4YT2A

Hmd ii from methanocaldococcus jannaschii
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
343
structure length
343
Chain Sequence
b'NMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
total genus 124
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt2A01
2IDZA 2VT3A 3LC1O 2YQ4A 4P4NA 1AGNA 1SBYA 4W7IA 1SOVA 4IPTA 4CM9A 4MVJP 2BGLA 1SEPA 4DYDA 3KYDA 1JAYA 1JW9B 2HO5A 1V3VA 4B7XA 1A71A 3GAFA 1GCUA 1J49A 1NQOA 1N7HA 3H6KA 3I6QA 4RPGA 3MWEB 2VWQA 4BNXA 3FHLA 5F1KA 4DREA 1DHRA 3EZLA 5GZ1A 3WMWA 1NXQA 2ZK7A 3FBGA 1NQ5A 4ALJA 1PZGA 4URFA 1T24A 2FR1A 1PL8A 4E5PA 4XGNA 3ZWBA 4EJ6A 2C0CA 3GNSA 5KKAA 3LF2A 4GI2A 5F5LA 1UUFA 1T2EA 5F3RA 2I9PA 4N7RA 3S55A 2X5JO 1KC3A 4XQCA 3PZBA 4CMKA 1LTHR 4GMFA 4LW8A 2P4HX 4XIYA 4YPOA 1P74A 2WD7A 1YH3A 1PL6A 3R6DA 2NQ8A 3FTNA 3DFZA 4WCFC 1D7OA 3DAPA 4WOKA 4BGUA 4LVUA 1ZEMA 1X13A 3W1VA 2CVQA 3I23A 3GGGA 4YTEA 1SOWA 2B5WA 1ARZA 4UEJA 2OP1A 4UAGA 1E3IA 3DMTC 4NR0A 4RV9A 1I32A 3R3JA 2CD9A 4M49A 4ND1A 3JQDA 4JP3A 1WDLA 2D2IA 2FN7A 2O7QA 2AQHA 5JMPA 5ILGA 5A3JA 4NFYA 3F47A 1B3BA 3AOEC 5C7LO 2SCUA 2OL4A 3JQ9A 2CZCA 1IZ0A 4O63O 4JBHA 2DAPA 2Q2VA 1YONA 2V6FA 4YXFA 3ZWYA 5AYVA 4CM7A 2FWMX 3UN1A 2VOEA 4OO3A 1EMDA 4EEZA 3KYCA 1C0KA 2ZYGA 1DIRA 3GUYA 4D0RA 5ICSA 3UCFA 1ONNA 1XA0A 4CLEA 1LDYA 5FWNA 1A7AA 3U4IA 3NT4A 1U3WA 4GQAA 4CM6A 2W2LA 2WE7A 1NFRA 2DLDA 3V2HA 3IP1A 4WNIA 1BXZA 4RVGA 4HFMA 1QRRA 1R0SA 3KSUA 3GZNA 2AW5A 4Y6RA 3LT1A 5DBIA 3UXYA 4RF3A 4ZQFA 3D5QA 3JQFA 5I8ZA 5G0WA 3ZWMA 1PZHA 3VKVA 3OQ6A 2A92A 5U4QA 5THQA 5G4KA 1WZEA 4BIIA 3NX4A 1EQ2A 2Y67A 2UUOA 5IDWA 3HJAA 3PP8A 5KKCA 3PLRA 4LGVA 2GN6A 5BT9A 5T64A 1ZJYA 3HSKA 1VL8A 5CDGA 5I7FA 5IN4A 4YRAA 1R4NA 2J3HA 3RU9A 4BGVA 3RU7A 4P38A 1WDMA 3ASVA 3OBBA 1DJQA 2E6UX 3WLEA 4J4HA 2ZTMA 2DC1A 4B4UA 3BZUA 3GG9A 3TZ6A 1A4IA 4J16A 1EVYA 5JS6A 2G0TA 1MGOA 1CYDA 4I5FA 3NJ8A 3GC6A 2C7VA 1PS9A 3RI3A 3AY7A 3AI2A 1BW9B 1NP3A 4H3VA 1GD1O 3ZU4A 4DPLA 2XOXA 3NTQA 2A35A 4CV0A 1BVRA 4J1TA 4P8RA 2W98A 1B15A 4TQGA 4CR6A 5JDIC 1PJ2A 1B8PA 4XWYA 3RC1A 1EVJA 1SC6A 1MXHA 3WX0A 3ETEA 4YACA 1VLLA 2NVUB 5A9RA 2EEZA 3IKTA 3CINA 3E03A 1UP6A 4LRTB 3OA0A 4M1QA 3WSWA 2AEFA 1C1XB 3RKUA 2GSDA 3NGXA 3DOCA 4JX8A 3KV3O 1KVTA 1R0KA 1U1IA 2YQ5A 1NVMB 4CJXA 1TB4A 2E49A 2Q4BA 2EP7A 2E37A 2ZYDA 4YT2A 2FR8A 1M76A 2NTNA 2ZB3A 4BGIA 1VSVA 4O6VA 2XPCA 2JHGA 2X8LA 4MVJA 5TSDA 2PKQP 4MOWA 4YAJA 3GDFA 1IL0A 4FQ8A 1ENPA 4JJFA 4CLDA 1VKNA 1O6ZA 2NSDA 3D1LA 2JAPA 5IJZA 2QG4A 4AG3A 3QE3A 5KJ1A 3BAZA 3KHUA 5F1PA 5CDSA 5JDCA 5I9LA 4CM8A 3GN2A 3AM4A 1ULSA 1T4BA 1IB6A 2X5OA 4IMRA 4E31A 5ENVA 5HS6A 3LZ6A 1O94A 3P7MA 4NG5A 4I5EA 3AM3A 1YL7A 2GZ1A 1DAOA 3CKYA 4EUFA 1EDOA 2AQIA 2GZ3A 3PQDA 4J1SA 4UEKA 1B8UA 3I83A 1PIWA 1HRDA 3GAZA 3JYLA 1MA0A 2I5PO 3ZNQA 2P4QA 3K9QO 1PJQA 4AJNA 4D42A 3T4EA 2WD7B 4J1QA 4BB6A 3FNFA 4IQ0A 4WASA 4YAIA 4PGFA 3WYBA 3ON5A 4YAKA 3SXPA 3CEAA 1EUCA 2D4AA 1DC5A 5HWSA 2QX7A 4GX2A 3WOHA 4L8VA 1SB9A 4XYBA 3GY0A 1UZLA 4J91A 2G1UA 2O3RA 2X5KO 5J23A 2ZTLA 3STHA 1E7YA 5B4TA 1Y8QA 5KWEA 3VVBA 3JYQA 1RPNA 3UCXA 2QYTA 5IFLA 4QO8A 2Q2WA 3QVWA 1ML3A 4MPDA 5DOZA 3PIIA 1ZFNA 4CQMD 1ADFA 1GZ3A 1H2HA 1U5CA 2Q1SA 1GEGA 4BVAA 4KDFA 3WJ7A 5LDHA 3DWFA 4E2WA 1U3VA 5K6AC 2JL1A 4LCEA 5HRUA 4KQWA 1U8FO 1N1EA 3O38A 2VWPA 2X86A 2Y0CA 4XYGA 4YB8A 2PD3A 1K2WA 4MVJF 1RM3A 3CZRA 3UUWA 3DZBA 2IEDA 4W82A 3W6ZA 4DIOA 1ZH8A 1PQUA 2A4KA 2PD4A 3DZGA 4KWIA 5DCYA 4Q3CA 2CVZA 4HV4A 4F6LA 1GPJA 3ZW8A 3VTZA 1PJ4A 4J9VA 1I5RA 4AJIA 1AXEA 2FRDA 2O2SA 3S1LA 5IF3A 3AFMA 2B4RO 3RFVA 4MVJE 3TFQA 4CV3A 2VZ0A 2CVOA 4GVLA 4RDIA 3DBLA 3VH1A 4GLLA 3F5QA 5HM8A 3K30A 1JWBB 1NPYA 4G65A 1J0XO 2WJPA 3LT0A 5EMHA 4CUKA 1PEDA 4FGSA 5JFOA 2YYYA 3FNHA 2V6GA 4TSKA 3ZN2A 5A02A 3KEOA 1UXKA 2W2KB 3ONDA 4WLFA 1M6HA 3T7EA 3VZRA 4BL5A 2W90A 1R6DA 3BIOA 1DFHA 1M75A 3DR3A 3I9MA 3QIVA 4XCVA 1NPTO 3NDIA 1WMBA 3RD5A 5MGBA 1P45A 4LCJA 4UUNA 4INAA 1U28A 1ONOA 2IEBA 4D7AA 5CDTA 4NH4A 2BFAA 1Q0LA 4PRLA 3WXBA 3ADOA 3F4LA 2Y66A 5CFZA 5I9NA 2HK8A 3I9OA 3OEYA 3D4NA 3AI3A 1ADCA 2OBYA 4R1SA 3RUHA 3S8MA 5IXSA 1BXGA 2POQX 3ZWPA 5BNFA 3JD2A 5FYDA 3VHRA 1DSSG 3I9NA 2EXXA 5ENDA 5CPFA 2P9CA 4BNGA 2WYVA 1M6WA 4FSHA 3MOGA 3PWKA 4X54A 3QRWA 1B3RA 1W8DA 2DTDA 1QYWA 3GQVA 1ID1A 2ZJ0A 5T8KA 3GDOA 3ZNOA 5DCUA 4IJKA 2QRKA 1YJ8A 4N5NA 3DBHB 4XDYA 4ZA2A 3QVTA 4GKBA 2Q99A 4OJNA 3RWBA 4TZKA 2O3JA 3TWOA 4PLHA 2DBVO 1E6UA 3A9WA 3M2PA 3WR5A 5CPBA 4ND4A 3RSHA 5EQDA 4PLZA 1QV6A 4RPKA 4DUPA 2J3JA 2OHXA 3EY4A 4Z3KA 1PZFA 3CZMA 4RF5A 1GY8A 2AQKA 1VL0A 4UVEA 4DXHA 4HBGA 1PX0A 1CQJA 3DEYX 3GZ4A 1YDEA 3INGA 3OETA 4LSMA 4E12A 2DTEA 4WEOA 3JQ7A 2CMDA 4WLNA 3E5RA 3H9UA 4QEDA 3K92A 3DBRA 2ZQZA 1HDRA 3KTDA 4K6CA 4B79A 3EMKA 2OO5A 3S2EA 3QVXA 5T5QA 1SMKA 4TKMA 1PWZA 4B7UA 1VJ1A 4L74A 1LSSA 2JFGA 2H9IA 3SC6A 3BTOA 4DLBA 1YB1A 4AJLA 3JQAA 3T7CA 1ONPA 3LYLA 5B1YA 1IHYA 4Q3BA 3G3EA 3GPIA 2I65A 4Q39A 1C1DA 1U7HA 3MTGA 3PFFA 2IYOA 3MJVA 1LDMA 2QQ5A 2H1SA 3QWIA 3DBVO 3JYPA 4XD2A 4ZRNA 3TPCA 2RCYA 1BDBA 3LSYA 4Y98A 1B7GO 4TVBA 5FI3A 1I2ZA 3UICA 2R00A 3ITDA 3HUDA 3VVCA 