3M15A

A zn-mediated asymmetric trimer of a cytochrome cb562 variant (d74a-ridc1)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Structural characterization of a microperoxidase inside a metal-directed protein cage.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3m15A00
2XLHA 1GQAA 4IB4A 5AGFA 4ULVA 1NBBA 2J9BA 1BBHA 3M4BA 4CIPA 4JEAA 256BA 5JVEA 3U8PA 4ER9A 2XL8A 3HNJA 3FOOA 3NMIA 1LM3B 2XLWA 1QPUA 4IARA 4IAQA 1QQ3A 4CJOA 4JEBA 3QW1A 4JE9A 3M4CA 2XM4A 1E86A 4CDYA 5JRAA 3C62A 3ZTMA 1E83A 4EIYA 2XL6A 1A7VA 4N4WA 3NMJA 1APCA 2YL7A 5JSLA 3DE8A 1YZAA 2BC5A 3C63A 3M79A 3HNIA 3NMKA 2QLAA 2XLOA 4U9EA 1CGOA 2CCYA 3DE9A 5JLIA 3FOPA 4NC3A 4U9DA 3ZQYA 1S05A 3ZTZA 4JKVA 3ZQVA 2XLEA 5JP7A 2YLIA 1JAFA 1E85A 2YL1A 3QW0A 4CDAA 2YLDA 3IQ5A 1RCPA 2XLDA 2YKZA 3TOMA 3M15A 3TOLA 5JT4A 4CX9A 5JS5A 5JUAA 1M6TA 3QVZA 4N6HA 4D4XA 1EKYA 2YL3A 3ZWIA 1YZCA 3HNKA 1CPRA 1MQVA 4D4NA 1YYJA 4CJGA 3IQ6A 5B3IA 1CPQA 2XLMA 3L1MA 2YL0A 4WGZA 3VRCA 1YYXA 2J8WA 3HNLA 4CDVA 4WGYA 3QVYA 2XLVA 4L6RA 2YLGA 1E84A 2XM0A 1CGNA
chains in the Genus database with same CATH superfamily
2XLHA 1GQAA 1O3UA 4EWCA 3PDMP 1JR8A 2HJ3A 4ZLDA 5AGFA 1IW7F 2EILC 3C8GB 4C3BA 4FX5A 3SXKA 2KQ9A 3W8IA 1WWPA 1NBBA 4MVUA 1Q0FA 4C7OB 4IJJA 4C3EA 3GEEA 3SXMA 3AJMA 1BBHA 4M63A 2VH3A 4BJ6C 3B29A 1D0XA 4CIPA 3LESA 2LIGA 1LS1A 4JEAA 4K0DA 2D4UA 5F5FA 3CZ6A 1M2OA 4RD9A 4CBEA 4OIQF 2EPOA 2KW3C 2XL4A 3RFYA 2RD9A 1K40A 3ABLC 3F46A 4KNVA 3CSKA 5D91A 3HNJA 4JC7A 1NFNA 4ONSA 3B0PA 4U5HA 5A6BA 1I5NA 1LM3B 1OCZC 3DAFA 4U5DE 5TJ5E 1AEPA 4IAQA 1QLEC 4NTAA 5DLJA 1QQ3A 1VYKA 2OQMA 4G78A 2J46A 3AG4C 3NYMA 2XM4A 1VTMP 1OCCC 5DQZA 4DJ9A 1EA8A 2KNHA 1E86A 4C3DA 4CDYA 4O79A 3ZTMA 4KI2A 2VCBA 3Q7GA 2P1AA 1LI5A 4P9TA 2PNOA 1JPJA 3K66A 4CS9A 4PR9A 1YA9A 2YZSA 1GGQA 2XL6A 3G4XA 2L6HA 4DBQA 4OIOF 1LVKA 1A7VA 2Q9AA 4N4WA 1A41A 3NMJA 3G4ZA 4BJ1A 2YL7A 3J06A 2CW0F 1V55C 1QVXA 1BDJB 1FAPB 2YRFA 3C7JA 1K04A 1YZAA 5EGYA 3LNMB 4DVYP 1RMVA 2P6VA 3DKAA 3C63A 4NTBA 2TMVP 3CQZA 1KU2A 2G3VA 4EBBA 2A68F 2QLAA 3WG7C 3EJNA 1CGOA 3KYJA 1T9KA 2CCYA 4ULWA 3ZIBA 1AUEA 2L6GA 3X2QC 1WN0A 4JJFA 3BRJA 3GWNA 2EIMC 3QTHA 3HLZA 4E7SA 1NU9C 5KYYB 2IYLD 4E17A 4NC3A 4U5BE 3AQCA 4ZLCA 4U9DA 1S05A 3ZTZA 1ZZPA 5L3QA 1U0BB 2Q4FA 4OD5A 1NLXA 1GS9A 5T3WA 4WABA 3N0TA 4J30B 4JURI 4MVRA 3ZC4A 5JP7A 2Q3TA 1DOVA 1PD0A 1JAFA 1OW8A 3S0XA 4DXWA 3FAPB 1OQCA 2R7XA 3FDQA 1QKRA 4W8KA 2OJQA 1TR2A 3U0CA 4QI2A 2YLDA 3L8JA 4PFOA 3GM1A 1OCRC 3EGDA 2XLDA 3EG9A 3JT1A 2YKZA 1E2XA 3M15A 3US6A 2GAQA 1NZEA 3KL4A 5JT4A 4PJLA 2BL2A 2CDQA 3RVYA 4CX9A 2FAPB 3DJUB 1LPEA 1F1MA 1ST6A 4N6HA 3DWWA 2R7SA 3I5PA 4MTGA 1D1AA 4XEKA 4MS2A 1ZHWA 2YL3A 4J32B 3EFOB 5A6KA 1OW6A 5BUOA 1VYIA 1Y6DA 3W8HA 2PFDA 5DS4A 3LLKA 3F47A 4OIRF 2E87A 3IQ6A 5B3IA 3U3BA 1K05A 1CPQA 1HE1A 2DGJA 2QY9A 