4YT2A

Hmd ii from methanocaldococcus jannaschii
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
343
structure length
343
Chain Sequence
NMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
total genus 124
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt2A01
1UZMA 5FF9A 1WVGA 3MOIA 4YAGA 1NTOA 4L4XA 4MVJP 5L4NA 2C5AA 3K6JA 4Z9XA 4J91A 4U6QA 2D3TA 3HFGA 3OHSX 4R51A 1QMGA 2PZJA 2JHFA 9LDTA 3HJAA 4CLDA 3V2UA 1ZMTA 3UF0A 2V6GA 4TZTA 3ROQA 3U49A 5KJFA 4KUGA 2CF5A 3ZNQA 4W9NC 3I9KA 5A5EA 1PS8A 4PLVA 2V7PA 1DLIA 1OFGA 1V8BA 2BGKA 3NEPX 2Q2QA 3A1NA 4AJLA 3LT0A 2RHRA 4A27A 2VYND 1BSVA 2PD3A 3NJ8A 2VUSA 3TF5A 1N1GA 4FSHA 4PLPA 3QVOA 5C7LO 1ONPA 4CLHA 3EZLA 2Y1DA 1X1TA 1MXHA 5DP1A 1MFPA 4MPDA 2B36A 5DT9A 1U3TA 3OJFA 2ZYGA 2YZ7A 4L4RA 2DTEA 3K73O 4Q3CA 2VRBA 3BMNA 4TSKA 3PJFA 4A0SA 2BRUA 1UDAA 4GMGA 3PDUA 1DIAA 2P4HX 5JDIC 1BVUA 3SC6A 3AI1A 4A10A 1ISMA 2GCGA 3W8DA 1K5HA 1ZSVA 2B4QA 4LW8A 2NSDA 4ALKA 4CM8A 1DSSG 4EJ0A 1ARZA 3MJVA 1I3LA 4IZIA 1O8CA 1R0KA 3EVNA 4QUKA 3WFIA 3WWZA 1IYZA 3DBRB 3S2EA 4M89A 4BO7A 2G76A 3JD2A 4FW8A 4MIYA 5TJ9A 4DLAA 1A27A 1CERA 1IE3A 2X5KO 5ENVA 4YDRA 4E6PA 1XSEA 2PGJA 5THQA 4AJKA 5G0SA 3L4BC 4Q39A 4FC6A 5CEJA 2UDPA 2V65A 1R15A 1A9YA 4WCFB 5AYVA 2GUGA 1E7QA 4NK5A 2VHZA 4R69A 5L7WA 4R9RA 2BKAA 3UCEA 3L07A 1RYEA 2O3SA 4R3NA 4CPDA 1ZIDA 5LDHA 3ICCA 2PZKA 4YJHB 1YOVB 1FDSA 4LISA 2Y68A 3IDSA 5B4UA 4YJHA 1YOVA 2J8ZA 4FCCA 3RUHA 3M2PA 3RUAA 3HHPA 1YB1A 1UDBA 4JCOA 3PXXA 1B2LA 2W2LA 1RPNA 4XZ3A 2AQHA 3K9QO 3MCVA 2PA3A 4UAGA 3D4OA 4D43A 4XX0A 2PZLA 5A06A 3SJ7A 4URFA 3AFMA 2AG8A 5TT1A 5JSFA 2FP4A 2VT2A 1H9AA 4Z0PA 3WWYA 1SOVA 3JQ9A 4E2YA 4J7XA 1U2DA 1U7TA 3JSAA 1U2GA 1QSGA 3JD3A 3RUCA 4CMIB 2I66A 3H2SA 1F06A 3TZKA 3OIDA 5C3MA 2AG5A 1AGNA 1JQBA 1XEAA 4M54A 1T4DA 3VH1A 1ISGA 2D8AA 4J2HA 4IZHA 3O38A 3D3WA 4PLCA 1NVTA 4GMFA 3BTSA 3RKRA 1DFIA 3CPSA 4MJLA 4YAKA 1BWSA 4XA8A 1YL5A 1DJNA 1EVYA 1DPGA 1T26A 1VI2A 2IXAA 4HNGA 2Y1GA 4GGPA 4KQXA 3VTFA 2FPPA 3HB5X 2X7HA 3B70A 3JQCA 4MVJI 1E7WA 3OP4A 1HDYA 2H1SA 2IZZA 1V9LA 1JU9A 3O8QA 4GLOA 1QV6A 4J2OA 5T8KA 5AXAA 1E3WA 3GHYA 4ND5A 1TT5A 5COAA 1R66A 3LC1O 4YBZA 5A3JA 4XB1A 2ILTA 3QWAA 4PLTA 1SAYA 4FJ1A 4U5QA 1VL0A 2FHSA 