3M15A

A zn-mediated asymmetric trimer of a cytochrome cb562 variant (d74a-ridc1)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a microperoxidase inside a metal-directed protein cage.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3m15A00
4ULVA 3L1MA 2XLVA 1A7VA 2XLEA 3FOOA 3VRCA 3ZQYA 1QPUA 4CDVA 1S05A 3M4CA 5JUAA 1NBBA 4IB4A 256BA 1E85A 2XM0A 1LM3B 1YZCA 1BBHA 2YL7A 4WGYA 4IAQA 3ZTMA 4CJOA 4CJGA 2YLIA 4N4WA 2XM4A 1GQAA 4JKVA 5JS5A 3TOMA 2QLAA 2CCYA 2XL6A 3IQ6A 1YZAA 5AGFA 1E86A 3IQ5A 5JSLA 4CX9A 1CGOA 3U8PA 3ZTZA 3HNKA 2YL0A 3QW0A 3TOLA 3HNJA 1RCPA 4NC3A 4N6HA 3HNLA 3M4BA 2YL1A 3C63A 3QW1A 3ZWIA 3QVYA 1M6TA 4U9EA 2XL8A 5JT4A 4ER9A 4WGZA 1QQ3A 4CDYA 3NMJA 1EKYA 2XLWA 3C62A 2YLDA 3M79A 2XLMA 5JLIA 1JAFA 5JVEA 3FOPA 4IARA 1YYXA 4EIYA 4JE9A 2YL3A 4L6RA 1CPRA 3ZQVA 3NMKA 5B3IA 4CDAA 1E84A 4JEBA 3DE9A 4JEAA 2J9BA 1CGNA 2YKZA 3HNIA 5JRAA 1MQVA 2J8WA 1CPQA 4U9DA 1E83A 2BC5A 4D4NA 3DE8A 2YLGA 5JP7A 2XLHA 2XLOA 3NMIA 4CIPA 1YYJA 3M15A 1APCA 3QVZA 4D4XA 2XLDA
chains in the Genus database with same CATH superfamily
2NPUA 4B6IA 4PACA 1A7VA 3O6XA 2ZXPA 4NTFA 3FVYA 1GM5A 3VRCA 4CIHA 5BUOA 2D5RB 4RD9A 2B0JA 4YK5A 1WN0A 1ZW3A 2P1AA 4C3BA 4CDVA 2P6VA 1NSGB 3UMIA 3L0IA 1D0YA 4KI2A 4PK4A 1R5ID 4IB4A 4BJTA 4A2NB 3DMDA 1LM3B 3KL4A 1BR2A 5DQZA 5DLJA 3DJUB 2G3KA 2OCCC 2A6EF 4JTAB 1YA7O 2J45A 2Y3DA 2ZXWC 5L0IA 2R7WA 4DVYP 1BR1A 1OW8A 2Q9AA 3G50A 3ASOC 4CBEA 2WVNA 4DBQA 4I1MA 3TOMA 3K1IC 5L0HA 2W4BA 1F1MA 4C7OB 4HEAJ 2QTVA 1KU2A 1V55C 3GEEA 2OU6A 1ZYRF 4Z9JA 1G4WR 3FAPB 4CX9A 1CGOA 5A6BA 5L0DA 5KYYB 3B29A 1M56C 4J7YA 3EGXB 5E3CA 3U8PA 3ZTZA 3B0UX 5CI9A 2HV7A 3WAQA 4RDAA 2AVKA 3U9JA 4W8KA 3DM5A 4JRZA 3TOLA 3HNJA 1NFNA 1WASA 2O9XA 5D92A 4AL0A 3W4YA 3JT1A 2FGYA 3GANA 2EPKX 4JTDB 4JVSA 3T6GB 3V5YA 2KW3C 4MTGA 1MMGA 2DYRC 1RKEA 3AGUA 4N6CA 3S29A 3EGDB 1LS4A 2NG1A 3C63A 4H54A 3SXMA 3A9CA 3TD7A 3QW1A 3X1OA 2Q9BA 2H7OA 3EG9A 2L81A 1OXKA 1TKNA 3QVYA 4BJ6A 3KYJA 1XZQA 3B0VC 2UUIA 3T4RA 2XL8A 2Y3BA 1YLMA 4IRUA 4WGZA 3W8IA 1ST6A 2NSGA 3R2PA 1D0ZA 4YN0B 5DS5A 1RMVA 3E70C 3GM2A 1M2VA 3VM6A 4O6YA 1LIHA 2R9RB 3NYJA 5TJ5E 2NUPA 3TJ6A 3AQBA 1S7ZA 5KYWB 2WZFA 1KNYA 3UMKA 4PJMA 1NG1A 1VK5A 3JSEO 2A1DD 4JCZA 4XEVA 1AEPA 1OKKA 1VLSA 3AQCA 3RYLA 1JAFA 4KNVA 3U2LA 4AL1A 2WVOA 2I8BA 4JTCB 2V26A 2HJ3A 1AVOB 4QI0A 4O6NA 3FOPA 1C17M 4IARA 4H4KC 1FMWA 2HKVA 2VH3A 1VB5A 3PCVA 2X0CA 1B68A 2IM8A 2YL3A 2Q3TA 1SF8A 3RFYA 2NUTA 4MVOA 1VTMP 3C8GB 1GS9A 3JZ0A 4OIRF 3U0CA 4Q5SF 3F47A 2WVQA 5L0FA 1CGNA 4ULWA 1J8YF 1MNDA 3ZVRA 4AE4B 3S90A 3T6BA 3ATPA 3G4XA 2MWQA 1ZHXA 1KTMA 3BRJA 2L6FA 3LS1A 5HV9A 2R7XA 2X51A 2HV6A 4LDQA 4U9DA 4W8PA 2KGOA 4U5DE 4DVZA 4ANJA 3DAFA 4BJ5C 3LLKA 3HTKC 2OJQA 3NKEA 3IHUA 3O10A 3H65A 4U5BE 3TULA 1Q0KA 2A0BA 3L34A 1TFKB 2ICWG 2ZXOA 3IQCA 5JP7A 5T3TA 