4YT2A

Hmd ii from methanocaldococcus jannaschii
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
343
structure length
343
Chain Sequence
NMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
total genus 124
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt2A01
1E7WA 2RH8A 3H9QA 1Y1PA 3RBZA 3PDUA 2A9FA 1X0XA 4PIVA 4KZPA 1FDUA 2OO5A 3H2SA 5DBIA 3GMSA 4KWHA 4E0BA 4WPGA 5BNTA 2VZ0A 2LDBA 1WDKA 4NHEA 4BO3A 3RFTA 5A1TA 4F6LA 4II2A 4CQMD 2FN7A 3NDRA 3AI2A 4WE3A 4WNIA 1KEWA 3VPSA 1OFGA 4CM7A 4WOKA 3NT5A 2YZ7A 1PGOA 5FF9A 5KVSA 1P0FA 4XD2A 3ZNQA 3QQPA 1O9BA 4J3FA 4BO1A 3P7MA 5DCYA 5ILOA 2AQIA 2Q49A 4DLBA 1LA2A 5THKA 2FRDA 3W4IA 4MVJP 3TN7A 3BTOA 1NASA 2VHYA 3WSVA 4CLEA 5A5EA 4LRSB 2R00C 2D59A 1EK5A 3NDJA 5JMWA 1KEPA 3GN2A 3E5RA 2Y1FA 4NMHA 5CDUA 1ZBQA 4GAEA 4YA6A 1ZXLA 1B26A 1O5IA 3GVXA 2G1UA 2PNFA 3PJEA 4BIIA 1SOVA 1KOLA 3KETA 1HZJA 3S8MA 3AM4A 3JD2A 5K9ZA 1GEEA 2X22A 4NQZA 2Q46A 1NPYA 4ND2A 3D7LA 6ADHA 1A7KA 3PHIA 1O6ZA 5A05A 3K73O 3L6OO 2CUKA 1IZ0A 2DPHA 3WMXA 4LISA 3TZCA 3UCEA 3WGGA 3IQDB 3KOUA 4BO4A 1NX6A 4J0FA 3WLEA 3GGGA 1KBZA 3RWBA 2DFVA 3UAGA 4PLZA 1DFHA 4FD3A 4UEJA 1WP4A 1NXQA 4IQ0A 3VPGA 1D4FA 3U9LA 1ISIA 1RYEA 2P9GA 3GG2A 4YACA 3HHPA 4MVJI 1U4SA 1KVQA 2P2SA 3JQGA 1KYQA 3KVOA 4GWGA 2YHIA 4S3MA 3WICA 3BYZA 3QP9A 4PN3A 3K96A 2FMUA 2EP5A 2O3UA 2W4QA 4MJLA 1R4NB 3F1LA 3O38A 1LRKA 1TXGA 4TROA 3OFSA 3S1LA 4B4WA 4TWRA 3BMNB 2EWMA 2X0NA 1R0KA 5HRUA 2FHSA 4PLVA 1F8GA 5TS3A 3RBVA 1PR9A 5LDGA 1LDYA 1MA0A 4MINA 3ROKA 4I9NA 4Q3NA 4E33A 2BFOA 3GLQA 3N74A 2EP7A 3ZWNA 5B37A 4YAJA 4P4LA 3B1KA 3SC6A 4CQLB 1Q7CA 4XR9A 2E82A 3BA1A 3NJ4A 3IIEA 4CMBA 5A4DA 4HFRA 2UUPA 4GSLA 3P2OA 4J1QA 3D0OA 2D8AA 2WM3A 3OHSX 4WASA 3BMNA 4YXFA 1R6DA 2CFCA 7ADHA 4AJ1A 5F1PA 2JFHA 2Z95A 1XKQA 4FPXA 4NU5A 4I9UA 1A7AA 5CG1A 2VOEA 3NX4A 2VHZA 3CMMA 4J6FA 3U0BA 5CEFA 3GQVA 3IJRA 4F46A 3H5NA 4G81A 4QXMA 1YBAA 2P5YA 3NGXA 3KYBA 5JC8A 3SXPA 1IPFA 1N9GB 1ONNA 2W2LA 3DBRB 3AK4A 3QRWA 1EUCA 5T64A 2Y1DA 4IQ8A 2ZQZA 4HP8A 5TGDA 1E7SA 5AXAA 3PVZA 1HDOA 1B15A 3S2GA 1XA0A 5IXYA 3F5SA 4ILKA 5KJCA 4OM8A 4HKTA 4W7HA 2HQ1A 3KSUA 3IC5A 4NH4A 4NPCA 4BS9A 4FB5A 4RORA 1GAEO 1Q0QA 3KV3O 2Y93A 1YQDA 3UVEA 3W8FA 1GV1A 1LLDA 2PFGA 4OQYA 4R1UA 4FOSA 1SEVA 4RVFA 2YUTA 1HLPA 1R12A 2YFHA 4CMEA 5IDWA 3WMWA 2E6UX 2BI8A 1P1JA 5JCJD 1HLDA 1ZNQO 2QYTA 3EAGA 1XHLA 3GHHA 3LC7O 2JAPA 3ICCA 4YB8A 3F3SA 3WBBA 2IE0A 3VZQA 4FN4A 3IP1A 4OMUA 2VOJA 3NJ8A 4TKMA 3JQAB 4L75A 3I4CA 5I8ZA 2WMDA 3RASA 4A26A 1P45A 4TVBA 4WCFC 4DWVA 1EE2A 2HCTA 1WWKA 3L6DA 4U0KA 3UF0A 4UVGA 4UREA 1FXSA 4EEZA 4YWJA 4B3JA 1VC2A 1C1DB 5G2OA 1I3NA 1C0PA 3IS3A 5A9SB 4CL8A 3B1FA 3ETDA 3JQAD 1JA9A 4RCVA 2OP0A 2DU8A 5GZ3A 4WGGA 3DXFA 3DBHB 1GQQA 5F21A 1XU7A 1E3WA 1GADO 1P1IA 3CH6A 3E9QA 4HNGA 3GGOA 4NK4A 4Z0TA 3DBHA 3HFGA 4U5QA 4EBFA 1U2DA 3AOEC 1A4UA 3FRJA 4OJNA 2J5QA 5G0SA 3I6QA 3MJVA 2DC1A 1YL6A 5TF4A 4R9SA 4FC7A 3NV9A 3U4DA 4JJFA 1ENPA 3H9GA 1L1FA 1TVEA 4ZQGA 4INAA 4CM4B 4U8GA 3D4NA 3AFNA 4XKJA 3L9XA 3FPLA 1R66A 3Q2KA 4FFNA 4LVCA 2BRUA 4IDGA 3RU9A 4MO2A 5A9TA 1T2EA 4R4JA 4QFCA 3CINA 3COSA 2VRCD 3WFJA 4MVJG 2PZLA 3AWDA 1EQ2A 3C7DB 4CMHA 7MDHA 1K6IA 1DPGA 3GY0A 1NPTO 1QR6A 2CY0A 1PJCA 3AFMA 1XLTA 3F1KA 1LX6A 1HE2A 1VRWA 4NBRA 3I4FA 4R16A 3VPXA 5J23A 1PJ3A 2G76A 4PLPA 1ADCA 3T4EA 4OXNA 1BVRA 3ROQA 4DXHA 2P9EA 2OXIA 4IXTA 1QRRA 1YS4A 1V8BA 2BH9A 4BNMA 2NU6A 1NVMB 2X9GA 3QVOA 3E6AA 5L51A 3JQCA 4KUEA 3GOHA 2X0RA 5EMHA 4QFDA 1D7OA 1U8XX 4TZKA 4XQEA 1CEQA 2D3TA 3ABIA 3JQDA 3HDQA 1T1RA 2C54A 3DZJA 3U49A 3WGIA 2Y68A 2RHRA 3DTYA 1LNQA 3G1UA 4YTEA 2FPGA 5IFLA 2ET6A 2ZB3A 2AG8A 4HY3A 3L0DA 4RZHA 2JD0A 4CR8A 1HE3A 1QP8A 4L74A 3ZHXA 3ZU5A 4J49A 4R3NA 4J1NA 1YRLA 2GCGA 1NHGA 1T24A 2ZB4A 4IMRA 1UXJA 1E3WB 4ZJUA 4BGEA 5LDHA 4Y6SA 1RYDA 5H83A 2PK3A 3SLGA 2RBEA 4RVDA 1HYEA 4TRRA 3VKUA 3HQ4O 3WLFA 3NTRA 3EZLA 2HU2A 5IDQA 5T6BA 3H2ZA 3DHYA 1E6UA 4PGFA 3O03A 4HXYA 1AXGA 4RLHA 1N2SA 4UULA 2BGKA 2I65A 4FGWA 3SJ7A 1Y8QB 2NACA 1VKNA 2GPTA 3DDNA 1NQOA 4Z9XA 4XRRA 1ZMOA 2OGUA 4AJHA 3PIIA 2FZWA 4RF4A 5AXBA 1HE4A 1P33A 4DYDA 5I9MA 1E6WA 2A4KA 2EERA 4PLHA 3GG9A 4OSPA 1UR5A 3Q9UA 3WQRA 2D4AA 2XAAA 1VSUA 1TI7A 3ST7A 3M1LA 1JDJA 1YDEA 1LDBA 1F14A 1NVGA 3HADA 1T2AA 2VWGA 3ITKA 3OJLA 3ZWYA 4BNLA 2F00A 3BHIA 4CQMA 3LDHA 4Q39A 4YT8A 1WW8A 2C20A 3GVIA 4CLOA 1M76A 4W82A 1MXFA 1PQPA 4E2XA 3QVSA 3O4RA 1J0XO 2O3QA 3V2UA 4PZDA 1QV7A 2ZATA 3OF2A 3MJTA 1NPDA 3TOZA 3OJOA 1E5LA 3NT2A 1T1SA 1CERA 3RKRA 1NFRA 1TEHA 5JS6A 3IAHA 4D45A 4FDAA 3VAZA 3KLPX 1C1XB 3I6IA 4D44A 1GZ3A 2BF7A 1AGNA 3DBLB 4LGVA 3Q0EA 1BSVA 4GPD1 1V0JA 1CRWG 1QMGA 4RDIA 2I66A 3MZ0A 1YQXA 3G79A 2P5UA 3AUUA 4PVCA 1QYWA 3GF4A 4GWKA 4RVHA 2H9IA 1ENYA 1KVTA 1J5PA 2J3JA 3SEFA 3WB9A 3KYDA 4A03A 1AUPA 4BNJA 2GZ3A 4MKXA 3RUEA 5DBFA 1I8TA 1LDNA 3QHAA 2AMFA 4K1LA 3TOXA 3QW2A 2CDCA 2AE1A 2X1HA 3UICA 2Q3EA 1DRVA 5JDIA 3AY3A 2VQ3A 4M55A 1OAAA 5BNIA 1EDZA 4FGSA 4NJMA 2YHIB 1LSUA 4PLGA 3RCBA 4A27A 5KTKA 3QWFA 5A03A 4XJTA 2AQHA 1J4AA 1V3UA 4J7XA 1ISGA 1X1TA 2A92A 1NHWA 4CODB 2NU9A 3JD1A 