1Q7CA 3OQ6A 3KYCB 1ADGA 2FZEA 4QEDA 5TSDA 1E7RA 2AEMA 2AXQA 2DT5A 4LK3A 2Q1UA 2RHCA 4KQWA 5KOIA 3Q9UA 4Q3DA 4DREA 3GZNB 5KJCA 1XCBA 4J90A 5A4DA 4CV3A 1UDCA 3QJ5A 3GZNA 2ZYDA 2DTXA 1JAXA 3R3SA 1GR0A 5F5NA 1DC3A 4FB5A 1E7SA 4G5HA 3U3XA 1GPDG 4JBIA 5FI5A 1HDOA 1I3MA 4B4WA 4DL9A 4EDFA 4OKIA 3DL2A 2P9GA 2W98A 3OEWA 2C5EA 1Z45A 4GSLA 3H4VA 3QVSA 4EBFA 2X9VA 3LF1A 3WDSA 4YAEA 1A4UA 5F21A 2EJWA 5F1PA 2HCTA 1KOLA 4O0LA 5DCUA 5DOVA 4EUFA 2JAHA 4DPKA 4I9NA 1LC3A 4WCFC 1UXJA 3EZYA 5EIOA 1ADBA 1E6EA 3NX4A 1GQQA 3I9JA 5I9LA 2GZ2A 5JYDA 1UXHA 3D4NA 1ADFA 1LDBA 3H7AA 1E3IA 1EZ4A 3DBLB 3RBXA 3EC7A 4IDEA 3STHA 1K6JA 3ZZNA 4ESOA 2YDYA 4GWGA 4E30A 1N92A 2VHXA 3F6YA 3GGGA 2BMAA 1BMDA 1R4MB 1MV8A 1V3VA 2XPCA 3RWBA 3ZGYA 1UP4A 1LDGA 4U0KA 4ND3A 4NBVA 4OSPA 2WTBA 5A9RA 3DMTA 3ENKA 5GMOA 1QP8A 4IJWA 3W1VA 1M75A 1R4NB 2OP0A 3KSUA 4TRMA 1O95A 3DONA 4KTVE 4XKJA 3WLEA 3DBHB 3KRTA 3JD0A 5BR7A 2QG4A 1QLJA 2JCXA 3B6ZA 5IZCC 5J23A 1GV0A 2WD8A 4RPGA 1NM5A 1P33A 5JO9A 3KB6A 3DZHA 5ICSA 2NQ8A 2ZQZA 2WSBA 3QLJA 4BUCA 3JV7A 2EERA 1PQPA 2EV9A 4EJMA 2QYTA 1KERA 2TMDA 5ICMA 2JD0A 1F12A 2QQ5A 1HYEA 4TQGA 1R6DA 4JN6B 5KCZA 2VZ0A 3PQEA 3LDHA 1KYQA 1UP7A 5A5FA 2BFMA 4R01A 4CLEA 2VZ8A 4WLFA 6LDHA 2DVMA 5H82A 7ADHA 3A28A 3FHLA 5B4TA 2D5AA 2GD1O 2E48A 4E33A 3FBGA 3E48A 5CDSA 1E6WA 3U09A 3KUXA 3IUPA 1JKIA 4FGSA 3KEOA 4OXYA 3PWKA 4W7HA 2B0JA 2AQKA 3RBZA 4CM1A 3PGJA 1XG5A 5THKA 5KTKA 1GDHA 3RFTA 1PR9A 3DHYA 5KVCA 1DRWA 2J6IA 1CQJA 4K6CA 5F5LA 4PG7A 3JQAB 4N54A 3ASVA 2DBQA 3NKLA 1ONOA 4RF2A 3H9EO 5JDCC 3DHEA 3IKTA 1ISHA 3JTMA 5H83A 1T1RA 2P68A 1XU9A 3WR5A 3HN2A 1AHHA 4BB5A 4XD2A 3IJPA 3GEGA 3WGOA 1XU7A 3V2GA 3E8XA 1Z75A 1BW9B 1WLYA 4RJTA 4WK6A 4UULA 2YV3A 4MP6A 4CM9D 1SBYA 2Q1SA 3VKUA 1IHYA 1T2AA 2EW2A 4J6FA 1GY8A 1HE5A 1Z74A 1EBUA 1ZEMA 4R5HA 3VPSA 1EVIA 2EIHA 4WOJA 2PWZA 3GZ4A 2EXXA 2HU2A 4J3FA 3E18A 1NBOA 1B3RA 1T2CA 4UREA 4O63O 4YWJA 3PIIA 1XIVA 5JAMA 4I8XA 1C0LA 2X86A 3NRCA 3D4PA 2VTDA 3MJSA 2NVUA 4RQTA 4MKRA 3ZNPA 4AJ4A 4E4YA 1P45A 4FR5A 1Y7TA 4OMUA 1HDCA 3OJOA 2P2SA 5ENDA 5C5IA 1W6UA 3EAGA 4UVGA 1YE3A 3S8MA 3FI9A 3ZU5A 3GOHA 5LC1A 7MDHA 4J7UA 1QORA 2Q2VA 4M87A 3JD4A 1R0LA 1DIBA 2OHXA 5MDHA 1MG0A 3WQSB 3C7CB 4IXWA 