3M15A

A zn-mediated asymmetric trimer of a cytochrome cb562 variant (d74a-ridc1)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
publication title Structural characterization of a microperoxidase inside a metal-directed protein cage.
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3m15A00
3M4BA 2J8WA 1LM3B 5AGFA 3TOLA 1E84A 1CPQA 1NBBA 3FOPA 2YL0A 3M79A 5B3IA 2YL7A 2BC5A 3DE9A 3VRCA 5JT4A 4ULVA 2XL6A 2YKZA 2YLDA 4WGYA 3ZTZA 3QW0A 1JAFA 2J9BA 5JS5A 4IB4A 1CGOA 4U9DA 5JP7A 3NMIA 5JSLA 4JEBA 2XLMA 4U9EA 2XLVA 2YLIA 256BA 3IQ5A 1E85A 3C62A 1EKYA 2XL8A 3M4CA 3QW1A 1MQVA 1QQ3A 3FOOA 3IQ6A 4JE9A 4CIPA 3ZTMA 4NC3A 5JUAA 1YZAA 1E86A 3NMKA 3HNKA 2XLHA 4CJGA 1YYJA 1QPUA 1YYXA 2YL1A 1BBHA 3U8PA 3HNJA 1S05A 2XLWA 1RCPA 1CGNA 4CDVA 1YZCA 3HNIA 3QVZA 4WGZA 3L1MA 1APCA 2XLDA 4EIYA 2CCYA 3QVYA 4CDAA 1GQAA 2XLOA 2XLEA 1CPRA 4JKVA 3ZWIA 3ZQYA 4CJOA 4CDYA 4JEAA 3M15A 2XM0A 2XM4A 5JRAA 1E83A 1A7VA 2YLGA 4N4WA 3ZQVA 3HNLA 4IARA 4CX9A 4D4XA 4IAQA 4D4NA 3DE8A 4L6RA 2YL3A 3NMJA 3C63A 3TOMA 4N6HA 1M6TA 2QLAA 5JVEA 5JLIA 4ER9A
chains in the Genus database with same CATH superfamily
1QSPA 3EGXA 5A69A 4MW8A 3SXZA 1KU2A 4EHPA 2J9UA 4G7HF 3K7DA 1WN0A 2Y3DA 3AG2C 3M4BA 4G7ZF 2YHSA 3R7CA 4CBEA 1LM3B 3CZ6A 1JRAA 4BG0A 1K05A 3O10A 1NFNA 1YA7O 2YRFA 4C3EA 4A4AA 2J7PA 3S90A 1EQ1A 4EBJA 2B0HA 4XQ1A 5KYXB 1ZZPA 2R7VA 2YL0A 2VB6A 4HFFB 5DS4A 2J45A 4MVUA 2R25A 3GWNA 1OQCA 2YL7A 3V5XA 5COGA 4WJ0A 1M57C 2G3VA 4AE4B 5KYUA 3S29A 1QZXA 3UMHA 3W8IA 4JCZA 3GEHA 5KYWA 3OEOA 5EK0A 2W45A 3G4ZA 3T6BA 3LS1A 1ZU5A 2KC3A 2ASRA 4YN0B 1Z6AA 3EQLF 4OD4A 1IW7F 2J9BA 2WZLA 4X0RA 1PD0A 4O7GA 3MLGA 3ASOC 3KMIA 1O5HA 5JP7A 4XTKA 5COFA 3V7OA 4AK9A 3Q6NA 3UR3C 2Q4FA 3TD7A 4JEBA 4YT2A 4U9EA 3JZ0A 4LACB 1T6QA 1LKXA 2Q9CA 2XLVA 4U5FE 1GGQA 1U89A 1RXQA 2L81A 1E85A 1MMNA 3EZIA 5TJ5E 4ANJA 4YT8A 3DI5A 2AU5A 3FOOA 4JE9A 3IQ6A 1K04A 2IOQA 5JUAA 4NC3A 3B0UX 1E86A 4Q4ZF 4CJGA 3EHNA 2OJQA 1ORSC 2HSQA 1YYXA 2VC9A 3ZC4A 4IAOA 2YL1A 1V74B 2PX0A 2OU6A 3LNMB 1T5OA 4E17A 1FFHA 2AVKA 4AL0A 5DS5A 4CS7A 2Y39A 2HS5A 4C7OB 4CSAC 1OCOC 2XLWA 1RCPA 3O39A 3U2LA 2AWCA 3LUTB 3CSKA 2XLDA 5K0IA 4EIYA 3ZDLA 4PFPA 3TULA 2R7SA 5DQZA 2A0BA 3SNHA 3N0TA 5T3TA 2R7TA 1H6GA 2NSGA 3TJ5A 2TMVP 2HJ3A 2P61A 1GQAA 5BQIA 1NZEA 3RQFA 1Q0KA 2DGJA 5E3CA 4JW1A 2YQYA 2WL8A 2LIGA 2ZXWC 5KYNA 4C3BA 3VM6A 3EGDA 4Z9IA 2KJGA 2XM0A 5E3AA 4O6YA 2YZSA 2J0XA 2MWQA 2GWWA 2NUPA 2Q9AA 2YLGA 4LDRA 4YL1A 3HNLA 2F22A 4D4XA 5L0IA 2WB7A 4IRUA 1QLEC 4MS2A 4DRJB 4O6NA 3ZVRA 4I44A 3C8ZA 2GAQA 1FMVA 2QE9A 4FX5A 3RVZA 2XXAB 3EG9A 2LFDA 2P7VA 3AOUA 3GEEA 3DE8A 4JRZA 2JX0A 4EBKA 2W4BA 1UG7A 1VK5A 1ZHXA 3NMJA 4JIOA 1OW6A 2CNWD 4EKWA 3GM1A 2H7OA 4FWVA 2PBEA 1Z23A 3MX3A 3DMDA 1M6TA 4RD9A 3RVYA 3SP1A 2IXMA 2KQ9A 1WATA 2RD9A 3RW0A 1D1BA 4XPYA 4OIOF 4MW3A 4BJ1A 