4YL1A 4EKWA 4WGZA 4RBNA 1G4US 4QI0A 1VLTA 5CI8A 3HNLA 3AG1C 2NPUA 5BQGA 2RSEB 2YLGA 1E84A 2ZPAA 4QDLA 4PK4A 4I1MA 1JPNA 2XM0A 1D0YA 2L9JA 2KK1A 5E3CA 5IY5C 3L34A 4BEJA 2GFHA 4ULVA 1NG1A 2AU5A 3N2ZB 5L0HA 4R32A 5KYUA 3VM6A 5HSWA 2GWWA 2XRHA 3B0UX 4BJ5A 2J9BA 2AP3A 5D92A 5A6BD 4A2NB 2R05A 4O6YA 2J0WA 5F28E 2ETSA 2OKUA 2Q9BA 2P0NA 4EBKA 2NSFA 4YL3A 3ZDLA 256BA 2C03A 2UUIA 4PJMA 3KKBA 1HW1A 3E70C 3R2PA 4N6CA 1T5OA 3GEIA 1ZU4A 4DRJB 4XLNF 1JMWA 2J7PA 3EFOA 4ER9A 1D0ZA 3UMHA 2AWYA 4YT2A 1J8MF 1WTYA 2R9RB 2L6FA 1AVOB 3JZ0A 3LEOA 3FOOA 5DS5A 2O9XA 3G50A 1VB5A 3U2MA 4Q5SF 4G7HF 1U6HA 1OKKD 4BJ6A 2EPNA 3FHDA 3Q6MA 3V5XA 4E18A 1UG7A 1LE2A 1MMGA 4AL0A 3U5SA 3FAJA 3AG2C 2DI3A 3E9VA 4JEBA 3S29A 1V54C 4PJJA 2JPUA 2Q00A 3M4CA 4YL0A 1EQ1A 2Y3GA 1G5ZA 1CGME 1RKEB 2R7QA 4P9FA 5T1DB 5A69A 2ZXRA 2OU6A 1Q0DA 3LUTB 2KSFA 1TWCA 1ZYRF 2LP4A 4BJTA 4XPWA 2WL8A 3EGXA 4DOZA 3K1IC 1VK5A 1ZHXA 5E3AA 2F22A 1NFOA 2BE5F 1BZ4A 3DAGA 3NYLA 1XWJA 3NKEA 2ASRA 3O10A 1EKYA 1ZU5A 1I4YA 5B1AC 4MTFA 2WVNA 5EK0A 3M79A 3NMKA 5GPGB 2J45A 3LS1A 2XLOA 3AQBA 4JTAB 3NDBB 4DBRA 2X51A 2KGOA 4HFKB 2H7BA 3DJNB 1SYQA 4KBLA 1NU7D 2J9WA 1OR2A 3N24A 3H65A 5AC5A 3NG1A 3FOPA 3ZVRA 1TFKB 2DYSC 1Q0MA 1OKKA 2GA0A 3JYYA 4CSAC 5DVWA 1ZHYA 3DM9B 4XPXA 1RKEA 4MTOA 5A6AA 3UMIA 1WATA 1C02A 5L0GA 1BR1A 4JJGA 3L0IA 4JRZA 2YL1A 1YDIA 4X0RA 4Z9IA 4A4AA 3EGDB 1O87A 4DVZA 2IOQA 3B0VC 3EG9B 2XS8A 1S7ZA 2MHRA 3IQTA 2R03A 3RQGA 4WJ0A 4CDAA 1RCPA 3ABMC 3JCUQ 4NTFA 2AVKA 1G4WR 5FCLA 3RF3A 1TFOB 3V5ZA 3C18A 2WZGA 4JCZA 2CNWA 3TOLA 4Z9JA 2Y69C 1YAUO 2DB4A 1OCOC 2HV7A 5JS5A 1TQGA 1M6TA 1VMAA 2HS5A 3CAXA 4H4KC 4CS7A 2NUTA 1Z6AA 3KH2A 3W2WA 2R7TA 4PJNA 4KNWA 3UGOA 1TWAA 4GEHA 3WAQA 2EIJC 3Q7LA 4MNDA 4D4NA 4H54A 2R02A 1ZHZA 2EINC 2IBFA 3TK0A 4MVQA 1A0BA 3VRCA 4P6IC 5COMA 2J8WA 4EUKB 1HE9A 2Y39A 4CDVA 1H6GA 1WASA 2J0XA 4NQFA 1M57C 2DYRC 2R7OA 3S90A 4MVMA 3W4YA 2WVQA 3UGPA 3RKOF 3SP1A 4O6NA 1PV3A 2CGEA 5KYUB 3JYHA 1W2WA 2YVKA 1SMYF 4IB4A 3GANA 2J7PD 2XSEA 3U9JA 4F4BA 3KYIA 1ORJA 2A6HF 3GODA 3O6XA 3T6BA 1YVIA 3LAYA 3OWTA 4MQ9F 2HKVA 3AGUA 4LDRA 2Q7RA 3H2VA 1V74B 4I3MA 3U8PA 3C8ZA 4AX2A 1KNYA 1R4TA 4JIOA 2WB7A 3GM2A 2XL8A 1PD1A 3Q6NA 1G8XA 3SNHA 1FR0A 4JTCB 4E0IA 1Q0KA 1FFHA 3ITFA 1FNTc 3T6JA 1LE4A 2XLWA 2XXAA 3EH1A 1QPUA 2JD3A 4IARA 4W8PA 1A7EA 2I15A 2W9YA 5CI9A 4FAPB 4U5CE 4LDKA 1C03A 5A6JA 3JRMO 3B71A 2A6EF 5E2QA 4XTKA 3W2VA 3QW1A 4XEFA 4I44A 3CEXA 1LIHA 4Q7CA 4I1OB 2LCHA 4LDQA 4O7GA 2LSEA 3HTKC 4LLEA 3T6GB 2EPLX 3PMRA 3EGXB 4OIPF 3VAYA 4EIYA 3QMKA 5DS6A 3SYNA 4FWVA 4BG0A 2HSQA 1KTMA 2NSGA 3UNGC 3IEEA 3MFNA 4U5GA 1FFTC 2ZXPA 2P7VA 4HE8D 1APCA 2EPKX 2G62A 1LS4A 3A11A 5F5HA 4LACB 5L0CA 1JOGA 1M2VA 3SXZA 1U89A 2Z15A 3ABKC 3LJBA 1C17M 4U5EE 2BC5A 4CS8A 4CIHA 4JVSA 1IZMA 1Z63A 4JTDB 1WOLA 3U8VA 3LEVA 4U9EA 1T6IA 2LK4A 