4AJJA 1AUPA 4WUVA 1A9YA 1AHHA 5FFFA 1I3LA 2W8ZA 1NPDA 3IIEA 2NVWA 4GMGA 3WYEA 3G1TA 4BKUA 5DZSA 4Z0PA 1NR1A 2DTXA 4BNMA 5HS4A 4TRMA 4WLOA 1Q2XA 1EE2A 1RKXA 1YS4A 4IY1A 3O4RA 4DLAA 1LLDA 1Y8QB 4YRDA 4LISA 3GFBA 4IIVA 4XYMA 1NVTA 1ZO8A 2X9NA 3UGKA 4JCOA 1Z7EA 1LSOA 3WIEA 3VH3A 3AUAA 4HUJA 5JO9A 4UEOA 4J90A 1U8XX 1BDMA 1BHSA 4RVSA 5G2OA 5L4NA 1R66A 1U7TA 3GLQA 2D3TA 2JKVA 3QWBA 1XIVA 1YQGA 5TS3A 4HWKA 5G0VA 1LLUA 3R3SA 3QWHA 4BMVA 4WECA 5CAEA 2YHIA 4XYEA 5G4LA 3TRIA 3RUDA 1HE5A 1H6AA 4BNJA 3DZFA 1HDYA 4Z9FA 2HCTA 2I3GA 3ZWAA 1GV0A 3Q3CA 1I2CA 2X1HA 3C8MA 1KY5A 3MEQA 1PSDA 3PGJA 2Z1NA 4XYLA 2ZTUA 1DIGA 2PGJA 5DN9A 4YJHA 1BTOA 2BRUA 4BMSA 1A27A 1V9LA 4EUHA 4ZN6A 1ZK0A 3DBLB 2XF8A 4MIYA 1N2SA 3HADA 4GLOA 3COSA 3TZQA 3ZU3A 1XHLA 3JYNA 1HT0A 3ADPA 1P44A 5DBFA 4OM8A 2NU7A 3ST7A 1NM5A 3SLKA 3AW9A 3TL3A 2DBZA 3BMQA 4ZU3A 2GO1A 4ALIA 4CM9D 1JU9A 3EVTA 3U3XA 2QHXA 5G0TA 4EW6A 3W4IA 3JQBC 1SCUA 3LVFO 3QVSA 2J6IA 1IOLA 4JJGA 4NMHA 3DC2A 5KJCA 4J6FA 3LLVA 2Y99A 1DHTA 1N92A 2X58A 1BXGB 4E2XA 4CM5A 1HDZA 1FDTA 4RVHA 1VJ0A 3KBOA 2DFDA 3HQ4O 4K28A 3AUSA 3F3SA 3RC9A 3UOGA 2WSBA 4CMCA 4D0SA 4BNZA 3R1IA 1BSVA 5TNXA 1MV8A 3BMNB 1YDWA 1HXHA 1PJBA 2H63A 4WJZA 4JGBA 3SX2A 1Y5RA 4KUGA 1E1LA 2H6EA 4CM4B 3KRTA 2Q45A 3L4BA 4XGKA 5EJ2A 3DDNA 4KTTE 1Y9AA 2G5CA 4N5MA 4WLVA 1WZIA 1UZNA 4GPD1 3DXFA 1NFQA 4CL8A 1XSEA 4YWJA 1CERA 1LBEA 1F12A 3UH1A 1PJTA 3OJLA 3ZU2A 3BTSA 4W99A 5CDYA 3A28A 1HZJA 1JKFA 2EKLA 1T25A 1TLTA 2CSUA 5IDYA 4L75A 1Y81A 3RAJA 1DIAA 1P0FA 2GCGA 4W9NA 3VDRA 4CMEA 4E33A 1ZK1A 1KEWA 4ZHSA 4XQGA 3QY9A 3AJRA 4RVUA 2FHSA 3BMCA 4GX1A 3FBTA 2R6JA 4M54A 1UXJA 1YWGO 4AL4A 5A04A 5CEEA 2ZTVA 4ZRMA 5JLAA 3RC7A 1CIVA 3DTTA 3WFJA 1MUUA 4YT4A 1GR0A 3L6OO 5T67A 4AJEA 2DPGA 2CFCA 3TL2A 1A72A 2EP5A 4O59O 4ZQBA 2EKPA 4PVDA 1LDBA 3DBRB 2NU9A 4EGFA 5EINA 4N18A 1Z45A 3EC7A 4BNHA 2OXIA 3WYCA 3EW7A 1PS0A 1QLJA 2NVBA 1ZSYA 4BB5A 3G17A 4E3ZA 1VRWA 1ZK3A 2FPIA 3U62A 2NNLD 1C1DB 4E5YA 4I9NA 3O26A 5DCWA 2QZZA 3I4CA 5EQFA 1GYQA 1NHWA 2W2LD 4YAGA 1B16A 1A4UA 3Q2KA 4WK6A 3C1OA 3RFTA 3BTVA 1MB4A 2FR0A 4JP2A 4E2ZA 1TVEA 2PZKA 2VHXA 3WGGA 5U9CA 2GDZA 3ZWCA 7MDHA 2BI7A 1IUKA 2Q1WA 4U6QA 3H3FA 2CF6A 3DONA 5KJEA 4XEHA 5JYEA 2BH9A 3GN1A 1X15A 3ASUA 5L3ZA 3ZHZA 4WPGA 1LI4A 2O3TA 4PN3A 1Q0QA 5F21A 4Y6PA 1LX6A 3ZNNA 3M6IA 3JQGA 2VUTA 1XR3A 3I9LA 2HMVA 3PIDA 2PZJA 3KM0A 4OHUA 3FWZA 2GR9A 3OF2A 3ROMA 1ISFA 4BQPA 1KC1A 5DP1A 1E7RA 4MIEA 4NZ9A 1KBZA 5IG2A 3ZZNA 3M1LA 3G49A 3VPGA 3INRA 5DDIP 1IPEA 5IZCA 2C2XA 4LMRA 2HMTA 2BFMA 4JBIA 4PIVA 2AG5A 1LDGA 2B4TO 2I99A 2G76A 2FP4A 4IZIA 4ZICA 3VAZA 2X4GA 3WIDA 4LVCA 2YHIB 3ICPA 3EYWA 4EJMA 4NFSA 1W6UA 2HRZA 2A9FA 4BO5A 2OZPA 3OECA 3TF5A 3KZVA 4ID9A 1F17A 3MTJA 1GL3A 1NBOA 1QR6A 4WCFA 3GGPA 2VTDA 5TRTA 1MFZA 5KVQA 1Q7GA 1D3AA 4XGIA 5EIOA 5BSGA 1LNQA 4I8XA 3H8VA 1B26A 3V5NA 1XG5A 2ZIZA 4XKJA 3CTMA 5B4UA 4DL9A 4D46A 2CDAA 3RROA 4JIGA 1T4DA 2JAHA 3QWAA 1SZJG 1DJNA 1GUZA 3PYMA 4A03A 4MVJD 5I9MA 3AK4A 4EITA 3JQ9C 2AE1A 5BNIA 2C5EA 4ONEA 5COBA 2C2YA 1NQAO 4NBVA 3H5AA 2HJSA 1N9GA 1R4MB 5KNLA 2EJVA 4YJGA 3RUCA 5EPOA 1JA9A 3D5TA 4XRGA 3PJGA 1LU9A 2IODA 4LRSB 4D3DA 4XDZA 1SPXA 1DOHA 1GDHA 4EI2A 5CG1A 5DP2A 4R4JA 2P9GA 4ZVVA 1M67A 4F46A 1PQPA 3LK7A 3PI7A 2PV7A 3BHMA 3L0DA 3B6ZA 4BKRA 4FIZA 4KMSA 4CMAA 4HKTA 2BLLA 3U49A 4PG4A 3JQFC 1FXSA 2HSDA 2JFHA 4N5LA 5L7TA 4PG8A 5T57A 4XR4A 5I8WA 5TLSA 1FDVA 1DRUA 2NLOA 2VZ8A 3PDUA 1EFLA 3I6IA 3GGOA 3QVOA 4YA6A 4R54A 1HE3A 3CSDA 4PZCA 4JROA 4Z0HO 3GVCA 2NM0A 4MINA 4BOYA 5C5IA 1PGJA 3GVHA 1LA2A 1E7MA 1PTJA 2HKIA 9LDTA 1WP4A 4NDNE 1Y6JA 3P2YA 1ZZEA 2GRAA 1YOVA 3BMCB 2I3AA 7ADHA 3WBFA 2BELA 2YW9A 3PK0A 3NTOA 1H0KA 1KVUA 3ZH2A 3FR7A 4BNVA 2WM3A 1P77A 4J2HA 3F6YA 2PWZA 4TRNA 3L9XA 4AJKA 4NBRA 1P1RA 1PJ3A 1DC3A 2CY0A 2FZWA 2YV2A 4CPDA 3ZCXA 1W0CA 3OH8A 1PR9A 2Z5LA 1GFSA 1UAGA 4LN1A 1N8KA 4WOJA 1TT5A 4ROSA 3S2FA 3WTCA 4J0EA 2HMWA 3B70A 3R0IA 4GSLA 1HTBA 3OQBA 4AJOA 4L4RA 3E1KA 4J7UA 1TI7A 2Y93A 1KETA 3UHAA 4OKNA 1B14A 2JCXA 2P5YA 4FOOA 3JD0A 5GZ6A 3ZDFA 1YB5A 1OI7A 4ALLA 3UAGA 3ZWNA 1T2AA 1I3MA 3ZI0A 2XXBA 1Z6ZA 2Z1MA 3OJEA 1CWUA 3MJTA 1QKIA 1S6YA 3FRJA 1MFPA 3PJEA 1J6UA 3GVIA 1LUAA 2HMSA 1IULA 3DB2A 3DTYA 4OSPA 2JHFA 3KYDB 3IS3A 3WGHA 5JC8A 3QHAA 3L6DA 3B20A 2V6BA 3B1FA 1HL3A 1BXKA 1KERA 2YHUA 1E77A 3UFXA 6LDHA 2DM6A 4MJLA 5KVVA 3WTBA 2HAEA 4CUJA 2NV6A 2E4AA 3PHIA 4RVDA 5JYDA 4YCAA 1YQXA 1FDWA 4PZDA 5EN4A 4Q9NA 4QUKA 4B3IA 4IJVA 4PLFA 5JDCC 5DBGA 4RL6A 3UKOA 1PS8A 1UP4A 4R1TA 1RYDA 3BHIA 1LSUA 1NWCA 1QYCA 3V2UA 3IQDB 2Y1FA 4YQZA 3AU8A 3ZNPA 5JXWA 1VKOA 1DEHA 1HLDA 3RBZA 1L7EA 1NASA 4IDCA 3SEFA 3NT2A 4BNWA 1BG6A 3L9WA 3T4XA 2J5QA 1LEHA 5CEJA 4IJUA 2B4QA 1H2BA 4NU5A 4OKIA 2IZ1A 2O3SA 3B1JA 5JCXA 2BGKA 3K2EA 3MJCA 3WS7A 3LT2A 1BRMA 4EBFA 3LLSA 1KOLA 2IE0A 2RHRA 4FFOA 4LSWA 3VDQA 2HK7A 3HG7A 4FOSA 2PR2A 3MOIA 3GNTA 4FFLA 2Y1EA 4A7PA 5KIAA 4MDHA 4RCVA 2EG9A 4MP6A 1E6WA 3GG2A 3D64A 1YRLA 5L95A 5B4VA 1NQTA 1UDBA 1YE3A 3H3JA 1D8AA 4NQZA 4ALKA 1W4ZA 3DHNA 3A06A 5L40A 2GN4A 1ZKMA 2VHVA 2VYNA 2UV8A 3GA0A 