4Q5SF 2EIMC 2OOCA 5L3QA 3POVA 3NYMA 1AUEA 3X1OA 4U5BE 3DD7A 1XWJA 2QNLA 3NKDA 2EPLX 2ICWG 2J8WA 4ZLDA 3FAJA 4PR9A 2L6GA 2V26A 5AGFA 3FVYA 1WGWA 1CPQA 1RKEA 3GM2A 4O6MA 1NBBA 3A11A 4E0IA 1GM5A 3K1HA 4PJLA 5KYYB 3U3FA 2HSBA 1MMGA 1A7DA 2P1AA 2L6HA 1ST6A 3O55A 5JT4A 1NG1A 4CSAA 4QI2A 5B3SC 4PK4A 2Y3BA 2PNOA 2YLDA 3EHMA 3QZCA 1OKKD 2C04A 2I15A 2R7OA 2DYRC 4WGYA 5DQTA 1Z63A 5DVWA 3RQGA 1VLSA 3RQEA 1JAFA 1D1CA 2FGYA 2NUTB 1ZHZA 2VCAA 3RFYA 3L8IA 5JS5A 3I5QA 3WAQA 4PJMA 2ZXRA 3S84A 4E18A 2EPNA 2EIKC 3ABLC 3JYHA 3NMIA 4YK5A 3A9CA 1VB5A 2ZD9A 4G0HA 3NKEA 4C3DA 4CS8C 3ZIBA 1I4YA 3TJ6A 3EFOB 3C62A 2I8BA 1NSGB 1YVIA 1W2WA 3B29A 4OIQF 3F47A 2XL8A 3QW1A 3O6XA 3S27A 2B0JA 4PFOA 1KTMA 1MQVA 4J7YA 5A6KA 2WZGA 1YA9A 4DBQA 3ZTMA 1ZW3A 1T6UA 2KYHA 1O87A 2AWYA 2Y3HA 2J9WA 2XS8A 3N24A 4OD5A 2WVQA 4P9TA 1YJGA 1I4ZA 4AX2A 1H9TA 1QPUA 1S7ZA 3HTKC 1U0BB 1RJ9A 2EPOA 1TR2A 3LLIA 5COMA 3CEXA 3C7JA 4U5DE 4XWJA 4JTAB 4GEHA 1HE9A 3W4YA 4A2NB 4DOZA 4CS9A 3FXHA 1XZPA 4MTGA 1CGNA 4LERA 4DJ9A 4CDVA 3BEHA 5A6BA 3QVZA 2AP3A 1PCXA 3HNIA 4E7ZA 2VASA 3M1CB 5D91A 1OCZC 2CCYA 1ORJA 1QKRA 4I3MA 4O79A 1JPJA 4UDVA 1LI5A 1M2VB 1OKKA 3C8GA 3ATPA 2VCCA 4N6CA 1J8YF 4OIPF 3ECSA 2OEXA 3T6JA 4BEJA 1CPRA 4JKVA 1UFBA 3GODA 3LEOA 2R7WA 2H7BA 1TFOB 4KC9A 3T4RA 4IGGA 2YWAA 5BUOA 1OR3A 2BE5F 3DAGA 4U5EE 3HLZA 2RSEB 1AEPA 4NTAA 3B0VC 1MMAA 3ABMC 3C18A 3LLKA 3K66A 1J8MF 1T6IA 3U0CA 3HJCA 3FAPB 4J32B 1PV3A 3L0IA 1ZHYA 1OR2A 1WASA 1DOWA 4IAQA 4LLCA 2LD6A 3KL4A 2X0CA 3U5SA 2EILC 3FDQA 4BJ6A 1LVKA 2LQGA 2R9RB 1PD1A 2V3CC 3RKOF 2EINC 4NQFA 4BPMA 3TQOA 3C63A 3EH2A 2J0WA 5AC4A 4DRIB 3TOMA 2ZPAA 4YL3A 4ONSA 2HFIA 3I4UA 3ABKC 4XLNF 2HZ8A 3V5ZA 2YVKA 4BJTA 5JVEA 3F46A 2CYDA 2HMQA 3K6BA 1MNEA 1Z3IX 1A41A 2R7RA 4KNWA 1K40A 1ORYA 1D0YA 4J7TA 1TQGA 2R7UA 2CW0F 1H9GA 4EUKB 4YT5A 2KSFA 1NU7D 2M64A 3BRJA 3EGXB 3NG1A 5CI9A 3SEOA 5L0HA 5KYXA 1G5ZA 4JCHA 1ZYRF 3KKBA 4AE4A 1E84A 1ZHWA 4FAPB 3LAYA 4U5CE 5F28E 4DRHB 2HV7A 1Z7Qc 2QY9A 5L0GA 1ZW2A 3FOPA 1G4WR 3US6A 4N06A 3WG7C 1HY5A 3DE9A 4Q7CA 5EGYA 4BJ5C 4EWCA 3PHF2 2LSEA 4XEFA 4YWQA 5EHHA 3JSEO 2VCBA 3U9MA 2BL2A 3ZTZA 3DJUB 4OIRF 3GORA 3QW0A 1EA8A 5L0JA 2KNHA 3CQZA 4K1OA 2WVNA 5KYUB 1SYQA 1LPEA 5KYWB 2KK1A 4JJGA 5BQGA 4MQ9F 2IXPA 1T01A 1C17M 1HE1A 3W8HA 2IM8A 1TKNA 1LE4A 2DI3A 1D1AA 1SR2A 1G4US 1LI7A 1SZIA 3L8JA 5CI8A 2XLMA 3TK0A 2DYSC 1YLMA 2YLIA 3ZG1A 4G7OF 1LS4A 3MYFA 3JYYA 3LNRA 1M2OA 2IBFA 3E9VA 3NRHA 3LJBA 4IWBA 2A0UA 3EZHA 4J30B 2G3KA 1IZMA 1HMDA 1WOLA 3M4CA 1AVOB 4LDQA 4PJJA 4B6IA 4CIPA 2DB4A 5T3WA 3SXMA 3QTHA 1FNTc 1VMAA 4P6IC 2Q00A 3AJMA 1N1CA 1YZAA 3DXJF 3NMKA 1JOGA 2XLHA 4H4KC 4C7OA 3L34A 3FMSA 1L7CA 1H7IA 4JC7A 4MVOA 3S9OA 4KBLA 3HNJA 2XSEA 3I5PA 3NYJA 4NY3A 2M4EA 3H65A 3W2VA 2P6VA 3JTLO 2O9XA 5L0FA 2PP4A 4JURI 3UGOA 2J9VA 3OWTA 1YZCA 2HJMA 2CNWA 