3K1IA 4NY3A 4YJWA 2QNLA 3X1OA 3NKDA 1R5ID 3POVA 4IAOA 3MYIA 3DE9A 1D1BA 4PACA 4AK9A 2M4EA 1WGWA 3KPHA 3ZQYA 2OG2A 4K1OA 5KYWA 1ZVZA 3ZQVA 2W45A 2QUPA 3EZHA 1H7IA 2XLEA 1QSPA 2KYHA 4CS8C 2AWCA 4Z9HA 5EHHA 3GORA 5FZTA 3WHNA 2CNWD 2IXNA 2FGYA 3UMKA 4MW8A 3DM5A 1T01A 3EHNA 4XEVA 5L3VA 3U2LA 5L0IA 2V3CC 5KYNA 1L3PA 1D1CA 1HMDA 1XZQA 2ZD9A 2G3KA 2VB6A 2Y3BA 2YHSA 3H2UA 3KMIA 3O55A 3OEOA 3TULA 4JZAA 3WODF 2NUPA 1VOMA 1YLMA 3ASNC 3VF0A 4AL1A 4YT8A 4CSAA 3DD7A 1M56C 1MNEA 4IGGA 4J7YA 5KYXA 2PX3A 2OEXA 2A1DD 2NUTB 4AE4A 4FESA 1Q0GA 4XWJA 1PCXA 4XQ1A 1ZW3A 5BQIA 2H7VC 3SXYA 3PHF2 3GM3A 2HZ8A 2ZXWC 4JW1A 3ZWIA 3HNKA 3BEHA 2P61A 1HMOA 4CJGA 2QE9A 3FVYA 2X0CA 1UFBA 2Y3HA 1Y4CA 2XLMA 4OD4A 4MVZA 4JCHA 4MW3A 3B9QA 2WZLA 4OINF 3RIPA 4WGYA 3GWLA 2XLVA 2CYDA 3ECSA 3K7DA 3QVYA 2I8BA 2B0JA 2M64A 1FMWA 1TWHA 1SF8A 1CGNA 5AC4A 3EHMA 5B3SC 3K33A 2HSBA 2A0BA 2LFFA 1T6UA 1TWGA 1HY5A 1N1CA 3ATPA 3I4UA 3S27A 3S9OA 5E33A 1OW7A 3MBGA 2XS1A 3HKKA 5B1BC 3C8GA 3M4BA 1RJ9B 2OOCA 3EZIA 3S84A 3I5QA 2IXOA 3QZCA 1MMAA 4C7OA 2FFHA 2W4BA 3RQEA 2KC3A 4DRHB 2ICWG 2HJMA 3AOUA 1YJGA 5HV9A 5JVEA 1OR3A 2H7OA 5L0JA 3AGTA 1V4AA 2C04A 2A0UA 4RDAA 2IM8A 2J9UA 2XXAB 4O6MA 2NG1A 2OEVA 3IPMO 3T9OA 2J9VA 3NMIA 1A7DA 2IXPA 2YWAA 3LLIA 3ZSUA 3ASOC 4G7ZF 2MYSA 3MYFA 3AG3C 3HJCA 3JSZA 3TQOA 3TJ6A 2Q9CA 4CS9C 4EHPA 1Z23A 3A9CA 1MNDA 4B6IA 1H9GA 4HFFB 3SZRA 4CJOA 5JSLA 4JE9A 3L8IA 1QZXA 2GDCA 2V26A 2OCCC 2D5RB 4K7BA 2HV6A 3JSEO 4BPMA 2EIKC 2B0HA 2R25A 3EPVA 4XPYA 5JRAA 1OXBA 2QTVA 3C62A 3JRTA 2VASA 3RH3A 3EH2A 2HFIA 3U3FA 2WZFA 1E83A 2EPMX 1J8YF 3PCVA 4YK5A 5L0DA 1OXKA 2YEVA 3K1HA 3NYJA 1M2VB 4LERA 3FMSA 1RJ9A 3OA1A 4LLCA 4HEAJ 1MMNA 3RW0A 3LS0A 4U5FE 2PF4E 2LQGA 1SZIA 3DE8A 1NSGB 2L7AA 4PFPA 1T6QA 2A69F 3DXJF 4GYTA 3S28A 4XLPF 4UDVA 3TJ5A 4Q4ZF 3T4RA 4G7OF 3HNIA 1ORYA 1LKXA 4MVOA 4NCQA 3U9MA 2VC9A 5DQTA 2L81A 1GM5A 1B68A 2MWQA 3EQLF 3FXHA 1VLSA 1EI7A 1I4ZA 5KYWB 4ANJA 2R7UA 1YA7O 3V5YA 3IQCA 5JLIA 1BR4A 2OJED 1YARO 2PX0A 2UUHA 3LNRA 4IWBA 4JKVA 3V7OA 5KYYA 2PP4A 2IXMA 1LI7A 2R7WA 3DZAA 3JTLO 5T3TA 3ZG1A 2LD6A 3DI5A 1H9TA 1BR2A 2VCCA 2ZXOA 4G0HA 4N06A 2JX0A 1ZW2A 3RYLA 2VCAA 5COFA 1L7CA 2YLIA 1E85A 1MMDA 1Z7Qc 3K6BA 2NUPB 2H8AA 2YQYA 2PBEA 3QW0A 5KYXB 2LFDA 3IQ5A 3MX3A 4AE4B 4J7TA 5BQHA 5CIVA 5K0IA 4GQHA 3R7CA 3DMDA 3TOMA 3O39A 5L0FA 1JRAA 4IRUA 1ZHTA 5JUAA 1Z3IX 3QVZA 1RXQA 3IHUA 2Y3DA 4YN0B 1RKCA 3UR3C 4D4XA 4EBJA 4E7ZA 2HUJA 1Z5ZA 4YT5A 1YZCA 1CPRA 1MQVA 4DRIB 2W4MA 2R7RA 1TKNA 1YYJA 1ORSC 4E0HA 1SR2A 1HW2A 3GEHA 1FTSA 3TD7A 3L1MA 2YL0A 4YT4A 3RVZA 3VYWA 1YYXA 3MLGA 4YWQA 1FMVA 4BJ5C 1DOWA 1XZPA 3M1CB 5COGA 4BEMJ 4L6RA 2WVOA 3C8GD 3NRHA 1O5HA 2HMZA 2KJGA 2R7VA 2HMQA 3RQFA 4MVSA 3SEOA 4KC9A
chains in the Genus database with same CATH topology