3SZRA 5KYXA 1LKXA 3X2QC 2F22A 1LVKA 2HZ8A 2M64A 3IPMO 1PV3A 3O55A 4FX5A 4KC9A 5FZTA 3EG9B 4CIPA 1JOGA 3U8VA 1EA8A 3TQOA 1TWCA 1TR2A 5L0CA 1QZXA 1NFOA 3MFNA 3L1MA 2HUJA 2XLVA 3UR3C 2XLEA 3ZDLA 4AX2A 4FESA 4EKWA 5DS6A 1FFTC 1Q0DA 1QPUA 3KYIA 2KJGA 4LACB 2AWYA 1ZW2A 4Q4ZF 2H7VC 2NUPB 2A68F 1S05A 3GORA 5L3QA 2Q00A 3B9QA 3M4CA 4MVQA 4OINF 1D1AA 4JJFA 3V5XA 5L3VA 4YT5A 3AOUA 1OCZC 2I15A 1E85A 3BEHA 4CSAA 1YZCA 2YL7A 3CAXA 1FTSA 1MNEA 1N1CA 2J0XA 3Q6MA 4NQFA 5COFA 1YJGA 3EZHA 4CJGA 2Y3GA 2V3CC 1DOWA 3E9VA 4DRHB 4N4WA 1HMDA 1OCRC 1Z23A 4YT4A 5KYUA 2Q7RA 2ZPAA 3N2ZB 1FFHA 4JKVA 3SYNA 5JS5A 1ZHYA 3GWNA 1M57C 3UMHA 4BEJA 1K40A 1TWHA 2G62A 1OKKD 2CCYA 3UNGC 3M1CB 2YHSA 2D4UA 1UFBA 1VYIA 2L7AA 3LEOA 3QZCA 3U5SA 3HNKA 4CS9A 2OEXA 3SXKA 2HMQA 4GYTA 2YL0A 3QW0A 2H7BA 2XL4A 2DB4A 1WGWA 1FMVA 4HE8D 1O3UA 3A11A 4O6MA 1QLEC 2L6HA 1MMNA 3MLGA 4K0DA 5E33A 1T5OA 4YT8A 5T3WA 1NU7D 5HSWA 2Y69C 3B0PA 1V4AA 4Z9IA 1WOLA 1ZHZA 3Q7LA 4I1OB 3ABMC 2J7PD 5L0JA 3AGTA 1TQGA 3WG7C 3FMSA 1HW1A 4MVMA 4DOZA 4Z9HA 4K1OA 4EWCA 3ZG1A 3AG1C 1BDJB 3NDBB 4XEFA 4U5GA 1PD1A 4U9EA 1M2OA 3ZC4A 4XEKA 4YWQA 2UUHA 2HJMA 3G4ZA 1CGME 3NMJA 4XLPF 5COMA 2GDCA 2XS8A 4LLCA 2HMZA 1SR2A 2OG2A 2P0NA 2YLDA 4OD4A 3PMRA 3LNRA 2WB7A 5A6BD 5EK0A 4UDVA 2XLMA 2IXOA 2J9UA 3SEOA 4HFKB 1AUEA 3T6JA 5A69A 3W8HA 1ZZPA 3H2VA 3GEHA 1K04A 5D91A 4MTFA 3WHNA 3POVA 1OCOC 1Y6DA 4PJLA 5F5FA 2QUPA 3VYWA 4G7OF 3ABKC 4EIYA 1YYXA 2Y39A 2PNOA 4JE9A 4P6IC 4E17A 3T9OA 3J06A 3O39A 1CPRA 1ORSC 1RKEB 1IW7F 3ZQVA 3EGDA 3NKDA 1Q0MA 2KNHA 4XPXA 3AJMA 2KYHA 2QNLA 3CSKA 2WZLA 1A0BA 5DQTA 3CEXA 4JEAA 5A6KA 3FDQA 1FR0A 5COGA 1LE4A 2Q9CA 3QTHA 4JZAA 2PBEA 3EJNA 4DBRA 2J8WA 3I4UA 2EPLX 1CPQA 5DVWA 2W45A 3ZIBA 5E2QA 2C04A 1E83A 1BR4A 4NY3A 3B71A 2YRFA 4ZLDA 2EILC 1Y4CA 4U5FE 4DXWA 3DE8A 4WABA 3JRTA 1RJ9A 3S9OA 3OEOA 3ZSUA 3NMIA 2VCCA 3EPVA 3SNHA 2JPUA 3DXJF 3EFOB 3ABLC 4E0IA 4EHPA 3LJBA 4IGGA 4PFPA 3RVYA 1T6QA 2XLDA 4K7BA 5CI8A 5B1BC 3I5PA 2BL2A 2YQYA 4BJ6C 2LFFA 3GWLA 2GFHA 3L8IA 3W2WA 2P61A 4OIOF 3SXZA 2ZD9A 1FAPB 4BJ1A 1YVIA 4R32A 2OEVA 1YARO 2NSFA 1WTYA 2MYSA 1QSPA 2CYDA 3WODF 5JUAA 2R7UA 4P9FA 1HE1A 256BA 2XM0A 3RW0A 4JW1A 4N06A 4CS8C 5EHHA 1BBHA 3RH3A 1IZMA 3NYMA 4G7HF 4E18A 1V74B 3ZTMA 3VAYA 3U2MA 4CJOA 3UGOA 3K1HA 2YLIA 2IXMA 1H9GA 2LFDA 3GODA 4M63A 3ASNC 3K33A 3US6A 4X0RA 4MVRA 1G5ZA 4LERA 4U5EE 3F46A 5IY5C 3PDMP 1GQAA 3KH2A 2IXNA 3RVZA 1H9TA 2ASRA 4GQHA 1XWJA 4JC7A 3DM9B 4MQ9F 3LUTB 4I3MA 3K6BA 5E3AA 3IQ5A 4FWVA 3Q6NA 5JSLA 4PR9A 4C7OA 3CQZA 4O79A 3LEVA 3K7DA 2EPMX 2R7VA 4XLNF 3N0TA 2AWCA 2BE5F 2GA0A 3EGXA 3LAYA 2OJED 3AG2C 2KK1A 2PF4E 3OA1A 4N6HA 2Q4FA 1G4US 2GWWA 4PJJA 4EBBA 1YAUO 1SYQA 2VASA 3JYHA 4BJ5A 3M4BA 5A6JA 3DKAA 2LD6A 3DAGA 3S27A 2LIGA 3K66A 4C3EA 2L6GA 3FHDA 1EI7A 1ORJA 3ZWIA 3EFOA 4KBLA 1C02A 2J7PA 