5B37A 3KYCB 3GVXA 1JVBA 4FD3A 4PZEA 3A14A 4D3SA 4I5DA 2UVDA 5JY1A 2C7GA 4R1NA 3V1UA 4BNLA 1BWSA 3KSZO 1QYVA 4YJGB 4U8GA 5H83A 4DMLA 3OIDA 1WW8A 1YL5A 3OJFA 3AM5A 1C0LA 4NFHA 2GUGA 2EGGA 4BHTA 5HBRA 4E4YA 1VE9A 3IC5A 3U09A 3GZNB 3WNQA 1JKJA 4TKLA 4BO9A 3HDQA 3H9EO 2DPHA 4Y67A 4MP8A 1YBAA 3WQQA 1NAHA 3JQAD 1O8CA 5G4KB 2NUAA 4AICA 1QORA 2DKNA 3K96A 3ZV4A 2OMEA 2PKQO 1PL7A 3O9ZA 3D3WA 4IDBA 3DL2A 3OHSX 3TN7A 2IRWA 2DU8A 3PJFA 4MKXA 5JO0A 1HDGO 4CR7A 2QW8A 4H15A 3D4OA 1R4NB 4GX5A 4UUMA 1XCBA 3H4VA 2HU2A 1ULUA 1W73A 3U9LA 3W8FA 2VYVA 1H9AA 3A1NA 8LDHA 4B8ZA 4YJFA 1P1IA 2Q46A 3E82A 5HA5A 4HNGA 4J7XA 5EL0A 2Y1CA 1MG5A 2LDXA 3E9NA 3H2ZA 5JNLA 1PGNA 3F1KA 2FZEA 4DGSA 2B69A 3GFGA 1ZW1A 1O0SA 1XQ6A 1ZK2A 1KEVA 4GWKA 4UVHA 5TGDA 3ROPA 3SLGA 3F46A 2GN9A 2Z95A 4HFJA 1F8FA 1IE3A 4HFRA 1CJCA 2Q1TA 4MKZA 1YO6A 2ZYAA 3ZWOA 1PU2A 4IS2A 1C3VA 3L07A 3QLJA 1JKIA 3O8QA 3VC7A 4WLEA 1PJSA 1OC4A 2X22A 1HZZA 4DIBA 4XR9A 4IZHA 2PZMA 5KVCA 2O4UX 4M87A 1C0IA 3WGQA 1FK8A 4L76A 4CM1A 3E48A 1X7DA 1E5LA 1ENOA 2EHDA 1HYHA 3QWFA 4S1VA 4DTIA 4N54A 1EK6A 1PR3A 1DFGA 3P2OA 1UR5A 3RASA 2I6TA 3TJRA 1MXFA 3PPIA 4CV1A 1O9BA 4XJSA 4WKGA 3FNGA 4E0BA 3NEPX 5A03A 4NBUA 3QV1A 3W8EA 1ENYA 4WCDA 4W6ZA 4EEXA 3I5MA 2VOJA 4BO8A 1ZJZA 4FN4A 5JC1A 1PZEA 1I8TA 3V1YA 2D59A 3WQSB 5AXBA 3QJ5A 3ZV3A 3I9JA 3WFIA 4I08A 2EJWA 3VKUA 2V65A 2Q49A 3FN4A 4CM3A 3HDHA 4RDHA 1E92A 4BO7A 5BR7A 4BMNA 1V0JA 3AY3A 3BMOA 5FEUA 4BNUA 4CMIA 3GVPA 2FPGA 1X7GA 3W6UA 4CM8B 4M8SA 4CLOA 3ITKA 3OIFA 4W4TA 4ZQHA 3WWYA 4C7KA 1V6AA 3I4FA 2RIRA 2G17A 3D3EA 1VPDA 1Q0HA 4RPJA 4BNIA 4GL4A 4CMJA 4LMPA 1GU7A 3I3OA 4OXNA 3NV9A 1VJTA 5IDQA 4QQRA 3ONEA 1U3UA 4MVJM 4J0FA 1RM0A 1S7CA 3K8ZA 3C7CB 3NGLA 4IQ8A 1HDCA 4EUEA 4QT0A 4BUCA 1LXCA 2HMUA 4CUZA 2UUPA 4GGPA 3DOJA 4U7WA 5KJFA 5G0UA 1WLYA 2X0JA 3MJSA 4J2OA 2GPTA 4RPLA 2DFVA 3GPDG 4KDEA 3GH3A 3K73O 4D45A 2YDXA 3UF0A 4IGFA 2AG8A 2ZCVA 2O23A 1DDOA 5JE8A 5A05A 2PNFA 2QZ9A 5K0ZA 3D0OA 4UUPA 2Q3EA 2EW2A 4KTVE 3GMDA 3JYOA 3HN2A 1NYTA 1JN0A 4IBOA 2TMDA 1DPGA 3FCOA 1I24A 1UZMA 5DF1A 1UXHA 1WWKA 3UCEA 2A94A 1JLLA 1TEHA 2X0NA 3NUGA 1XDWA 3DZKA 3ZWXA 1J5PA 1XU9A 2DBQA 4BKPA 1YVEI 4PG7A 2PTGA 4YDRA 4FR5A 3I1JA 3PYXA 4CL3A 3KYBA 1I0ZA 1IY8A 3GRKA 2RH4A 1H6CA 1XQ1A 3CMCO 3FPCA 5CEFA 4B8WA 2BGMA 4FFNA 1OBFO 4BNYA 4B4VA 4FBGA 3GF4A 3W4KA 4A26A 2DBRA 1IZ9A 3AUUA 4MO2A 1P1HA 3V1TC 4G5HA 5COQA 3F9IA 3IJRA 2ZCUA 1UAYA 3H65A 1U3TA 3OA2A 1UH5A 1EBFA 5JSFA 3C3XA 1DXYA 3KLMX 2V6MA 3PVZA 2BFOA 5ADHA 1HWYA 1NWHA 1JQBA 2CF5A 3M2TA 1ISMA 3ROKA 3GEDA 3HB5X 4JLWA 3H2SA 1LQUA 5L7WA 4BO4A 3WGIA 3PFWO 2O4CA 3D3WB 4IDAA 3NKLA 4XB1A 3CIFA 5L45A 5COAA 4FCCA 3DMYA 2OGUA 3UVEA 4YAEA 4YT8A 1H6BA 5KVSA 3Q6IA 1U2DA 2IXAA 3RFXA 4DYVA 1M66A 1KIFA 1P9LA 4RGBA 2O7SA 4L4XA 4ALMA 4CLHA 1NFFA 1YJQA 3PQFA 4YJFB 3ENKA 4RZHA 2X0IA 3H7AA 3LC2O 5I7VA 3IMFA 4FFPA 4WGGA 1G0OA 2EERA 5TT1A 1IHXA 3EAGA 4DPMA 4II3A 4ZD6A 3IDSA 5MDHA 1E0DA 5LDGA 3E9QA 5HTOA 3CXRA 2VRCA 3HE3A 3ONFA 1GADO 3FR8A 3H9GA 3DZJA 2UAGA 3JQBA 1IYZA 3HDYA 1EVIA 2QYSA 1AXGA 2I67A 1Y8RA 3PHHA 1HSOA 4M89A 1YBVA 1HETA 3TDKA 4ALNA 2YY7A 5A4DA 1I30A 1SB8A 5ES3A 1SO8A 3S2IA 1WAMA 4FC7A 2YV3A 4R3NA 4J1NA 4XB2A 2PZLA 4C7JA 3ZWWA 4E32A 3LU1A 2X23A 1VC2A 4D44A 1Y5MA 2NTJA 4TZTA 4CMGA 1MC4A 1P31A 4TVOA 3ZHXA 1JAXA 4F3YA 1MG0A 2ZJ1A 1K89A 3L4BC 1X1EA 2WE8A 3RVDA 3HHPA 5GY7A 3ETDA 5KJ6A 1ADGA 1NHGA 2BHLA 3FI9A 1CEQA 4HX5A 4CLXA 4JBGA 2WWRA 2RAFA 3FPLA 2YDYA 1H6DA 2AEMA 1UP7A 1B8VA 4I9HA 2C59A 2GASA 2AQ8A 1E3LA 1R0LA 3LQFA 2YUTA 5ER9A 1GUFA 3GNQA 1UDAA 2D8AA 4W9NC 2Q50A 4CMBA 4CMEC 4ESOA 5BNTA 4TMFA 1RJWA 1J4AA 4K6FA 3JQ7B 5TX7A 3JCZA 2PY6A 3GEMA 3OQ1A 4CMIB 4R9SA 4AJ2A 4RLHA 4R68A 5KOIA 3ULKA 1BW9A 2YJZA 1RM4A 3HZZA 3ZGYA 4J7CA 5IXYA 1ZMOA 2O50A 3JQAB 4NNJA 5T6BA 1K3TA 3D7LA 2Y1GA 1HE2A 2HJRA 4ZJUA 1KY4A 3AFNA 4GWGA 4PVCA 4XQ9A 4G2NA 3TFOA 1JTVA 3BXXA 1NVGA 2NVUA 3MJEA 3TQHA 4AJPA 2PFGA 2EIHA 5A9SA 3EGOA 3ICCA 1F0YA 1YGYA 1KVSA 3OSUA 1EK5A 2Q2QA 3PWSA 3RBXA 1ZBQA 4PLYA 4Z6KA 5IZ4A 1A7KA 1GV1A 1JWAB 1SAYA 2Q1UA 3DHEA 3TZHA 1EZ4A 2OFPA 1E3WA 1FDUA 4HFNA 4PLGA 2C5AA 1ISJA 3HFGA 4XA8A 4AVYA 4BV9A 3N58A 1MC5A 5EESA 5JCJA 3JSAA 3QW2A 3TNLA 2GD1O 4R5MA 2O48X 3BTUA 3IUPA 1ZCJA 2YV1A 2Y05A 1QP8A 4NK4A 3WGOA 3ANLA 3GT0A 2P68A 4YYZA 3NJ4A 3H9QA 1ISHA 2J3IA 1Z7BA 1CETA 2ZB8A 1GTMA 2NU8A 1DC6A 1WDKA 4U0KA 4ZGWA 3PHGA 1KEPA 4R3WA 2C82A 2P9EA 4XZ3A 4I5GA 2IZ0A 4OYRA 4GBJA 2VWGA 2JD2A 4JN6B 2VTEA 4FC6A 5L4SA 4BO6A 1BGVA 1U5AA 1E6EA 1UJMA 3CMMA 2HK9A 3AY6A 2DVMA 2HLPA 3N74A 3EDMA 1U4OA 1NR7A 1LC3A 2Y68A 1T2FA 4S3MA 3VZQA 5IZCC 2XXJA 3ZU5A 4A10A 3H9JA 1ZUD1 5ILOA 4L4SA 1I2BA 1T26A 3JQEA 2JD1A 3KVOA 1CRWG 4YJHB 1V3TA 3WICA 5JMWA 1R16A 4MVJH 2NTVA 1XKQA 3WGTA 3Q1LA 3WB9A 4QX6A 2XAAA 2B0JA 4YBZA 1ZIDA 4OMUA 2VUUA 5AXDA 1IPFA 3DMTA 4MIOA 1LC0A 4QXMA 3WG9A 3EK2A 3ETGA 4A73A 4U6SA 1E7QA 4DBZA 1GPDG 3AOEA 2RH8A 3HN7A 4OXKA 3CPSA 1M2WA 3BMQB 2IXBA 1Q1NA 1NX6A 1T1RA 2E82A 3RUFA 2EWMA 3IKVA 2OOSA 4OAQA 1R37A 3HWRA 4RPHA 2AXQA 3ANNA 5LCXA 4Q3EA 3V8BA 2AE2A 2PGLA 