2IRWA 3TZHA 1DAPA 4CM3A 4BO9A 1UZNA 3KZVA 2GRAA 4WLEA 2ZIZA 1ZK0A 4NBTA 5TJHA 3RC7A 1EFKA 3NTQA 4NJOA 4BKRA 4BO4A 2CNBA 2Q4BA 3VHRA 1D4FA 2PKQP 4OOEA 1KEUA 1ZK2A 4CLOB 5L95A 3DFZA 1WP4A 5IG2A 2VCYA 2X23A 3GT0A 4L74A 4YJDA 4NFSA 3WTCA 4BNWA 1HSZA 3WJ7A 3OQ1A 4J1QA 4RPLA 4BOYA 4CMKA 1EE9A 3PTZA 4YVFA 4BB6A 1E3EA 1SEPA 2AW5A 3UFXA 4CV2A 2GYYA 3NTRA 4GX5A 3QIVA 4JBHA 3P2OA 3MTJA 4BKUA 4XR9A 4BNFA 4E3ZA 3A4VA 1ISFA 4YACA 1K2WA 4U6SA 1J0XO 1QRRA 2HMTA 1W4ZA 2IYOA 3ULKA 4A26A 3UUWA 1FDVA 4K28A 3AUTA 1PWZA 1GZ3A 3UN1A 3GK3A 4YT8A 5TNXA 3CKYA 3FCOA 3W8FA 3HZZA 2NUAA 1SB8A 4L0QA 3GG9A 4GBJA 4R3WA 3QWHA 2ZCVA 2EGGA 2NLOA 1QKIA 3ZWOA 4D0SA 4A2CA 3AOEA 4NIMA 1C0IA 4YEDA 2IODA 3S2IA 3G0OA 4WJZA 4XRGA 1F8GA 1ADCA 1X13A 5A9TA 2J3KA 4MIOA 4L4SA 3GRPA 1EUDA 3EY4A 2OZPA 3PJGA 5ES3A 3U5TA 4DBVO 3O9ZA 4BO6A 5B4VA 2PNFA 4RPJA 4RORA 1K3TA 4K6FA 4RF5A 4A5OA 3PFWO 5DCWA 4DQVA 2VWGA 4IM7A 4KWHA 4Z9YA 5JY6A 2AA3A 2I99A 4D3FA 1LLUA 5GZ6A 2O7QA 3SLKA 4MP8A 3NT5A 3AI3A 2WMDA 4PLYA 3DZKA 3JQBA 1JVBA 3IOYA 1D1SA 2EKPA 3PZBA 3WGTA 4ZGWA 3DBVO 2O50A 1LU9A 5BNFA 1QXSA 2JL1A 3M2TA 5JY1A 4XYMA 1X0XA 2DUUA 2ZB3A 1NAIA 1HXHA 2Q4EA 1WWKA 3OF2A 1LDNA 4B7UA 2WE7A 4JJIA 1H6DA 5B1YA 5MGBA 1VKNA 2W90A 4EYEA 3JYLA 4FFMA 4JLWA 4XGIA 4XQ9A 2YUTA 4FJ0A 1WDKA 1E7YA 2YHUA 4INAA 3GR6A 4DUPA 3OM9A 2OGUA 3DWFA 1C1XB 4W9NA 3AFNA 3WFJA 4YCAA 5KNLA 4Q3NA 4HX5A 3D0OA 1PX0A 3HDQA 3ZWMA 4PIVA 1HETA 2O3JA 1QYCA 2JFHA 2E4AA 4S1VA 4ONEA 1ENYA 2NTVA 3H9GA 1U3UA 3GDFA 4TROA 1YDEA 3P2YA 1CWUA 2DQ4A 5IN4A 3RD5A 3RFVA 3WNQA 3SEFA 4CR6A 3NUGA 4FFLA 4LRSB 4GX2A 3F46A 3PLNA 1PS9A 4FFNA 5JDIA 3N74A 4ALIA 2A92A 2QYSA 3D3EA 4PG6A 5CPFA 3F5QA 5G4KB 3PDJA 1U8FO 2RCYA 2PKQO 1K6XA 1LC0A 4N5NA 4TVBA 1BXKA 4MVJF 2R00C 5KJ6A 1B15A 1GUFA 1DOHA 4BMVA 3QHAA 2O3RA 4DLLA 3AJRA 3S55A 5IDQA 1HKUA 1T2FA 1PQWA 3MJEA 2OBYA 3NDRA 1CF2O 3Q9NA 5IF3A 4MKXA 4Y67A 3JQGB 2JFGA 3BHJA 1LSSA 1PGPA 3ANMA 4EZBA 4MVJG 2BH9A 3M1AA 5KWEA 2Q1TA 3LT1A 2NVWA 3L4BA 4EUHA 4RF4A 1NXQA 3KSZO 3H3JA 4OQZA 1B8PA 4E12A 1DIHA 3WXBA 4CJXA 5COQA 3ZWPA 4P4LA 4IS2A 3FBTA 3DO5A 3TN7A 4AJHA 1N2SA 4EEXA 4ROSA 4EITA 4LCEA 1DRVA 5EQFA 4YRDA 2DTDA 3HDHA 4TVOA 3D64A 3CZRA 4GGOA 4HBGA 1E5QA 3GN1A 3N58A 