3RQFA 3KMIA 2LCHA 5CIVA 1M2VB 3FAJA 1M6TA 2CNWA 2PFDA 2WZGA 4CS7A 4XPYA 1T9KA 2AU5A 4ER9A 2VCBA 2G3VA 5KYUB 3L8JA 1MMDA 4JCHA 2XLWA 1LI5A 1NZEA 2VCAA 2YZSA 4YJWA 3UGPA 3JCUQ 2A6HF 1LS1A 2CW0F 5BQHA 1QKRA 4G7ZF 2LQGA 1Z7Qc 1WATA 2IOQA 1WWPA 2MHRA 2J9WA 2YWAA 2Z15A 4F4BA 5JLIA 1UG7A 2R05A 1OR2A 4MW3A 4MW8A 1TWAA 2NUTB 3C8GA 3K1IA 5GPGB 3V7OA 5B3IA 4CDAA 2W9YA 4AE4A 4OIPF 1Z3IX 2J46A 4XTKA 3AG3C 2XXAB 4MVUA 1LPEA 5FCLA 2JD3A 2LK4A 2GAQA 2ZXRA 3LS0A 3JRMO 4RBNA 3R7CA 1MQVA 1Q0FA 1T6UA 2VC9A 1NLXA 3U3BA 2FFHA 3W2VA 3NG1A 5F28E 1I4YA 1XZPA 2YVKA 5B3SC 1I4ZA 1OXBA 3C8GD 3EH2A 4LDRA 1A7EA 2R7RA 4YL0A 1VOMA 2EIJC 4YL1A 5KYXB 2BC5A 1OQCA 2J0WA 2R25A 3NYLA 5T1DB 3S0XA 4MVSA 3RQGA 4JURI 1C03A 1ZHWA 2YLGA 3SXYA 2XLOA 3LESA 2HFIA 4NTAA 2IXPA 3V5ZA 1D1BA 1VLTA 2DI3A 4MVZA 4QDLA 1YYJA 2ETSA 2EPOA 4YT2A 2XSEA 2E87A 3M15A 2EPNA 2J9VA 5KYYA 3RKOF 3IEEA 4JJGA 2P7VA 4NCQA 4ULVA 2R02A 1U89A 2Y3HA 1L7CA 3FOOA 4O7GA 1JMWA 4PJNA 5A6AA 3KKBA 3ZQYA 5DS4A 2PP4A 4XPWA 3AG4C 2TMVP 3QMKA 3S28A 3I5QA 2KSFA 1E2XA 1ZU5A 4EBKA 1MMAA 1Z5ZA 3ECSA 3C18A 4WJ0A 1NBBA 1HE9A 3GM3A 3RF3A 2CGEA 5AC4A 4ONSA 1L3PA 3VF0A 1OR3A 4J7TA 4BEMJ 4WGYA 2HSQA 4IAQA 1O87A 1HW2A 3GEIA 1SMYF 2A69F 1J8MF 1EQ1A 1GGQA 1TWGA 2OOCA 3DI5A 4IJJA 5F5HA 3Q7GA 3JYYA 5AC5A 2IYLD 2XM4A 4P9TA 3H2UA 4DJ9A 4QI2A 3U9MA 2IBFA 1V54C 1ZU4A 4G0HA 2QLAA 2R03A 3N24A 4MNDA 3RQEA 4J30B 3CZ6A 2XL6A 3IQ6A 1YZAA 5AGFA 3TJ5A 1E86A 1QVXA 5KYNA 5KYWA 1RKCA 1HMOA 2LSEA 1Q0GA 4OD5A 4LDKA 1R4TA 1RXQA 1DOVA 1SZIA 1A7DA 4U5HA 4AK9A 1JPNA 1HY5A 1RCPA 2HS5A 2R7QA 3TK0A 4BG0A 1VMAA 2KQ9A 4NC3A 3OWTA 3EH1A 3HNLA 2CNWD 2XRHA 2YL1A 1FNTc 5EGYA 1U0BB 4PFOA 3DD7A 4XQ1A 2EINC 3GM1A 4G78A 4J32B 3SP1A 4EUKB 3MX3A 2R7OA 4JIOA 5JT4A 3EHNA 1QQ3A 2WL8A 4CDYA 1EKYA 2LP4A 3C62A 1NU9C 1BZ4A 2JX0A 1H6GA 2FAPB 3U3FA 3M79A 2M4EA 5L0GA 1T6IA 1O5HA 2C03A 4DRJB 4DRIB 3IQTA 2AP3A 5BQIA 4CSAC 3EHMA 4BPMA 5B1AC 1LE2A 4E7ZA 2PX0A 1PD0A 3C8ZA 2CDQA 1YA9A 2RSEB 5JVEA 2PX3A 2QY9A 3S84A 4A4AA 1U6HA 4XWJA 1JRAA 2QE9A 4Q7CA 5K0IA 2EIMC 3LLIA 2B0HA 3MYIA 3MYFA 2HSBA 5BQGA 2DYSC 4CS8A 3HKKA 4KNWA 1OW6A 4EBJA 3KPHA 4LLEA 4ZLCA 3NRHA 1PCXA 3EZIA 4L6RA 3NMKA 2R7TA 2KC3A 1JPJA 1ZVZA 4JEBA 4C3DA 4MS2A 2H8AA 3DZAA 1E84A 1ZHTA 1OW7A 4GEHA 3DE9A 4IAOA 3LNMB 2J9BA 3HLZA 3PHF2 4CS9C 2YEVA 4I44A 2YKZA 3HNIA 5JRAA 3C7JA 2L9JA 1H7IA 2OQMA 2DGJA 2EIKC 3FXHA 3JTLO 4E0HA 1VYKA 4OIQF 3HJCA 4U5CE 1JR8A 1D1CA 1RJ9B 3RIPA 1W2WA 3DWWA 1D0XA 1TFOB 2RD9A 4E7SA 2R7SA 3JSZA 1G8XA 4NTBA 4D4NA 1T01A 2W4MA 1A41A 2XLHA 3EQLF 1Z63A 1Z6AA 1OCCC 1YDIA 1I5NA 4YL3A 4FAPB 2XXAA 2OKUA 4IWBA 1K05A 3MBGA 4HFFB 4MTOA 3QVZA 1APCA 2A0UA 2VB6A 3ITFA 4D4XA 2XS1A 1LI7A 3DJNB 1ORYA
chains in the Genus database with same CATH topology