2XLHA 1GQAA 4IB4A 5AGFA 4ULVA 1NBBA 2J9BA 1BBHA 3M4BA 4CIPA 4JEAA 256BA 5JVEA 3U8PA 4ER9A 2XL8A 3HNJA 3FOOA 3NMIA 1LM3B 2XLWA 1QPUA 4IARA 4IAQA 1QQ3A 4CJOA 4JEBA 3QW1A 4JE9A 3M4CA 2XM4A 1E86A 4CDYA 5JRAA 3C62A 3ZTMA 1E83A 4EIYA 2XL6A 1A7VA 4N4WA 3NMJA 1APCA 2YL7A 5JSLA 3DE8A 1YZAA 2BC5A 3C63A 3M79A 3HNIA 3NMKA 2QLAA 2XLOA 4U9EA 1CGOA 2CCYA 3DE9A 5JLIA 3FOPA 4NC3A 4U9DA 3ZQYA 1S05A 3ZTZA 4JKVA 3ZQVA 2XLEA 5JP7A 2YLIA 1JAFA 1E85A 2YL1A 3QW0A 4CDAA 2YLDA 3IQ5A 1RCPA 2XLDA 2YKZA 3TOMA 3M15A 3TOLA 5JT4A 4CX9A 5JS5A 5JUAA 1M6TA 3QVZA 4N6HA 4D4XA 1EKYA 2YL3A 3ZWIA 1YZCA 3HNKA 1CPRA 1MQVA 4D4NA 1YYJA 4CJGA 3IQ6A 5B3IA 1CPQA 2XLMA 3L1MA 2YL0A 4WGZA 3VRCA 1YYXA 2J8WA 3HNLA 4CDVA 4WGYA 3QVYA 2XLVA 4L6RA 2YLGA 1E84A 2XM0A 1CGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLH A;  1GQA A;  4IB4 A;  5AGF A;  4ULV A;  1NBB A;  2J9B A;  1BBH A;  3M4B A;  4CIP A;  4JEA A;  256B A;  5JVE A;  3U8P A;  4ER9 A;  2XL8 A;  3HNJ A;  3FOO A;  3NMI A;  1LM3 B;  2XLW A;  1QPU A;  4IAR A;  4IAQ A;  1QQ3 A;  4CJO A;  4JEB A;  3QW1 A;  4JE9 A;  3M4C A;  2XM4 A;  1E86 A;  4CDY A;  5JRA A;  3C62 A;  3ZTM A;  1E83 A;  4EIY A;  2XL6 A;  1A7V A;  4N4W A;  3NMJ A;  1APC A;  2YL7 A;  5JSL A;  3DE8 A;  1YZA A;  2BC5 A;  3C63 A;  3M79 A;  3HNI A;  3NMK A;  2QLA A;  2XLO A;  4U9E A;  1CGO A;  2CCY A;  3DE9 A;  5JLI A;  3FOP A;  4NC3 A;  4U9D A;  3ZQY A;  1S05 A;  3ZTZ A;  4JKV A;  3ZQV A;  2XLE A;  5JP7 A;  2YLI A;  1JAF A;  1E85 A;  2YL1 A;  3QW0 A;  4CDA A;  2YLD A;  3IQ5 A;  1RCP A;  2XLD A;  2YKZ A;  3TOM A;  3M15 A;  3TOL A;  5JT4 A;  4CX9 A;  5JS5 A;  5JUA A;  1M6T A;  3QVZ A;  4N6H A;  4D4X A;  1EKY A;  2YL3 A;  3ZWI A;  1YZC A;  3HNK A;  1CPR A;  1MQV A;  4D4N A;  1YYJ A;  4CJG A;  3IQ6 A;  5B3I A;  1CPQ A;  2XLM A;  3L1M A;  2YL0 A;  4WGZ A;  3VRC A;  1YYX A;  2J8W A;  3HNL A;  4CDV A;  4WGY A;  3QVY A;  2XLV A;  4L6R A;  2YLG A;  1E84 A;  2XM0 A;  1CGN A; 
#chains in the Genus database with same CATH topology
 2XLH A;  1GQA A;  1O3U A;  4EWC A;  3PDM P;  1JR8 A;  2HJ3 A;  4ZLD A;  5AGF A;  1IW7 F;  2EIL C;  3C8G B;  4C3B A;  4FX5 A;  3SXK A;  2KQ9 A;  3W8I A;  1WWP A;  1NBB A;  4MVU A;  1Q0F A;  4C7O B;  4IJJ A;  4C3E A;  3GEE A;  3SXM A;  3AJM A;  1BBH A;  4M63 A;  2VH3 A;  4BJ6 C;  3B29 A;  1D0X A;  4CIP A;  3LES A;  2LIG A;  1LS1 A;  4JEA A;  4K0D A;  2D4U A;  5F5F A;  3CZ6 A;  1M2O A;  4RD9 A;  4CBE A;  4OIQ F;  2EPO A;  2KW3 C;  2XL4 A;  3RFY A;  2RD9 A;  1K40 A;  3ABL C;  3F46 A;  4KNV A;  3CSK A;  5D91 A;  3HNJ A;  4JC7 A;  1NFN A;  4ONS A;  3B0P A;  4U5H A;  5A6B A;  1I5N A;  1LM3 B;  1OCZ C;  3DAF A;  4U5D E;  5TJ5 E;  1AEP A;  4IAQ A;  1QLE C;  4NTA A;  5DLJ A;  1QQ3 A;  1VYK A;  2OQM A;  4G78 A;  2J46 A;  3AG4 C;  3NYM A;  2XM4 A;  1VTM P;  1OCC C;  5DQZ A;  4DJ9 A;  1EA8 A;  2KNH