3RC7A 3GPDG 4B79A 3KHUA 4DPMA 4EUEA 4TRNA 3RBXA 1U5AA 3O26A 3H9EO 2GZ1A 4E3ZA 4PRKA 3DZBA 3NDIA 4E2YA 4BB5A 5CEEA 2DUWA 3PQDA 2DM6A 2ZJ0A 3ZV4A 2H6EA 4BO9A 4BMNA 3ZGYA 1SB9A 4GH5A 4JP3A 1A5ZA 3ZWXA 1PJ2A 2VUUA 1LLQA 1V6AA 3B1JA 4F3YA 4FFRA 4Q3AA 2B4TO 4OKIA 2JHGA 4Y67A 3ZN2A 1GPDG 2Z1NA 4IDAA 3W6UA 3JQ8B 3RI3A 4PCVA 4O6VA 1P9LA 2GZ2A 3TRIA 2YY7A 1MUUA 1RWBA 2VZ9A 1GD1O 4TQGA 3VZRA 5FEUA 3AU8A 1DIGA 3R1IA 2Q45A 1ZKMA 3E5MA 1SC6A 4CM6A 4MVJF 1YL5A 1UUFA 2ZK7A 1DJQA 4FJ0A 3I9OA 4GKVA 2J3HA 4QO7A 2YV2A 2O2SA 3OQBA 4FFPA 4E21A 1U3WA 1B8PA 1R37A 2W2LD 3ZNPA 3F6YA 5TJHA 3CPSA 2PY6A 4GGPA 3GZNB 3PWSA 2JAHA 4HFMA 3V1YA 1Z73A 3BMQB 3PEFA 5AOVA 1BXGB 2XXJA 3PK0A 3I1JA 4L4XA 3OEWA 4KQXA 1PTJA 1CF2O 4FCCA 3EMKA 1BXGA 3IKVA 3MJSA 4L0QA 2VUSA 2NSDA 1MGOA 1YE3A 2NM0A 4MP8A 4NDNE 2QIOA 1EVZA 3HUDA 4X54A 2YHUA 1R0SA 2PZKA 4XYMA 5H82A 2PD6A 4LMPA 5KOIA 4ZN6A 5TC4A 1M2WA 2AA3A 4R1SA 3B70A 4OO3A 3E18A 3VTFA 1N7HA 3LU1A 4JLWA 1YVEI 4ND1A 4CLDA 5L9AA 3MCVA 3D5TA 3ZCXA 5EN4A 1B3BA 2PZJA 1EQUA 5A5FA 4DYVA 4PLCA 4F6CA 3WGOA 1I3MA 3DZGA 1X0VA 1ZEMA 3LVFO 5AQ1A 4E32A 4IDFA 3K5PA 4PG4A 1OBFO 4MVJE 4A10A 5CPFA 4EITA 3UXYA 4TSKA 1TT5A 3CUKA 3RC2A 1WMBA 4AJLA 4F45A 1N9GA 3TF5A 4DLAA 4O5OA 5KJFA 3A9WA 1YJ8A 1TT5B 2PD3A 1B8VA 5L7YA 1MXHA 1LUAA 4Z0PA 1Y8RB 2X5OA 3RU7A 4LK3A 1PJTA 2AE2A 2NTJA 1IUKA 1BDMA 5FI5A 4XYLA 1F0YA 3W4JA 1ZCJA 2NNLD 4XQ9A 1R4NA 2DBQA 3R6DA 4XYBA 2GERA 2WDZA 3B20A 3DAPA 1I10A 3D5QA 3PIDA 3QV1A 1ZK1A 1DC4A 1GU7A 1S6YA 2ZCVA 3F5QA 3R3SA 1XIVA 5DOVA 5T67A 3ZWWA 1D1TA 4J91A 2E4AA 1KIFA 2HK7A 4IPTA 3GC6A 1VSVA 2VTDA 2VWQA 5JMPA 3CEAA 1XCBA 2HAEA 2POQX 5L7TA 1VL6A 2WYUA 4W9NC 4J7CA 3INTA 1Q0LA 1ZK4A 5JE8A 5JY6A 2OFPA 5JXWA 1RM4A 1L7DA 2O2YA 4N7RA 1U4OA 5JBIA 1J49A 2Y0CA 3UCXA 4TRMA 3DO5A 2VYNA 5JAQA 4UVIA 5KIAA 2B0JA 4HBGA 3C7AA 1BHSA 5JDCC 1BW9B 1ID1A 5DN9A 1HDCA 5G4LA 4BV9A 3KUXA 1GR0A 5HTOA 3ZH2A 2ZTUA 1KETA 2BFMA 4AJNA 3ZHYA 1PL7A 1DRUA 3I23A 1XQ6A 4YQYA 1GYPA 2HKIA 5A3VA 1GUFA 4U6SA 3U4HA 3ANNA 3EY4A 3KEQA 1MC4A 2C7VA 1P44A 3BMOA 5I7FA 3VKVA 1K89A 1DBVO 2B4RO 4E2WA 4E5YA 5EQDA 1IZ9A 4I1IA 2AQ8A 1X13A 2EGGA 3OQ1A 2DTEA 2Q99A 3HSKA 2H5LA 3KZVA 4FSHA 5KNLA 5JC1A 2AHRA 4L76A 3ZWPA 4AJPA 5L53A 4RPHA 1YH3A 4N5MA 4J9UE 4R54A 1HEUA 3VH3A 1DOHA 2BI7A 3C3XA 1HETA 1M6HA 3FNHA 1N1GA 2WD7B 5F5LA 1AE1A 5DZSA 4BO7A 2FR1A 3GZNA 4YVFA 4CM9A 4MVJH 2GRAA 3A06A 4YJGB 9LDTA 5HM8A 3KYCA 4DBVO 2IZ1A 4NJOA 1LDMA 1GQYA 4GX0A 3JD4A 3K2EA 1CQJA 1HT0A 4HV4A 3DZKA 4I5DA 2X9NA 3C1TA 1PIWA 4NJMB 3PLRA 4P8RA 2EV9A 2OP1A 2CVZA 2P68A 1XELA 2HJSA 5I7SA 2HLPA 2JFFA 5BT9A 4DVJA 1Z6ZA 3GFBA 2WTBA 5KJ6A 2GN9A 3GK3A 4CV2A 4EUFA 3QWBA 4KMSA 5C3MA 2BLLA 3HJAA 2Q1UA 3CKYA 4R3WA 1VJ0A 1C3VA 1E3JA 1HDXA 2FR8A 3DHEA 4M8SA 2JFGA 4EW6A 4J4HA 1PZGA 1ZJZA 5JY1A 3C85A 4BNFA 1ML3A 1HDZA 4YJFA 4WEQA 2Y66A 4Z9FA 1SZJG 4O1MA 1N8KA 2IODA 1E3SA 1E7QA 1LDGA 1ZK3A 5ES3A 3ZV6A 5IG2A 2DQ4A 1JAXA 5GY7A 1LEHA 4RVGA 1H6AA 4IIVA 1I30A 2C0CA 3JTMA 3ANLA 4R69A 4UEOA 4OXYA 1D1SA 4P4GA 1PZHA 2Z1MA 1XYGA 1MG0A 3TFQA 4PG5A 2I3GA 1PS9A 4CR6A 1ZSNA 5JW6A 1LU9A 1MX3A 2G17A 4FBGA 4O63O 4A73A 4GVXA 1ISJA 4P38A 4CV1A 5TJ9A 3FWZA 5F3RA 5DCWA 1UH5A 4K28A 1EVIA 1EEHA 3GNQA 1LSJA 2GSDA 3CZMA 3K6JA 1HZZA 5EJ2A 2GDZA 4FIZA 4E2ZA 3I3OA 4BHTA 1LXCA 2YV1A 3CE6A 5EL0A 1PJSA 3CTMA 3LT2A 5I8WA 3S2IA 2JKVA 4G65A 3OP4A 2CDBA 5JYDA 4WECA 4JQCA 5GMOA 3GUCA 5KVQA 1P74A 2BGLA 2NTVA 4YJGA 3ZDFA 4DIOA 1ISFA 1PGJA 1CWUA 4CMIB 4KOAA 3GEMA 5GZ6A 1LSOA 3GR6A 2AG5A 1NP3A 3JQAA 3RIHA 3FPCA 1C0LA 4Z6KA 2D2IA 3NT4A 1CDOA 2OORA 5G0WA 4DPLA 2DTDA 4EZBA 3JYLA 3FHLA 4CMCA 2DT5A 5L45A 2IEBA 3D3EA 3NRCA 3PWZA 3AJRA 4NFYA 3MTJA 3ZNNA 4CLRA 5CG2A 1YB1A 4OYRA 1QYCA 3GRKA 4GLOA 4D42A 4WCDA 3T7EA 4J4TA 2DFDA 1EBFA 1PGQA 4BO5A 1GCOA 4DL9A 3JQ8A 4J2OA 2JD2A 4AL4A 5F1OA 3P2YA 1EFKA 1RM3A 4PLYA 1KEUA 3NAQA 4PZEA 2PTGA 4R41A 3RUAA 3AW9A 3ZZNA 1HSOA 3INRA 4IBOA 4BOYA 3NUGA 5C5IA 1U9JA 5U4QA 1U5CA 4MOWA 4YBZA 1W6UA 2I3AA 3UN1A 1F8FA 3QVWA 1CJCA 4E5PA 4YCAA 1PQUA 1K2WA 3VTZA 1QYXA 3QJ5A 3T4XA 5KCZA 1TT7A 3OIFA 4NG5A 3GDGA 1VPDA 5TNXA 1Y5MA 2VNSA 1OMOA 3HN2A 3ONEA 2OHXA 3PHHA 4H16A 3WGYA 4CQMB 3ETEA 4CJXA 1E0DA 2B35A 2Q4EA 2RHCA 3R0IA 3C7CB 2EKPA 2BMAA 1K0UA 5B4TA 3U62A 4RF5A 4XIJA 4YAIA 4ZQEA 2NADA 3QVTA 4IZIA 4NI5A 2HMUA 4DQUA 2C2YA 3P19A 3D3WA 2PZMA 4QSMA 3KSDO 1WZIA 3OICA 5MGBA 4RF3A 3PHGA 5ER9A 5BSHA 2WJPA 4KTVE 3VH1A 4K26A 3O9ZA 5F5NA 3GN1A 5K0ZA 3EGOA 3EVNA 4URFA 4KUHA 1V9LA 3TDKA 3OA0A 2NTNA 1ZK2A 3ZWMA 4GMFA 3PJFA 2I76A 3H3FA 3LC1O 3FTNA 3UGKA 2X5KO 5IAAA 1PS8A 3OJFA 3ASUA 3AUSA 4BKPA 3NYWA 4IUYA 4CLRB 1C14A 4FFOA 3BXXA 5CP8A 4CM1A 5JAMA 3F47A 2JJYA 4OQZA 4BNYA 1JKFA 3EC7A 3JQFA 2NU8A 4CMAA 2DLDA 1ISHA 3LC2O 1EVYA 4XIYA 2FR0A 1PQWA 3AM3A 1KVUA 1R0LA 1NQAO 3JSAA 4NBWA 1JTVA 1QLHA 4ZRMA 5KVCA 2XOXA 2Y05A 3ASVA 4WLEA 2D1YA 8LDHA 4E12A 3QIVA 1I36A 4ZQHA 1Z7EA 2VNAA 2HRBA 4I5EA 2Z5LA 1QYVA 3JQGB 4KDEA 1XR3A 2C82A 4KQWA 5GZ1A 1PJBA 5JAIA 3TPCA 4CR7A 4I5GA 4A7PA 3NTQA 4ESOA 2VTEA 3FBTA 2VWPA 1O95A 1T4DA 2FZEA 3L9WA 1PWZA 4CUZA 