1LRKA 1L7DA 3GHHA 4AJHA 3L6EA 5C7OO 2C20A 1HYGA 1I01A 1VM6A 4MVJI 3U4HA 3PLNA 2BF7A 2F00A 2WD8A 1E5QA 4KP7A 1X14A 3ZWVA 4CLRA 4ND5A 4BGEA 5JW6A 3F4BA 3AOGA 4JK3A 5TJ9A 5DT9A 3OEWA 1Y8RB 3LC7O 2I66A 4FW8A 4B3JA 3SJUA 4FJ2A 1OFGA 3C85A 2PKRA 2WYWA 1NAIA 2DUUA 1XLTA 1H5QA 1JVSA 3F1LA 1N7GA 3K5PA 4Q3AA 2P91A 3RKRA 3U5TA 4OL9A 2O3UA 2V7PA 3BYZA 1QXSA 2X9GA 2TMGA 2EW8A 1F8GA 1YL6A 1QYXA 1DRVA 2Y1DA 2X6TA 4O1MA 3ZV6A 5BSHA 3NRCA 5AQ1A 4UREA 3RUEA 1VI2A 5CG2A 1GCOA 1WNTA 1OOEA 4ZQEA 1ZMTA 1K6IA 3NYWA 4NIMA 4DRYA 1CDOA 4OSOA 1PGPA 3FSRA 3WDSA 4Q3NA 2P5UA 1XGKA 3PYLA 3RJ9A 5IN5A 3VZSA 1MX3A 1Z73A 1QMGA 1P33A 5L7YA 4IS3A 1U2GA 1ZNQO 3DZIA 3RQSA 2VZ9A 1B2LA 2W2KA 5L51A 1VSUA 1GQQA 4FFMA 1I36A 1UDCA 1GYRA 2OBNA 3NAQA 1E3JA 3JD3A 3DHYA 3KUXA 1YQDA 4OOFA 4RF4A 4ND2A 1O95A 3AI1A 2VNAA 3PXXA 3QSGA 5CP8A 5JDIA 1ZK4A 4DC1A 4B3HA 4AJ1A 2IZZA 1R15A 4IUYA 2J8ZA 2VYND 3JQ6A 3E18A 3F5SA 1E3EA 4DBVO 2GERA 4CODB 2VQ3A 1K0UA 5C7IO 2JD0A 1LSJA 1KVRA 1N1GA 1KVQA 1QSGA 2CDBA 1HF3A 4RQUA 1PJLA 4Q3DA 1H93A 1RM5A 3JD4A 4PFJA 5TC4A 3WSVA 5A9SB 1GEEA 5BSFA 1D1SA 3PHLA 1C14A 4GH5A 1HYEA 3NDJA 4I1IA 1GQYA 4BO0A 3DBHA 4G81A 4OGWA 5FF9A 1E3WB 3OFSA 4JQCA 2WYUA 4NI5A 3NDRA 3KETA 3PTZA 2FMUA 4NK5A 4UVDA 2UYYA 3JQ8A 4IM7A 4RJTA 2GN8A 1OMOA 1QV7A 2LDBA 5H82A 3W4JA 3GK3A 4CMHA 2W4QA 1D4FA 3EVNA 4PLVA 3JQGB 1A9ZA 1JDJA 4OOEA 1DB3A 1DLIA 2E48A 4RVFA 2X0RA 3GHYA 2VYVD 3L4SO 2Y0EA 3MJ4A 5KTKA 2D5AA 1EBUA 4QECA 4D79A 4P22A 2R2GA 3DFUA 4UVIA 2AMFA 2FOIA 2JFFA 1YXMA 5DOVA 5C37A 4IGEA 4R1UA 1ZXLA 4Y8VA 5DNAA 4DA9A 4K9DA 5TJHA 1HKUA 4PCVA 5A06A 1EUZA 2BFPA 4Y9DA 1T2DA 2NACA 4JXKA 4XQEA 1NNUA 4E5NA 5A3VA 3C7AA 3KB6A 4TROA 3QA9A 3B1KA 2H5LA 4Z3DA 2OP0A 3RCBA 5JAZA 1ZXBA 4DMMA 4D3FA 2VUSA 3WLFA 4IXTA 4QFCA 1EE9A 4IMPA 2ZATA 5JAQA 5I7EA 3WMXA 4TRRA 4F45A 1TXGA 2VNSA 3GEGA 3VZPA 1ISGA 3Q0EA 4NHEA 4WCFB 1EEHA 1PQWA 2F1KA 3G1UA 3U0BA 3X2FA 2QRLA 1GQ2A 1ISIA 3KSDO 5BQFA 4EYEA 1BMDA 1BVUA 4P4GA 4DQXA 1ZSNA 4QTZA 4NJMA 2EF1A 4U0JA 2BMAA 2BD0A 3JD1A 4CQLA 1E7WA 1DBVO 4EJ0A 3V2GA 4BKQA 4KOAA 4NJOA 1DIHA 4OQZA 4DWVA 4IJWA 1GYPA 1F14A 1DAPA 1GZ4A 4IINA 4DC0A 1DLJA 2Q4EA 3ZV5A 3GR6A 2RBEA 2G82A 1N9GB 4IXWA 4E5MA 4FFRA 1XELA 1LDNA 4L9RA 5ER6A 4BNKA 1PGOA 1U4SA 4YRBA 5K6AA 4D43A 3RIHA 3DZHA 3OJOA 1I33A 2EKQA 2Y0DA 3H5NA 4BKOA 4R9RA 2C07A 6ADHA 1E1NA 1EVZA 4BS9A 5THKA 1H94A 3DAFA 3E5MA 3HDJA 4FPXA 4E13A 4J4TA 5CHEA 4CLRB 3E8XA 3G79A 3WWZA 5TT0A 3U4DA 1KS9A 2VT2A 3VPHA 4GVXA 2PGDA 4CV2A 5F5NA 2WMDA 3TZKA 5KCZA 3K2BA 4Z0TA 3E9MA 3ZHBA 2HUNA 3GDGA 4M55A 4YQYA 4KUEA 2HQ1A 1AN9A 3G0OA 4L0QA 1KEUA 3PGXA 2B35A 4C4OA 3DO5A 4HNHA 3FTPA 5AXAA 1E3SA 4ITUA 5EERA 3JTMA 2PH5A 4DIFA 5AOVA 3KO8A 4FS3A 1X0VA 2D0IA 2YZ7A 3K6JA 2CNBA 4JNKA 5H81A 1EFKA 2C54A 3Q2IA 4XX0A 4O0LA 3OMLA 3VH2A 3C1TA 1G6KA 3SBOA 1SEVA 5ICMA 4KWHA 4ZQGA 3NT5A 4EDFA 3UW3A 1V8BA 1YOVB 3GRPA 4H7PA 3C24A 2JJYA 4IIUA 4PG6A 3D4PA 4R5HA 1HE4A 5A9TA 4E2YA 4Y6SA 5TF4A 3FWNA 1G0NA 4PLWA 2BKAA 1HDXA 3S2GA 4NBTA 4BO3A 1DIBA 4IDFA 2I76A 5DULA 4DPKA 3AUTA 3GMSA 1YKFA 4I9UA 2GF2A 1TT5B 3PHJA 5C3MA 2PA3A 1XYGA 3WBBA 4RF2A 5CDUA 1ZVMA 3RUAA 4A5OA 1XWFA 3LDHA 3DQPA 5A5FA 5JAIA 2HRBA 5A1TA 3DOOA 5I7SA 1K6JA 3IL2A 4A2CA 2P2SA 2PLAA 5AXCA 4BO1A 3WNVA 4HP8A 3MWDB 5T8KC 2AHRA 2BI8A 3BMNA 4HADA 4WNCA 4R69A 1FMCA 1WPQA 1RWBA 2O3QA 2NU6A 3ANMA 4PLPA 4QSMA 4CM4A 4E21A 3EHEA 3AU9A 4NBWA 4BQRA 1FF9A 1HDOA 1UXGA 1QG6A 3TOZA 4R41A 3W8DA 4TWRA 1G1AA 4A27A 4RORA 3ORFA 2FSSA 3CE6A 1HEUA 3Q9UA 2B36A 4U5QA 3AWDA 3LT4A 4CQMA 3FF4A 3HNPA 4MVJG 4Z9XA 3JQ8B 5B12A 2AA3A 1NTOA 1QYDA 3WQRA 3QQPA 4HY3A 3TOXA 3WJAA 3JQCA 1LDEA 5A5EA 3PJDA 1LRJA 1OAAA 4OH1A 4FDAA 3ZW9A 1DC4A 1ENZA 3GOHA 4ILKA 3KOUA 4GKVA 4QO7A 3SC4A 1PWXA 2CDCA 1V3UA 3JV7A 1WXDA 1ZSVA 2DQ4A 2J3KA 3E6AA 1OZAA 4YVFA 4E30A 1Z74A 2OUIA 2VRCD 2GLXA 1KYQA 4O5OA 3Q11A 4B4WA 2C29D 4CQMB 2ZB7A 5L53A 1UXIA 2R00C 4CR8A 3INTA 3IAHA 1VL6A 3M1AA 3VH4A 2ILTA 3K31A 3OICA 1SNYA 1YB4A 2YFHA 4IDEA 3PEFA 1U9JA 4E5KA 5K9ZA 3CH6A 4WEQA 5JAMA 1LQTA 1A5ZA 1I3NA 1E1MA 1RYEA 2ET6A 3ROQA 4MP3A 4NJMB 3PQEA 3VPSA 4CQLB 3FNEA 3TZCA 3IJPA 2VN8A 3L77A 3PZRA 3PRJA 4A0SA 1V35A 3ZHYA 2J5RA 1CF2O 1OC2A 2J5KA 2NQTA 3Q9NA 4PG5A 1EQUA 3A4VA 2YFQA 4FB5A 1K6XA 2B83A 2RHCA 4GGOA 1GUYA 2VHWA 2QRJA 3RBVA 2IYPA 2Y1OA 1P1KA 4DQUA 4IQGA 3OJ0A 4KUHA 1WVGA 5AVOA 4FGWA 5G0SA 2FSVA 1CQIA 2UDPA 1EUDA 4RQTA 3IP3A 3KLPX 4Z9YA 1HLPA 4XRRA 3U4CA 2WDZA 4BNTA 2VRBA 5TQVA 1TT7A 2WEKA 1LRLA 4FJ1A 4B4OA 1PJCA 4WE3A 3RUIA 2VHZA 1EDZA 4MKRA 4K26A 3BHJA 1I10A 5U1PA 3RJ5A 1P0CA 1Q7BA 2GZ2A 5L9AA 4OQYA 3KEQA 4FJ0A 1DRWA 1AE1A 4XIJA 3VPXA 4YR9A 5JBIA 4F6CA 1F06A 4W7HA 3VOSA 4GSKA 2B5VA 3C1AA 3OM9A 2ZKLA 2ZB4A 3HB4X 2WTBA 2NADA 2ZQYA 3BA1A 5IDXA 3GUCA 3SVTA 1FDSA 4J3FA 1T2CA 2PD6A 3CUKA 1O5IA 3IUSA 2X9VA 3SJ7A 1Z75A 5JCJD 1L1FA 4AJ4A 4E6PA 2DT5A 4DVJA 1D1TA 4II2A 4DLLA 1C0PA 2EV9A 2FPPA 5IAAA 4BO2A 8ADHA 3O03A 1GZ6A 2CUKA 3O8QB 4K1LA 4GX0A 3PDJA 4WLUA 4BNNA 4J43A 1R4MA 2PH3A 1X1TA 3MCVA 1P1FA 4IDDA 1LLQA 3IOYA 4EZBA 4R51A 4BNFA 1QLHA 5ITWA 3P5SA 3VTFA 