2OOC A;  2XLM A;  2XRH A;  2L6H A;  2WZL A;  1FMW A;  1K40 A;  1AVO B;  3T6J A;  3JZ0 A;  1YZC A;  4YT5 A;  3EH2 A;  3U9M A;  2UUH A;  3WAQ A;  4AL1 A;  2E87 A;  2XS1 A;  1TKN A;  3EGD A;  3FOO A;  3PCV A;  2QNL A;  4JE9 A;  4YN0 B;  2DI3 A;  3GEE A;  4IAQ A;  4U5C E;  4BEJ A;  3O55 A;  1E85 A;  4Z9J A;  4ER9 A;  3KYJ A;  4C3D A;  2D4U A;  1RJ9 A;  3C8Z A;  4IRU A;  1D1A A;  4BJT A;  4KC9 A;  4IAO A;  2GWW A;  3NG1 A;  2LCH A;  3N0T A;  1JPN A;  4JCH A;  1AUE A;  1NU7 D;  5F5F A;  3ZTZ A;  4U5B E;  4JJG A;  4PJL A;  1A7D A;  4W8K A;  4AK9 A;  4XPY A;  1MNE A;  5L3Q A;  4DVY P;  3EQL F;  2XSE A;  2IM8 A;  5B1A C;  3N24 A;  1ZVZ A;  3JRT A;  1OR2 A;  3PMR A;  4MTF A;  1LVK A;  3X1O A;  1QQ3 A;  1JOG A;  2XS8 A;  3L8I A;  1CGO A;  1YVI A;  5EGY A;  5DQT A;  3C62 A;  1V54 C;  3S84 A;  3RQE A;  5A6A A;  1QSP A;  4DRJ B;  2NUT A;  3HLZ A;  2WVQ A; 
#chains in the Genus database with same CATH homology
 4N6H A;  4CX9 A;  1E84 A;  1MQV A;  3L1M A;  2XM0 A;  3HNK A;  4JEB A;  2XL8 A;  4D4N A;  3ZQY A;  1E83 A;  3DE8 A;  2YL1 A;  3QVZ A;  4NC3 A;  2XLW A;  256B A;  4CDY A;  4CJG A;  4IB4 A;  4IAR A;  2QLA A;  2YLI A;  2XLE A;  4CJO A;  4D4X A;  4EIY A;  2XM4 A;  2CCY A;  2YKZ A;  1A7V A;  4N4W A;  2BC5 A;  5JP7 A;  3ZTM A;  5JUA A;  4ULV A;  4CIP A;  3VRC A;  4WGY A;  2YL3 A;  3C63 A;  3DE9 A;  1GQA A;  5JS5 A;  2XLV A;  3FOP A;  1APC A;  3QVY A;  1E86 A;  2J9B A;  3ZWI A;  3NMK A;  1M6T A;  1CPQ A;  1YYJ A;  2YLG A;  4U9D A;  5JRA A;  3NMJ A;  1YYX A;  3IQ5 A;  3TOM A;  3HNL A;  4U9E A;  5B3I A;  3HNI A;  5JVE A;  5AGF A;  4JKV A;  1LM3 B;  2J8W A;  3QW1 A;  1EKY A;  4JEA A;  1RCP A;  2XLH A;  4L6R A;  1NBB A;  3M79 A;  2YL7 A;  3M15 A;  5JT4 A;  2XLO A;  4CDV A;  2XLM A;  3M4B A;  1CPR A;  1CGN A;  1YZC A;  2YL0 A;  3FOO A;  2XLD A;  3M4C A;  1JAF A;  4JE9 A;  5JLI A;  4IAQ A;  1BBH A;  1E85 A;  4ER9 A;  2YLD A;  4CDA A;  3HNJ A;  4WGZ A;  3NMI A;  3ZTZ A;  1YZA A;  3QW0 A;  1QPU A;  5JSL A;  3ZQV A;  3TOL A;  3IQ6 A;  1QQ3 A;  1S05 A;  1CGO A;  2XL6 A;  3C62 A;  3U8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...