3UOGA 3E6AA 1NQOA 1VLLA 1LSJA 2I3GA 4KUHA 4RPHA 4W7IA 2W8ZA 1YO6A 4BNZA 3TWOA 3E82A 5BQFA 5HBRA 4H3VA 4U0JA 3VC7A 3BMOB 3B1FA 1UH5A 5C37A 3F4BA 4B8WA 2YQ4A 1LX6A 1SEVA 1A71A 1OAAA 3EW7A 1UAGA 1Y9AA 2AE1A 5ADHA 1Q1NA 4NBRA 4J0EA 2G0TA 5GY7A 1GZ4A 3EVTA 1GPJA 5JCJD 5CDUA 5CPBA 3HNPA 3ZH2A 1JWAB 1ZW1A 1T2EA 1H5QA 1YVEI 4ALNA 4IDBA 3D5TA 3IC5A 2H9IA 2HK7A 2Y05A 1JAYA 2HRZA 5A05A 4CM5A 1H94A 4IGFA 4LSMA 1GUYA 1XQ6A 5G2OA 4CMBA 2NVBA 4OGWA 1P1KA 4IY1A 3LLSA 2HUNA 3MWEB 3U4HA 3IIEA 3ZWXA 2B4TO 3S1LA 1GQ2A 1NFRA 1Z73A 4NMHA 2BGMA 1B26A 4WLOA 1ZKMA 4IGEA 4MVJA 1A5ZA 1T2DA 5I8ZA 3IP1A 1EQ2A 3VPFA 1FK8A 3CZMA 1KY5A 3CUKA 1Z82A 1U8XX 1GL3A 2CDBA 3JQ7B 4DIFA 3ZNOA 1TEHA 4BQRA 3NT4A 4NBUA 5DOZA 3QA9A 1Q0HA 3GMDA 2NTJA 4YA6A 3F1LA 4RDHA 3AI2A 5TF4A 4R9SA 2VOEA 3WOHA 1B3BA 4AG3A 4BNKA 3MZ0A 1JDJA 1YL6A 2EKQA 3KHUA 1J49A 3JQDA 3TNLA 4I5GA 2JCVA 1LTHR 4WLNA 2BGLA 4CM7A 2RAFA 3QVWA 4W82A 4GX1A 1ENOA 5JC1A 1OOEA 3FNHA 2PY6A 1JLLA 4P8RA 3IUSA 3VH3A 2D1YA 5ER6A 4YAIA 3ORFA 3KXDA 1SC6A 2Q3EA 3DBRA 4XJSA 3SVTA 3K2BA 1E5LA 3ONDA 3R6DA 5DP2A 5H81A 4NH4A 4BNIA 3P5SA 1FDWA 2RIRA 4UVDA 4CR7A 3JYOA 1TLTA 4WCFA 4I9HA 1BTOA 2HO5A 1DXYA 4B3JA 4YJGB 4AJ2A 5CHEA 2ET6A 2SCUA 3FD8A 2NV6A 1I2ZA 5TRTA 2NADA 4FJ2A 3GUYA 5JAQA 1LA2A 4Z3DA 4AJ1A 1WMAA 4IXTA 1YJQA 1ZK1A 1B16A 5TQVA 2UUOA 1B8VA 1NX6A 1Y81A 4YJFB 1QR6A 4AJNA 5K6AC 3R0IA 3DAPA 4PG5A 6ADHA 2E6UX 3L6EA 5KVSA 4I5EA 1UR5A 3OEYA 3RC2A 3FWNA 4DIBA 3KYDB 4LRTB 1KVSA 2X5OA 2P5UA 5BSFA 4UUMA 1U1IA 1J5PA 4OJNA 1E1MA 4L73A 3W4JA 4CMEC 2Y66A 1UZLA 2ZQYA 3F47A 5G4LA 4Z0TA 3RAJA 4BGUA 4QQRA 5IZCA 2UAGA 4C7KA 3GG2A 4WUVA 4OO3A 4L9RA 1S6YA 4CMIA 4CUKA 4FQ8A 1H0KA 4E2XA 2BLLA 4CQMD 1PZEA 4ZQHA 4J0FA 1SNYA 1LRLA 3SXPA 4R41A 1DIRA 5CP8A 4XB2A 4CL8A 4KUEA 4PCVA 4BO3A 2D0IA 3RCBA 3QP9A 4AL4A 4XJTA 4IDGA 1W0CA 3TJRA 3E9MA 4KMSA 4NJMB 2EWMA 1B0AA 4JGBA 1U3VA 3VOSA 4J9UE 1GCUA 1T1SA 3WYEA 4DVJA 2OP1A 1PJ4A 4FS3A 5L45A 4O6VA 3QE3A 3F3SA 3B20A 3KM0A 2XOXA 1WXDA 1S7CA 4HFJA 4JROA 1IOLA 4I5FA 2VNAA 3RU9A 1LDEA 2YFQA 1H2BA 2GN9A 3WGGA 8LDHA 4PGFA 2A4KA 2NNLD 1YL7A 3WLFA 3ZWCA 5TC4A 4PLWA 4BGVA 4JNKA 3AM4A 5CG2A 4Q3EA 5ER9A 3LVFO 1CIVA 3KYCA 3AK4A 4LSWA 1L1FA 2O2YA 4O5OA 4W99A 1NPTO 