2GYYA 4HXYA 1Y7TA 5LC1A 3PWZA 2GNAA 5FI5A 2X7HA 4UULA 4YJDA 4RO0A 1TA4A 2PK3A 4UUOA 4DQVA 2GGSA 4KZPA 3RC2A 4J9UE 1K5HA 3ABIA 3NTRA 1DO8A 4P4LA 4OXYA 1R12A 4UVGA 3WGYA 1HSZA 4JJIA 1N5DA 1YBMA 4LK3A 1XU7A 2NWQA 3H5RA 1PGQA 2FY8A 4J4BA 4PLCA 1I3KA 2B37A 2EGHA 1Y1PA 4BV8A 5F1OA 1ADBA 3QP9A 2D1YA 1X7HA 3OIGA 2JCYA 3VPFA 2AEJA 2QIOA 1ZEJA 1GAEO 4YEDA 4TRJA 5TIIA 3BMOB 4IDGA 4L73A 5BSEA 2VCYA 3EZYA 4R01A 4NU6A 4NPCA 5JPIA 3I9KA 3C7DB 1B0AA 1O89A 3P19A 4CLOB 5GZ3A 4QFDA 3EUWA 4GAEA 3WGZA 3FD8A 4H16A 1LLCA 3DAGA 3TSCA 1LJ8A 1T1SA 2VWHA 4AFNA 1DFIA 1H9BA 1Y9EA 3HFSA 1P3DA 4R16A 3MZ0A 2D5CA 4D41A 1MLDA 3I52A 1FJHA 4KQXA 5GMOA 4RZIA 1E7SA 2DUWA 5JY6A 4YT5A 4J49A 2HDHA 4B7CA 9LDBA 1C1XA 2JCVA 3X2EA 2VHYA 1ORRA 1MP0A 4PRKA 3OP4A 1E1KA 4M86A 1XEAA 1Q7CA 5ITVA 1X0XA 4OIMA 3LF1A 2OORA 2O2YA 3N7UA 4XJTA 4PLTA 1AHIA 1WMAA 3ENNA 1Z82A 5L4LA 4ND3A 1P1JA 4RLSA 3KXDA
chains in the Genus database with same CATH superfamily
2YQ4A 3RAEC 3A6ZA 4KE8A 5C53B 1R6VA 4BAUA 2XRYA 5JAPA 2CXNA 2FFQA 5GZ1A 3AKEA 3X0DA 4B48A 3P0IA 2P79A 3GNSA 3GLHE 2AOTA 3HU1A 1X1SA 4N7RA 1AKUA 1O95D 1KC3A 1Q17A 4TWIA 1KI9A 2DBYA 1P74A 4J0QA 3DAPA 1DC8A 3OA1A 1X13A 2C8JA 1OVMA 4ZVTA 2WUDA 4YL0A 2OP1A 3D8HA 4YI3A 4NR0A 4X95A 4JP3A 2C8KA 3FIUA 2WTAA 4RE6A 1K92A 3KHTA 4NFYA 2SCUA 5ALNA 4FTWA 1SCAA 1QCZA 2QGZA 1L7AA 4CM6A 1Y1SA 3VHXA 3GZNA 2CL7X 4INOA 2AW5A 5DLJA 2IYRA 4EJFA 1VKRA 3ZZ0A 4FWIB 2G0AA 4J29A 2HU7A 2I6GA 1EWQA 3T0IA 1XDBA 3VR6H 2R9RB 5JS6A 4R0NA 4RTSA 5BVHA 2I3ZA 3OIUA 4ZV7A 4QA9A 3L6RA 2QG9A 1RQGA 4MUNA 3IE1A 2ZE7A 4JBNA 3WX0A 3DNFA 1NMEA 2B2XA 1KU6A 1N33B 1PLJA 3F3KA 3NGXA 2CBZA 4YV7A 1NULA 5JANA 3VTKA 2IQ5A 3G7SA 1QHIA 2OTCA 2XA1A 3H2BA 2G5GX 2IYWA 3TTXA 2XPCA 2KSFA 1RQLA 3IMCA 3CLUD 4K03A 4U7GA 4EGSA 3HZRA 1Z88A 1SA0A 2CXPA 2I2WA 5DPMA 1O2DA 5JDCA 2JIMA 3LDGA 2R8ZA 2XIQA 3COVA 1T4BA 1YFLA 1NSFA 1BS1A 1DOVA 3P7MA 4NG5A 4ND8B 1DAOA 3MAAC 3CKYA 1QHGA 1AKRA 4UEKA 2XECA 3LM8A 1MA0A 3SVLA 2QQ0A 3HR8A 5AC4A 4R2XA 3ON5A 4N7JA 1YULA 2V74B 3TBFA 3L0YA 1DC5A 3V34A 4BLSA 1FIUA 3AOUA 3TLAA 5DHSA 1MVLA 2AC7A 3HXTA 1V39A 2GEJA 3TG8A 1FP2A 4NENA 2L82A 1P2DA 2HLDA 3WNCA 2PD3A 3IDAA 4MWBA 2QPTA 2PD4A 1V8DA 2D62A 1DX4A 4RM2A 4EA7A 1CUSA 4KSBA 3VTZA 4GOND 5CCBA 4KMMA 2FRVA 1UXOA 2X42A 3H8JA 4CEHB 3R8XA 3MUEA 4WKOA 3VH1A 3F5QA 4B34A 1NPYA 1J0XO 3LL4A 1KK2A 2CXOA 5JFOA 3U9SA 2W2KB 1U0TA 3T7EA 1C3XA 1NNLA 4BYMA 3QIVA 1M2KA 4YRCA 3D81A 3NGMA 3RD5A 3YASA 3KQOA 4LCJA 2IEBA 4QNMA 4PRLA 2BFAA 821PA 3TQQA 3OEYA 1UWVA 3PUYA 2OBYA 1XQYA 5JFTA 1JXMA 3FTFA 5DMHA 4IXDA 5AVXA 1E3DA 3HI4A 1ECPA 1QYWA 5T8KA 3MLEA 3RKSA 4D0GA 2ZJZA 4B3SB 3QVTA 4OJNA 4RXMA 3V8VA 3RSHA 2ZJFA 3CZMA 1BN6A 2RHOA 1AHNA 4G0UA 2GPBA 4MQ5A 3H9UA 1WW3A 4QEDA 5BSTA 3DBRA 3KH2A 2A9QA 3ATPA 1H9GA 4AZ0B 1MB0A 5FH9A 1YB1A 1TYBE 5CB6A 5B1YA 3HCAA 4Q39A 4DDKA 4OIRF 9GPBA 4QUEA 4TQUS 4MH0R 3DDOA 5FI3A 3HUDA 1MCZA 3L7IA 4WKPA 1Z47A 3T4PA 3GYBA 3BFXA 1HQCA 1RKXA 3P2JA 2VJBA 1VHWA 3GARA 2P9HA 4MEAA 3F6BX 1VMDA 1CNEA 4FLEA 4A2PA 2Q21A 2Y2VA 2A5FA 3AZQA 3FAKA 3G8DA 1O8BA 4PR3A 4J0IA 3ELYA 4DCSA 3O21A 2GEKA 3KTAA 2P67A 4AZWA 1J0BA 2PGJA 4NTZA 3Q8WA 1TAGA 3LDAA 4PBTA 4WNAA 4EB6B 2EYUA 3DBLB 1XHLA 1ZW2A 3ADPA 4LTDA 1RR6A 1MQAA 3OFND 1SXJD 1RIIA 4ULVA 3L3BA 3W6PA 1XDZA 5KJCA 1C8VB 4LOIA 3LLVA 4X92A 4YDHB 4FAPB 2J5BA 2Y3IA 2CXSA 1VJ0A 4F3RA 3C5HA 3VX4A 3HNIA 3QPVA 1G4HA 2Q45A 1Q95A 3VVMA 1PYDA 3K7EA 2PUFA 4MS3A 2DY0A 2HCBA 2EKLA 3BIJA 5AOAA 4KITB 4K9RA 3N2LA 1IEVA 3LZDA 5BYJA 1YWGO 2ZT8A 4BX2A 2J59A 2F3RA 3IAEA 5EINA 2QR3A 1V8FA 2WIFA 2OU6A 1U2RA 3G17A 1ZK3A 1Z4OA 5K0JA 4CSAC 1G18A 2Y1WA 2RCNA 3O26A 4YRGA 2JBWA 4Q34A 3I4CA 2OHJA 3H1PA 2VBCA 3VR1A 2BH9A 1DWUA 1JGTA 1UBMS 1FU7A 1CKEA 1CVRA 4MRSA 2BGNA 2HMVA 3PIDA 3WZ2A 1T9GR 1XPRA 3JSXA 3N8GA 4KPUB 3OLZA 4TLLB 1JIKA 1JU4A 3VPGA 1KQ3A 5IZCA 3Q7IA 2BFMA 3OY7A 4BX3A 1T8SA 4DNOA 1X7XA 3DFFA 1ZN9A 2PMBA 5CNMA 2PFKA 4S24A 4WESA 5B58T 4JE9A 5LFAA 1QR6A 4E88A 2WINI 2JHAA 4YUVA 4PF1A 1XZ8A 4PO8A 2AR0A 3U17A 1FXWF 3LKDA 3M1YA 4D2IA 1D1CA 3QWAA 1SZJG 1NG9A 4A03A 5EVCA 3GLGE 1ZGGA 4KE7A 2EJVA 3RUCA 1E4EB 4P9FA 5KYVA 3ILHA 4KQ6A 2DRIA 1GDHA 3T15A 4EI2A 2NP7A 3C45A 1EA7A 4HDOB 4ZVVA 3QBJA 4JI0B 3LK7A 3L0DA 2QSZA 3HHEA 2ST1A 2HHHB 2ZFUA 3U49A 4NU8X 3T1OA 2G5PA 1A7EA 1XRPA 1JZQA 2CUTA 1MB3A 1KH3A 3CEMA 3QEMA 1RJ9B 3IYLW 3H1EA 4QBKA 1LA2A 3HFJA 3CQZA 5H3HA 2GRAA 4CCYA 2E5FA 1A2BA 3DE9A 4C2AA 4FQ5A 3R7WB 3C3YA 3CLHA 1EK1A 3F6YA 2PWZA 5JZVA 2HJMA 3ZCXA 2YXEA 2Z2KA 2XB2A 1KP3A 3B70A 2Q4RA 2Y76A 2J09A 1QPUA 1P7ZA 3ZHSA 5CFOA 2JCXA 1OI7A 1AO0A 3IQ6A 2PU5A 1KEEB 2Y6UA 1CWUA 2OLJA 4JYCA 5C51B 1TKRA 3DB2A 3WLOA 5SY9A 3KYDB 3I73A 3IP9A 1WABA 2YHUA 4I50F 4EFLA 4DVYP 4BEMJ 3DLTA 2C3MA 4KVAA 2WJVA 2VF4X 3IOEA 3OUTA 4I6EA 3E2MA 2AVDA 2W4IA 1JYEA 3BBLA 3BHIA 1VMKA 1BE8A 2O8NA 1UJNA 1L7EA 2Z57A 2IY9A 3CF2A 4IF6A 3UR3C 2BR5A 5ENZA 3KQKA 1ZH0A 3CURA 4FYPA 2PGNA 3VDQA 3IGFA 3K2IA 1T5DX 4KO2S 2RI1A 1GS9A 1JQDA 2XNHA 3EISA 4DSTA 4C05A 2ZAIA 3S84A 4B2LA 3O3NB 4F2HA 4INZA 4YJGB 3EZFA 4CFZA 1M1YB 5JSZB 1ABFA 