2NG1A 3IPMO 3Q6MA 2EPKX 3IQCA 4PACA 3RYLA 2LP4A 2OKUA 1G8XA 4Z9HA 3QVYA 3UMIA 5HSWA 1OCRC 2NPUA 3DZAA 4JZAA 5A6JA 5L0DA 1TWHA 1QVXA 5B1AC 2D4UA 1DOVA 1TWAA 3U2MA 3VYWA 4JTCB 2XLEA 4Z9JA 5F5HA 4BEMJ 2OG2A 2R02A 3DAFA 2LK4A 3ZWIA 3KYIA 3KH2A 2XRHA 3R2PA 3Q7GA 1B68A 4XEVA 3HKKA 3AG4C 4CDYA 4JEAA 2LFFA 3JT1A 1WTYA 2MHRA 2XM4A 1GS9A 3IQTA 1A7VA 1E83A 2CGEA 3Q7LA 4E7SA 1HW1A 4OINF 4IARA 4CX9A 4F4BA 3EGDB 2XXAA 2A6EF 4PJNA 2A68F 4NTFA 2Q9BA 2VH3A 2XL4A 4GQHA 2NUPB 3E70C 2YEVA 1NU9C 4EBBA 4DVYP 2XS1A 3SYNA 2OJED 4LLEA 3RIPA 4G78A 4BJ5A 1FR0A 1WWPA 2A69F 3AG3C 3DKAA 4NTBA 4M63A 4QI0A 3GEIA 3GM3A 4L6RA 2Y69C 3MFNA 3DJNB 2EPMX 1MNDA 2W4MA 2QUPA 3AGTA 2OEVA 3EG9B 4I1MA 4NCQA 4MVSA 1NFOA 3B71A 4MNDA 5JLIA 3VAYA 3EPVA 1U6HA 2OCCC 1BDJB 4AL1A 2R7QA 3RF3A 1MMDA 2PF4E 4DBRA 1LIHA 3S0XA 1L3PA 2R7XA 2NSFA 2QTVA 4IJJA 4XPXA 5GPGB 2LCHA 4P9FA 3J06A 5KYYA 2GFHA 2L9JA 3TOLA 1LS1A 1C02A 1BR4A 2PX3A 2HUJA 3KPHA 1RMVA 5A6AA 2P0NA 2R05A 1Q0FA 3M79A 3AG1C 5B3IA 1Q0DA 1JPNA 2MYSA 4JTDB 1BZ4A 2BC5A 2W9YA 5T1DB 5E33A 3IHUA 3RH3A 3VRCA 3AQBA 5HV9A 1EI7A 1RKEB 2J46A 3GWLA 3IEEA 2XL6A 1C03A 3JRMO 2G62A 2YKZA 3DWWA 2NUTA 5BQHA 3AQCA 1TWGA 1YAUO 3K1IC 1JR8A 4JJFA 2IXNA 4MVMA 3LESA 2KGOA 2L6FA 3PDMP 1Q0GA 4CS8A 2Y3GA 4YL0A 5F5FA 4IB4A 2Q3TA 1CGOA 2FAPB 4U5GA 4U9DA 3EFOA 1OXKA 3DM5A 4MVZA 2HMZA 4W8KA 5JSLA 1R4TA 1Z5ZA 2A6HF 1YARO 2KW3C 4MVRA 4RBNA 5IY5C 5AC5A 1TWCA 1RKCA 256BA 5DLJA 3IQ5A 2UUHA 3EJNA 1E2XA 1KNYA 4H54A 1EKYA 1FTSA 4XPWA 1VYIA 1XZQA 3OA1A 3U3BA 4CIHA 3AGUA 3JRTA 3V5YA 4KI2A 1OXBA 5FZTA 3X2QC 1QQ3A 1SF8A 3B0PA 3K33A 4YJWA 3SXKA 4QDLA 4K0DA 3LEVA 1V4AA 3N2ZB 2GDCA 4KNVA 3NDBB 1V54C 3HNKA 2Q7RA 1YYJA 3WHNA 1YDIA 2HV6A 3U9JA 3G4XA 3UMKA 1BBHA 4E0HA 4XLPF 1O3UA 3U8PA 1D0XA 3PMRA 2PFDA 2GA0A 1S05A 4I1OB 3MYIA 1FMWA 1M2VA 1RJ9B 1ZU4A 1OW7A 3H2UA 3LS0A 4U5HA 4WGZA 1VLTA 4RDAA 3L1MA 1APCA 2C03A 2JD3A 4LDKA 2WZFA 3SZRA 3ZSUA 4K7BA 5L0CA 3UGPA 5B1BC 1ZVZA 3ITFA 4MTOA 3W2WA 1BR2A 5D92A 4CS9C 1TFKB 1A0BA 4CDAA 2XLOA 4XEKA 2R03A 3H2VA 3JCUQ 4HEAJ 4WABA 4W8PA 3JSZA 4MVQA 1VYKA 3ASNC 3MBGA 4MTFA 3ZQYA 1Y4CA 2A1DD 3C8GB 1LE2A 1FAPB 4CJOA 3M15A 4ULVA 3EH1A 2J7PD 3G50A 5JRAA 4DXWA 1M56C 2X51A 3S28A 2H7VC 4YT4A 1BR1A 3QMKA 4N4WA 1HW2A 3ZQVA 1VTMP 3T9OA 1Y6DA 3UNGC 1VOMA 3CAXA 4ULWA 1NLXA 3B9QA 1ZHTA 2HKVA 1FFTC 1I5NA 1Q0MA 2EIJC 1T9KA 3PCVA 4D4NA 2JPUA 4ZLCA 2E87A 2D5RB 2ETSA 3VF0A 4DVZA 1JMWA 2L7AA 2YL3A 1OW8A 2FFHA 3GANA 2OQMA 5A6BD 2UUIA 3K1IA 5FCLA 2IXOA 1F1MA 2H8AA 1A7EA 5DS6A 3KYJA 4HE8D 1SMYF 3FHDA 4R32A 3U8VA 4BJ6C 1D0ZA 2CDQA 4HFKB 2QLAA 4N6HA 4JVSA 4GYTA 3WODF 3T6GB 5E2QA 1OCCC 4FESA 1HMOA 3C8GD 5CIVA 5L3VA 2ZXPA 1V55C 1CGME 2IYLD 3DM9B 1R5ID 3NYLA 3SXYA 4ER9A 2ZXOA 2WVOA 2Z15A
chains in the Genus database with same CATH topology