4ULVA 3L1MA 2XLVA 1A7VA 2XLEA 3FOOA 3VRCA 3ZQYA 1QPUA 4CDVA 1S05A 3M4CA 5JUAA 1NBBA 4IB4A 256BA 1E85A 2XM0A 1LM3B 1YZCA 1BBHA 2YL7A 4WGYA 4IAQA 3ZTMA 4CJOA 4CJGA 2YLIA 4N4WA 2XM4A 1GQAA 4JKVA 5JS5A 3TOMA 2QLAA 2CCYA 2XL6A 3IQ6A 1YZAA 5AGFA 1E86A 3IQ5A 5JSLA 4CX9A 1CGOA 3U8PA 3ZTZA 3HNKA 2YL0A 3QW0A 3TOLA 3HNJA 1RCPA 4NC3A 4N6HA 3HNLA 3M4BA 2YL1A 3C63A 3QW1A 3ZWIA 3QVYA 1M6TA 4U9EA 2XL8A 5JT4A 4ER9A 4WGZA 1QQ3A 4CDYA 3NMJA 1EKYA 2XLWA 3C62A 2YLDA 3M79A 2XLMA 5JLIA 1JAFA 5JVEA 3FOPA 4IARA 1YYXA 4EIYA 4JE9A 2YL3A 4L6RA 1CPRA 3ZQVA 3NMKA 5B3IA 4CDAA 1E84A 4JEBA 3DE9A 4JEAA 2J9BA 1CGNA 2YKZA 3HNIA 5JRAA 1MQVA 2J8WA 1CPQA 4U9DA 1E83A 2BC5A 4D4NA 3DE8A 2YLGA 5JP7A 2XLHA 2XLOA 3NMIA 4CIPA 1YYJA 3M15A 1APCA 3QVZA 4D4XA 2XLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ULV A;  3L1M A;  2XLV A;  1A7V A;  2XLE A;  3FOO A;  3VRC A;  3ZQY A;  1QPU A;  4CDV A;  1S05 A;  3M4C A;  5JUA A;  1NBB A;  4IB4 A;  256B A;  1E85 A;  2XM0 A;  1LM3 B;  1YZC A;  1BBH A;  2YL7 A;  4WGY A;  4IAQ A;  3ZTM A;  4CJO A;  4CJG A;  2YLI A;  4N4W A;  2XM4 A;  1GQA A;  4JKV A;  5JS5 A;  3TOM A;  2QLA A;  2CCY A;  2XL6 A;  3IQ6 A;  1YZA A;  5AGF A;  1E86 A;  3IQ5 A;  5JSL A;  4CX9 A;  1CGO A;  3U8P A;  3ZTZ A;  3HNK A;  2YL0 A;  3QW0 A;  3TOL A;  3HNJ A;  1RCP A;  4NC3 A;  4N6H A;  3HNL A;  3M4B A;  2YL1 A;  3C63 A;  3QW1 A;  3ZWI A;  3QVY A;  1M6T A;  4U9E A;  2XL8 A;  5JT4 A;  4ER9 A;  4WGZ A;  1QQ3 A;  4CDY A;  3NMJ A;  1EKY A;  2XLW A;  3C62 A;  2YLD A;  3M79 A;  2XLM A;  5JLI A;  1JAF A;  5JVE A;  3FOP A;  4IAR A;  1YYX A;  4EIY A;  4JE9 A;  2YL3 A;  4L6R A;  1CPR A;  3ZQV A;  3NMK A;  5B3I A;  4CDA A;  1E84 A;  4JEB A;  3DE9 A;  4JEA A;  2J9B A;  1CGN A;  2YKZ A;  3HNI A;  5JRA A;  1MQV A;  2J8W A;  1CPQ A;  4U9D A;  1E83 A;  2BC5 A;  4D4N A;  3DE8 A;  2YLG A;  5JP7 A;  2XLH A;  2XLO A;  3NMI A;  4CIP A;  1YYJ A;  3M15 A;  1APC A;  3QVZ A;  4D4X A;  2XLD A; 
#chains in the Genus database with same CATH topology
 2NPU A;  4B6I A;  4PAC A;  1A7V A;  3O6X A;  2ZXP A;  4NTF A;  3FVY A;  1GM5 A;  3VRC A;  4CIH A;  5BUO A;  2D5R B;  4RD9 A;  2B0J A;  4YK5 A;  1WN0 A;  1ZW3 A;  2P1A A;  4C3B A;  4CDV A;  2P6V A;  1NSG B;  3UMI A;  3L0I A;  1D0Y A;  4KI2 A;  4PK4 A;  1R5I D;  4IB4 A;  4BJT A;  4A2N B;  3DMD A;  1LM3 B;  3KL4 A;  1BR2 A;  5DQZ A;  5DLJ A;  3DJU B;  2G3K A;  2OCC C;  2A6E F;  4JTA B;  1YA7 O;  2J45 A;  2Y3D A;  2ZXW C;  5L0I A;  2R7W A;  4DVY P;  1BR1 A;  1OW8 A;  2Q9A A;  3G50 A;  3ASO C;  4CBE A;  2WVN A;  4DBQ A;  4I1M A;  3TOM A;  3K1I C;  5L0H A;  2W4B A;  1F1M A;  4C7O B;  4HEA J;  2QTV A;  1KU2 A;  1V55 C;  3GEE A;  2OU6 A;  1ZYR F;  4Z9J A;  1G4W R;  3FAP B;  4CX9 A;  1CGO A;  5A6B A;  5L0D A;  5KYY B;  3B29 A;  1M56 C;  4J7Y A;  3EGX B;  5E3C A;  3U8P A;  3ZTZ A;  3B0U X;  5CI9 A;  2HV7 A;  