2X0IA 3JYOA 2GUGA 3GA0A 3TJRA 3WNVA 4Y6RA 4BKUA 3H5RA 2DTXA 2WEKA 3W8EA 3GEDA 5L4NA 2JL1A 2PKQP 3PGJA 1FDTA 3DHNA 2J6IA 3U3XA 8ADHA 4RO0A 4OXKA 4GL4A 1IULA 1HF3A 2OL4A 2GD1O 2QRKA 4IGEA 1SO8A 2E37A 4YJDA 4MIYA 1EFLA 1UZMA 5LC1A 5IN5A 3OEYA 4JJIA 3RFVA 4GGOA 2B4QA 2CF6A 4Z9YA 3BZUA 5L4SA 3I9KA 4ID9A 2IZ0A 2R6JA 4AFNA 5KWEA 1PR3A 4MP6A 3FCOA 2V6BA 5I9NA 1X7DA 2Q2WA 3KYDB 1EK6A 1BMDA 4FS3A 3C24A 5KKAA 2GYYA 3DMTA 1JU9A 3FR7A 4DPKA 4R01A 3VVCA 2EEZA 3BMCB 5CHEA 1M6WA 2YJZA 5KVVA 2PGLA 2V6MA 1QKIA 2PLAA 3HDJA 4GMGA 4YJFB 1IOLA 4GX2A 5T57A 4ZD6A 3DMYA 2QHXA 4EJ6A 1ZMTA 1I5RA 3H4VA 4E30A 3CIFA 2PH3A 3GRPA 3AUAA 3U4IA 3LZ6A 4ND5A 1ZUD1 3LF2A 4AG3A 4XYEA 4PG8A 4N5LA 1M66A 2EIHA 3L77A 1ONPA 1YDWA 1ZH8A 5FI3A 3GAZA 3T7CA 4DRYA 3MJCA 2X0JA 5EINA 3LLSA 5BSFA 1WDLA 3ZWAA 2E49A 4XB1A 3Q3CA 2NVUB 5T5QA 5IDXA 4YJHA 5EIOA 2RIRA 3WSWA 3KM0A 3I9LA 1C0IA 2Q2QA 5TX7A 2ZTVA 3ETGA 2HMSA 3WGZA 4E6PA 4PG7A 4R1TA 1YXMA 4O59O 1X7HA 4RPLA 3WGHA 5JDIC 1F12A 3DR3A 3Q6IA 2X86A 3ROMA 1BTOA 4IGFA 1Y7TA 4EJMA 3E9NA 1F06A 3GT0A 1X1EA 4BMVA 1NR7A 1ULSA 4UUNA 3DFZA 4BKOA 3INGA 2HK8A 5EERA 4XX0A 3TFOA 2PGDA 1DC5A 2UAGA 3DOJA 3OA2A 4FC6A 3WTCA 5CAEA 2H63A 2CF5A 3JD0A 4N5NA 1E3EA 2CDAA 2NVWA 2EJVA 1IHXA 3FBGA 3F4BA 1JVBA 1B14A 1V3VA 3ZHBA 3MTGA 1TLTA 2JHFA 4Q3BA 3SVTA 3AOEA 3AUTA 4JCOA 1WPQA 2UVDA 4RPGA 3FD8A 4E13A 3G0OA 2SCUA 4BO6A 4NNJA 1WLYA 1I2ZA 3DONA 3EYWA 4Q3CA 1H6DA 2ZKLA 1I32A 2GN4A 1OC2A 1XDWA 4I5FA 4XGNA 3D3WB 4GLLA 4QO8A 3FNGA 4FOOA 4OOEA 3GDOA 1P77A 1MC5A 3QLJA 2YQ5A 1HDRA 1LQTA 3V8BA 4FJ2A 3SC4A 1EE9A 2J5RA 5DOZA 4HFJA 4OKNA 5COBA 1E6EA 1H6CA 3UHAA 3ULKA 3IOYA 1D3AA 4BV8A 1KERA 2PKRA 3FI9A 3IMFA 4B3IA 3BHJA 1PU2A 4R1NA 2NVBA 3EK2A 1VE9A 3K8ZA 1BG6A 2HK9A 1AN9A 1FDWA 1JWBB 3BMQA 2W2KA 4OAQA 4E4YA 2QX7A 3WFIA 4YAEA 2TMDA 4IS2A 4WK6A 4ALKA 4XWYA 1LTHR 2LDXA 1GTMA 1BDBA 3TL2A 1U1IA 2CSUA 1YBMA 3HE3A 3M2TA 4IZHA 3ZWVA 1H93A 1C0KA 1DIRA 3E48A 4W9NA 1EUDA 1M67A 4Y9DA 1G6KA 3PQFA 3JQFC 3I83A 1PSDA 4PFJA 1UXGA 4BO0A 1VI2A 2IXAA 3B6ZA 1TA4A 4DIFA 2PH5A 2EG9A 2X7HA 2VHWA 2QRJA 5HWSA 2YYYA 1UXKA 2DVMA 4ALNA 1YBVA 5TLSA 6LDHA 1GEGA 3W4KA 2Q1WA 2C07A 2O7SA 1C1DA 3VHRA 5I9LA 1BVUA 2FSSA 3OH8A 1LDEA 4CM8A 2A94A 4RPKA 1DSSG 4WCFB 3DTTA 2I5PO 4O0LA 3W8DA 3NTOA 1XSEA 3D4OA 3Q1LA 4J9VA 4BNZA 1E7YA 1U28A 3BHMA 3L07A 1WXDA 4WLOA 4R5MA 2HMTA 3BTVA 2FY8A 4BB6A 3G49A 3PXXA 1YOVB 1ZFNA 3BTUA 3C1OA 3IDSA 4CM5A 1JAYA 4S1VA 5JO0A 5KKCA 2Q1TA 1HRDA 1DDOA 1AHIA 1T26A 1VJ1A 5G0UA 4PZCA 3X2EA 4IJWA 1KS9A 3VDRA 4RV9A 4IMPA 2VN8A 5CPBA 4OH1A 3GZ4A 3AM5A 3D1LA 4LCEA 2O3SA 4TMFA 4YR9A 3FNFA 2QRLA 1HDYA 2QQ5A 3NEPX 4NZ9A 3UH1A 4AJEA 1SEPA 2BHLA 1PJQA 4XZ3A 3M2PA 3DBRA 1GCUA 4IQGA 4DQXA 1JQBA 4H7PA 4XQCA 5DNAA 2PA3A 1K3TA 3UFXA 1IE3A 4ZQFA 2DBVO 3TZKA 2BELA 3H3JA 2TMGA 2OBYA 1PJLA 1F17A 2G82A 4ZQBA 5JSFA 1P3DA 4JJGA 1T2FA 4L4RA 2XPCA 1Y6JA 3LF1A 2GN6A 5I7VA 1ZK0A 5TIIA 4CMGA 4ZHSA 2W98A 2H1SA 4JGBA 3DZHA 1T2CA 4OGWA 2VYVD 1S7CA 3ONFA 3UUWA 1VJTA 1H6BA 4OL9A 4UEKA 1O94A 1W8DA 1N92A 3PP8A 4AJKA 3KEOA 4RL6A 1B16A 4RVUA 1NWHA 4TRJA 3FTPA 4IJKA 3ZW8A 1OZAA 4MVJM 2HMVA 1B7GO 3O8QA 3RSHA 4GKBA 1DIBA 1K5HA 4KP7A 4YAKA 4BNXA 1GFSA 4Y6PA 5BNFA 3C8MA 3DBVO 1BRMA 4EEXA 3ADOA 1UJMA 3GHYA 1EZ4A 3HN7A 1JN0A 4BNVA 3EVTA 4YJHB 1DHRA 1ZSYA 3LLVA 4XDYA 5TSDA 2V65A 1B3RA 3DQPA 4HX5A 4JBGA 1V3TA 2WD7A 1UDAA 2C59A 4CMJA 1T2DA 4DA9A 2JCYA 4QUKA 3DWFA 2DUUA 4NU6A 5CDTA 4AICA 3JV7A 3EUWA 1QXSA 4LVUA 4UVHA 4C7JA 4U0JA 4UVDA 2EW8A 2WYWA 2CZCA 1A9ZA 1DFGA 2NQTA 3V2GA 2HRZA 5IJZA 1Y9EA 3WR5A 5IN4A 4A2CA 4AJJA 1FDVA 3WIEA 4RZIA 4XGIA 1MB4A 4DBZA 1QSGA 5CDGA 2VHVA 2B5WA 5HBRA 2ZB7A 1LBEA 1DJNA 1YL7A 5BSEA 1W4ZA 4EGFA 2ZJ1A 1KVSA 4FFLA 1LQUA 5L3ZA 4EI2A 2JCXA 4DC1A 2RAFA 4OIMA 4RF2A 4YRDA 1PZFA 2WWRA 3G1TA 5DT9A 4CMEC 3GVHA 5JNLA 1LC3A 3RJ9A 2EKQA 2X6TA 1O8CA 1YKFA 3PWKA 4CMKA 5C7OO 3AY7A 3RUFA 3GDFA 1YWGO 2DBZA 4CM3A 4M1QA 1YJQA 3NGLA 4N18A 5HS4A 4PLWA 1UAYA 4D0RA 3JCZA 1E1KA 5KJEA 4BGVA 3UOGA 2V7PA 2DPGA 1B8UA 4KTTE 4QX6A 1WVGA 4M49A 4CLXA 2FPIA 4BNKA 1X15A 1ZSVA 3KB6A 1P1KA 3MWDB 2OUIA 2YV3A 3D4PA 3OIDA 3PYMA 4OOFA 4M87A 2ZYGA 5ITWA 2AEJA 4ALIA 1I01A 4M54A 2BGMA 3GPIA 5THQA 4PVDA 3W1VA 1Y5RA 1BGVA 5MDHA 1E7RA 4J90A 1Y8QA 2B69A 4CPDA 3GFGA 1LRJA 1U7TA 5IZ4A 2EHDA 1N5DA 1KEVA 1UDBA 3DMTC 3S2EA 2Y1EA 4NFSA 4B7UA 5JO9A 1GL3A 2Q4BA 4QT0A 1JLLA 5TT0A 3UCFA 1D8AA 1NBOA 3WWYA 2IYPA 1PS0A 2XXBA 1OOEA 3DAGA 1HDGO 2XF8A 4M89A 1DIAA 3MOIA 4UUMA 2C29D 3DOCA 3GNTA 4ZRNA 5CDYA 5AXDA 5DDIP 4DQVA 4D3SA 1E1NA 3AI1A 3DZIA 2PV7A 2ZYAA 5BSGA 4E31A 1ORRA 4D46A 1I3KA 4JP2A 5EESA 1O89A 1P0CA 2VYND 4M86A 4RGBA 1HTBA 1E5QA 2W8ZA 1H0KA 3I9MA 4CM4A 3RROA 4B3HA 1W73A 1ZXBA 3H65A 2ZTMA 4MIOA 4AJ2A 2OZPA 4IS3A 4XQGA 3WXBA 4GX1A 3ADPA 3WS7A 2W2KB 3AOGA 1ZW1A 2O48X 3ON5A 3QWHA 3RVDA 1SBYA 4DUPA 3I5MA 4D0SA 1L7EA 2PGJA 3GVCA 4BGIA 1FDSA 2G5CA 4IDEA 3QSGA 1H94A 2WE8A 3HDHA 1NR1A 2NVUA 1DHTA 4DIBA 3UW3A 1ZIDA 1DO8A 2HUNA 3JQ6A 2QG4A 4U6QA 2I9PA 4C7KA 4XCVA 2YDXA 1XEAA 2QYSA 1Y81A 3M6IA 1FJHA 4DGSA 5ITVA 2P9CA 2UUOA 3GAFA 3PYLA 4W7IA 3L4SO 3KXDA 1U7HA 3FSRA 1RM5A 4J1TA 1NQ5A 3WQQA 5JCXA 2Y0EA 2ZCUA 2F1KA 3F9IA 4CL3A 2YW9A 4IJVA 4B7XA 1XG5A 3ENNA 4AJOA 1E77A 2EXXA 2VCYA 2AW5A 4J2HA 3ZWBA 4L73A 2D5CA 1LC0A 4YT2A 1YOVA 2ZYDA 1DB3A 1ISMA 4QEDA 4YDRA 1ONOA 4R68A 3JQ9A 4NK5A 4WLFA 2Q1SA 3BMOB 4FQ8A 2AEFA 1EUZA 1T25A 4IDBA 4U7WA 3ZHZA 3ITDA 3PYXA 4BMSA 2YQ4A 1NAHA 4XEHA 5JCJA 5CDSA 1E3IA 3HB4X 4YYZA 3ROPA 4TZTA 3TNLA 4ITUA 3Q9NA 4RPJA 1DC3A 4JN6B 4UVEA 3TWOA 4PLTA 4WJZA 3IKTA 1SPXA 4CLHA 2V6GA 1YGYA 5G4KA 3JQBC 5IXSA 2QZZA 4IXWA 3WQSB 2X9VA 3E8XA 3M1AA 1JKJA 3MJ4A 4P22A 4PLFA 1UDCA 4RDHA 3X2FA 1RM0A 1GYQA 2VUTA 1LSSA 3E1KA 1H2HA 2BFAA 5A9SA 9LDBA 4IINA 5ER6A 4WLUA 3ZNOA 1HYHA 1JWAB 1BW9A 2EJWA 3VDQA 3CZRA 4JXKA 2EGHA 1I33A 3SLKA 1SB8A 2Y1CA 1A72A 4RLSA 1QLJA 3P5SA 3IL2A 3RD5A 5C7IO 5CFZA 3K31A 4HUJA 2RCYA 2VRCA 5IZCA 3DC2A 4J4BA 2R2GA 3PZBA 1P1FA 1QV6A 1NVTA 2R00A 1V35A 1SOWA 4CUJA 3A4VA 3H9JA 3BIOA 3PLNA 3RJ5A 3OECA 3L4BC 1H2BA 1HKUA 1GDHA 3E03A 1Z75A 2W90A 1WAMA 4CV3A 4DREA 2D0IA 4EDFA 1UP6A 5AXCA 3DZFA 5FYDA 4TVOA 1QG6A 1YB4A 5F1KA 1T4BA 3FNEA 3WG9A 4ALMA 1GY8A 2NLOA 5L7WA 5U9CA 3QY9A 3RC9A 2B5VA 3RQSA 1FK8A 4ONEA 4B7CA 3LT4A 3N7UA 3PFFA 5TQVA 1E1LA 3L4BA 2WSBA 3VZSA 3TZ6A 3VH2A 3RUHA 3SJUA 4KDFA 3R3JA 3CMCO 1KVRA 2E48A 1X14A 2GF2A 2YDYA 1IPEA 3WIDA 4WCFA 2O23A 4NBUA 4GBJA 3GUYA 4K9DA 3ZU2A 5COAA 3OM9A 4IY1A 1UXIA 1IHYA 4BNGA 1ENZA 1E92A 3PDJA 2GGSA 4E5NA 4EJ0A 4Q3DA 3S2FA 2NV6A 3E9MA 1KC1A 2FOIA 3DAFA 2WE7A 1B2LA 2V6FA 4W99A 4EYEA 2NQ8A 1E3LA 4BO8A 3WJAA 2DAPA 4B8WA 1RKXA 3DOOA 2Y1GA 4CUKA 1I24A 2ZB8A 2O4CA 3GNSA 3ICPA 3PPIA 2NU7A 3RC1A 3WGTA 1DLJA 4NBVA 2G0TA 4CM9D 1XWFA 5JLAA 1PEDA 4NBTA 4PG6A 2D5AA 3STHA 2VT2A 5K6AC 4FFMA 3FR8A 2FPPA 4I9HA 3PHJA 5KJ1A 1DAOA 2HMWA 4UAGA 4D7AA 2BD0A 1O0SA 4Q9NA 4Z0HO 3ZW9A 1I0ZA 1P31A 3IJPA 4CLOB 1XQ1A 4QTZA 3RKUA 3ZV5A 3EHEA 2O3TA 4JBIA 3WDSA 4XB2A 4H3VA 1IY8A 5ILGA 1GZ4A 1IL0A 4R5HA 1Q7GA 4BNUA 4WLNA 2QZ9A 1KY5A 4XGKA 4RQTA 1U8FO 2FSVA 3VPFA 2EF1A 1ZVMA 1EBUA 2RH4A 1Q0HA 5DBGA 4WLVA 3OMLA 1TB4A 3ZU4A 4R9RA 3JQEA 3PI7A 3MOGA 2J3IA 3DBLA 4Q3EA 3RAJA 4B4UA 4ZGWA 1E1MA 5CEJA 3IP3A 3JYQA 3VPHA 3V5NA 4B4OA 3AI3A 4TKLA 4BQRA 4YRAA 3SX2A 4DMLA 4GVLA 2UYYA 5TT1A 1EMDA 3W6ZA 5H81A 4BVAA 4R51A 4IIUA 4XR4A 1VLLA 4GQAA 3EDMA 4KWIA 2GLXA 3VZPA 4J1SA 1VL0A 5ENVA 1DEHA 5BQFA 4MKRA 1X7GA 1PGPA 1UZLA 2IEDA 3MJEA 3PTZA 1OI7A 4JX8A 5AYVA 4A5OA 5A02A 3WJ7A 1N1EA 3FF4A 1XU9A 1H5QA 3KO8A 1IB6A 1NNUA 1NWCA 3PJDA 4DC0A 2PD4A 1CETA 2ZIZA 3IUPA 4BUCA 1UP4A 3UKOA 1HXHA 4RJTA 1EVJA 1UAGA 3MEQA 4QQRA 5JFOA 1GYRA 5ICMA 2AXQA 3PJGA 5I7EA 3IUSA 3MWEB 5TRTA 1FMCA 2GNAA 4K6CA 1Q1NA 1KY4A 3HFSA 3U5TA 2PR2A 3H5AA 4L4SA 4WNCA 4ALJA 3VOSA 3DFUA 4K6FA 1U3TA 3GH3A 1Z74A 2IRWA 2VT3A 3EW7A 3JQBA 4B4VA 2DKNA 4BNTA 5JDCA 1JKIA 2Q2VA 2X8LA 4IDCA 4ROSA 1R16A 4HNHA 2Y67A 3OJ0A 3LK7A 4H15A 2O3JA 4L8VA 4MIEA 3RUDA 3U4CA 2GO1A 3JYPA 4LN1A 1GQ2A 3AY6A 3FN4A 4JIGA 4D43A 3JQ7B 2IZZA 4JK3A 4MVJA 2UDPA 1A9YA 1Z82A 4WOJA 3VH4A 3O8QB 4AVYA 1G0NA 4BNWA 3HDYA 1GV0A 1EDOA 3LSYA 4YQZA 3LT1A 1Z45A 4BKQA 2AQKA 1W0CA 3I9NA 1MP0A 3OJEA 4LSMA 1I2BA 4EUHA 3GGPA 3KSZO 3NKLA 5DF1A 5IZCC 3TQHA 5G4KB 4YPOA 1VKOA 3WNQA 1QYDA 5T8KC 4AJ4A 4BNHA 1MLDA 3WYBA 3K9QO 4C4OA 4LRTB 3OBBA 4YT4A 1J6UA 2OMEA 5HA5A 3WOHA 2C7GA 5A3JA 3Q2IA 5G0TA 4OHUA 1GUYA 2IDZA 4J0EA 1MFZA 3WTBA 1ZJYA 4G2NA 2HDHA 1H9AA 1RJWA 2O7QA 3PRJA 5DP2A 4ZU3A 5COQA 3HG7A 4FJ1A 4Z3KA 3WYCA 3V1TC 4J43A 3V2HA 3QWIA 1A4IA 2YFQA 2JCVA 4BNNA 5BR7A 1PL6A 4YAGA 4XJSA 3H9UA 5B1YA 3ONDA 3ENKA 3ZI0A 3H7AA 2GN8A 4MDHA 4E5KA 1Y9AA 2IXBA 2HJRA 4GI2A 3AU9A 2BKAA 4OSOA 2DBRA 3ANMA 1WMAA 1H9BA 2UV8A 2QW8A 1E7MA 1R4MB 3RUIA 2PKQO 3ORFA 4ZICA 2AEMA 5DP1A 4JNKA 4ZVVA 5C37A 1VM6A 3EZYA 2Y99A 2CVOA 3TZQA 1A27A 1GPJA 2PWZA 1MV8A 2EKLA 3TZHA 2I99A 5B12A 4B8ZA 1C1XA 4LCJA 1BXKA 5JYEA 1LRLA 2P4QA 3OSUA 3WBFA 4PRLA 2Y1OA 1NAIA 4XDZA 4Y98A 3BAZA 4CV0A 1ZZEA 1PWXA 1DXYA 1R15A 4LW8A 4D79A 1UP7A 1QORA 2A35A 3DL2A 5T8KA 3PZRA 1OC4A 4WKGA 4BL5A 1RPNA 3V1UA 2O3RA 4JBHA 4N54A 3HB5X 2O4UX 2NUAA 4J16A 1NQTA 4LSWA 1DAPA 1UXHA 5A06A 2O50A 2VHXA 4IDDA 4ND4A 4A0SA 1ZO8A 2VRBA 3KTDA 3I52A 4CQLA 2NWQA 1WDMA 3PQEA 1P1HA 3KYCB 5EPOA 1G0OA 1DRWA 1YB5A 3GEGA 2C5AA 3L6EA 1LLCA 3QVXA 3CXRA 1YQGA 5L4LA 2GASA 4UUOA 4D3FA 2CNBA 2I67A 1MG5A 5L40A 1U2GA 2ILTA 1FF9A 4NR0A 5FFFA 4W4TA 2B83A 2JD1A 1SAYA 2X4GA 1CIVA 3LT0A 3I9JA 1NFFA 1P1RA 4DLLA 4FW8A 2CVQA 1YONA 1UZNA 4G5HA 4P4NA 3ZWOA 2FWMX 4E5MA 3A28A 1SMKA 3JYNA 1WNTA 4W6ZA 4BKRA 3U09A 4NIMA 1DC6A 1LJ8A 4JROA 5A04A 1Z7BA 3A14A 3G3EA 2BFPA 3LQFA 5JPIA 4HWKA 3HWRA 1PJ4A 4BGUA 4J7UA 4ND3A 4HFNA 3A1NA 4DMMA 3K92A 5A9RA 1ADBA 3PHLA 4L9RA 4MP3A 1NYTA 2ZTLA 1HYGA 4DTIA 1R4MA 1ZEJA 1PZEA 1ADFA 4Z3DA 2P91A 1SNYA 3HNPA 3N58A 4RQUA 4D41A 3PGXA 4WUVA 3JQ9C 1Y8RA 4UUPA 1HE5A 2B37A 3K2BA 3OETA 2VWHA 1JW9B 2HO5A 3QE3A 2J3KA 3HZZA 1B0AA 1DLIA 2CD9A 1XGKA 2J5KA 3PFWO 3GVPA 3RFXA 1A71A 2VZ8A 3TSCA 4ALLA 5DCUA 3FWNA 3DEYX 4Y8VA 1DIHA 1YO6A 4QECA 3QA9A 3K30A 5IF3A 2FP4A 5EQFA 3E82A 4I08A 2I6TA 2X58A 5U1PA 