3AM5A 3SHFA 3THXA 3MLBA 1RDFA 1FPQA 1AUXA 1XQXA 3CRW1 2HIGA 3ESYA 1NAHA 2WSMA 4AICA 2W6PA 4M0DA 3BERA 2CHFA 3EHMA 3SQOA 1GLVA 2R84A 4GRDA 2X7JA 1WD7A 2WJJA 1P3JA 1KYWA 1B6RA 3JSEO 3GFGA 1SFRA 4HFJA 2QB5A 1NVAA 8GPBA 5E6UB 1TJ3A 3L07A 1PJSA 4D8VA 3NP7A 4XR9A 2F3TA 2HCJB 1D04A 3EXHB 2EHDA 1HYHA 4RD0A 2Q28A 3L7YA 2FKNA 1QIGA 2O2DA 1MXFA 4CV1A 1XVTA 2HGSA 2FPLA 5A03A 5HIJA 3B0VC 3T5GA 2JASA 5B7PA 1ZOPA 5LXTF 4UTPA 4JJAA 3ORQA 2H2DA 5KVAA 4GP6A 2D4HA 3NIBA 4EECA 4XWGA 1E6CA 3RFUA 3DFMA 2E2WA 1NIPA 4BNIA 1CG6A 4FI3F 2XXAB 2R7NA 1I3CA 3RHFA 5CR9A 5KYGA 2PMFA 2QF7A 3HN6A 4DR1B 2QYHA 2UZAA 2UUPA 4EZEA 3DOJA 2WYIA 1R9GA 3MGCA 2GPTA 4KDEA 1PYGA 2X19A 3O39A 2CYDA 3JALA 2A3RA 2IHBA 4UBMA 5TARA 3WYDA 1WE2A 4NAHA 4NOMA 4EGQA 4X44A 4NOLA 3OLCX 3FLEA 1K7EB 1I0ZA 1GG9A 5K0TA 4MW0A 2NSJA 4C4ZA 1W581 5COQA 4B40A 1U3TA 3OA2A 4GEGA 3TVDA 3M2TA 2XSZA 1UJ4A 5JROA 1ZITA 4URZR 2ORIA 5E2BA 3FB1A 5KTNA 2ZJ4A 4YFYA 1THZA 3G2LA 2A1UA 1ZS9A 3H7AA 4J8PA 3LC2O 5CDFA 3I2KA 2EERA 1TZ2A 2DH5A 3QYPA 4BN0A 4L3WA 2GNOA 4K9NA 1IYZA 5BPHA 3MWYW 5LBTA 3ACCA 2YV3A 4RHFA 4TXLA 4G23A 4CNBA 4F8JA 3HJCA 4TZTA 1ZH2A 3DLCA 2ZJ1A 2WWVD 4C43A 3NBXX 1XNJA 2WWRA 4YRLA 4NEHB 4KRYA 2IZOA 3PNYA 2PX5A 4W9NC 4J3NA 1J4AA 3MVEA 1K1EA 3VMFA 3QUCA 3B60A 1EVEA 4OKSA 3O2SB 3I2YX 1RMTA 4XOUA 5IJ0B 4CDAA 4R2KA 3HKKA 2EVWX 4MKHA 4GPIB 3EGOA 4EX6A 1EK5A 1V43A 1KMCA 4WK0B 1RAHA 1YR2A 1VBMA 3PVSA 2W6IA 1AVTA 2CB9A 3B5IA 3BTUA 3IUPA 5F12A 5ABPA 5KOJB 2Q0HA 1UOPA 2J3IA 5BT8A 3D6VA 2R9VA 4U0KA 4G8JA 1JMVA 3I0NA 1GAXA 3OPXA 1GGJA 4B73A 3NPAA 2QTZA 3CMMA 1HX7A 3AKYA 1N75A 1YJAA 3RSSA 4S3MA 4MUIA 1TJ4A 3N2YA 5NLLA 5JMWA 1QTIA 3GD5A 4MIOA 3BKWA 4UPDA 4ERXA 1N36B 3UTDA 1OYYA 3A6PC 1P19A 5LYJB 3SI7A 5BMVF 2X7XA 2PUWA 5IBCA 4KSYA 2BF7A 2WD8A 1V9CA 3V4RA 4MGYR 5JH7B 1CR0A 2ZYUX 2HR1A 5DGTA 4ON9A 1KAGA 3PNOA 2X6TA 1OLUB 3MQFA 4LNHA 1XHFA 2HWYA 3W78A 3S7ZA 2X0FA 3AVVA 2JC3A 1Z73A 4C7OB 1YS6A 2ADFA 3RQSA 1W96A 4QPJC 4L2IA 3UMFA 5KTMA 4MWZA 1T0IA 2H7YA 1L8AA 3OBIA 3ODGA 5CH5A 1L3CA 1EHIA 3AERB 2GERA 1TK3A 5LQDA 3RNOA 4EVQA 4DVGA 4DBRA 2ERYA 2I22A 3OQJA 4DY6A 4OGWA 4NK5A 1Y98A 1OXMA 4CN9A 4IM7A 5KDOA 4CMHA 2W4QA 3SDZA 4D8YA 5KAPA 1A82A 1NUUA 1NOJA 1PUXA 4Q1CA 4ZVOA 3ICQB 1DWOA 5DH9A 4MAFA 4IGEA 5EIBC 3ZCQA 2QN1A 4XQEA 5LQSA 4O5AA 4LDZA 4M7OA 5JAQA 1QP0A 4Y2VA 4LTNA 3U3JA 2ZW9A 3LD9A 1ZCZA 3L49A 3L8GA 4Q9JA 3KZOA 4GBED 1GNQA 2B7LA 2G82A 4IXWA 4QI0A 2HLNA 1LDNA 4L9RA 5ER6A 3HP1A 3OJOA 2EKQA 1BVYF 2NZWA 3HNKA 4OBXA 4YJ2B 3UMJA 4J4TA 1YSCA 3U4DA 4LJ6A 5J1SB 3QKTA 4ID3A 3P0HA 5A6SB 3H2IA 1KEUA 4LVNA 4HNHA 2CLIB 2UZ1B 1ORYA 3JTMA 4DIFA 4OH7A 3KC2A 1UMBB 3T5MA 2PKEA 3PIRA 3ORHA 3VAYA 3WWDA 2AJ8A 4EDFA 5DLYA 3K1YA 3D4PA 4IKOA 2J9RA 4KQGA 3MYRA 3VR4H 5DQTA 1LGYA 4RIFA 2ZWOA 1RWBA 5E4JA 1R7RA 3BFJA 1JFTA 3W8DA 2ZSJA 4UPVA 4LHZA 2ZSBA 3T1TA 4W5QA 3WQRA 1J70A 3JQCA 2HEIA 4E5DA 4OH1A 4DV1B 1XZMA 1JT2A 4KE6A 3SC4A 4C0JA 4ZDKA 2QYOA 3JV7A 3HM2A 2J3KA 4GICA 1N6RA 2JLQA 4A4DA 2PBRA 2MYNA 2MMCA 4N6GA 1OFTA 1VSTA 4Z53A 2IYFA 3K31A 3M3PA 4IDEA 4KWTA 1PLLA 3Q5EA 1JDBC 4WEQA 5BWOA 4P3KA 4FNOA 2RGEA 4IHJF 5C81A 2RMKA 1P80A 3PZRA 3OY2A 2IBMA 1SC9A 3O1LA 4EHNA 1L4EA 4CGZA 2O2GA 3HYLA 3B3AA 3RVRA 1RRFA 1TFOB 1DTSA 3HPQA 3LEVA 2JK1A 5CU7A 1Z4NA 4U39A 4LZOA 5BSRA 3DJYA 4CN8A 4DQLA 4AWXA 3KD2A 3UXHA 2C31A 4DRJB 3S2UA 5HQTA 3EARA 1D2AA 3PPWA 2BT4A 2V7VA 2JFXA 3HY4A 4F85A 2ZQYA 2ZETA 1EA5A 1AXRA 5CGQB 1U2DC 3SJ7A 1L1FA 3K6BA 4TV9A 3R2PA 2J8WA 2I71A 3PDJA 4WLUA 2Z6AA 2AP3A 3B0UX 4ZT2A 3RVJA 1FX0A 2XSEA 4DV7B 5T41A 3BXZA 4HVAA 4RAOA 2IOHA 5IASA 4G09A 2H2GA 3ZQUA 4QOIA 4MVOA 2HSWA 2ZJAA 2XRHA 2OCAA 2Q3JA 4HPWA 4EWCA 1MHTA 4X64B 2ZYIA 3T5PA 2VASA 3EZYA 1O89A 3P19A 2V0GA 4GAEA 4HEA6 4RSRA 4E22A 2HF8A 1ZD3A 1LJ8A 4ZAVA 3KOWA 1GQFA 2XODA 4YJWA 3WZMA 4R2IA 3BQMB 3H6GA 4RZIA 5JY6A 1SUEA 2VHYA 3ASYA 5FBWB 5LA6F 2YTZA 5EWMA 5L4LA 1QZUA 1YZHA 5BYKA 4N6OA 4TV8A 4DM7A 1RC0A 4YCNA 1C2TA 2HPHA 3QH4A 2FFRA 4QARA 2Q7OE 3C6QA 4LDQA 1YA7O 3FBGA 4U5BE 3NANA 5IYZF 3T41A 3ZWBA 5JTUA 4EJ6A 3VV3A 5CT8A 3CC8A 3S55A 3E22A 1OV6A 4Z4IA 2O8EA 5DM4A 2ZRNA 1YH3A 4C88A 1D7OA 1RJEA 2WPDA 3D2AA 1Z8DA 4OK5A 5IARA 2GNPA 2G3YA 2V9ZA 1P2BA 2D2IA 2QLNA 2FN7A 5DNVA 5CI9A 4DWWA 5C7LO 3WP1B 1C8BA 1Q5PA 1RAIA 3Q3IA 4ZGBA 3R7CA 4I81A 1L5YA 1UBRS 2FPUA 5A6BA 3LUFA 3GRRA 4WGYA 2MHRA 3DV0A 2J0EA 4ND7A 2KWIA 4WNIA 4RVGA 5TEWA 5CLIA 3ZVRA 2ZT7A 3PLRA 4AY6A 4B3DA 5IN4A 1W76A 1DJQA 3R3YA 2ATVA 5ALKA 2RD9A 4HXFB 2E5LB 3RI3A 4D9HA 2JIOA 2DHDA 2GARA 4LZJA 3DA8A 4RVCA 1B8PA 1JBQA 4R84A 1QH1B 3ETEA 4WFIA 1T5HX 4D9NA 4ZV4A 3LBYA 4P6VF 3E0XA 1XTVA 3Q15C 4H7KA 1M76A 4EMTA 2OILA 1U2ZA 1VSVA 1H7IA 3GM2A 2JAQA 4P3OA 4RCZA 1W0JA 2O8DB 4QZVA 4TS4A 3OX3A 2XNDD 4F2WA 3KHUA 5F1PA 3PR2B 2XRMA 3O3MB 1KXZA 2NZ2A 1JIIA 2GZ3A 4GOKA 2HMYB 5EWLB 1OU4A 4JWKA 3WDMA 2GPJA 2YXLA 4YAIA 3AILA 3WYBA 3IULA 1GRQA 1Z2EA 3KDSE 3KAPA 3LRTA 2O3RA 5J23A 1ZMRA 5B4TA 3OZEA 3WIBA 4W1QA 5KWEA 1J0EA 3IVRA 2JIPA 5BY2A 1AQ6A 1O77A 2J0WA 3PIIA 3T1VA 4MW9A 5KX5F 2AVKA 2ZWIA 2HWWA 3U7RA 3X2QC 2IYNA 1KFEB 