3M4BA 2J8WA 1LM3B 5AGFA 3TOLA 1E84A 1CPQA 1NBBA 3FOPA 2YL0A 3M79A 5B3IA 2YL7A 2BC5A 3DE9A 3VRCA 5JT4A 4ULVA 2XL6A 2YKZA 2YLDA 4WGYA 3ZTZA 3QW0A 1JAFA 2J9BA 5JS5A 4IB4A 1CGOA 4U9DA 5JP7A 3NMIA 5JSLA 4JEBA 2XLMA 4U9EA 2XLVA 2YLIA 256BA 3IQ5A 1E85A 3C62A 1EKYA 2XL8A 3M4CA 3QW1A 1MQVA 1QQ3A 3FOOA 3IQ6A 4JE9A 4CIPA 3ZTMA 4NC3A 5JUAA 1YZAA 1E86A 3NMKA 3HNKA 2XLHA 4CJGA 1YYJA 1QPUA 1YYXA 2YL1A 1BBHA 3U8PA 3HNJA 1S05A 2XLWA 1RCPA 1CGNA 4CDVA 1YZCA 3HNIA 3QVZA 4WGZA 3L1MA 1APCA 2XLDA 4EIYA 2CCYA 3QVYA 4CDAA 1GQAA 2XLOA 2XLEA 1CPRA 4JKVA 3ZWIA 3ZQYA 4CJOA 4CDYA 4JEAA 3M15A 2XM0A 2XM4A 5JRAA 1E83A 1A7VA 2YLGA 4N4WA 3ZQVA 3HNLA 4IARA 4CX9A 4D4XA 4IAQA 4D4NA 3DE8A 4L6RA 2YL3A 3NMJA 3C63A 3TOMA 4N6HA 1M6TA 2QLAA 5JVEA 5JLIA 4ER9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4B A;  2J8W A;  1LM3 B;  5AGF A;  3TOL A;  1E84 A;  1CPQ A;  1NBB A;  3FOP A;  2YL0 A;  3M79 A;  5B3I A;  2YL7 A;  2BC5 A;  3DE9 A;  3VRC A;  5JT4 A;  4ULV A;  2XL6 A;  2YKZ A;  2YLD A;  4WGY A;  3ZTZ A;  3QW0 A;  1JAF A;  2J9B A;  5JS5 A;  4IB4 A;  1CGO A;  4U9D A;  5JP7 A;  3NMI A;  5JSL A;  4JEB A;  2XLM A;  4U9E A;  2XLV A;  2YLI A;  256B A;  3IQ5 A;  1E85 A;  3C62 A;  1EKY A;  2XL8 A;  3M4C A;  3QW1 A;  1MQV A;  1QQ3 A;  3FOO A;  3IQ6 A;  4JE9 A;  4CIP A;  3ZTM A;  4NC3 A;  5JUA A;  1YZA A;  1E86 A;  3NMK A;  3HNK A;  2XLH A;  4CJG A;  1YYJ A;  1QPU A;  1YYX A;  2YL1 A;  1BBH A;  3U8P A;  3HNJ A;  1S05 A;  2XLW A;  1RCP A;  1CGN A;  4CDV A;  1YZC A;  3HNI A;  3QVZ A;  4WGZ A;  3L1M A;  1APC A;  2XLD A;  4EIY A;  2CCY A;  3QVY A;  4CDA A;  1GQA A;  2XLO A;  2XLE A;  1CPR A;  4JKV A;  3ZWI A;  3ZQY A;  4CJO A;  4CDY A;  4JEA A;  3M15 A;  2XM0 A;  2XM4 A;  5JRA A;  1E83 A;  1A7V A;  2YLG A;  4N4W A;  3ZQV A;  3HNL A;  4IAR A;  4CX9 A;  4D4X A;  4IAQ A;  4D4N A;  3DE8 A;  4L6R A;  2YL3 A;  3NMJ A;  3C63 A;  3TOM A;  4N6H A;  1M6T A;  2QLA A;  5JVE A;  5JLI A;  4ER9 A; 
#chains in the Genus database with same CATH topology
 1QSP A;  3EGX A;  5A69 A;  4MW8 A;  3SXZ A;  1KU2 A;  4EHP A;  2J9U A;  4G7H F;  3K7D A;  1WN0 A;  2Y3D A;  3AG2 C;  3M4B A;  4G7Z F;  2YHS A;  3R7C A;  4CBE A;  1LM3 B;  3CZ6 A;  1JRA A;  4BG0 A;  1K05 A;  3O10 A;  1NFN A;  1YA7 O;  2YRF A;  4C3E A;  4A4A A;  2J7P A;  3S90 A;  1EQ1 A;  4EBJ A;  2B0H A;  4XQ1 A;  5KYX B;  1ZZP A;  2R7V A;  2YL0 A;  2VB6 A;  4HFF B;  5DS4 A;  2J45 A;  4MVU A;  2R25 A;  3GWN A;  1OQC A;  2YL7 A;  3V5X A;  5COG A;  4WJ0 A;  1M57 C;  2G3V A;  4AE4 B;  5KYU A;  3S29 A;  1QZX A;  3UMH A;  3W8I A;  4JCZ A;  3GEH A;  5KYW A;  3OEO A;  5EK0 A;  2W45 A;  3G4Z A;  3T6B A;  3LS1 A;  1ZU5 A;  2KC3 A;  2ASR A;  4YN0 B;  1Z6A A;  3EQL F;  4OD4 A;  1IW7 F;  2J9B A;  2WZL A;  4X0R A;  1PD0 A;  4O7G A;  3MLG A;  3ASO C;  3KMI A;  1O5H A;  5JP7 A;  4XTK A;  5COF