3WAQ A;  4RDA A;  2AVK A;  3U9J A;  4W8K A;  3DM5 A;  4JRZ A;  3TOL A;  3HNJ A;  1NFN A;  1WAS A;  2O9X A;  5D92 A;  4AL0 A;  3W4Y A;  3JT1 A;  2FGY A;  3GAN A;  2EPK X;  4JTD B;  4JVS A;  3T6G B;  3V5Y A;  2KW3 C;  4MTG A;  1MMG A;  2DYR C;  1RKE A;  3AGU A;  4N6C A;  3S29 A;  3EGD B;  1LS4 A;  2NG1 A;  3C63 A;  4H54 A;  3SXM A;  3A9C A;  3TD7 A;  3QW1 A;  3X1O A;  2Q9B A;  2H7O A;  3EG9 A;  2L81 A;  1OXK A;  1TKN A;  3QVY A;  4BJ6 A;  3KYJ A;  1XZQ A;  3B0V C;  2UUI A;  3T4R A;  2XL8 A;  2Y3B A;  1YLM A;  4IRU A;  4WGZ A;  3W8I A;  1ST6 A;  2NSG A;  3R2P A;  1D0Z A;  4YN0 B;  5DS5 A;  1RMV A;  3E70 C;  3GM2 A;  1M2V A;  3VM6 A;  4O6Y A;  1LIH A;  2R9R B;  3NYJ A;  5TJ5 E;  2NUP A;  3TJ6 A;  3AQB A;  1S7Z A;  5KYW B;  2WZF A;  1KNY A;  3UMK A;  4PJM A;  1NG1 A;  1VK5 A;  3JSE O;  2A1D D;  4JCZ A;  4XEV A;  1AEP A;  1OKK A;  1VLS A;  3AQC A;  3RYL A;  1JAF A;  4KNV A;  3U2L A;  4AL1 A;  2WVO A;  2I8B A;  4JTC B;  2V26 A;  2HJ3 A;  1AVO B;  4QI0 A;  4O6N A;  3FOP A;  1C17 M;  4IAR A;  4H4K C;  1FMW A;  2HKV A;  2VH3 A;  1VB5 A;  3PCV A;  2X0C A;  1B68 A;  2IM8 A;  2YL3 A;  2Q3T A;  1SF8 A;  3RFY A;  2NUT A;  4MVO A;  1VTM P;  3C8G B;  1GS9 A;  3JZ0 A;  4OIR F;  3U0C A;  4Q5S F;  3F47 A;  2WVQ A;  5L0F A;  1CGN A;  4ULW A;  1J8Y F;  1MND A;  3ZVR A;  4AE4 B;  3S90 A;  3T6B A;  3ATP A;  3G4X A;  2MWQ A;  1ZHX A;  1KTM A;  3BRJ A;  2L6F A;  3LS1 A;  5HV9 A;  2R7X A;  2X51 A;  2HV6 A;  4LDQ A;  4U9D A;  4W8P A;  2KGO A;  4U5D E;  4DVZ A;  4ANJ A;  3DAF A;  4BJ5 C;  3LLK A;  3HTK C;  2OJQ A;  3NKE A;  3IHU A;  3O10 A;  3H65 A;  4U5B E;  3TUL A;  1Q0K A;  2A0B A;  3L34 A;  1TFK B;  2ICW G;  2ZXO A;  3IQC A;  5JP7 A;  5T3T A;  3SZR A;  5KYX A;  1LKX A;  3X2Q C;  2F22 A;  1LVK A;  2HZ8 A;  2M64 A;  3IPM O;  1PV3 A;  3O55 A;  4FX5 A;  4KC9 A;  5FZT A;  3EG9 B;  4CIP A;  1JOG A;  3U8V A;  1EA8 A;  3TQO A;  1TWC A;  1TR2 A;  5L0C A;  1QZX A;  1NFO A;  3MFN A;  3L1M A;  2HUJ A;  2XLV A;  3UR3 C;  2XLE A;  3ZDL A;  4AX2 A;  4FES A;  4EKW A;  5DS6 A;  1FFT C;  1Q0D A;  1QPU A;  3KYI A;  2KJG A;  4LAC B;  2AWY A;  1ZW2 A;  4Q4Z F;  2H7V C;  2NUP B;  2A68 F;  1S05 A;  3GOR A;  5L3Q A;  2Q00 A;  3B9Q A;  3M4C A;  4MVQ A;  4OIN F;  1D1A A;  4JJF A;  3V5X A;  5L3V A;  4YT5 A;  3AOU A;  1OCZ C;  2I15 A;  1E85 A;  3BEH A;  4CSA A;  1YZC A;  2YL7 A;  3CAX A;  1FTS A;  1MNE A;  1N1C A;  2J0X A;  3Q6M A;  4NQF A;  5COF A;  1YJG A;  3EZH A;  4CJG A;  2Y3G A;  2V3C C;  1DOW A;  3E9V A;  4DRH B;  4N4W A;  1HMD A;  1OCR C;  1Z23 A;  4YT4 A;  5KYU A;  2Q7R A;  2ZPA A;  3N2Z B;  1FFH A;  4JKV A;  3SYN A;  5JS5 A;  1ZHY A;  3GWN A;  1M57 C;  3UMH A;  4BEJ A;  1K40 A;  1TWH A;  2G62 A;  1OKK D;  2CCY A;  3UNG C;  3M1C B;  2YHS A;  2D4U A;  1UFB A;  1VYI