3C1AA 4D3DA 5IDYA 4II3A 3OIGA 3ZWCA 1U3VA 4IJUA 1PL8A 4CMIA 3DB2A 1GUZA 4ZA2A 2VYVA 2Q50A 5DULA 4FR5A 5C7LO 5FWNA 3ZV3A 1NM5A 2B36A 4XA8A 4BO2A 1HSZA 2OBNA 2OOSA 4MVJD 1I3LA 5AVOA 1IYZA 1M75A 4WEOA 1CQIA 2Y0DA 3QWAA 3GMDA 1GZ6A 1MFPA 3LYLA 1PX0A 4GX5A 4LMRA 1AHHA 1KC3A 3VC7A 5ICSA 2C2XA 1NFQA 3KLMX 3WYEA 4MPDA 1I2CA 1DFIA 4RVSA 1K6XA 1HL3A 5G0VA 2CMDA 1U3UA 2J8ZA 4I8XA 1SCUA 3VVBA 1N7GA 1ARZA 1VL8A 3OQ6A 1WZEA 1LI4A 1Q2XA 4XRGA 1NTOA 5LCXA 2ZQYA 1CYDA 1ENOA 1LLUA 3BMCA 4BNIA 5B4UA 3ZU3A 2IYOA 5L95A 1JVSA 1HWYA 1K6JA 2GR9A 2HSDA 3S55A 5K6AA 4GSKA 4YEDA 3JQ7A 5ENDA 4NFHA 5B4VA 3JD3A 1G1AA 2X5JO 5ADHA 5HS6A 3TL3A 3F46A 2WYVA 3D64A 1AXEA 4CM8B 3WX0A 2C5EA 3SBOA 1ULUA 4HADA 3H8VA 1PGNA 3KRTA 2X23A 3F4LA 4XYGA 4BQPA 5JAZA 4YT5A 4KUGA 3RUCA 1Q7BA 1BWSA 3KBOA 2P4HX 4IM7A 3BTSA 3G17A 2EW2A 1BXZA 2WD8A 3Q11A 4MKZA 4AJIA 3CSDA 4YRBA 3H6KA 3WWZA 3WGQA 1ADGA
chains in the Genus database with same CATH superfamily
2NV0A 3MJDA 2FUG1 3H9QA 4OA5A 1P6QA 1U2PA 4C0SA 4ABTA 1ETHA 1OAOA 2P75A 2WV9A 1X0XA 4H1WA 1HQKA 4NONA 4N6NA 2B5OA 1V16A 1AQUA 2GOYA 2BCGY 1H0HA 1RWXA 1UJCA 1Z35A 3LUHA 2VP9A 3PX3A 4N49A 5ESDA 2IWRA 5A5VA 2Y0PA 1PW7A 6REQA 3TIIA 3AW8A 1N5RA 5HCIA 4NHEA 3GGSA 4JBWA 4LDJA 4LWZA 4D6PA 3OEEA 5A1TA 5BSUA 5IABA 3O8DA 1U7UA 2IVZA 3AI2A 3NVAA 1P7VA 2CXHA 3I0NA 4WE3A 2P6OA 1XD2B 1K8YB 2QA5A 2YY5A 4WNIA 3RRZA 3UV7A 5KWSA 4RFLA 4HQ0A 2BMEA 3PUIA 2G06A 1IIRA 1PGOA 3KKZA 3U17A 1UPUA 3G50A 3M83A 2LXNA 1IHDA 1QFZA 2Z08A 3FTQA 2HWYA 3ZVKA 1O9BA 4FDTA 5K3EA 3B85A 4BO1A 1WUYA 5ILOA 5AHKA 2ZZMA 4R31A 1F5SA 2CZGA 4WCVA 4Q5SF 1FXWA 4HDRA 3GRAA 3LHDA 4YDSA 2XL4A 4X0RA 3M4YA 1MPTA 3W4IA 1S2NA 1NASA 1X80A 1W0KA 4H7DA 2ACKA 4KE9A 4LRSB 2HB6A 2IPOA 4EGCB 2D59A 1W35A 3NDJA 3AHFA 5JMWA 3K0FA 4KBFA 5K05A 2EL7A 3W79A 3E5RA 2Y1FA 3CZ5A 4NMHA 2J33A 2Q3CA 4URHA 5TEVA 4YUXA 1MW9X 1C7QA 3GD5A 3GVXA 2DY0A 2G1UA 2OKGA 4M7OA 4BIIA 4I44A 4JY7A 1KOLA 1O94C 1G3RA 2HSQA 1OVMA 3AM4A 2JLZA 1JILA 2AOWA 4H6XA 4IOJA 1GITA 1NBBA 4MW9A 3DOEA 4EW1A 2WTMA 2I7CA 1S8FA 4ND2A 3VHXA 3V1NA 3WLPA 4CKBA 5CXXA 4EY7A 1V2HE 4TUYA 3E8MA 4L4YA 1ZUNB 2WHEA 3SR4A 3IQDB 3KOUA 3UCEA 2A9VA 1IW7F 2BGRA 4KGDA 4BZZA 1Q0TA 3EEYA 3DGEC 1YYXA 3WLEA 4C20A 1QU2A 3RWBA 4Q9KA 2DFVA 4IIJA 4KCGA 1JLSA 4HVLA 5MFPA 1NXQA 1QKJA 1ISIA 5HVNA 3GG2A 1YR2A 2IHVA 3PQCA 4S1TA 1BOFA 2ZUUA 3O82A 1P5ZB 3I37X 3TX6A 4MVJI 1U4SA 4HAYA 1KYQA 2I1LA 2QE7A 2YHIA 3HB9A 2F8SA 2WHQA 4H4EA 3WICA 3PHCA 4S0ZA 4YL1A 4P3YA 4UFOA 3N24A 2BMWA 5REQB 2EP5A 2O3UA 4MJLA 1A4XA 1R4NB 2RI0A 3NI2A 1TXGA 4TROA 5DGTA 3T12A 1E1CB 4TTPA 1Q0GA 1W59A 2EWMA 1EGMB 2FHSA 4K9QA 4PQEA 5J47A 1REQA 2VAMA 2QUIA 4QI2A 4ESEA 2BISA 1GNVA 5D3ZA 5TS3A 4DLRA 2EBWA 2VDRB 2H48A 5LMNB 1BEZA 1NM5C 3A9SA 2UXBB 3RIMA 3ZBUA 4EA6A 3IQXA 4TMZA 3DG9A 2REOA 4Q3NA 1ZR2A 2BFOA 1NNSA 1KKMA 1G8GA 2EP7A 2P27A 5FUYA 1Q2UA 4JEIA 5F4ZA 4NCHA 4UHHA 3VR5A 1BGXT 4IAQA 2WUEA 1I2MA 4YRQA 4CQLB 3IJ5A 2CN1A 1XEFA 3HYNA 4XR9A 3BA1A 2A68F 4Q18A 4CMBA 2R7XA 3KVVA 4HFRA 4Q02A 9GPBA 1QG0A 5JEEA 4J1QA 2JGFA 3DKKA 2WM3A 2FLVA 3MTAA 5IC6A 2JBAA 3CYFA 4BY9E 2FZ5A 4YXFA 4IARA 1SA0B 4AYWA 1R6DA 1XXHB 2Q9UA 4FBLA 4KMOA 2NO1A 3O2QB 7ADHA 4F4CA 1NXOA 3TD2A 2RI1A 2Z95A 3AL3A 1ACJA 1Z18A 3L46A 3MCAA 2PUEA 4A4DA 1H42A 2VCAA 3NPAA 2FW8A 2ZR8A 1NJ1A 2HTEA 2VOEA 3NX4A 3FY4A 4R0NA 4IRUA 3U0BA 1Z8DA 3GQVA 4YRZA 1BAPA 5A6BA 3IJRA 5KQRA 2C8JA 1CHDA 3H5NA 3L5KA 2FW1A 1YBAA 3O8BA 4P4SB 3KYBA 4ZCSA 5JC8A 1Z34A 5MFZA 1NLMA 4RUKA 1T6XA 2ZRNA 4CTJA 1BYIA 4MR9B 2Y1DA 3LUFA 4DIKA 3FCUB 4IQ8A 3BGIA 2ZQZA 1AURA 5F28E 1A2OA 1OT3A 1MQAA 4TLDA 5I7OA 2V96A 5AXAA 5K01A 4I1RA 4RKEA 3WLNA 4HX9A 5IT5A 5CD1A 5IXYA 1J90A 1HG0A 4FGJA 2X41A 3AJDA 4JT9A 4GR9A 5BOSB 4W7HA 1HURA 1SBTA 2OE2A 1TVMA 2W2NA 4F8JA 2QGNA 4H0CA 2ID9A 2HRCA 3K71B 5CK4A 3EZXA 3GRYA 2QTCA 3KSRA 3GJQA 5JT1A 3I62A 4GOND 4GPIB 3CFYA 4KSCA 4R1UA 1Q7TA 3CVJA 3K0FB 4NSNA 4RVFA 3UOAB 1QF7A 3M4ZA 5IDWA 3WMWA 4QDZA 1HLDA 1ONSA 1ZNQO 2R8ZA 3GHHA 3LC7O 4JLVA 3ICCA 2BL4A 3VNUA 3C3JA 4O4IA 3F3SA 4TYQA 4XOUA 1I7DA 3HNJA 1K08A 3NJ8A 1CZHA 4LOKA 2UYCA 5I8ZA 5TJ5E 1QOQB 3KQMA 3RASA 3ZC3A 1S96A 3SICE 1J0EA 5BSWA 2P1DA 4R05A 2P8SA 1EE2A 2HCTA 1WWKA 2AI2A 5JIBA 1B2RA 2FAXA 1U8EA 2JX0A 1AEPA 1I7SB 3U60B 1H1TA 2VPWA 2VI5A 3R5XA 2WLSA 2Z5FA 3ETDA 1JA9A 2OK8A 2ZYRA 5K0CA 2OP0A 2RK6A 1K4KA 4X6YA 1G6OA 5CRIA 2OG2A 3QELA 4AD8A 2IYNA 3DXFA 3ISVA 4MEAA 5L0CA 5F21A 5C8VA 3C5VA 4LGYA 3WODF 1E3WA 3FOEC 1DQZA 1FNSA 3E9QA 4HNGA 1UXOA 3L06A 4BASA 3HFGA 1JHRA 4EBFA 1KARA 2MSWA 2PL3A 4G4SO 5E8JA 2EWWA 3QG1A 5CA0B 1A4UA 3C6XA 3FRJA 3SF8B 3L8CA 5EC8A 2YN4A 4F4BA 1NZJA 4BLTA 3LM8A 2H08A 5T6MA 3U4QB 1RKBA 4R9SA 4FC7A 3DLIA 4YMWA 1YULA 2XMCA 3R20A 4JJFA 4HWPA 3NKVA 4YJ2F 1TVEA 3ZY3A 3DSRA 3G8CA 4QOJA 1M6YA 2Z2KA 3TMKA 5LJLA 2XCSB 3KOWA 1VSQA 2FEKA 3D4NA 3PF9A 4NY3A 5T41A 1GXSB 2HOQA 4LVCA 1TD9A 4IDGA 1O96B 1O3YA 4YBRA 3RU9A 1C4XA 1MN6A 4MO2A 1SCUB 1S2MA 3FZYA 1G5PA 2VRCD 4WFKA 3WFJA 5IPFA 1SGWA 2WIFA 3AWDA 4HAZA 1OB2A 4J94A 1NVDA 1RXEA 4ZZ2A 1K6IA 2YLGA 3RVPA 1AGXA 3MWEA 3RB8A 