4KQWA 5HRUA 3LHFA 1N1EA 3O38A 4DCMA 4JTCB 2OG2A 3FNRA 1H2ZA 2Z3ZA 4JI5B 4HV4A 3WC4A 5A5GA 5F64A 3WZLA 1RFGE 4MVJE 1Q0DA 4GVLA 2HHAA 2BFWA 4IJQA 3LT0A 3DZAA 4W1PA 1TFUA 1UQTA 3A4NA 1UXKA 3ONDA 3U2QA 2QTVA 3DR3A 4M0CA 5MGBA 1Y42X 3KAKA 4WZAB 1YAHA 3K66A 1I1HA 2P8JA 3ADOA 3OJXA 1KTVA 4R1SA 3TEFA 5IXSA 2POQX 1POWA 5BNFA 1HT2E 2P9CA 2IYXA 4C0WA 3VOTA 1IJKA 3F6RA 4NTBA 5FLEX 1RI3A 1N5LA 3IDQA 4BC0A 3DMGA 3RWBA 3TWOA 1JR2A 1MRSA 4ND4A 2FSHA 4RPKA 2BMEA 3IHLA 3PRYA 1PX0A 3RSCA 2LQGA 2PNOA 2ACKA 2OZKA 2W71A 1CGNA 3ZBQA 1KOJA 3LOPA 1N77A 2H9IA 3GJYA 1HT1E 5AI6A 4PXAA 3LYLA 3GA7A 3RF7A 3Q0IA 3B6EA 1ZVZA 4GYKA 4CIAA 1NN5A 4F5ZA 1JQEA 2NP6A 2R00A 3HXKA 3QF4B 2AF4C 5FFFA 1Q1GA 3MM4A 1E9EA 2FAXA 4GE3A 1KPGA 2QE7A 5IJXA 3DMPA 4HUQB 1R5BA 4G5SA 4BRUA 4KXMA 1R5ID 3TE7A 1Q2UA 4RTKA 2EPLX 4DN6A 1LLDA 3FFWA 5AVJA 1Y8QB 1OJLA 2GTHA 3CLKA 2QP9X 1H2EA 1JDVA 2R7VA 1ZHYA 2CCYA 3TAHA 4BRSA 2RIPA 1YQGA 3NKFA 4B81A 2Y1XA 3QVVA 2PWBA 4S1TA 4US2R 4CGYA 3ZYZA 4MA5A 4AMUA 3LLKA 1OWLA 3J81k 2EDCA 2Z5GA 3GRCA 4LG1A 2QAIA 3TINA 2ONKA 1ICEA 4L57A 1Q57A 1B23P 1Y8AA 5DNYB 4QLBA 1XLVA 4AJ9A 1E8NA 1NZJA 2ZXFA 4E2XA 3VZCA 3B1VA 4M99A 1ZVKA 2KGOA 2QP3A 3NOXA 5EJ2A 1YI1A 3DXFA 2REBA 4JMPA 5GINE 3HJUA 2QX4A 3ZQVA 4BIMA 3K1AA 4RD1A 2CFTA 4II7A 1M0EA 2RBKA 3MWGA 4AJEA 3WLSA 1NSTA 2EKPA 4A6DA 2NU9A 4EGFA 3GXOA 2ZI4A 3HCDA 4RGQA 3UY4A 2K6GA 5C31A 2HWUA 3PQ2A 1RXYA 3U62A 1DRKA 3RQFA 4YAGA 3KQYA 3PT9A 1A8IA 4B84A 5KNBD 4MQ9F 4EHBA 3EDOA 1X15A 1IZZA 1ZYRF 1PJAA 2HSQA 4N7MA 1CY7A 1KO5A 2VUTA 1QVXA 4OHUA 3ROMA 4U9DA 2A33A 721PA 2QDXA 4EVIA 1IZ7A 4YCMA 5IVHA 3GPCA 4ZICA 4FM9A 1AQJA 3ETLA 1QNLA 1JFFA 1ODFA 3NU1A 2P90A 1O97C 5FEMA 121PA 4MGKR 3BWMA 1T36A 1D3AA 4PYJA 4XE5A 3CRMA 4PHGA 1B68A 1AA6A 4C30A 3GRUA 1WG8A 3IAXA 3PYMA 4BJ6C 2C2YA 3GNLA 4H6PA 2PZFA 4UTZA 2QLAA 5EPOA 3Q8XB 4XRGA 1K27A 5D3MA 1QRUA 3GBVA 1Q6YA 3SMQA 1KMHB 2ZSHA 3SFTA 2WU3A 2QVLA 4IIGA 4KMSA 4XPIB 3A9UA 4HKTA 1SUIA 3WRYC 3OCJA 4F4BA 4YMGA 3F2VA 3JVEA 3FUCA 1HE3A 4KRGA 2NM0A 2A78A 1YZFA 4DE5A 1PGJA 1IK6A 9LDTA 5CA0A 4OHYA 2WHQA 3U3DA 2IE8A 3PK0A 5E0KB 2QN3A 4WJKB 4MS2A 1LVGA 1GAJA 1P1RA 1JR8A 3IPYA 3VDXA 2Q4OA 1U6IA 1TUBB 4C3EA 5ADWA 4WQMA 3FSGA 4C0KA 1R6XA 1SBHA 2HLDD 5HJ7A 4J7UA 3VDNB 4FOOA 3JD0A 1YB5A 2FFAA 3K33A 2HDNB 1ZNWA 3DTYA 4LDPA 5CK5A 3NKDA 3L01A 3TD7A 1E2GA 2H51A 4RJKA 2R05A 4RWZA 5K7SA 4UBJA 3QPWA 3BT7A 2W6QA 4XUCA 1ND5A 2X5NA 5EEHA 4ENVA 1RYDA 1NWCA 1SR8A 2HQSA 4IDCA 1BG6A 4CHGA 3LQRA 2Q0SA 2FP4B 4DLVA 1WY7A 2VPYA 2BBSA 2XMQA 2ZPAA 1X7ZA 4Z4CA 4XIFA 3NAMA 1DKMA 4ABTA 1Y1RA 1QFSA 1ZHXA 2RHRA 4JJZA 4RH1A 2PR2A 1J2EA 5KIAA 4IIBA 3IPCA 1PZNA 4NZNA 1UDBA 2W5UA 1JKXA 1W34A 1V7CA 1OFHA 2E4ZA 2C7GA 1ZW3A 1FC0A 4BNLA 4XLZA 2XMZA 4PO1A 3OIDA 3L43A 1LZKA 4BO9A 5CM2Z 1G42A 1JHMA 4WN9B 1QORA 3H5VA 2YOFA 1PL7A 5CNKA 3U0VA 4D0LB 4KL8S 3R6TA 5HF5A 1V4BA 3ZD6A 5BQ3A 3TR6A 1G5QA 1MKYA 3SLGA 1D6MA 1FY2A 3F46A 4HFRA 5BP7A 3RYCB 2FX2A 3O8QA 1JZSA 4Y2JA 1IC6A 3AG2C 1LPOA 4M87A 3L7AA 1C0IA 3KT8A 3HCRA 1YD7A 3PPIA 1XYVA 1PDWA 1KY3A 1X1CA 5F51A 4MQLA 4G7ZF 2OQMA 1GCGA 1PZEA 1EUQA 3CPJB 1OT5A 4KXXA 3AY3A 1I2MA 3L7CA 3QU9A 1ZMXA 4M8SA 3D0QA 3KR0A 1G2OA 5EWJA 1Q3KA 1YBHA 4RPJA 4X7MA 5AJZA 4F4HA 2QRQA 1A4XA 3C7CB 2OYSA 4IJ6A 3P9XA 1VPTA 3COWA 1XZBA 1TLFA 4RCYA 2B9VA 3EVZA 3HH8A 3HMKA 2P6NA 3G6WA 1KZHA 2H0AA 3EDQA 4ZO6A 3N0XA 4XLNF 3WKDA 4Y1FA 4AP5A 3O8OA 3GP3A 1WCIB 1JXQA 2ZITA 4H6VA 1OILA 4IBOA 3R3ZA 1J8DA 4QTXA 3M9LA 2X0NA 4FYKA 4GYJA 3L7NA 5DBOA 4TYPA 2VDRB 1C7ZA 2QVBA 3I1JA 3HBLA 1IY8A 4PJJA 2NXWA 2VBIA 3I42A 4JUIA 3FFAA 5C1IA 3T4UA 2ZXOA 1IZ9A 4G5HA 1JS1X 2VPPA 5MN4A 1XF9A 1NWHA 4PAQA 1NOIA 4X1OA 3RTBA 2R0QC 2ZRKA 5HMLA 3F5MA 3D3WB 3VYTB 2IEYA 3T3OA 2B34A 5F7JA 1H6BA 4U9EA 3DC7A 2L6FA 1M66A 3VO2A 4JEUA 1IVNA 4OHFA 3EXEA 2XE8A 4QYTA 2P65A 1N1CA 4JI8B 4P4TA 1XD2A 2ZVJA 4YIKA 1UJCA 1KH1A 1AXGA 3EOAI 3ZCTA 1YNSA 2Y27A 4XB2A 2KYHA 4C7JA 1CDDA 4DLZA 3M4CA 2BZ1A 4B6IA 3HI6A 4BFWA 1PNOA 4E5SA 2XZOA 2ZRBA 3QEKA 4G4JA 1H6DA 4JLUA 4ZARA 4TT3A 4XEKA 1G17A 1XZEA 4TWZA 3OP1A 4YECA 1UJ2A 1X8JA 2GHRA 1X92A 2C3PA 1N6IA 1E79A 1MMNA 3HZZA 5IXYA 4P7FA 3RBAA 5DVWA 1XRLA 3LGXA 1P0QA 3DHVA 1NUPA 4P58A 3QZCA 2B3TA 4AJPA 5LBUA 4GE0A 5A9SA 3OSUA 1YGYA 1KVSA 4L8FA 4MHTA 1KDOA 4W8KA 5JCJA 2GD1O 1Z6YA 4R5MA 1I4WA 5ALMA 4WCVA 2R60A 2R87A 4IILA 4P6IC 3BCSA 3WSTA 3RRFA 2VQ6A 2P9EA 3CX8A 3RSFA 2RK3A 1OW8A 3EXIB 2RJNA 4TL9A 4Z2AA 2HK9A 3U60B 1ML4A 4BATA 2QVZX 1J09A 3KVOA 1AGPA 1L7NA 1R4AA 1TMYA 4RMIA 4I99A 3WG9A 3H19A 4A73A 3PFNA 1PAUA 2IV3A 1C3JA 4MA4A 3REQA 1T1RA 1FSFA 3PF8A 4RPHA 3EZHA 1O57A 2GEDA 5C7OO 1VM6A 4W5RA 5KYUA 2QX9A 3A36A 3ZDXB 1U90A 5EYPB 3KX2A 1CRQA 3FVQA 4UM9D 4ZHQF 2XMPA 4MV4A 3ZXSA 1YL6A 1DRVA 3ZV6A 3GFRA 1OOEA 1QK4A 3AFHA 1TM1E 3DOUA 4Q3NA 3II6X 2R8OA 3GEPA 2COUA 5JPCA 2ISQA 3V7WA 5K3CA 1YQDA 5E1DA 3PXXA 3QSGA 3HGTA 2C3OA 5BOSA 2IZZA 2RI0A 4IUYA 2OKUA 1F3LA 2EFJA 3JQ6A 2E0IA 3KXKA 3AR5A 3QG1A 1NOKA 4C06A 2JH9A 1DMSA 4RQUA 5TC4A 2OEXA 2ORYA 4P3PA 3I2HA 3VJMA 4HAZA 3CAXA 2JB9A 1SBTA 4KR6A 4XEVA 1HW2A 