A;  1E86 A;  4C3D A;  4CDY A;  4O79 A;  3ZTM A;  4KI2 A;  2VCB A;  3Q7G A;  2P1A A;  1LI5 A;  4P9T A;  2PNO A;  1JPJ A;  3K66 A;  4CS9 A;  4PR9 A;  1YA9 A;  2YZS A;  1GGQ A;  2XL6 A;  3G4X A;  2L6H A;  4DBQ A;  4OIO F;  1LVK A;  1A7V A;  2Q9A A;  4N4W A;  1A41 A;  3NMJ A;  3G4Z A;  4BJ1 A;  2YL7 A;  3J06 A;  2CW0 F;  1V55 C;  1QVX A;  1BDJ B;  1FAP B;  2YRF A;  3C7J A;  1K04 A;  1YZA A;  5EGY A;  3LNM B;  4DVY P;  1RMV A;  2P6V A;  3DKA A;  3C63 A;  4NTB A;  2TMV P;  3CQZ A;  1KU2 A;  2G3V A;  4EBB A;  2A68 F;  2QLA A;  3WG7 C;  3EJN A;  1CGO A;  3KYJ A;  1T9K A;  2CCY A;  4ULW A;  3ZIB A;  1AUE A;  2L6G A;  3X2Q C;  1WN0 A;  4JJF A;  3BRJ A;  3GWN A;  2EIM C;  3QTH A;  3HLZ A;  4E7S A;  1NU9 C;  5KYY B;  2IYL D;  4E17 A;  4NC3 A;  4U5B E;  3AQC A;  4ZLC A;  4U9D A;  1S05 A;  3ZTZ A;  1ZZP A;  5L3Q A;  1U0B B;  2Q4F A;  4OD5 A;  1NLX A;  1GS9 A;  5T3W A;  4WAB A;  3N0T A;  4J30 B;  4JUR I;  4MVR A;  3ZC4 A;  5JP7 A;  2Q3T A;  1DOV A;  1PD0 A;  1JAF A;  1OW8 A;  3S0X A;  4DXW A;  3FAP B;  1OQC A;  2R7X A;  3FDQ A;  1QKR A;  4W8K A;  2OJQ A;  1TR2 A;  3U0C A;  4QI2 A;  2YLD A;  3L8J A;  4PFO A;  3GM1 A;  1OCR C;  3EGD A;  2XLD A;  3EG9 A;  3JT1 A;  2YKZ A;  1E2X A;  3M15 A;  3US6 A;  2GAQ A;  1NZE A;  3KL4 A;  5JT4 A;  4PJL A;  2BL2 A;  2CDQ A;  3RVY A;  4CX9 A;  2FAP B;  3DJU B;  1LPE A;  1F1M A;  1ST6 A;  4N6H A;  3DWW A;  2R7S A;  3I5P A;  4MTG A;  1D1A A;  4XEK A;  4MS2 A;  1ZHW A;  2YL3 A;  4J32 B;  3EFO B;  5A6K A;  1OW6 A;  5BUO A;  1VYI A;  1Y6D A;  3W8H A;  2PFD A;  5DS4 A;  3LLK A;  3F47 A;  4OIR F;  2E87 A;  3IQ6 A;  5B3I A;  3U3B A;  1K05 A;  1CPQ A;  1HE1 A;  2DGJ A;  2QY9 A;  4YL1 A;  4EKW A;  4WGZ A;  4RBN A;  1G4U S;  4QI0 A;  1VLT A;  5CI8 A;  3HNL A;  3AG1 C;  2NPU A;  5BQG A;  2RSE B;  2YLG A;  1E84 A;  2ZPA A;  4QDL A;  4PK4 A;  4I1M A;  1JPN A;  2XM0 A;  1D0Y A;  2L9J A;  2KK1 A;  5E3C A;  5IY5 C;  3L34 A;  4BEJ A;  2GFH A;  4ULV A;  1NG1 A;  2AU5 A;  3N2Z B;  5L0H A;  4R32 A;  5KYU A;  3VM6 A;  5HSW A;  2GWW A;  2XRH A;  3B0U X;  4BJ5 A;  2J9B A;  2AP3 A;  5D92 A;  5A6B D;  4A2N B;  2R05 A;  4O6Y A;  2J0W A;  5F28 E;  2ETS A;  2OKU A;  2Q9B A;  2P0N A;  4EBK A;  2NSF A;  4YL3 A;  3ZDL A;  256B A;  2C03 A;  2UUI A;  4PJM A;  3KKB A;  1HW1 A;  3E70 C;  3R2P A;  4N6C A;  1T5O A;  3GEI A;  1ZU4 A;  4DRJ B;  4XLN F;  1JMW A;  2J7P A;  3EFO A;  4ER9 A;  1D0Z A;  3UMH A;  2AWY A;  4YT2 A;  1J8M F;  1WTY A;  2R9R B;  2L6F A;  1AVO B;  3JZ0 A;  3LEO A;  3FOO A;  5DS5 A;  2O9X A;  3G50 A;  1VB5 A;  3U2M A;  4Q5S F;  4G7H F;  1U6H A;  1OKK D;  4BJ6 A;  2EPN A;  3FHD A;  3Q6M A;  3V5X A;  4E18 A;  1UG7 A;  1LE2 A;  1MMG A;  4AL0 A;  3U5S A;  3FAJ A;  3AG2 C;  2DI3 A;  3E9V A;  4JEB A;  3S29 A;  1V54 C;  4PJJ A;  2JPU