3NALA 4BEMJ 1DNPA 1J97A 3U6KA 4LZPA 1IUNA 1L5ZA 2XRZA 3TQIA 2B82A 5LZ7A 4ZI7F 5J23A 1BDIA 2HU7A 2CYAA 4JI5B 2F8TA 1CY4A 4N0QA 4PLPA 1ZM2A 4W1PA 3QTLA 2NPIA 3HN6A 1FVFA 4LJKA 2JZNA 1OKKD 1CB7A 1BVRA 1C3XA 3ROQA 3ZHSA 2IUSA 3N0TA 2O1XA 1LBHA 2P9EA 3DR5A 4YWHA 1ZX1A 2QSJA 5BQ3A 1TVCA 1XZJA 3ZCSA 4FOPA 3OESA 2XXAA 1I13A 1UBJS 3E9DA 2SECE 4X66B 1BE0A 2CBXA 4FZ5A 2BH9A 1DV1A 2P9JA 3E27A 3QPDA 4JD5A 4LJ6A 4PC2A 4BNMA 4X3PA 5EIFA 1JAIA 1NVMB 2X9GA 3QVOA 3ZDDA 3ZCVA 5L51A 2AVNA 4LHEA 4ES6A 2ZLBA 4XEUA 3GDHA 2RHBA 2QEQA 4KUEA 1TWCA 2R7NA 1CFZA 3MJHA 5DU2A 3I39X 4RIHA 4X65B 5H68A 5CYPA 3U9SA 5HR5A 5JQWA 1JHMA 3U49A 1SRRA 5CVCA 3DTYA 3WGIA 3HKKA 3NETA 3A32A 1Z22A 3OE1A 4KFSA 4P35A 1C50A 2PLNA 3G1UA 5EXEA 4XUCA 4HATA 1AS3A 1U3FA 1P61B 2PWPA 3WP0A 4A2PA 1Y48E 2ZB3A 3L4JA 4O33A 3R5HA 4G25A 4RZHA 4WOPA 4FXOA 1SKAA 1R88A 1XPUA 3RYLA 3C8GD 4KE8A 4L74A 5AKXA 1GO2A 2C1ZA 3S1AB 1M34A 3PCXA 1NHGA 4IMRA 3PQ7A 1UXJA 3VSAA 1V8FA 2GVNA 1D6SA 3O1IC 4M36A 4LF8B 2ZIWB 1BR1A 4L95C 1P17A 4URYR 1X92A 3G9TA 3L8EA 2QJWA 4Y7DA 4EY8A 4ZI3A 1GZ7A 5J2TA 1LGYA 1U1DA 1FMWA 5T3YA 3LESA 2E18A 3GFVA 3SEOA 3PPYA 1OIVA 3R0VA 4RY2A 3ESXA 1JZTA 4EQ6B 3KR1A 1NSYA 3O03A 4OQMA 1EGQA 1AXGA 4RLHA 4UULA 1UFBA 2QRMA 4N3CA 2ICWG 4FGWA 3VO8A 1EUYA 3G2JA 1W0KD 1IDN1 2J45A 3KE8A 4JI1B 1JWLA 4MPTA 1ZMOA 3WMRA 5EMNA 5IAEA 2NZ2A 3DNPA 3MTEA 1W7AA 4DNQA 1CS0A 4QYWA 3GLUA 1HW1A 4KYVA 3AL0C 3FCCA 1JG7A 3A05A 4PLHA 1ZUNA 4KIFA 1KYXA 1YIDA 3HJFA 4I6EA 1QRUA 2BN4A 2V3VA 1EFAA 2IUEA 1JDJA 1F4PA 1M1NB 3LS0A 1YDEA 1AH2A 3ZWYA 4ASUD 1EFUA 4NC3A 2R1VB 2ZJ5A 3BHIA 4H1TA 4MUMA 4AULA 4CLOA 3A26A 1J1UA 1XMXA 1E4OA 1SVKA 5DTIA 2HJ3A 2QUZA 3ROTA 2GWRA 3BJZA 1RHQA 4MO9A 2ECFA 4IIJB 2R7UA 2XUGA 3AB7A 1BX1A 2PMDA 5EZYB 2WMYA 2XD4A 2ADMA 3UTDA 1MRZA 2AN3A 3N9IA 3UYLA 5F9MA 1BMFA 2NG1A 3WLIA 5JSZA 4GI5A 3OA1A 4L6IA 5CT8A 4KRFA 2WC1A 1XQVA 1ZQ9A 1BD3A 3QE2A 3PPXA 2WJZB 1YFZA 3A37A 1EDEA 1C1XB 1W5EA 3WVNA 1C4KA 4DT1A 2OCGA 1C7JA 2P7IA 3CRMA 5KPJA 1AGNA 2CVPA 4RKYA 4QEZA 4Q01A 1U28C 2QRZA 1VCNA 3FPFA 4IH4A 4M8NE 1OXBB 4RDIA 3CUTA 5FPQA 2DUMA 3QMPA 4MV8A 3GX1A 3TPFA 1AQNA 4DV6B 1XNGA 1HPLA 3ABZA 4J8PA 4PAMA 2HL6A 2J8WA 4JVSA 1P4JA 3GF4A 4GWKA 4RA9B 1XD8A 5HQJA 1KVTA 2J3JA 3BILA 4Q66C 1T5SA 3WB9A 1GGNA 3FTFA 2GZ3A 1XXHA 2IIBA 1NRXA 2ZVPX 3KPUA 1FNMA 1TMKA 1XE3A 1Z0SA 2GMWA 1LDNA 3H1BA 2AGVA 3VA7A 5IAJA 3TLMA 3M4BA 2GFHA 4LV6A 2CDCA 5AKHA 2AE1A 2X1HA 2L81A 1SELA 1VE5A 3QLVC 3ZEAA 2Q3EA 4MUHA 2ERXA 3DE2X 5D5PA 1FP7A 4UBMA 2WRZA 5AJWA 3CB2A 1TDJA 1EDZA 4FGSA 3CEHA 4LXYA 1LSUA 2XLVA 5F2OA 1T0IA 3RCBA 3BC1A 4UMEA 5KTKA 5J2UB 2NPFA 1T5DX 2AQHA 1V3UA 1TA0A 3OO1A 1ISGA 2YZGA 3PL5A 1PEAA 1S0UA 1Z47A 3QVKA 3SSAA 1NHWA 2DEUA 1ZD1A 4CODB 2YVLA 3OUUA 3RQFA 3O3NB 2FW6A 5FL7D 3RRNA 4F91B 5KNCH 4LBWA 4JLPA 3TVTA 4I8DA 1TFKB 3NOQA 5HWSA 3U61B 1TD1A 5K0IA 3LKZA 4MRVA 4DPMA 3SQLA 3OUTA 3EXIA 5CNMA 3LNCA 1PYGA 3PGLA 4EUEA 3AO0B 5A5GA 5GM1A 2QV0A 1EVLA 1SRQA 3FFAA 2GI4A 4IF4A 4LX8A 3IEUA 4A0RA 3I09A 2WQ7A 1FSGA 4GM1A 5I47A 3ZEIA 1ID8A 2C2GA 3NHUA 4PRKA 2RHJA 3DZBA 4E2YA 3IOEA 4K86A 1J7KA 1Z7GA 5CEEA 1E2LA 3DD5A 3EWAA 1JI3A 4GGMX 4KAJA 3G0DA 3ZV4A 2H6EA 2W00A 3P9ZA 4BMNA 5FPYA 1YA7O 3ZGYA 3LY8A 3KZXA 4GH5A 1HEYA 3GFTA 4CEIA 1CV2A 2VUUA 3A3OA 1TMYA 1LLQA 3H2BA 4XAQA 1QAQA 5A2QA 4GICA 3UUGA 4CIXA 2H7CA 4ZT6A 1RXYA 1QCYA 1KYIA 2ON6A 4B0OA 3LPNA 1HDIA 2JEOA 4IZ6A 4R7ZA 3W6UA 2QUKA 2YS7A 4GS5A 2IELA 3WB0A 4PCVA 4JEAA 1OHHD 2NSJA 2YMMA 1RWBA 3AFIA 1GD1O 3KOMA 2VZ9A 4TQGA 2GAOA 2WM9B 1DIGA 2Q45A 1JXQA 1SC6A 3UHJA 1YAUO 4CM6A 2CXPA 1M2VB 2IYFA 1DJQA 5FH9A 3I9OA 1YKSA 2YV2A 4LHWA 4CWAA 4JHXA 2H59A 3FOCA 3M49A 2ODBA 1GN8A 1U3WA 5A3SA 3TKAA 2J9BA 1SD5A 1VBKA 2ZRPA 1UJNA 1TJ5A 4KQ6A 1JOGA 4GGPA 5LJIA 2BDTA 3CE9A 1X1RA 4V0SA 4RS3A 2VTBB 5G53C 1Z73A 2HDWA 3PEFA 4BP8A 4KR9A 3GLGB 3DCJA 3MFNA 1ORJA 3M6AA 1A41A 4UBKA 1NQXA 2R8RA 2VXYA 4B17A 3BORA 3OEWA 5ALDA 4KQXA 2F1RA 1CF2O 1U7ZA 2FQ1A 1N3LA 5HHTA 2A0BA 1TZKA 3PDIA 1ZNYA 3P9SA 4BJ3A 2XCRB 4PSVA 2B8NA 4NDNE 2HY7A 2YHUA 4DM4A 5CFQA 2BFEA 2XADA 3CWCA 4ZC8A 3NB0A 4G23A 4LMPA 5KOIA 4ZN6A 2W6CX 4R1SA 2XM0A 1GA6A 4EI8A 5L0FA 4HAOA 2G70A 3CSKA 3EFBA 1U0BB 4N6CA 4CS8C 1FP4B 2X8BA 3KTOA 1YVEI 2HRDA 3C8ZA 3LU1A 3MCUA 2ZI4A 4QVGA 2FSHA 3D5TA 5L9AA 2PUCA 1EQUA 4CDAA 1M74A 3U37A 2W45A 1ADJA 1OV6A 1EKXA 4AN1A 4PLCA 4DYVA 3K6RA 5ISMA 1CUBA 3FZQA 4O1IA 4IRXA 2OXFA 1X0VA 1XTSA 1DI0A 3O8NA 4IH9A 3QXXA 1SXJD 2OAEA 1GIAA 3QUSA 3S40A 3VDXA 4YDQA 2P6RA 2NTYC 4TT3D 3M1YA 5FX2A 1L4FA 2PAAA 4O4JB 3UXYA 4WY5A 4B75A 3VPAA 3SC2B 4TV8F 1TT5A 2B98A 2XZDA 3CUKA 1NXSA 3EZ9A 3F4KA 4EHAA 1G38A 3TF5A 1L5MA 3VKHA 1FNTc 2J9GA 2C2BA 1QWOA 4DV5B 3ED5A 3ZYCA 4RAQA 4B76A 4H17A 4GPZA 3U56A 2NUBA 4BN4A 3BH7A 4DMRA 4Z0PA 1TGVA 4CKZA 1LV8A 5J2TF 3FMFA 3QPCA 2WVQA 4XJXA 1OCRC 2VASA 1VMKA 1BDMA 1TUEA 1DAHA 4GBMA 4DNFA 5KO2A 4CT5A 2DB4A 4YRMA 1ZR4A 2ZREA 3JZMA 4HQKA 3BSYA 4L9AA 1ZCJA 1V55C 4QGBA 3R6LA 4MKIA 4D5EA 5LA6F 3S81A 2WDZA 3B20A 2FMXA 1I10A 3D5QA 8ATCA 3QV1A 1TIBA 1IHPA 2M6RA 2W6IA 2DCMA 5DOVA 3ZWWA 