1MFZA 1U5AA 3KLMX 4MINA 4OKNA 3WG9A 1NHWA 2FMUA 4DC1A 1R0SA 3WSVA 5JCXA 4RVDA 2C7VA 1NAHA 1ONNA 3BMQB 1ZK3A 3AM5A 1PL8A 3E9NA 3IQDB 4CMHA 4Q9NA 2VZ9A 5JDCA 4IJUA 2O3UA 5I7FA 2YQ5A 4BNYA 5B37A 3AUSA 1GADO 1MA0A 4K9DA 3MJTA 4BO5A 4XQCA 5AOVA 4L8VA 4WEQA 1ISJA 1EK5A 1X7HA 4B3IA 1F0YA 2ZB4A 3PHHA 4GPD1 1PQUA 3HN7A 3W4IA 4DC0A 1L7EA 3WQQA 1DHRA 2FN7A 3PFFA 3INGA 3MTGA 5EMHA 3GQVA 5JO0A 3AY6A 3DHNA 4OQYA 2BFAA 3WS7A 3L77A 1HE4A 2Z1MA 4Z9FA 4GH5A 3JQ8B 1O0SA 1P77A 4LCJA 4H16A 2YY7A 2P91A 3DBLA 4NQZA 3GLQA 2GPTA 2E49A 1NWCA 3F9IA 4JQCA 1ZH8A 4M55A 1IZ9A 1WNTA 1UXGA 4NDNE 2D59A 1R4MA 5T6BA 4NBWA 1GAEO 4IQ0A 4D79A 1PSDA 1TXGA 2C20A 4LGVA 1R16A 1KETA 4F6LA 5I7VA 3JYQA 4BO1A 3UH1A 1E1LA 3ONFA 4K26A 2W2KB 1R4NA 2VRCA 2VUTA 1C1DB 3WMWA 4NFYA 2W2KA 2FPIA 4XWYA 5BT9A 1EVZA 2O4UX 3DBHA 2H6EA 1WMBA 5KIAA 3ZN2A 5IXSA 1BDMA 1EEHA 1YB4A 3T4EA 4EI2A 5EESA 3RC9A 1G1AA 5AXCA 2B69A 2Y0CA 3KLPX 5GZ3A 1IHXA 3E03A 4XEHA 2B5WA 1HYGA 4J1SA 1YONA 3ETGA 3VH2A 3OETA 5DNAA 3AU9A 5F1OA 3RROA 1JA9A 3UGKA 1VRWA 3I23A 4DPMA 2YYYA 5TT0A 1GEEA 1C0KA 1E7MA 3HB4X 5G0VA 2O2SA 3AUAA 1GU7A 1ZBQA 4TKMA 1OZAA 2HJRA 2X0NA 3ENNA 4ALMA 1F17A 2EGHA 2PGDA 4J43A 5GZ1A 2DLDA 3OFSA 1X14A 1YH3A 3FNFA 4IBOA 3GEMA 1U3WA 1Y9EA 4U8GA 5TS3A 4E31A 1LLQA 5DBFA 1CRWG 3DFUA 3H5RA 1HZJA 4RVSA 3PP8A 4JXKA 4IJVA 1LSUA 3U4DA 3BIOA 3WIEA 3K5PA 1VL8A 2R2GA 3NGLA 4BNGA 3BMCB 3JQAA 2VYVA 4WPGA 3FR8A 3FSRA 2GR9A 2V6FA 3FNGA 4IQ8A 4CM4B 2CUKA 5U9CA 2C2XA 4XCVA 4FD3A 4TMFA 4R68A 2AEJA 4RQUA 4FBGA 1PL7A 2EG9A 4HADA 1JWBB 2HMVA 2YV1A 2CDCA 4BNJA 2GO1A 5CG1A 4CLXA 2CVOA 1ENZA 4P38A 2PFGA 3DZBA 1BW9A 1MUUA 1BDBA 3T7CA 2UVDA 4WASA 4F6CA 4XYEA 1HL3A 4B7XA 1PZGA 1HLDA 1CDOA 4BGIA 1YJ8A 3CIFA 1NHGA 3RUFA 1YKFA 1RWBA 3I9MA 2PZMA 2VYNA 3VZSA 4BKOA 2YHIB 3C3XA 3JQFC 3KTDA 4HFMA 4D7AA 2HRBA 4BKQA 4JJGA 1M76A 3Q11A 3WB9A 5A9SB 3HE3A 3DAGA 1BXGB 2P5YA 1HDRA 1DO8A 1LRKA 2NQTA 5A02A 3ON5A 5A9SA 2B5VA 2PTGA 1DHTA 3RJ9A 2ZB8A 3ZWWA 3X2FA 3VZQA 1AXEA 2J3JA 4S3MA 4ZN6A 2JHGA 3UW3A 5I8WA 5JFOA 3FF4A 4ZICA 2HQ1A 3LYLA 1NVMB 4R1UA 1Z7EA 2I9PA 1KC1A 3BHMA 3R3JA 2Y93A 4ZVVA 2X22A 1DIGA 1PWXA 4EUEA 4GLLA 4I1IA 1IL0A 2CVQA 2W4QA 4UEKA 4XDZA 4J4HA 2Y1FA 3Q6IA 1DB3A 3O4RA 