A;  2L7A A;  3LEO A;  3QZC A;  3U5S A;  3HNK A;  4CS9 A;  2OEX A;  3SXK A;  2HMQ A;  4GYT A;  2YL0 A;  3QW0 A;  2H7B A;  2XL4 A;  2DB4 A;  1WGW A;  1FMV A;  4HE8 D;  1O3U A;  3A11 A;  4O6M A;  1QLE C;  2L6H A;  1MMN A;  3MLG A;  4K0D A;  5E33 A;  1T5O A;  4YT8 A;  5T3W A;  1NU7 D;  5HSW A;  2Y69 C;  3B0P A;  1V4A A;  4Z9I A;  1WOL A;  1ZHZ A;  3Q7L A;  4I1O B;  3ABM C;  2J7P D;  5L0J A;  3AGT A;  1TQG A;  3WG7 C;  3FMS A;  1HW1 A;  4MVM A;  4DOZ A;  4Z9H A;  4K1O A;  4EWC A;  3ZG1 A;  3AG1 C;  1BDJ B;  3NDB B;  4XEF A;  4U5G A;  1PD1 A;  4U9E A;  1M2O A;  3ZC4 A;  4XEK A;  4YWQ A;  2UUH A;  2HJM A;  3G4Z A;  1CGM E;  3NMJ A;  4XLP F;  5COM A;  2GDC A;  2XS8 A;  4LLC A;  2HMZ A;  1SR2 A;  2OG2 A;  2P0N A;  2YLD A;  4OD4 A;  3PMR A;  3LNR A;  2WB7 A;  5A6B D;  5EK0 A;  4UDV A;  2XLM A;  2IXO A;  2J9U A;  3SEO A;  4HFK B;  1AUE A;  3T6J A;  5A69 A;  3W8H A;  1ZZP A;  3H2V A;  3GEH A;  1K04 A;  5D91 A;  4MTF A;  3WHN A;  3POV A;  1OCO C;  1Y6D A;  4PJL A;  5F5F A;  2QUP A;  3VYW A;  4G7O F;  3ABK C;  4EIY A;  1YYX A;  2Y39 A;  2PNO A;  4JE9 A;  4P6I C;  4E17 A;  3T9O A;  3J06 A;  3O39 A;  1CPR A;  1ORS C;  1RKE B;  1IW7 F;  3ZQV A;  3EGD A;  3NKD A;  1Q0M A;  2KNH A;  4XPX A;  3AJM A;  2KYH A;  2QNL A;  3CSK A;  2WZL A;  1A0B A;  5DQT A;  3CEX A;  4JEA A;  5A6K A;  3FDQ A;  1FR0 A;  5COG A;  1LE4 A;  2Q9C A;  3QTH A;  4JZA A;  2PBE A;  3EJN A;  4DBR A;  2J8W A;  3I4U A;  2EPL X;  1CPQ A;  5DVW A;  2W45 A;  3ZIB A;  5E2Q A;  2C04 A;  1E83 A;  1BR4 A;  4NY3 A;  3B71 A;  2YRF A;  4ZLD A;  2EIL C;  1Y4C A;  4U5F E;  4DXW A;  3DE8 A;  4WAB A;  3JRT A;  1RJ9 A;  3S9O A;  3OEO A;  3ZSU A;  3NMI A;  2VCC A;  3EPV A;  3SNH A;  2JPU A;  3DXJ F;  3EFO B;  3ABL C;  4E0I A;  4EHP A;  3LJB A;  4IGG A;  4PFP A;  3RVY A;  1T6Q A;  2XLD A;  4K7B A;  5CI8 A;  5B1B C;  3I5P A;  2BL2 A;  2YQY A;  4BJ6 C;  2LFF A;  3GWL A;  2GFH A;  3L8I A;  3W2W A;  2P61 A;  4OIO F;  3SXZ A;  2ZD9 A;  1FAP B;  4BJ1 A;  1YVI A;  4R32 A;  2OEV A;  1YAR O;  2NSF A;  1WTY A;  2MYS A;  1QSP A;  2CYD A;  3WOD F;  5JUA A;  2R7U A;  4P9F A;  1HE1 A;  256B A;  2XM0 A;  3RW0 A;  4JW1 A;  4N06 A;  4CS8 C;  5EHH A;  1BBH A;  3RH3 A;  1IZM A;  3NYM A;  4G7H F;  4E18 A;  1V74 B;  3ZTM A;  3VAY A;  3U2M A;  4CJO A;  3UGO A;  3K1H A;  2YLI A;  2IXM A;  1H9G A;  2LFD A;  3GOD A;  4M63 A;  3ASN C;  3K33 A;  3US6 A;  4X0R A;  4MVR A;  1G5Z A;  4LER A;  4U5E E;  3F46 A;  5IY5 C;  3PDM P;  1GQA A;  3KH2 A;  2IXN A;  3RVZ A;  1H9T A;  2ASR A;  4GQH A;  1XWJ A;  4JC7 A;  3DM9 B;  4MQ9 F;  3LUT B;  4I3M A;  3K6B A;  5E3A A;  3IQ5 A;  4FWV A;  3Q6N A;  5JSL A;  4PR9 A;  4C7O A;  3CQZ A;  4O79 A;  3LEV A;  3K7D A;  2EPM X;  2R7V A;  4XLN F;  3N0T A;  2AWC A;  2BE5 F;  2GA0 A;  3EGX A;  3LAY