4MWZA 2H7VA 1E79A 1BA3A 5FOTA 3X1JA 5DX8A 4C7VA 2X4IA 3E05A 4HAVA 4IOLA 4URVR 5FZTA 3B82A 3DKIA 3FTDA 4U5FE 3EMDA 3GC6A 3TJMA 1N33B 4JYMA 1UPBA 1H8EA 3AT1A 3HO8A 1BR4A 1ZXXA 1AD2A 2XZTA 4GEGA 2QTNA 2NMVA 2DE0X 1YJBA 4P0PB 2OFOA 3J80A 5EJ6A 3ZVRA 4FESA 2POCA 4LJLA 3INTA 1VCIA 2ZQ5A 1ZK4A 1LPAB 5KSPA 5K6RA 3DCNA 2DPXA 2WPDA 4JLAA 4XIIA 4JUFA 1D0SA 3I1IA 1LPEA 2WWWA 1Z6QA 4JI3B 3DYVA 4AZVA 3RIGA 1FNBA 1K97A 4R6WA 1GP2A 4DMUB 1UZUA 3UJNA 1J49A 3BIFA 2RGRA 4A2NB 2VP4A 4OF4A 3GPLA 2IU3A 3C8HA 2VYNA 3NEYA 4LAFA 2QLAA 3A9VA 3NG1A 4BXOB 1LZKA 1O57A 3W2HA 1VMAA 1GWNA 4X1OA 3B53X 1XL1A 4BFCA 3GLKA 5KIAA 1P91A 3NKEA 2H9AA 2WYIA 3CVXA 3H1EA 3FNRA 2WJYA 2GT1A 1MDBA 1DTEA 1YI0A 1BW9B 4Q7MB 1XRNA 1HDCA 4W8GA 4ZVPA 3KUXA 4GYTA 1E0JA 1GR0A 1QHHB 2I78A 4R7GA 2JLUA 4NCBA 2BFMA 3X1KA 1MKYA 3D2AA 1PL7A 1DRUA 4JQSA 1XQ6A 5E2IA 1GYPA 2HKIA 3ZHYA 4ILEA 4FHGA 4BN0A 4M99A 3U4HA 1P72A 4B3CA 4PX9A 3KTAA 1CIJA 1KI6A 3NGMA 2GTIA 2R25A 1UANA 1HUQA 1YB2A 3EC1A 4MYCA 5K0FA 1A7JA 3LKBA 4J0KA 2AXPA 3OZ7A 3ADBA 2DYKA 4IOMA 3REQA 1TCUA 4OD4A 2R86A 3MGGA 2W4BA 1OAKA 1X13A 3GNLA 4Q7JB 1CBUA 1UBHS 4BV3A 3K5HA 2Q99A 3IRUA 5KNLA 2AMVA 2H5LA 4RSMA 5HZMA 1QJ4A 3N8HA 4LHZA 1NV9A 2PSSA 3BSWA 4OK6A 3JRXA 1NGSA 1YH3A 4P80A 3NWOA 4R54A 3ZXSA 1GPBA 3QXHA 3VH3A 5B6JA 1S3IA 1DOHA 1SN7A 2P9FA 3FNHA 3KKKA 3P0IA 4X8OA 2BWJA 5JG7A 1N1GA 1QONA 2R6FA 3TAXA 3LPCA 4B82A 1A82A 5F5LA 2CE7A 1PAUA 2OAQ1 4BO7A 5JH7F 5DLPA 4CM9A 1GLGA 4I5IA 2GRAA 3A06A 4MVJH 1P62B 3L7CA 4O4HF 4COKA 5AVRA 3DEFA 5JSUA 1EJ6A 1PR6A 2H4FA 4IILA 2C78A 1TUBB 2QJRA 3QX7A 2XDQA 4G0ZA 3CO0S 4DBVO 1OZHA 4KR3A 1YR9A 7MHTA 3DZKA 1UFKA 3L49A 4NJMB 3L2OB 1I51A 2EV9A 2QF7A 3UAXA 5T4EA 1G7SA 2OO7A 1ZIPA 2PO5A 2WVAA 4XASA 1LS1A 1JJFA 3MD9A 1XELA 4C0WA 2VXOA 4R2XA 5I7SA 2Z2JA 3QEMA 5BT9A 2BV3A 5LYJF 4DVJA 4OD0A 2B1QA 4CHTA 4I4TB 4X7PA 1T5IA 5J3JA 2AS0A 3DYIA 4CV2A 1GAJA 1CTQA 1SQFA 3UPDA 4MICA 3CKYA 4BVEA 4OP1A 4R3WA 1C3VA 1EB9A 1HDXA 4MVMA 4PCLA 4RZSA 4M1WA 3EPVA 4EW6A 3WLQA 3ZK9A 1ZJZA 3D8RA 4GYJA 2D1TA 1BDJB 4YJFA 4HMOA 1WA5A 2BE5F 2Y66A 4Q7EA 3M7IA 1JR3A 3H75A 1WU8A 4QQNA 5KQGA 3T5MA 2DQ4A 5IG2A 2G77B 3O1JC 1JAXA 3T6JA 3HTXA 4IDPA 2OV2A 4OI2A 1FFHA 1PDOA 2C0CA 2C9MA 3ANLA 3F7MA 4H35A 5EEHA 1WE2A 4HFKB 1Y42X 3MYIA 1DOWA 1RPJA 2CNWA 3LNMB 1P5RA 3R3VA 3D1VA 4IVNA 4OXYA 1XYGA 3TFQA 1USIA 5AJVB 3V46A 1G5FA 3QBTA 2FP3A 1DRKA 5JW6A 4V0NA 4O63O 3HM9A 3HCCA 1OWOA 4GUAA 4CV1A 1A1VA 2FVXA 2UKDA 5IANA 1YKGA 2ZVJA 5DGDA 3DEIA 4BLRA 3NATA 4WK4B 4N6HA 1KMQA 1RU3A 2FSVC 3MUFA 1M2OA 4X8LA 3MBKA 4HNQA 2Q2NA 2O19A 2FN3A 3KOZA 3CZMA 2GDZA 1E64A 2GYVA 2QM7A 2X4DA 1NJ6A 4QE3A 2YV1A 3Q8WA 1CEEA 5EGYA 2PAFA 3K09A 3ZZTA 3B3GA 1PJSA 3ZOZA 3JAKB 5KNCD 3JSZA 1KSJA 1JHXA 1YHYA 2JHAA 4E0IA 5THXA 3WMGA 3TH5A 5JYDA 4LWQA 3U0VA 3JZDA 1KR5A 2P2DA 4M76B 1B74A 3AF3A 5KVQA 4PWZA 5FUXA 3ZDFA 5MN4A 1TYDE 1PGJA 3IBCA 4QELA 1CWUA 2F1OA 2H2IA 2H2WA 4M3NA 4NS1A 4UKDA 3CGWA 2MTBA 2AG5A 3FGOA 1GM5A 3JQAA 5J9FA 1T3GA 3RIHA 3VYUB 5KNBH 3CLSC 1Z08A 1I5NA 4JOBA 4OI1A 1H3NA 3H97A 2D2IA 3JVUA 3NT4A 5CLIA 2DTDA 4QTYA 4G0UA 3PJRA 3KL4A 2VRWA 1SVUA 3JYLA 3FUCA 2AOUB 5HF6A 2PH7A 3C0KA 1G98A 1RWNA 2QXTA 2VJMA 4CMCA 1GQAA 3OM1A 3NYQA 2IEBA 3P45A 4RAOA 1ZN8A 2HJHA 3NRCA 2JLQA 4WERA 3RC3A 3WG7C 2ST1A 1QNLA 2JGAA 4CLRA 3X3HA 3CPEA 3VO2A 1L4BA 2CUZA 2MMCA 3GRKA 4JB8A 4JDUA 4QA9A 1LLFA 5AT1A 3GGCA 1RKCA 2C4TA 3RT9A 3UGQA 4F3NA 1E3QA 4J4TA 2DFDA 3F9CA 4HSGA 5CAEB 4DL9A 3OO0A 2XRYA 2AWNA 2RIPA 2FI1A 5F1OA 4AL4A 3SIXA 5JJBA 4D26A 1ZESA 4PLYA 3B0UX 3NAQA 2PTGA 4CG3A 1Z4NA 1YRHA 3ZZNA 4OJYA 1S4MA 1O4WA 1ZIOA 3F3YA 4G4GA 2BTQA 1B6GA 2ENWA 2QN8A 3UK1A 4EYOA 1M8JA 5EZYA 5AW3A 1D0XA 2VPPA 3INRA 4ZAZA 1EFCA 1JEQA 2I4OA 2NTEA 4JBNA 4BOYA 4IEIA 1GUBA 4PWYA 2QAIA 1XLWA 5JYCA 1DWUA 1EFDN 2ANCA 4HQFA 4MB2A 2HA7A 3TW6A 3WGLA 4F9EA 3VTZA 1RRVA 5BN5A 1KU2A 3FKSD 3T4XA 2FE1A 1TT7A 4QPZA 5FBHA 2A0UA 1KQOA 5A1JA 4JKVA 2PNJA 4TMVA 5TNXA 3T95A 4MV0A 1OMOA 4H16A 3UJ9A 2OHXA 3ETEA 3GZTB 2E85A 3DEJA 3SLRA 3NWBA 1P8AA 1YR3A 3K33A 2VJBA 4RU1A 1E6KA 1Z83A 3UK7A 2WR8A 2LVBA 1GU1A 2RHCA 3LWBA 1P9WA 3WHKA 1XHFA 4U9UA 4LF7B 1JHVA 3PC8A 3HK2A 1Z5UA 1V1RA 2EKPA 1WTYA 5JUAA 2IDKA 2OHVA 1CQJB 3KDSE 2PUWA 5KU1A 5L3SB 2HLHA 1G8KA 2JI6A 4GYWA 4LVOA 4ZQEA 4LWPA 3SSMA 3T8YA 3RC8A 3QVTA 4NI5A 3O9VA 2JGIA 1PT6A 2H7BA 3U8PA 1JHDA 4HNAB 2EPNA 4Z86A 3PEYA 4L5BA 4BMXA 4QSMA 1CDEA 2UUAB 3KSDO 4J1TC 3Q7TA 3RS5A 1WZIA 3D6HA 3OICA 2DPYA 3TM4A 2VBIA 3ISJA 4C01A 3ANTA 5ER9A 5I6DA 1YOBA 3VH1A 1HK7A 1J42A 4UTZA 4HRAA 3K9FC 3EIEA 1URPA 3QU9A 4TPKA 4URFA 4U2EA 4I46A 3UKJA 3EGWA 3TXAA 3K32A 4QRDA 1H05A 2NTNA 1ZK2A 1GL6A 3N6VA 3OA0A 2I76A 4U1RA 1XMJA 2XUZA 2VCHA 2HFIA 1THGA 3U8VA 2QG6A 1YZFA 3FTNA 4P3OA 5DK4A 3OJFA 1KPIA 4FCVA 2E21A 4OUDB 4Q0MA 5E7MA 4ZI5A 1GL9B 4IUYA 4PYIA 1XA3A 4QQ8A 4I55A 4WOCA 3H2YA 4DDMA 1UZAA 2IHJA 4BXOA 1E94E 1VGRA 3KDAA 1JNXX 4FFOA 4KX3A 4OLFA 1X7WB 2ZPAA 1DINA 3BXXA 3SHVA 5LP6A 3F47A 2JJYA 2C3YA 4NZOA 3RSFA 1KMMA 3JQFA 5CDFE 2NU8A 1AU9A 1WZUA 3LC2O 2FXIA 1ND5A 4XEVA 3EZGA 2UZ1A 5H70A 