A;  2Q00 A;  3M4C A;  4YL0 A;  1EQ1 A;  2Y3G A;  1G5Z A;  1CGM E;  1RKE B;  2R7Q A;  4P9F A;  5T1D B;  5A69 A;  2ZXR A;  2OU6 A;  1Q0D A;  3LUT B;  2KSF A;  1TWC A;  1ZYR F;  2LP4 A;  4BJT A;  4XPW A;  2WL8 A;  3EGX A;  4DOZ A;  3K1I C;  1VK5 A;  1ZHX A;  5E3A A;  2F22 A;  1NFO A;  2BE5 F;  1BZ4 A;  3DAG A;  3NYL A;  1XWJ A;  3NKE A;  2ASR A;  3O10 A;  1EKY A;  1ZU5 A;  1I4Y A;  5B1A C;  4MTF A;  2WVN A;  5EK0 A;  3M79 A;  3NMK A;  5GPG B;  2J45 A;  3LS1 A;  2XLO A;  3AQB A;  4JTA B;  3NDB B;  4DBR A;  2X51 A;  2KGO A;  4HFK B;  2H7B A;  3DJN B;  1SYQ A;  4KBL A;  1NU7 D;  2J9W A;  1OR2 A;  3N24 A;  3H65 A;  5AC5 A;  3NG1 A;  3FOP A;  3ZVR A;  1TFK B;  2DYS C;  1Q0M A;  1OKK A;  2GA0 A;  3JYY A;  4CSA C;  5DVW A;  1ZHY A;  3DM9 B;  4XPX A;  1RKE A;  4MTO A;  5A6A A;  3UMI A;  1WAT A;  1C02 A;  5L0G A;  1BR1 A;  4JJG A;  3L0I A;  4JRZ A;  2YL1 A;  1YDI A;  4X0R A;  4Z9I A;  4A4A A;  3EGD B;  1O87 A;  4DVZ A;  2IOQ A;  3B0V C;  3EG9 B;  2XS8 A;  1S7Z A;  2MHR A;  3IQT A;  2R03 A;  3RQG A;  4WJ0 A;  4CDA A;  1RCP A;  3ABM C;  3JCU Q;  4NTF A;  2AVK A;  1G4W R;  5FCL A;  3RF3 A;  1TFO B;  3V5Z A;  3C18 A;  2WZG A;  4JCZ A;  2CNW A;  3TOL A;  4Z9J A;  2Y69 C;  1YAU O;  2DB4 A;  1OCO C;  2HV7 A;  5JS5 A;  1TQG A;  1M6T A;  1VMA A;  2HS5 A;  3CAX A;  4H4K C;  4CS7 A;  2NUT A;  1Z6A A;  3KH2 A;  3W2W A;  2R7T A;  4PJN A;  4KNW A;  3UGO A;  1TWA A;  4GEH A;  3WAQ A;  2EIJ C;  3Q7L A;  4MND A;  4D4N A;  4H54 A;  2R02 A;  1ZHZ A;  2EIN C;  2IBF A;  3TK0 A;  4MVQ A;  1A0B A;  3VRC A;  4P6I C;  5COM A;  2J8W A;  4EUK B;  1HE9 A;  2Y39 A;  4CDV A;  1H6G A;  1WAS A;  2J0X A;  4NQF A;  1M57 C;  2DYR C;  2R7O A;  3S90 A;  4MVM A;  3W4Y A;  2WVQ A;  3UGP A;  3RKO F;  3SP1 A;  4O6N A;  1PV3 A;  2CGE A;  5KYU B;  3JYH A;  1W2W A;  2YVK A;  1SMY F;  4IB4 A;  3GAN A;  2J7P D;  2XSE A;  3U9J A;  4F4B A;  3KYI A;  1ORJ A;  2A6H F;  3GOD A;  3O6X A;  3T6B A;  1YVI A;  3LAY A;  3OWT A;  4MQ9 F;  2HKV A;  3AGU A;  4LDR A;  2Q7R A;  3H2V A;  1V74 B;  4I3M A;  3U8P A;  3C8Z A;  4AX2 A;  1KNY A;  1R4T A;  4JIO A;  2WB7 A;  3GM2 A;  2XL8 A;  1PD1 A;  3Q6N A;  1G8X A;  3SNH A;  1FR0 A;  4JTC B;  4E0I A;  1Q0K A;  1FFH A;  3ITF A;  1FNT c;  3T6J A;  1LE4 A;  2XLW A;  2XXA A;  3EH1 A;  1QPU A;  2JD3 A;  4IAR A;  4W8P A;  1A7E A;  2I15 A;  2W9Y A;  5CI9 A;  4FAP B;  4U5C E;  4LDK A;  1C03 A;  5A6J A;  3JRM O;  3B71 A;  2A6E F;  5E2Q A;  4XTK A;  3W2V A;  3QW1 A;  4XEF A;  4I44 A;  3CEX A;  1LIH A;  4Q7C A;  4I1O B;  2LCH A;  4LDQ A;  4O7G A;  2LSE A;  3HTK C;  4LLE A;  3T6G B;  2EPL X;  3PMR A;  3EGX B;  4OIP F;  3VAY A;  4EIY A;  3QMK A;  5DS6 A;  3SYN A;  4FWV A;  4BG0 A;  2HSQ A;  1KTM A;  2NSG A;  3UNG C;  3IEE A;  3MFN A;  4U5G A;  1FFT C;  2ZXP A;  2P7V