4IH4A 2XNSA 1QTRA 2EL9A 2O8BA 3ZDAA 2OOKA 3EN0A 1JU3A 3PXAA 1D9XA 1F20A 2AMFA 2Z5FA 4QOGA 5DOVA 4W9MC 2B0CA 2WHPB 4JY7A 1TAUA 5AKIA 3B36A 2BFDB 5A06A 3SF8A 3PUIA 2NACA 3COJA 1XL0A 5DVZA 2R6FA 1ZXBA 4QYIA 2ODEA 3WLFA 1TW2A 3WMXA 2YKZA 1W5EA 2NPOA 1QGED 1EE1A 2OV1A 4U0JA 5IH7A 5C3UA 4NJOA 4B3XA 3CUWA 2WLTA 4B1FA 2CLOB 4RULA 1DAPA 3CVUA 4WZAE 3K9CA 5EQTA 3ELBA 4BLPA 1MABB 1KZ4A 4MVZA 4Y3UA 1DG9A 3C2QA 3AP1A 1M34B 3B6KA 1QRDA 2G9RA 3EASA 4IUBS 4BS9A 2YZNA 2R2AA 4B8YA 1CUHA 5JQGF 1TJYA 5CB8A 4P3NA 4ES6A 4W5OA 4Z0TA 2V8BA 1OFIA 4KUEA 3BGDA 1VLVA 3CT4A 3IEEA 1MZVA 3IIKA 1AC5A 3E7DA 1THMA 3SEAA 4J03A 3BE4A 2QSUA 3WDKA 1U94A 4JXZA 3V7UA 2LV8A 1KYIA 4PG6A 3OOWA 5TF4A 2YWAA 1CSEE 4UZEA 4F9FA 1HDXA 1SVKA 5KYNA 3AUTA 1G6OA 4X24A 3TGPA 5JAIA 2IOFA 5I7SA 1K6JA 3D7RA 2AHRA 2A0WA 2AI3A 3BMNA 2XHEA 1Y89A 1HV8A 3KVRA 4E21A 3LRXA 4PS1A 3TX6A 3FA2A 4A27A 5C1DA 2XSZD 4U5QA 5DHUA 4QVKA 2PUGA 1T8UA 3QGMA 4D4IA 5DNWA 4MWSA 3WJAA 1BX3A 1LDEA 3AIMA 3PJDA 3OZAA 3ZW9A 4DLPA 5ALSA 3K1IC 3DCYA 2BEVB 4A3SA 1CK4A 2KQUA 4O5OA 421PA 2C29D 4K9SA 4EIYA 1NU9C 2JIBA 4KBGA 2BZ0A 2XLBA 4FONA 1S2GA 3ZQ4A 2I6SA 1Z63A 4Q7MB 1FQKA 3E1SA 4P2BA 3RC3A 2J5RA 3NP9A 3DEZA 4DCUA 2IYPA 2Y1OA 3TW4A 3L8CA 5DKFA 3IP3A 4AB1A 4MTFA 3ZY6A 4HQRA 2QMOA 4FINA 3FFBA 5CB4B 1HNWB 2J9GA 4EPWA 3KXIA 2VRBA 1SHKA 1VECA 4ARZB 3VNUA 1WBJB 3IP5A 2YJTD 2OHIA 3CRVA 3MT7A 2IHYA 1RFLA 1X2BA 4AKGA 4IUCS 3Q8KA 2W6ID 3NHUA 4PCLA 3EFOB 5IAAA 2QRGA 2CUKA 1XK7A 3JS5A 4XWWA 4QGSA 2IUSA 4Q1FA 3MCVA 1P1FA 3F7OA 1RHQA 4RKEA 5DI3B 3VTFA 1YR8A 5I5EA 2C5FA 1G5RA 5EXDA 1Z17A 4UUOA 2HX1A 4OJYA 1R12A 4ISBA 1N5DA 3IQXA 3N75A 3CRNA 2H1CA 2F6RA 1Q0UA 1F6BA 3HO6A 2C97A 2KJQA 2AEJA 4RTOA 5DHTA 4JHLA 1MRZA 5AI8A 5EKDA 2ZUSA 3IQEA 3SCZA 1P2FA 2UUAB 3O9MA 2RSEB 4OBBA 1J7KA 3W9UA 4CSAA 1E7SA 1W0KA 3A9SA 2FW9A 1MP0A 2FMHA 4MMZB 1GNLA 2GA0A 1Q7CA 5B1DA 1FNDA 2ZBPA 1F4PA 4LBWA 1XTSA 1Z07A 3GFPA 3MMZA 1SBYA 2PGXA 1TUEA 5KYYA 2BGLA 2LUOA 1JAYA 4PC1A 1V3VA 4ZYTA 4ADSG 1NNEA 1NXQA 4ALJA 5F2NA 5J2UB 4M1WA 2H54A 3HRKA 3F3YA 4XVUA 5GJBA 4TUYF 2EPMX 1X3SA 2O7RA 1KAOA 3PL5A 1UFKA 1XAHA 1AKTA 4INJA 4AC9A 4WCFC 4UAUA 2PR7A 2BH2A 3W5SA 1YRBA 3UBMA 1S8OA 5KQSA 1JHOA 4JXXA 4WWHA 2FYTA 3FPJA 4TLAA 2HF7A 1W2HA 2ZE8A 3ZWYA 1UC9A 5IS2A 3SWWA 4K6HA 1LDYA 4YMHA 3L1HA 5FA8A 1PWYE 4JT4A 5DBIA 3MMSA 3U4MA 3D5QA 5HKLA 5G0WA 3ZWMA 3KSRA 1UWKA 1U6JA 4A2WA 2UUOA 3GFFA 3HJAA 3R4VA 1ZGCA 4YRAA 1T6IA 1UKAA 1Z23A 4B4UA 3BZUA 4O02B 1A76A 4KN8A 2EAUA 4CKCA 2VHEA 4PJLA 2GAJA 2I4OA 3BPSA 2WZFA 1K5GA 3H97A 1EVJA 1MXHA 4RZQA 1DELA 2P9QA 3E03A 2PWPA 1P4RA 1OJ7A 4RJJA 3AF1A 4CJXA 2E37A 2C03A 3VPBA 4Y6LA 1G9TA 1K8QA 5JJIA 5KKNB 3LO5A 5EE0A 3ADKA 2E9SA 4JJFA 4V0RA 2WUFA 1O6ZA 4RWEA 4GECA 1E89A 5FD8A 1MX1A 1PNTA 4K0DA 4Q12A 1M10A 2V6JA 3PQDA 3RT1A 3I83A 4IO0A 3CU5A 3WNDA 4QGAA 5FNZA 1T6ZA 5BV2P 4J91A 4HQNA 4BWYA 2HSEA 4KQ2A 4KIFA 1IHUA 1KDZA 4Y2SA 2UYOA 1M54A 4OQQA 3LP5A 2JL1A 2LSEA 4LGCA 3GCZA 2GCOA 1I6LA 1H8EA 4TX1A 4KWIA 4JB0A 5EZ5A 3GJ6A 3VO1A 4LF9B 4MVXA 1ZI8A 3H9BA 5C1OA 3C0KA 2ZUDA 1AV7A 1RMYA 1RXUA 2VZ0A 4GLLA 5J5AA 4FEGA 5JS2A 3PNKA 2WJPA 4N03A 2A9VA 4TSKA 4RTNA 1TR2A 1M6HA 4BFLA 1A9TA 3MLAA 3EQ6A 3Q2OA 5EOVA 3CCFA 2HA7A 2BE5F 4M21A 4KKVA 5HHTA 2Z08A 4OB7A 3RUHA 1O03A 3BEDA 3JD2A 5FYDA 4PZ0A 2EXXA 5CPFA 3AVXA 2XLCA 2NSFA 3F5DA 3DPIA 1CRPA 1YGPA 4AO6A 2VPZA 4OPMA 2MMGA 1W8DA 1TM7E 4WBNB 2R44A 3GDOA 3L18A 4F4JA 1E84A 3X43A 3VU3A 1OI3A 3TLGB 3B3GA 4PLHA 4DKJA 4M0PA 1VFPA 5G40A 1QV6A 1Z56C 1PZFA 4AP6A 4C2TA 5T6MA 5AH0A 4BTLA 4HR7A 2QNLA 4AZTA 3TB6A 1QFZA 4JWTA 4WLNA 1OVGA 4I7EA 1GXSA 3S2EA 1VJ1A 2JFGA 1XRNA 3MPOA 1ZH6A 2OQVA 3T9OA 3AF3A 1NLYA 2O1EA 2W00A 2OJQA 1FP4B 2P62A 5M29A 2O57A 5ELLA 3O31A 1JILA 4MKIA 1T3LA 4GBMA 3KKPA 4G1EB 4WLOA 5ADUS 1X1BA 1YS4A 4YCJA 2YHAA 4DSAA 2BE7A 3HUTA 1UKZA 3CCCA 3OPNA 1ZO8A 1Z7EA 4NYJR 2ZANA 4YI5A 2Y4NA 2P69A 4LRQA 2F1JA 1LLUA 2PZ8A 5GIOE 3T95A 2YHIA 2YY5A 4EO4A 4DR2B 4YUXA 2C9BA 1HFWA 4JC8A 2C84A 4BMSA 2MDTA 4HAWA 4TTPA 4Z9HA 2I9KA 2XF8A 2JLYA 3AW9A 4ZU3A 3DW3X 1CUUA 3FCUB 5AVSA 5G0TA 1SCUA 2OCDA 4MR7B 3B6JA 3HR4A 4JC0A 3O4FA 5KC8A 2A58A 1ZUHA 1WZ2A 1Y4CA 1YDFA 4CMCA 2HW8A 4RKQA 5TNXA 4CM4B 1N8TA 4XM1A 2G5CA 4WLVA 1WZIA 4L9AA 1DXHA 1F12A 4JH0A 4JQSA 4L72A 2Q3TA 3A1DA 4UHFA 1IWOA 4ZQIA 2WPDD 4W9NA 3U4QB 2BTOA 4L1KA 4AL4A 5A04A 4ZRMA 2X15A 4JV5B 1TO2E 1D8TA 4N18A 3QOYA 5A6BD 2FPIA 4MV0A 2G8NA 1Z16A 3TKLA 3ZZMA 1YZKA 1A4UA 1WV0A 3I34X 4E2ZA 5BURA 4W5JA 2NUPA 3DVRX 4H77A 5BV0A 4ZAWA 4F8EA 1E2LA 4Y6PA 1C7QA 2K4MA 1PQYA 4HSGA 1QS0A 1G7TA 4PQFA 3SVZA 2O5CA 1U7WA 4QUIA 4LRXA 2LFDA 3W7BA 2HMTA 3AW8A 2I99A 3OPMA 3H2GA 1W6UA 2ZRHA 3FGOA 1GITA 3CGGA 4JYPA 5I9SA 1IG3A 4BP3A 1Q7GA 4KEAA 4RXUA 4XGIA 1JJBA 3MQ2A 3UAXA 4PFPA 1H1DA 1ZUNA 2BEJA 1C2YA 4FHDA 1BEZA 1NI4B 4G5GA 4C7VA 4LEIA 1W0JD 1WPRA 4FDMA 3FY4A 3AESB 5LB2A 5KSWB 4ZCSA 4NH0A 3D3NA 3B82A 5KTYA 3JVIA 2J07A 1TMGE 3PI7A 4IRUA 1AN0A 2YS6A 4PNZA 1W93A 2JFHA 4DDHA 2QZPA 3S90A 3EUEA 3JYHA 1QR2A 4YA6A 1AT1A 3SHOA 1XU4A 5AK4A 5H02A 3X3HA 4MINA 2JFUA 4KBFA 4U2EA <