4BO2A 2J5RA 3K92A 2HMSA 3ADPA 4GQAA 1R37A 4JJFA 4OHUA 3TQHA 4GL4A 3AM3A 1VSUA 4DLBA 4MO2A 1L7DA 1X15A 3GY0A 1XA0A 4MIEA 2A94A 3HWRA 5F3RA 1EMDA 2IZ0A 5DBIA 4CLOA 5I7SA 5KKCA 3JQ6A 1I3KA 1X0VA 2GZ1A 2QRLA 1H9BA 1N5DA 4ZA2A 2Y1OA 3VZRA 5EPOA 4MOWA 3I4FA 3NV9A 4IJKA 1QYDA 3QQPA 3GGPA 5DF1A 4DXHA 1QV7A 3W6UA 1LXCA 1PGJA 1V35A 1E77A 4A03A 4E2ZA 2RBEA 3TZ6A 1NR7A 1B7GO 2R00A 1HRDA 1XDWA 2VN8A 1U4SA 3WGZA 3BTUA 4CLRB 5LDGA 1FMCA 3HUDA 1DFHA 4NZ9A 3FR7A 3DOJA 1PJCA 3PJDA 2W2LD 1T24A 1LQUA 4BGEA 2VHVA 2FSVA 2IYPA 4WGGA 2OOSA 4BKPA 1U7HA 3UCXA 3KV3O 1RM3A 3ZNNA 2OFPA 1Q7BA 2IE0A 4PZEA 3W8EA 3OSUA 3R1IA 1WZEA 1U9JA 2DUWA 3U4IA 3PQDA 1UUFA 2H63A 4RVFA 4TRJA 4DWVA 5CEFA 2DBZA 1MC4A 1AHIA 4UEJA 5T5QA 2ZKLA 3LC7O 4E5KA 4Z6KA 5ILGA 3GNSA 3WTBA 1RM0A 3EYWA 2GZ3A 4OSOA 1ID1A 4IQGA 3GDGA 3H9QA 3UVEA 2C54A 1NR1A 3GVPA 4BNVA 3GHHA 1Y6JA 3V1TC 3IKVA 3AWDA 3CINA 3VVCA 1LUAA 1ULUA 5IDXA 3QV1A 4FPXA 3PYMA 2B35A 2EW8A 2PH3A 4QFCA 2O48X 1O5IA 3K96A 3WJAA 3OIGA 1D7OA 3L9WA 4AJJA 1ZXLA 5IN5A 4BVAA 3A14A 3HFSA 5K9ZA 5EQDA 1Y8QB 1P31A 1HTBA 2LDBA 3WX0A 4M86A 4PLFA 2P4QA 1HYHA 3F4LA 4II2A 4F45A 1LRJA 3WBFA 5TIIA 4HY3A 2ZTLA 4PN3A 1LNQA 2XAAA 2FSSA 2JD1A 1A7AA 1ORRA 3WQRA 4N5LA 2DKNA 3C7DB 4NI5A 4B7CA 1YBMA 3F1KA 2CY0A 4ZHSA 4RVHA 3I9LA 2I65A 4QO8A 3OICA 3EHEA 3ZWYA 1SOWA 4DA9A 1NFQA 1IUKA 2B83A 4LVUA 2VT3A 4WKGA 3ZDFA 3UCFA 4XYLA 3LC2O 2WE8A 4YAJA 1Q2XA 3VTZA 4RLHA 1LEHA 3PEFA 5IAAA 4JK3A 3PVZA 4N18A 1N7HA 3LSYA 4XIYA 1C1XA 4GSKA 4D44A 3FPLA 3GDOA 4BHTA 1H2HA 2JAPA 4RF3A 5K0ZA 4H15A 1GEGA 3VAZA 2GERA 4E5NA 1G0OA 1E3LA 2IXBA 2EF1A 2Y0EA 3ONEA 2WEKA 4FGWA 5L53A 2BHLA 4B4VA 1QLHA 2ZK7A 3QSGA 4WE3A 3RIHA 3AOGA 1JW9B 3BXXA 3PWZA 3NTOA 2PKRA 4MDHA 1ENPA 1V3TA 4PVCA 1H93A 4G65A 4NU5A 1PJBA 5BSGA 1K0UA 5HS4A 4DIOA 4PRKA 3ANLA 3AY3A 4RCVA 5G4KA 3QWBA 1I30A 2CMDA 3ETEA 2NACA 3BYZA 1UXIA 2WYVA 3PLRA 3RKUA 2IEDA 4IDFA 2GF2A 3DEYX 5TGDA 2QHXA 4E5PA 2AEFA 4KTTE 4ZRNA 4CUJA 2BD0A 5AQ1A 3DQPA 1I36A 2WD7B 1E92A 1HLPA 1NQ5A 2DAPA 4MVJM 4YTEA 3MWDB 4D42A 2WD7A 5L9AA 3JQGA 5JAZA 1ZVMA 4DQUA 3NGXA 1U4OA 2CVZA 1BGVA 3ZWNA 4IMPA 2QIOA 1GYQA 1XQ1A 2AHRA 4Z3KA 2BI8A 2DFVA 1KIFA 5G0WA 4RL6A 3P7MA 4DMLA 2EP7A 2J5QA 5JW6A 2X9NA 4BS9A 