A;  3V7O A;  4AK9 A;  3Q6N A;  3UR3 C;  2Q4F A;  3TD7 A;  4JEB A;  4YT2 A;  4U9E A;  3JZ0 A;  4LAC B;  1T6Q A;  1LKX A;  2Q9C A;  2XLV A;  4U5F E;  1GGQ A;  1U89 A;  1RXQ A;  2L81 A;  1E85 A;  1MMN A;  3EZI A;  5TJ5 E;  4ANJ A;  4YT8 A;  3DI5 A;  2AU5 A;  3FOO A;  4JE9 A;  3IQ6 A;  1K04 A;  2IOQ A;  5JUA A;  4NC3 A;  3B0U X;  1E86 A;  4Q4Z F;  4CJG A;  3EHN A;  2OJQ A;  1ORS C;  2HSQ A;  1YYX A;  2VC9 A;  3ZC4 A;  4IAO A;  2YL1 A;  1V74 B;  2PX0 A;  2OU6 A;  3LNM B;  1T5O A;  4E17 A;  1FFH A;  2AVK A;  4AL0 A;  5DS5 A;  4CS7 A;  2Y39 A;  2HS5 A;  4C7O B;  4CSA C;  1OCO C;  2XLW A;  1RCP A;  3O39 A;  3U2L A;  2AWC A;  3LUT B;  3CSK A;  2XLD A;  5K0I A;  4EIY A;  3ZDL A;  4PFP A;  3TUL A;  2R7S A;  5DQZ A;  2A0B A;  3SNH A;  3N0T A;  5T3T A;  2R7T A;  1H6G A;  2NSG A;  3TJ5 A;  2TMV P;  2HJ3 A;  2P61 A;  1GQA A;  5BQI A;  1NZE A;  3RQF A;  1Q0K A;  2DGJ A;  5E3C A;  4JW1 A;  2YQY A;  2WL8 A;  2LIG A;  2ZXW C;  5KYN A;  4C3B A;  3VM6 A;  3EGD A;  4Z9I A;  2KJG A;  2XM0 A;  5E3A A;  4O6Y A;  2YZS A;  2J0X A;  2MWQ A;  2GWW A;  2NUP A;  2Q9A A;  2YLG A;  4LDR A;  4YL1 A;  3HNL A;  2F22 A;  4D4X A;  5L0I A;  2WB7 A;  4IRU A;  1QLE C;  4MS2 A;  4DRJ B;  4O6N A;  3ZVR A;  4I44 A;  3C8Z A;  2GAQ A;  1FMV A;  2QE9 A;  4FX5 A;  3RVZ A;  2XXA B;  3EG9 A;  2LFD A;  2P7V A;  3AOU A;  3GEE A;  3DE8 A;  4JRZ A;  2JX0 A;  4EBK A;  2W4B A;  1UG7 A;  1VK5 A;  1ZHX A;  3NMJ A;  4JIO A;  1OW6 A;  2CNW D;  4EKW A;  3GM1 A;  2H7O A;  4FWV A;  2PBE A;  1Z23 A;  3MX3 A;  3DMD A;  1M6T A;  4RD9 A;  3RVY A;  3SP1 A;  2IXM A;  2KQ9 A;  1WAT A;  2RD9 A;  3RW0 A;  1D1B A;  4XPY A;  4OIO F;  4MW3 A;  4BJ1 A;  4Q5S F;  2EIM C;  2OOC A;  5L3Q A;  3POV A;  3NYM A;  1AUE A;  3X1O A;  4U5B E;  3DD7 A;  1XWJ A;  2QNL A;  3NKD A;  2EPL X;  2ICW G;  2J8W A;  4ZLD A;  3FAJ A;  4PR9 A;  2L6G A;  2V26 A;  5AGF A;  3FVY A;  1WGW A;  1CPQ A;  1RKE A;  3GM2 A;  4O6M A;  1NBB A;  3A11 A;  4E0I A;  1GM5 A;  3K1H A;  4PJL A;  5KYY B;  3U3F A;  2HSB A;  1MMG A;  1A7D A;  2P1A A;  2L6H A;  1ST6 A;  3O55 A;  5JT4 A;  1NG1 A;  4CSA A;  4QI2 A;  5B3S C;  4PK4 A;  2Y3B A;  2PNO A;  2YLD A;  3EHM A;  3QZC A;  1OKK D;  2C04 A;  2I15 A;  2R7O A;  2DYR C;  4WGY A;  5DQT A;  1Z63 A;  5DVW A;  3RQG A;  1VLS A;  3RQE A;  1JAF A;  1D1C A;  2FGY A;  2NUT B;  1ZHZ A;  2VCA A;  3RFY A;  3L8I A;  5JS5 A;  3I5Q A;  3WAQ A;  4PJM A;  2ZXR A;  3S84 A;  4E18 A;  2EPN A;  2EIK C;  3ABL C;  3JYH A;  3NMI A;  4YK5 A;  3A9C A;  1VB5 A;  2ZD9 A;  4G0H A;  3NKE A;  4C3D A;  4CS8 C;  3ZIB A;  1I4Y A;  3TJ6 A;  3EFO B;  3C62 A;  2I8B A;  1NSG B;  1YVI A;  1W2W A;  3B29 A;  4OIQ F;  3F47 A;  2XL8 A;  3QW1 A;  3O6X A;  3S27 A;  2B0J A;  4PFO A;  1KTM A;  1MQV A;  4J7Y A;  5A6K A;  2WZG A;  1YA9 A;  4DBQ A;  3ZTM A;  1ZW3 A;  1T6U A;  2KYH A;  1O87 A;  2AWY A;  2Y3H A;  2J9W A;  2XS8 A;  3N24 A;  4OD5 A;  2WVQ A;  4P9T A;  1YJG A;  1I4Z A;  4AX2 A;  1H9T A;  1QPU A;  1S7Z A;  3HTK C;  1U0B B;  1RJ9 A;  2EPO A;  1TR2 A;  3LLI A;  5COM A;  3CEX A;  3C7J A;  4U5D E;  4XWJ A;  4JTA B;  4GEH A;  1HE9 A;  3W4Y A;  4A2N B;  4DOZ A;  4CS9 A;  3FXH A;  1XZP A;  4MTG A;  1CGN A;  4LER A;  4DJ9 A;  4CDV A;  3BEH A;  5A6B A;  3QVZ A;  2AP3 A;  1PCX A;  3HNI A;  4E7Z A;  2VAS A;  3M1C B;  5D91 A;  1OCZ C;  2CCY A;  1ORJ A;  1QKR A;  4I3M A;  4O79 A;  1JPJ A;  4UDV A;  1LI5 A;  1M2V B;  1OKK A;  3C8G A;  3ATP A;  2VCC A;  4N6C A;  1J8Y F;  4OIP F;  3ECS A;  2OEX A;  3T6J A;  4BEJ A;  1CPR A;  4JKV A;  1UFB A;  3GOD A;  3LEO A;  2R7W A;  2H7B A;  1TFO B;  4KC9 A;  3T4R A;  4IGG A;  2YWA A;  5BUO A;  1OR3 A;  2BE5 F;  3DAG A;  4U5E E;  3HLZ A;  2RSE B;  1AEP A;  4NTA A;  3B0V C;  1MMA A;  3ABM C;  3C18 A;  3LLK A;  3K66 A;  1J8M F;  1T6I A;  3U0C A;  3HJC A;  3FAP B;  4J32 B;  1PV3 A;  3L0I A;  1ZHY A;  1OR2 A;  1WAS A;  1DOW A;  4IAQ A;  4LLC A;  2LD6 A;  3KL4 A;  2X0C A;  3U5S A;  2EIL C;  3FDQ A;  4BJ6 A;  1LVK A;  2LQG A;  2R9R B;  1PD1 A;  2V3C C;  3RKO F;  2EIN C;  4NQF A;  4BPM A;  3TQO A;  3C63 A;  3EH2 A;  2J0W A;  5AC4 A;  4DRI B;  3TOM A;  2ZPA A;  4YL3 A;  4ONS A;  2HFI A;  3I4U A;  3ABK C;  4XLN F;  2HZ8 A;  3V5Z A;  2YVK A;  4BJT A;  5JVE A;  3F46 A;  2CYD A;  2HMQ A;  3K6B A;  1MNE A;  1Z3I X;  1A41 A;  2R7R A;  4KNW A;  1K40 A;  1ORY A;  1D0Y A;  4J7T A;  1TQG A;  2R7U A;  2CW0 F;  1H9G A;  4EUK B;  4YT5 A;  2KSF A;  1NU7 D;  2M64 A;  3BRJ A;  3EGX B;  3NG1 A;  5CI9 A;  3SEO A;  5L0H A;  5KYX A;  1G5Z A;  4JCH A;  1ZYR F;  3KKB A;  4AE4 A;  1E84 A;  1ZHW A;  4FAP B;  3LAY A;  4U5C E;  5F28 E;  4DRH B;  2HV7 A;  1Z7Q c;  2QY9 A;  5L0G A;  1ZW2 A;  3FOP A;  1G4W R;  3US6 A;  4N06 A;  3WG7 C;  1HY5 A;  3DE9 A;  4Q7C A;  5EGY A;  4BJ5 C;  4EWC A;  3PHF 2;  2LSE A;  4XEF A;  4YWQ A;  5EHH A;  3JSE O;  2VCB A;  3U9M A;  2BL2 A;  3ZTZ A;  3DJU B;  4OIR F;  3GOR A;  3QW0 A;  1EA8 A;  5L0J A;  2KNH A;  3CQZ A;  4K1O A;  2WVN A;  5KYU B;  1SYQ A;  1LPE A;  5KYW B;  2KK1 A;  4JJG A;  5BQG A;  4MQ9 F;  2IXP A;  1T01 A;  1C17 M;  1HE1 A;  3W8H A;  2IM8 A;  1TKN A;  1LE4 A;  2DI3 A;  1D1A A;  1SR2 A;  1G4U S;  1LI7 A;  1SZI A;  3L8J A;  5CI8 A;  2XLM A;  3TK0 A;  2DYS C;  1YLM A;  2YLI A;  3ZG1 A;  4G7O F;  1LS4 A;  3MYF A;  3JYY A;  3LNR A;  1M2O A;  2IBF A;  3E9V A;  3NRH A;  3LJB A;  4IWB A;  2A0U A;  3EZH A;  4J30 B;  2G3K A;  1IZM A;  1HMD A;  1WOL A;  3M4C A;  1AVO B;  4LDQ A;  4PJJ A;  4B6I A;  4CIP A;  2DB4 A;  5T3W A;  3SXM A;  3QTH A;  1FNT c;  1VMA A;  4P6I C;  2Q00 A;  3AJM A;  1N1C A;  1YZA A;  3DXJ F;  3NMK A;  1JOG A;  2XLH A;  