A;  2OJE D;  3AG2 C;  2KK1 A;  2PF4 E;  3OA1 A;  4N6H A;  2Q4F A;  1G4U S;  2GWW A;  4PJJ A;  4EBB A;  1YAU O;  1SYQ A;  2VAS A;  3JYH A;  4BJ5 A;  3M4B A;  5A6J A;  3DKA A;  2LD6 A;  3DAG A;  3S27 A;  2LIG A;  3K66 A;  4C3E A;  2L6G A;  3FHD A;  1EI7 A;  1ORJ A;  3ZWI A;  3EFO A;  4KBL A;  1C02 A;  2J7P A;  3RQF A;  3KMI A;  2LCH A;  5CIV A;  1M2V B;  3FAJ A;  1M6T A;  2CNW A;  2PFD A;  2WZG A;  4CS7 A;  4XPY A;  1T9K A;  2AU5 A;  4ER9 A;  2VCB A;  2G3V A;  5KYU B;  3L8J A;  1MMD A;  4JCH A;  2XLW A;  1LI5 A;  1NZE A;  2VCA A;  2YZS A;  4YJW A;  3UGP A;  3JCU Q;  2A6H F;  1LS1 A;  2CW0 F;  5BQH A;  1QKR A;  4G7Z F;  2LQG A;  1Z7Q c;  1WAT A;  2IOQ A;  1WWP A;  2MHR A;  2J9W A;  2YWA A;  2Z15 A;  4F4B A;  5JLI A;  1UG7 A;  2R05 A;  1OR2 A;  4MW3 A;  4MW8 A;  1TWA A;  2NUT B;  3C8G A;  3K1I A;  5GPG B;  3V7O A;  5B3I A;  4CDA A;  2W9Y A;  4AE4 A;  4OIP F;  1Z3I X;  2J46 A;  4XTK A;  3AG3 C;  2XXA B;  4MVU A;  1LPE A;  5FCL A;  2JD3 A;  2LK4 A;  2GAQ A;  2ZXR A;  3LS0 A;  3JRM O;  4RBN A;  3R7C A;  1MQV A;  1Q0F A;  1T6U A;  2VC9 A;  1NLX A;  3U3B A;  2FFH A;  3W2V A;  3NG1 A;  5F28 E;  1I4Y A;  1XZP A;  2YVK A;  5B3S C;  1I4Z A;  1OXB A;  3C8G D;  3EH2 A;  4LDR A;  1A7E A;  2R7R A;  4YL0 A;  1VOM A;  2EIJ C;  4YL1 A;  5KYX B;  2BC5 A;  1OQC A;  2J0W A;  2R25 A;  3NYL A;  5T1D B;  3S0X A;  4MVS A;  3RQG A;  4JUR I;  1C03 A;  1ZHW A;  2YLG A;  3SXY A;  2XLO A;  3LES A;  2HFI A;  4NTA A;  2IXP A;  3V5Z A;  1D1B A;  1VLT A;  2DI3 A;  4MVZ A;  4QDL A;  1YYJ A;  2ETS A;  2EPO A;  4YT2 A;  2XSE A;  2E87 A;  3M15 A;  2EPN A;  2J9V A;  5KYY A;  3RKO F;  3IEE A;  4JJG A;  2P7V A;  4NCQ A;  4ULV A;  2R02 A;  1U89 A;  2Y3H A;  1L7C A;  3FOO A;  4O7G A;  1JMW A;  4PJN A;  5A6A A;  3KKB A;  3ZQY A;  5DS4 A;  2PP4 A;  4XPW A;  3AG4 C;  2TMV P;  3QMK A;  3S28 A;  3I5Q A;  2KSF A;  1E2X A;  1ZU5 A;  4EBK A;  1MMA A;  1Z5Z A;  3ECS A;  3C18 A;  4WJ0 A;  1NBB A;  1HE9 A;  3GM3 A;  3RF3 A;  2CGE A;  5AC4 A;  4ONS A;  1L3P A;  3VF0 A;  1OR3 A;  4J7T A;  4BEM J;  4WGY A;  2HSQ A;  4IAQ A;  1O87 A;  1HW2 A;  3GEI A;  1SMY F;  2A69 F;  1J8M F;  1EQ1 A;  1GGQ A;  1TWG A;  2OOC A;  3DI5 A;  4IJJ A;  5F5H A;  3Q7G A;  3JYY A;  5AC5 A;  2IYL D;  2XM4 A;  4P9T A;  3H2U A;  4DJ9 A;  4QI2 A;  3U9M A;  2IBF A;  1V54 C;  1ZU4 A;  4G0H A;  2QLA A;  2R03 A;  3N24 A;  4MND A;  3RQE A;  4J30 B;  3CZ6 A;  2XL6 A;  3IQ6 A;  1YZA A;  5AGF A;  3TJ5 A;  1E86 A;  1QVX A;  5KYN A;  5KYW A;  1RKC A;  1HMO A;  2LSE A;  1Q0G A;  4OD5 A;  4LDK A;  1R4T A;  1RXQ A;  1DOV A;  1SZI A;  1A7D A;  4U5H A;  4AK9 A;  1JPN A;  1HY5 A;  1RCP A;  2HS5 A;  2R7Q A;  3TK0 A;  4BG0 A;  1VMA A;  2KQ9 A;  4NC3 A;  3OWT A;  3EH1 A;  3HNL A;  2CNW D;  2XRH A;  2YL1 A;  1FNT c;  5EGY A;  