A;  4HE8 D;  1APC A;  2EPK X;  2G62 A;  1LS4 A;  3A11 A;  5F5H A;  4LAC B;  5L0C A;  1JOG A;  1M2V A;  3SXZ A;  1U89 A;  2Z15 A;  3ABK C;  3LJB A;  1C17 M;  4U5E E;  2BC5 A;  4CS8 A;  4CIH A;  4JVS A;  1IZM A;  1Z63 A;  4JTD B;  1WOL A;  3U8V A;  3LEV A;  4U9E A;  1T6I A;  2LK4 A;  3K1I A;  4NY3 A;  4YJW A;  2QNL A;  3X1O A;  3NKD A;  1R5I D;  3POV A;  4IAO A;  3MYI A;  3DE9 A;  1D1B A;  4PAC A;  4AK9 A;  2M4E A;  1WGW A;  3KPH A;  3ZQY A;  2OG2 A;  4K1O A;  5KYW A;  1ZVZ A;  3ZQV A;  2W45 A;  2QUP A;  3EZH A;  1H7I A;  2XLE A;  1QSP A;  2KYH A;  4CS8 C;  2AWC A;  4Z9H A;  5EHH A;  3GOR A;  5FZT A;  3WHN A;  2CNW D;  2IXN A;  2FGY A;  3UMK A;  4MW8 A;  3DM5 A;  1T01 A;  3EHN A;  4XEV A;  5L3V A;  3U2L A;  5L0I A;  2V3C C;  5KYN A;  1L3P A;  1D1C A;  1HMD A;  1XZQ A;  2ZD9 A;  2G3K A;  2VB6 A;  2Y3B A;  2YHS A;  3H2U A;  3KMI A;  3O55 A;  3OEO A;  3TUL A;  4JZA A;  3WOD F;  2NUP A;  1VOM A;  1YLM A;  3ASN C;  3VF0 A;  4AL1 A;  4YT8 A;  4CSA A;  3DD7 A;  1M56 C;  1MNE A;  4IGG A;  4J7Y A;  5KYX A;  2PX3 A;  2OEX A;  2A1D D;  2NUT B;  4AE4 A;  4FES A;  1Q0G A;  4XWJ A;  1PCX A;  4XQ1 A;  1ZW3 A;  5BQI A;  2H7V C;  3SXY A;  3PHF 2;  3GM3 A;  2HZ8 A;  2ZXW C;  4JW1 A;  3ZWI A;  3HNK A;  3BEH A;  2P61 A;  1HMO A;  4CJG A;  2QE9 A;  3FVY A;  2X0C A;  1UFB A;  2Y3H A;  1Y4C A;  2XLM A;  4OD4 A;  4MVZ A;  4JCH A;  4MW3 A;  3B9Q A;  2WZL A;  4OIN F;  3RIP A;  4WGY A;  3GWL A;  2XLV A;  2CYD A;  3ECS A;  3K7D A;  3QVY A;  2I8B A;  2B0J A;  2M64 A;  1FMW A;  1TWH A;  1SF8 A;  1CGN A;  5AC4 A;  3EHM A;  5B3S C;  3K33 A;  2HSB A;  2A0B A;  2LFF A;  1T6U A;  1TWG A;  1HY5 A;  1N1C A;  3ATP A;  3I4U A;  3S27 A;  3S9O A;  5E33 A;  1OW7 A;  3MBG A;  2XS1 A;  3HKK A;  5B1B C;  3C8G A;  3M4B A;  1RJ9 B;  2OOC A;  3EZI A;  3S84 A;  3I5Q A;  2IXO A;  3QZC A;  1MMA A;  4C7O A;  2FFH A;  2W4B A;  3RQE A;  2KC3 A;  4DRH B;  2ICW G;  2HJM A;  3AOU A;  1YJG A;  5HV9 A;  5JVE A;  1OR3 A;  2H7O A;  5L0J A;  3AGT A;  1V4A A;  2C04 A;  2A0U A;  4RDA A;  2IM8 A;  2J9U A;  2XXA B;  4O6M A;  2NG1 A;  2OEV A;  3IPM O;  3T9O A;  2J9V A;  3NMI A;  1A7D A;  2IXP A;  2YWA A;  3LLI A;  3ZSU A;  3ASO C;  4G7Z F;  2MYS A;  3MYF A;  3AG3 C;  3HJC A;  3JSZ A;  3TQO A;  3TJ6 A;  2Q9C A;  4CS9 C;  4EHP A;  1Z23 A;  3A9C A;  1MND A;  4B6I A;  1H9G A;  4HFF B;  3SZR A;  4CJO A;  5JSL A;  4JE9 A;  3L8I A;  1QZX A;  2GDC A;  2V26 A;  2OCC C;  2D5R B;  4K7B A;  2HV6 A;  3JSE O;  4BPM A;  2EIK C;  2B0H A;  2R25 A;  3EPV A;  4XPY A;  5JRA A;  1OXB A;  2QTV A;  3C62 A;  3JRT A;  2VAS A;  3RH3 A;  3EH2 A;  2HFI A;  3U3F A;  2WZF A;  1E83 A;  2EPM X;  1J8Y F;  3PCV A;  4YK5 A;  5L0D A;  1OXK A;  2YEV A;  3K1H A;  3NYJ A;  1M2V B;  4LER A;  3FMS A;  1RJ9 A;  3OA1 A;  4LLC A;  4HEA