4H4K C;  4C7O A;  3L34 A;  3FMS A;  1L7C A;  1H7I A;  4JC7 A;  4MVO A;  3S9O A;  4KBL A;  3HNJ A;  2XSE A;  3I5P A;  3NYJ A;  4NY3 A;  2M4E A;  3H65 A;  3W2V A;  2P6V A;  3JTL O;  2O9X A;  5L0F A;  2PP4 A;  4JUR I;  3UGO A;  2J9V A;  3OWT A;  1YZC A;  2HJM A;  2CNW A;  2NG1 A;  3IPM O;  3Q6M A;  2EPK X;  3IQC A;  4PAC A;  3RYL A;  2LP4 A;  2OKU A;  1G8X A;  4Z9H A;  3QVY A;  3UMI A;  5HSW A;  1OCR C;  2NPU A;  3DZA A;  4JZA A;  5A6J A;  5L0D A;  1TWH A;  1QVX A;  5B1A C;  2D4U A;  1DOV A;  1TWA A;  3U2M A;  3VYW A;  4JTC B;  2XLE A;  4Z9J A;  5F5H A;  4BEM J;  2OG2 A;  2R02 A;  3DAF A;  2LK4 A;  3ZWI A;  3KYI A;  3KH2 A;  2XRH A;  3R2P A;  3Q7G A;  1B68 A;  4XEV A;  3HKK A;  3AG4 C;  4CDY A;  4JEA A;  2LFF A;  3JT1 A;  1WTY A;  2MHR A;  2XM4 A;  1GS9 A;  3IQT A;  1A7V A;  1E83 A;  2CGE A;  3Q7L A;  4E7S A;  1HW1 A;  4OIN F;  4IAR A;  4CX9 A;  4F4B A;  3EGD B;  2XXA A;  2A6E F;  4PJN A;  2A68 F;  4NTF A;  2Q9B A;  2VH3 A;  2XL4 A;  4GQH A;  2NUP B;  3E70 C;  2YEV A;  1NU9 C;  4EBB A;  4DVY P;  2XS1 A;  3SYN A;  2OJE D;  4LLE A;  3RIP A;  4G78 A;  4BJ5 A;  1FR0 A;  1WWP A;  2A69 F;  3AG3 C;  3DKA A;  4NTB A;  4M63 A;  4QI0 A;  3GEI A;  3GM3 A;  4L6R A;  2Y69 C;  3MFN A;  3DJN B;  2EPM X;  1MND A;  2W4M A;  2QUP A;  3AGT A;  2OEV A;  3EG9 B;  4I1M A;  4NCQ A;  4MVS A;  1NFO A;  3B71 A;  4MND A;  5JLI A;  3VAY A;  3EPV A;  1U6H A;  2OCC C;  1BDJ B;  4AL1 A;  2R7Q A;  3RF3 A;  1MMD A;  2PF4 E;  4DBR A;  1LIH A;  3S0X A;  1L3P A;  2R7X A;  2NSF A;  2QTV A;  4IJJ A;  4XPX A;  5GPG B;  2LCH A;  4P9F A;  3J06 A;  5KYY A;  2GFH A;  2L9J A;  3TOL A;  1LS1 A;  1C02 A;  1BR4 A;  2PX3 A;  2HUJ A;  3KPH A;  1RMV A;  5A6A A;  2P0N A;  2R05 A;  1Q0F A;  3M79 A;  3AG1 C;  5B3I A;  1Q0D A;  1JPN A;  2MYS A;  4JTD B;  1BZ4 A;  2BC5 A;  2W9Y A;  5T1D B;  5E33 A;  3IHU A;  3RH3 A;  3VRC A;  3AQB A;  5HV9 A;  1EI7 A;  1RKE B;  2J46 A;  3GWL A;  3IEE A;  2XL6 A;  1C03 A;  3JRM O;  2G62 A;  2YKZ A;  3DWW A;  2NUT A;  5BQH A;  3AQC A;  1TWG A;  1YAU O;  3K1I C;  1JR8 A;  4JJF A;  2IXN A;  4MVM A;  3LES A;  2KGO A;  2L6F A;  3PDM P;  1Q0G A;  4CS8 A;  2Y3G A;  4YL0 A;  5F5F A;  4IB4 A;  2Q3T A;  1CGO A;  2FAP B;  4U5G A;  4U9D A;  3EFO A;  1OXK A;  3DM5 A;  4MVZ A;  2HMZ A;  4W8K A;  5JSL A;  1R4T A;  1Z5Z A;  2A6H F;  1YAR O;  2KW3 C;  4MVR A;  4RBN A;  5IY5 C;  5AC5 A;  1TWC A;  1RKC A;  256B A;  5DLJ A;  3IQ5 A;  2UUH A;  3EJN A;  1E2X A;  1KNY A;  4H54 A;  1EKY A;  1FTS A;  4XPW A;  1VYI A;  1XZQ A;  3OA1 A;  3U3B A;  4CIH A;  3AGU A;  3JRT A;  3V5Y A;  4KI2 A;  1OXB A;  5FZT A;  3X2Q C;  1QQ3 A;  1SF8 A;  3B0P A;  3K33 A;  4YJW A;  3SXK A;  4QDL A;  4K0D A;  3LEV A;  1V4A A;  3N2Z B;  2GDC A;  4KNV A;  3NDB B;  1V54 C;  3HNK A;  2Q7R A;  1YYJ A;  3WHN