3E9QA 4PRLA 1YQDA 1X1EA 4DTIA 3ZW8A 4BNNA 3AY7A 3BTVA 1ZMOA 3ZV5A 2HSDA 2P9CA 2GASA 2JD2A 4GX0A 1ZJYA 4UUNA 3ITKA 1NQTA 4XR4A 5DN9A 3JYNA 4XDYA 5CEEA 1AE1A 1PGQA 3PQFA 1XHLA 2ZTUA 2QRKA 3BAZA 5K6AA 2UUPA 3M6IA 4XYBA 4OXNA 3BTOA 3DR3A 3EK2A 2FRDA 3TRIA 1HF3A 3DZFA 2G17A 3KYBA 4R1SA 3ST7A 5CDTA 3BMOA 3S2FA 1U28A 5KKAA 2EJVA 2VNSA 4PFJA 1P1JA 2WYUA 5T64A 1ZFNA 2OBNA 1IB6A 3H5AA 1YDWA 3JYPA 4ND1A 4CMEA 4E32A 4YRBA 1KVRA 4BNUA 1EK6A 3NDJA 1CEQA 5BNTA 3ICPA 4IMRA 2EEZA 4AJEA 3RQSA 4PLZA 3GFGA 1SPXA 5ITWA 4UVHA 3G49A 4DRYA 1PJ2A 1ZZEA 4UUPA 1GUZA 2QZ9A 1P74A 3H3FA 4RV9A 2HK9A 4XIJA 3UKOA 3WICA 3W4KA 1H6CA 2Q99A 4RGBA 4GVXA 2HJSA 3K30A 2OO5A 3COSA 1QYVA 1WW8A 2AQIA 4KOAA 3OH8A 1HE3A 3TPCA 2X58A 4TWRA 4W6ZA 1WZIA 3M1LA 5IFLA 2OXIA 1HDXA 4YQYA 3ZHBA 3T4XA 3JQ7A 5I9MA 1FJHA 2BI7A 2I5PO 5L4SA 2AMFA 1KY4A 4TZKA 1EDZA 1YB5A 1GD1O 2AE2A 1CJCA 2I76A 4CM9A 3DXFA 4NHEA 5DBGA 1ZK4A 2RH8A 3WMXA 4FN4A 5B12A 3NT2A 1VE9A 4GI2A 1O9BA 1ZO8A 1W8DA 3GVCA 4KZPA 4M49A 2O23A 1PZHA 4XGNA 3TOZA 1SMKA 1P0FA 3D7LA 1EE2A 5HS6A 1E1NA 2F00A 1E0DA 3IAHA 3C1AA 1T25A 4E5YA 3DOCA 4E13A 4DMMA 2ZB7A 3VVBA 2EKLA 2J3HA 2DPGA 3BMNB 2D5CA 1DLJA 1EQUA 4PZCA 4YT2A 2YV2A 4YRAA 3INRA 5CDGA 2WJPA 1DAOA 1VJ1A 3K8ZA 2DFDA 3HQ4O 4HV4A 3C85A 4BIIA 4PVDA 3A06A 4RLSA 4ZQEA 1E3JA 4CM8B 1JVSA 4Q3BA 5DZSA 3H9UA 1D3AA 2EHDA 4D3SA 2B37A 5A3VA 1YS4A 2CF6A 3ASUA 1JKFA 4FIZA 1AUPA 3QY9A 2ZCUA 1P9LA 2ZATA 3FTNA 3V2HA 2QX7A 4EJ6A 1XGKA 3U4CA 4Y8VA 4D46A 4OOFA 2IDZA 3I5MA 1GZ6A 4HXYA 4YJGA 1PIWA 2HKIA 4ILKA 1TB4A 4FFPA 5FFFA 2WYWA 1ZCJA 3RU7A 1N1EA 5FEUA 1P0CA 3GVIA 1O94A 1RJWA 1NASA 1XWFA 1V0JA 3Q1LA 2YDXA 1H6BA 1DC6A 1MX3A 3CMMA 3EGOA 1OI7A 3H2ZA 3O03A 4YJFA 1PU2A 3WYBA 5EINA 1KEVA 4IIUA 3T7EA 4R16A 4K1LA 4A73A 1E6UA 2CDAA 4WNCA 2VWHA 3KYDA 4CM6A 4UEOA 3QWIA 3VDQA 1VC2A 5HTOA 4KDEA 2DBRA 1MC5A 5JYEA 3FWZA 4HP8A 4D45A 2G5CA 3I9NA 4EGFA 4DGSA 3GVXA 3BA1A 2IEBA 1PJLA 1UJMA 2Y1EA 3A9WA 2CD9A 3ZU4A 3GGOA 4OXKA 1E3SA 4XQEA 4ZQBA 3GFBA 4CMAA 4Y9DA 3G1UA 1PR3A 4FDAA 2R6JA 1DDOA 2C29D 4Y6RA 1MXFA 4ZQFA 3ZV6A 2PV7A 4IINA 1Q7GA 2BFOA 1EBFA 4NU6A 4B8ZA 5JS6A 5CDYA 4Y6PA 3IP3A 2DC1A 3LLVA 3PYXA 1AXGA 4QTZA 4NJMA 2Z5LA 4R4JA 1JTVA 3LQFA 1GFSA 2X1HA 