3OZCA 1K5PA 2FR0A 1N5KA 1KVUA 4L9WA 4X60A 1P9OA 4PG7A 2IUUA 3WV5A 5B58C 2JFBA 3JSAA 1AJEA 4NBWA 1D9ZA 3KZNA 2I7TA 1QLHA 1QVWA 1M0TA 4WHMA 3PD7A 3ASVA 3MW8A 2H3EA 4N6OA 4OD5A 4E12A 3KLOA 1JIKA 2GPSA 2HRBA 2VNAA 4ZQHA 5GZ1A 4ZHQB 5ESRA 4KDEA 1XR3A 4KQWA 5JAIA 1N3IA 4PE5B 4LQ4A 1CF9A 3TPCA 1FW6A 3BD7A 5LYJA 1NRJB 2XRHA 1TAGA 3NTQA 1NY5A 1UKEA 2O0KA 3V8PA 4B47A 5E3JA 2V1XA 2JKZA 2VWPA 3CURA 4C89A 1T4DA 1J09A 1UF9A 2FZEA 2VQEB 1V5IA 1JALA 1HI9A 2CHGA 2JPUA 2IHNA 2X0IA 3ZGLA 2B9EA 2XA2A 3HCWA 5M3BA 3QW1A 4BKUA 5B7QA 1RZUA 2DTXA 2G0AA 2RKBA 3GXOA 3AG1C 3Q7SA 3W8EA 3S27A 3GEDA 1NV8A 3AQIA 3JRMO 5K3AA 1TYEB 1CFJA 4IAOA 1VTKA 1ZD3A 3IXLA 4FUQA 2P1AA 8ADHA 1M34B 3F8TA 1UPTA 2IBMA 1HF3A 3PQ4A 3RTBA 2QRKA 4NTBA 2X40A 3U39A 4IGEA 1SO8A 3QEKA 4KVZA 1MJFA 4MIYA 2VJKA 4KREA 2P35A 3KQVA 5LD2C 1UZMA 4OQFA 3OEYA 5EGSA 3V7OA 4ENVA 2PIDA 3NVKI 1N5MA 1GG9A 1T9GR 2C9BA 2IZ0A 2R6JA 1V8DA 5C1IA 4PC1A 5KWEA 1IY2A 3RYIB 2X15A 1B8OA 2WINI 3I04A 3SC2A 3AIOA 5HQ3A 1VCHA 3COZA 4FE4A 4MQFA 5I9NA 3K1IC 1J06A 2FZLA 3HCNA 4GLFA 4HDKB 2ZBUA 5CLGA 1T9BA 1BE8A 4IDQA 3FR7A 3USZA 1FPMA 4DPKA 2LE0A 3DMNA 2EEZA 3EVDA 1ZI8A 1E9VA 5JWHA 4FLMA 2BR4A 4O8CA 2V9ZA 1F4VA 1EFTA 3FVVA 4J0GA 1N57A 3QOWA 4M37A 3J81A 2QORA 2OC4A 4L7QA 1IOLA 1CE8B 4YJFB 2CFRA 4WY2A 5FWXA 1N2BA 4ZD6A 5DNYB 3GOQA 5AM2A 5HRCA 4C0JA 4EJ6A 3GDWA 1T3TA 4S12A 1XZPA 4E30A 3CIFA 2VJOA 1J20A 3IUMA 1FDRA 3R74A 3U4IA 4ME6A 3COPA 1SA0A 1XTBA 3LF2A 1QFYA 3AILA 4CJOA 3R09A 1BHQ1 2FMFA 2YJGA 2XQGA 2HV9A 3NANA 1KJNA 3A7DA 1M66A 4NECA 3RVNA 3L77A 4IGIA 1ONPA 4O4LB 3ZDQA 1K9VF 3TQCA 1FMJA 2BFFB 1O77A 3RHSA 4MWBA 2FPLA 4XLLA 2XQKA 4EIYA 3AMVA 3T7CA 3UMRA 4RMHA 4DJFC 4C2AA 4QUIA 5EINA 1K63A 4M4SA 4MGYR 3NMIA 1ZLXA 5BSFA 2ZS7A 1NW8A 4GMKA 2F9LA 3KCNA 3Q3CA 4FMCF 2X1LA 4KAAA 4XB1A 4O0MA 5EIOA 3V7YA 2J30A 4G4SP 4Y9UA 1XVAA 4CFSA 1C0IA 4PICA 3RS0A 3OLYA 3ODPA 5JROA 3GLTA 3DI5A 2GAAA 5AVWA 4E6PA 4RGYA 5EFOA 1LK0A 1YXMA 4O59O 4RPLA 3DH0A 4NTFA 5DM2A 3S44A 4TLLB 1Q0RA 1WIWA 4NV3A 4ENUA 4G0NA 4BVKA 3K6KA 1KZYC 4S05A 1RI5A 2QZJA 4J29A 2Z04A 1WY7A 1RI4A 4L3OA 1M8FA 1LBSA 4FMDB 2VQFB 1RZRA 2DERA 1ULSA 1P6XA 4MGHA 4OK5A 1GTL1 1X3LA 2NZWA 3K16A 1DC5A 2RH5A 2UAGA 3M4NA 3LH5A 4FC6A 4MRMB 4V0KA 4ZO6A 5TF0A 3ROGA 3UWPA 2CF5A 2J9FB 3JD0A 1P8JA 3SYKA 4DYHA 1MMGA 1TKRA 3W8RA 2R79A 3NFYA 4BLUA 3OFJA 3VGPA 1Q0KA 3GRVA 1Q1ZA 2NVWA 4GI1A 3K70B 4LZOA 3FJ1A 4FFSA 4D8YA 4ZDKA 1GN9A 1UEXC 1V3VA 2OEXA 2C98A 1YCGA 3D4BA 3G0BA 3R24A 5FRDA 4IG4A 5A6AA 2JHFA 2Z3VA 3CKMA 3SVTA 5D6OA 3AUTA 4UTNA 3GLIE 1K8RA 1H5UA 3HJHA 4RPGA 1K0FA 4E13A 4RXTA 4BO6A 2H7YA 3OG9A 2CV1A 2NXEA 1U2GC 2QTBA 2OCCC 2W6ID 4X6UA 5HG0A 4Q3CA 4ENSA 1HEIA 1I32A 1PVDA 1XDWA 1WMDA 3AINA 3MWJA 4QO8A 3UA4A 3VR0A 3K9WA 3GDOA 3AHJA 1K05A 4I19A 2ZRBA 2J7PA 1JHYA 5EQTA 3DMHA 4IX9A 1BROA 1EE9A 1Y4DE 1GRVA 1VA5A 2VJMB 3KQQA 4HFJA 4OP3A 3SX4A 2A78A 5H59A 2CLSA 2OT3B 3MAGA 1KI1A 4IIBA 1PU2A 3Q1KA 4Q7LA 2NVBA 1M8PA 1ZC3A 3AJAA 5EJMA 3K8ZA 2R44A 3E2PA 3IOBA 1H2AS 3AUKA 3BWBA 3RS8A 1ATZA 3IEEA 2P6NA 4RNDB 1BG6A 5EVJA 2QTFA 5H80A 4IJMA 5LXTF 1Z3IX 4Y9SA 2W2KA 3LOPA 1ZM9A 4BJTA 2PBZA 3DJFA 1Z26A 4JL5A 4P1ZA 4P9NA 3GEIA 4YL3A 1TJNA 2TMDA 4RX1A 4WK6A 4OHOA 5BN5B 4ALKA 5JFGA 2ZSKA 1EXMA 1GTMA 1RS0A 1TKCA 3BEDA 3QYFA 2YVAA 1YBMA 4R32A 4WBNB 4B6GA 1IHUA 4ARAA 2JGNA 4IZHA 3ZWVA 5HBGA 4O4IF 4QU9A 4DCJA 4W9NA 1YZLA 1YDHA 4FI3F 4POAA 1H2XA 2I9KA 1G6KA 1SHUX 1Q16A 1P3JA 2VNIA 3L01A 3PQFA 4R9NA 1YRYE 1IQUA 2X76A 3FYUA 4BO0A 5IARA 3U9JA 5A0FA 2I2WA 2XM4A 2VAPA 3QBJA 3S2YA 4BQQA 5MGNA 3GLHB 3F49S 3R3UA 2HHJA 3DULA 2VHWA 1KZ6A 1U7DA 3B6KA 1P60A 3DYBA 1OH7A 3F8WA 1UXKA 3EARA 4ALNA 1OD6A 3ABKC 1NUTA 1WMEA 4O7GA 3EXEB 3P9YA 1KU0A 4L8WB 4QBFA 4UNPA 5TLSA 3AVUA 1NNEA 4IQ4A 4BB9A 2Q1WA 3O8LA 5SYMA 3K0BA 5ALGA 1T34A 4DV4B 2G04A 1NVEA 3AETA 4LXXA 3S2UA 3CVOA 2Z3WA 1KEEB 2ODPA 3H83A 5C2JB 3BB1A 3H1TA 2XE8A 4RPKA 3WO1A 4Q47A 3FAPB 1DSSG 2A59A 4ZZ3A 1GZHB 1L8AA 1SY7A 3DNMA 3ABLC 1GILA 1N2CA 5AC4A 1LTKA 2FWIA 2AUNA 3UK6A 1WHSA 3H9BA 4BMDA 3FYSA 3IP7A 3NTOA 1XEWY 3Q1LA 1VB5A 3FDZB 3MT8A 4MK4A 2BM8A 4CIHA 1IN5A 1WXDA 1HH4A 2WHPB 4R5MA 4WLOA 4OYHA 2FFBA 2ZIAA 1YTUA 2GK6A 1KH3A 4HI0E 1D6MA 1OI3A 3C1OA 1W76A 1IC6A 4MUYA 1XAIA 2M2IA 2ONJA 3NTLA 5HK8A 3FUXA 3V7WA 5BPFA 4NJEB 5JCOC 5KKCA 1Z7Qc 1AHIA 1T26A 2V9CA 3DVAA 3E9CA 3ELUA 4GZ6A 5C81A 2ANBA 3NTVA 3SQOA 4CF4A 4YUYA 1SCQA 5C4IA 2CNKA 2NT3A 2YMLA 5ENZA 4JDPA 3T7JA 3O5AA 3BDAA 3M6VA 2VN8A 4QG7A 5CPBA 1EP1B 4OH1A 1FQOA 2GK4A 5FTKA 5H8WA 4ENTA 4LCEA 4NZNA 1Q1AA 1RRPA 4TMFA 1LNSA 1XKTA 2PQ0A 5JO0A 1U8CB 1YTLA 1HDYA 2QQ5A 4C0QC 2ZIFA 2BHLA 1A77A 2GJSA 4X61A 3LPMA 5EJAA 5J5AA 5K8IA 1H4VB 2LCFA 3HWWA 2B3TA 4F4JA 1FJXA 3MT7A 4NE7A 5D51S 1E2UA 2BUAA 5CNIA 4BBPA 4IQGA 3QKTA 4LI3X 3DLTA 4H7PA 3BL8A 2ZJZA 4UDOA 1OA0A 3MGBA 3UFXA 4DA7A 2OZEA 3N8GA 2J0EA 2LV8A 4KQ1A 3RREA 4WNYA 5KQSA 4A6EA 1F17A 4HGYA 4ZQBA 5JSFA 2XTZA 4MTCA 1UBOS 4PINA 2G72A 3LGAA 3OWHA 3LF1A 1F60A 5I7VA 1NT2A 3TFWA 2EKDA 1HNNA 1A3CA 4WZBE 2VR1A 3HR8A 2EILC 4KGZA 1PBTA 2W98A 2H1SA 4DQLA 3G8AA