A;  1YDI A;  2HV6 A;  3U9J A;  3G4X A;  3UMK A;  1BBH A;  4E0H A;  4XLP F;  1O3U A;  3U8P A;  1D0X A;  3PMR A;  2PFD A;  2GA0 A;  1S05 A;  4I1O B;  3MYI A;  1FMW A;  1M2V A;  1RJ9 B;  1ZU4 A;  1OW7 A;  3H2U A;  3LS0 A;  4U5H A;  4WGZ A;  1VLT A;  4RDA A;  3L1M A;  1APC A;  2C03 A;  2JD3 A;  4LDK A;  2WZF A;  3SZR A;  3ZSU A;  4K7B A;  5L0C A;  3UGP A;  5B1B C;  1ZVZ A;  3ITF A;  4MTO A;  3W2W A;  1BR2 A;  5D92 A;  4CS9 C;  1TFK B;  1A0B A;  4CDA A;  2XLO A;  4XEK A;  2R03 A;  3H2V A;  3JCU Q;  4HEA J;  4WAB A;  4W8P A;  3JSZ A;  4MVQ A;  1VYK A;  3ASN C;  3MBG A;  4MTF A;  3ZQY A;  1Y4C A;  2A1D D;  3C8G B;  1LE2 A;  1FAP B;  4CJO A;  3M15 A;  4ULV A;  3EH1 A;  2J7P D;  3G50 A;  5JRA A;  4DXW A;  1M56 C;  2X51 A;  3S28 A;  2H7V C;  4YT4 A;  1BR1 A;  3QMK A;  4N4W A;  1HW2 A;  3ZQV A;  1VTM P;  3T9O A;  1Y6D A;  3UNG C;  1VOM A;  3CAX A;  4ULW A;  1NLX A;  3B9Q A;  1ZHT A;  2HKV A;  1FFT C;  1I5N A;  1Q0M A;  2EIJ C;  1T9K A;  3PCV A;  4D4N A;  2JPU A;  4ZLC A;  2E87 A;  2D5R B;  2ETS A;  3VF0 A;  4DVZ A;  1JMW A;  2L7A A;  2YL3 A;  1OW8 A;  2FFH A;  3GAN A;  2OQM A;  5A6B D;  2UUI A;  3K1I A;  5FCL A;  2IXO A;  1F1M A;  2H8A A;  1A7E A;  5DS6 A;  3KYJ A;  4HE8 D;  1SMY F;  3FHD A;  4R32 A;  3U8V A;  4BJ6 C;  1D0Z A;  2CDQ A;  4HFK B;  2QLA A;  4N6H A;  4JVS A;  4GYT A;  3WOD F;  3T6G B;  5E2Q A;  1OCC C;  4FES A;  1HMO A;  3C8G D;  5CIV A;  5L3V A;  2ZXP A;  1V55 C;  1CGM E;  2IYL D;  3DM9 B;  1R5I D;  3NYL A;  3SXY A;  4ER9 A;  2ZXO A;  2WVO A;  2Z15 A; 
#chains in the Genus database with same CATH homology
 3M4B A;  2J8W A;  1LM3 B;  5AGF A;  3TOL A;  1E84 A;  1CPQ A;  1NBB A;  3FOP A;  2YL0 A;  3M79 A;  5B3I A;  2YL7 A;  2BC5 A;  3DE9 A;  3VRC A;  5JT4 A;  4ULV A;  2XL6 A;  2YKZ A;  2YLD A;  4WGY A;  3ZTZ A;  3QW0 A;  1JAF A;  2J9B A;  5JS5 A;  4IB4 A;  1CGO A;  4U9D A;  5JP7 A;  3NMI A;  5JSL A;  4JEB A;  2XLM A;  4U9E A;  2XLV A;  2YLI A;  256B A;  3IQ5 A;  1E85 A;  3C62 A;  1EKY A;  2XL8 A;  3M4C A;  3QW1 A;  1MQV A;  1QQ3 A;  3FOO A;  3IQ6 A;  4JE9 A;  4CIP A;  3ZTM A;  4NC3 A;  5JUA A;  1YZA A;  1E86 A;  3NMK A;  3HNK A;  2XLH A;  4CJG A;  1YYJ A;  1QPU A;  1YYX A;  2YL1 A;  1BBH A;  3U8P A;  3HNJ A;  1S05 A;  2XLW A;  1RCP A;  1CGN A;  4CDV A;  1YZC A;  3HNI A;  3QVZ A;  4WGZ A;  3L1M A;  1APC A;  2XLD A;  4EIY A;  2CCY A;  3QVY A;  4CDA A;  1GQA A;  2XLO A;  2XLE A;  1CPR A;  4JKV A;  3ZWI A;  3ZQY A;  4CJO A;  4CDY A;  4JEA A;  3M15 A;  2XM0 A;  2XM4 A;  5JRA A;  1E83 A;  1A7V A;  2YLG A;  4N4W A;  3ZQV A;  3HNL A;  4IAR A;  4CX9 A;  4D4X A;  4IAQ A;  4D4N A;  3DE8 A;  4L6R A;  2YL3 A;  3NMJ A;  3C63 A;  3TOM A;  4N6H A;  1M6T A;  2QLA A;  5JVE A;  5JLI A;  4ER9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...