J;  1MMN A;  3RW0 A;  3LS0 A;  4U5F E;  2PF4 E;  2LQG A;  1SZI A;  3DE8 A;  1NSG B;  2L7A A;  4PFP A;  1T6Q A;  2A69 F;  3DXJ F;  4GYT A;  3S28 A;  4XLP F;  4UDV A;  3TJ5 A;  4Q4Z F;  3T4R A;  4G7O F;  3HNI A;  1ORY A;  1LKX A;  4MVO A;  4NCQ A;  3U9M A;  2VC9 A;  5DQT A;  2L81 A;  1GM5 A;  1B68 A;  2MWQ A;  3EQL F;  3FXH A;  1VLS A;  1EI7 A;  1I4Z A;  5KYW B;  4ANJ A;  2R7U A;  1YA7 O;  3V5Y A;  3IQC A;  5JLI A;  1BR4 A;  2OJE D;  1YAR O;  2PX0 A;  2UUH A;  3LNR A;  4IWB A;  4JKV A;  3V7O A;  5KYY A;  2PP4 A;  2IXM A;  1LI7 A;  2R7W A;  3DZA A;  3JTL O;  5T3T A;  3ZG1 A;  2LD6 A;  3DI5 A;  1H9T A;  1BR2 A;  2VCC A;  2ZXO A;  4G0H A;  4N06 A;  2JX0 A;  1ZW2 A;  3RYL A;  2VCA A;  5COF A;  1L7C A;  2YLI A;  1E85 A;  1MMD A;  1Z7Q c;  3K6B A;  2NUP B;  2H8A A;  2YQY A;  2PBE A;  3QW0 A;  5KYX B;  2LFD A;  3IQ5 A;  3MX3 A;  4AE4 B;  4J7T A;  5BQH A;  5CIV A;  5K0I A;  4GQH A;  3R7C A;  3DMD A;  3TOM A;  3O39 A;  5L0F A;  1JRA A;  4IRU A;  1ZHT A;  5JUA A;  1Z3I X;  3QVZ A;  1RXQ A;  3IHU A;  2Y3D A;  4YN0 B;  1RKC A;  3UR3 C;  4D4X A;  4EBJ A;  4E7Z A;  2HUJ A;  1Z5Z A;  4YT5 A;  1YZC A;  1CPR A;  1MQV A;  4DRI B;  2W4M A;  2R7R A;  1TKN A;  1YYJ A;  1ORS C;  4E0H A;  1SR2 A;  1HW2 A;  3GEH A;  1FTS A;  3TD7 A;  3L1M A;  2YL0 A;  4YT4 A;  3RVZ A;  3VYW A;  1YYX A;  3MLG A;  4YWQ A;  1FMV A;  4BJ5 C;  1DOW A;  1XZP A;  3M1C B;  5COG A;  4BEM J;  4L6R A;  2WVO A;  3C8G D;  3NRH A;  1O5H A;  2HMZ A;  2KJG A;  2R7V A;  2HMQ A;  3RQF A;  4MVS A;  3SEO A;  4KC9 A; 
#chains in the Genus database with same CATH homology
 2XLH A;  1GQA A;  4IB4 A;  5AGF A;  4ULV A;  1NBB A;  2J9B A;  1BBH A;  3M4B A;  4CIP A;  4JEA A;  256B A;  5JVE A;  3U8P A;  4ER9 A;  2XL8 A;  3HNJ A;  3FOO A;  3NMI A;  1LM3 B;  2XLW A;  1QPU A;  4IAR A;  4IAQ A;  1QQ3 A;  4CJO A;  4JEB A;  3QW1 A;  4JE9 A;  3M4C A;  2XM4 A;  1E86 A;  4CDY A;  5JRA A;  3C62 A;  3ZTM A;  1E83 A;  4EIY A;  2XL6 A;  1A7V A;  4N4W A;  3NMJ A;  1APC A;  2YL7 A;  5JSL A;  3DE8 A;  1YZA A;  2BC5 A;  3C63 A;  3M79 A;  3HNI A;  3NMK A;  2QLA A;  2XLO A;  4U9E A;  1CGO A;  2CCY A;  3DE9 A;  5JLI A;  3FOP A;  4NC3 A;  4U9D A;  3ZQY A;  1S05 A;  3ZTZ A;  4JKV A;  3ZQV A;  2XLE A;  5JP7 A;  2YLI A;  1JAF A;  1E85 A;  2YL1 A;  3QW0 A;  4CDA A;  2YLD A;  3IQ5 A;  1RCP A;  2XLD A;  2YKZ A;  3TOM A;  3M15 A;  3TOL A;  5JT4 A;  4CX9 A;  5JS5 A;  5JUA A;  1M6T A;  3QVZ A;  4N6H A;  4D4X A;  1EKY A;  2YL3 A;  3ZWI A;  1YZC A;  3HNK A;  1CPR A;  1MQV A;  4D4N A;  1YYJ A;  4CJG A;  3IQ6 A;  5B3I A;  1CPQ A;  2XLM A;  3L1M A;  2YL0 A;  4WGZ A;  3VRC A;  1YYX A;  2J8W A;  3HNL A;  4CDV A;  4WGY A;  3QVY A;  2XLV A;  4L6R A;  2YLG A;  1E84 A;  2XM0 A;  1CGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...