1U0B B;  4PFO A;  3DD7 A;  4XQ1 A;  2EIN C;  3GM1 A;  4G78 A;  4J32 B;  3SP1 A;  4EUK B;  3MX3 A;  2R7O A;  4JIO A;  5JT4 A;  3EHN A;  1QQ3 A;  2WL8 A;  4CDY A;  1EKY A;  2LP4 A;  3C62 A;  1NU9 C;  1BZ4 A;  2JX0 A;  1H6G A;  2FAP B;  3U3F A;  3M79 A;  2M4E A;  5L0G A;  1T6I A;  1O5H A;  2C03 A;  4DRJ B;  4DRI B;  3IQT A;  2AP3 A;  5BQI A;  4CSA C;  3EHM A;  4BPM A;  5B1A C;  1LE2 A;  4E7Z A;  2PX0 A;  1PD0 A;  3C8Z A;  2CDQ A;  1YA9 A;  2RSE B;  5JVE A;  2PX3 A;  2QY9 A;  3S84 A;  4A4A A;  1U6H A;  4XWJ A;  1JRA A;  2QE9 A;  4Q7C A;  5K0I A;  2EIM C;  3LLI A;  2B0H A;  3MYI A;  3MYF A;  2HSB A;  5BQG A;  2DYS C;  4CS8 A;  3HKK A;  4KNW A;  1OW6 A;  4EBJ A;  3KPH A;  4LLE A;  4ZLC A;  3NRH A;  1PCX A;  3EZI A;  4L6R A;  3NMK A;  2R7T A;  2KC3 A;  1JPJ A;  1ZVZ A;  4JEB A;  4C3D A;  4MS2 A;  2H8A A;  3DZA A;  1E84 A;  1ZHT A;  1OW7 A;  4GEH A;  3DE9 A;  4IAO A;  3LNM B;  2J9B A;  3HLZ A;  3PHF 2;  4CS9 C;  2YEV A;  4I44 A;  2YKZ A;  3HNI A;  5JRA A;  3C7J A;  2L9J A;  1H7I A;  2OQM A;  2DGJ A;  2EIK C;  3FXH A;  3JTL O;  4E0H A;  1VYK A;  4OIQ F;  3HJC A;  4U5C E;  1JR8 A;  1D1C A;  1RJ9 B;  3RIP A;  1W2W A;  3DWW A;  1D0X A;  1TFO B;  2RD9 A;  4E7S A;  2R7S A;  3JSZ A;  1G8X A;  4NTB A;  4D4N A;  1T01 A;  2W4M A;  1A41 A;  2XLH A;  3EQL F;  1Z63 A;  1Z6A A;  1OCC C;  1YDI A;  1I5N A;  4YL3 A;  4FAP B;  2XXA A;  2OKU A;  4IWB A;  1K05 A;  3MBG A;  4HFF B;  4MTO A;  3QVZ A;  1APC A;  2A0U A;  2VB6 A;  3ITF A;  4D4X A;  2XS1 A;  1LI7 A;  3DJN B;  1ORY A; 
#chains in the Genus database with same CATH homology
 4ULV A;  3L1M A;  2XLV A;  1A7V A;  2XLE A;  3FOO A;  3VRC A;  3ZQY A;  1QPU A;  4CDV A;  1S05 A;  3M4C A;  5JUA A;  1NBB A;  4IB4 A;  256B A;  1E85 A;  2XM0 A;  1LM3 B;  1YZC A;  1BBH A;  2YL7 A;  4WGY A;  4IAQ A;  3ZTM A;  4CJO A;  4CJG A;  2YLI A;  4N4W A;  2XM4 A;  1GQA A;  4JKV A;  5JS5 A;  3TOM A;  2QLA A;  2CCY A;  2XL6 A;  3IQ6 A;  1YZA A;  5AGF A;  1E86 A;  3IQ5 A;  5JSL A;  4CX9 A;  1CGO A;  3U8P A;  3ZTZ A;  3HNK A;  2YL0 A;  3QW0 A;  3TOL A;  3HNJ A;  1RCP A;  4NC3 A;  4N6H A;  3HNL A;  3M4B A;  2YL1 A;  3C63 A;  3QW1 A;  3ZWI A;  3QVY A;  1M6T A;  4U9E A;  2XL8 A;  5JT4 A;  4ER9 A;  4WGZ A;  1QQ3 A;  4CDY A;  3NMJ A;  1EKY A;  2XLW A;  3C62 A;  2YLD A;  3M79 A;  2XLM A;  5JLI A;  1JAF A;  5JVE A;  3FOP A;  4IAR A;  1YYX A;  4EIY A;  4JE9 A;  2YL3 A;  4L6R A;  1CPR A;  3ZQV A;  3NMK A;  5B3I A;  4CDA A;  1E84 A;  4JEB A;  3DE9 A;  4JEA A;  2J9B A;  1CGN A;  2YKZ A;  3HNI A;  5JRA A;  1MQV A;  2J8W A;  1CPQ A;  4U9D A;  1E83 A;  2BC5 A;  4D4N A;  3DE8 A;  2YLG A;  5JP7 A;  2XLH A;  2XLO A;  3NMI A;  4CIP A;  1YYJ A;  3M15 A;  1APC A;  3QVZ A;  4D4X A;  2XLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...