3VKVA 1BRMA 4YYZA 5AVOA 3D1LA 3TSCA 1OBFO 1ISIA 2PD6A 3KOUA 4MP3A 2Y0DA 3D3WB 4BNLA 1Q0QA 4KP7A 5IJZA 2VHYA 3PIDA 5DCYA 3TFOA 2V6MA 3K31A 1HWYA 3WBBA 2IZ1A 4YR9A 4C4OA 3GNTA 4F3YA 1ZSNA 3GPDG 1KC3A 3AU8A 2C82A 1DRUA 2X0IA 3GAZA 1R12A 5T57A 1NPDA 1GQYA 2FWMX 2GLXA 3ZHZA 3O8QB 3TL2A 3I6IA 1SCUA 3I9OA 1IPFA 1X7DA 3X2EA 1E3WB 1TT5B 3BMQA 1YXMA 4E21A 2PGLA 1N8KA 2BFPA 3CEAA 4L76A 3G79A 5DDIP 1YQGA 1O6ZA 4QX6A 3IS3A 1GCOA 2HLPA 3S2GA 5L51A 1FXSA 2B4RO 3PK0A 4UUOA 1HZZA 5JMWA 1LQTA 2X8LA 1Z6ZA 4CV1A 4N5MA 3LT4A 3DMYA 1I8TA 4J16A 4LN1A 3GAFA 2GSDA 2C59A 4Z0HO 4O59O 3E5MA 1IY8A 3HADA 5KVQA 1KBZA 1BHSA 1I2BA 3VPGA 3PHJA 3P19A 3DOOA 2OUIA 3GNQA 1HDGO 3KSDO 4L75A 4RVGA 3ZV3A 1YWGO 4E5MA 2Y1CA 4BNMA 3PPIA 1IPEA 4FFRA 3JQFA 1YBAA 1RKXA 1LI4A 4J49A 1NYTA 1JKJA 2JKVA 3MJ4A 3JQ8A 3TFQA 3QVTA 1TT7A 1E1KA 2CFCA 4GKVA 2E37A 4LMPA 4IUYA 4IDCA 1Y5MA 4WOKA 3V8BA 1HSOA 4AJOA 4CMJA 4QO7A 3OA2A 3ROPA 2A35A 3CXRA 3OMLA 3PYLA 1K89A 3V1YA 1PZFA 2UYYA 3DC2A 4AVYA 5AXDA 4B4OA 1PJ3A 1KVTA 1I0ZA 1VJ0A 2LDXA 1C1DA 3RVDA 3I4CA 1XLTA 3WIDA 2H5LA 3ABIA 3ROMA 3W6ZA 3DZIA 4J7CA 3U62A 3ZV4A 1OMOA 4WEOA 3BHIA 4NK4A 1ZNQO 1LSOA 2YW9A 3GUCA 1P1IA 5G0TA 1NP3A 2Q50A 4LVCA 1B8UA 1I01A 1UP6A 4M8SA 5L7TA 2X6TA 3WSWA 1ZEJA 4H7PA 3JCZA 2HMUA 3EDMA 5EL0A 5A04A 5C7IO 2BELA 1M67A 2XXJA 1LDYA 1XYGA 4P22A 3JQ9C 5BSEA 4G2NA 1IULA 5JBIA 4LMRA 4R1TA 4XQGA 2POQX 3U9LA 1PS0A 4ZJUA 3TZCA 1YQXA 1ML3A 2FR1A 1I33A 3GH3A 3ZI0A 4ND4A 2X0RA 4G81A 3VZPA 5JC8A 4D0RA 1WDMA 3LZ6A 4IIVA 2PH5A 3DTTA 1M2WA 2EP5A 3I3OA 1TA4A 3Q3CA 3RI3A 4NPCA 5L40A 4PG4A 4BO0A 4YPOA 4YT5A 3IL2A 1NWHA 2VUUA 2JFFA 3Q2KA 1PJSA 1CETA 3GC6A 3HG7A 3BZUA 1NFFA 4C7JA 1A9ZA 2VOJA 2QZZA 4CODB 5U1PA 1BXZA 1JN0A 2I67A 1Z7BA 3HDYA 4Y98A 5G0UA 5AXBA 1I3NA 1V3UA 2X5JO 5T8KC 2X4GA 3ZWAA 5A03A 5EERA 3LF2A 3O26A 3BMCA 5JCJA 2JJYA 3NAQA 2V6BA 5C7OO 2D2IA 5U4QA 1I24A 2I6TA 4Q3AA 3UHAA 4CM4A 5I9NA 4NG5A 1OC4A 5L7YA 1KEWA 1P1FA 1XELA 1ULSA 4CV0A 1RYDA 1DJQA 3FRJA 3ZU3A 1VL6A 3UXYA 1K6IA 2QW8A 3ZHYA 2ZTMA 4WCDA 3L0DA 2AQ8A 5BSHA 3FTPA 2GN8A 4JX8A 4MVJD 2TMGA 3DZGA 2P9EA 2FY8A 2ZJ0A 4AFNA 9LDBA 1EUCA 2BF7A 5FI3A 5KJEA 1D1TA 3PRJA 3KO8A 5LCXA 4TRRA 3QVXA 2CZCA 4BV8A 2YHIA 2Q49A 2PR2A 3SX2A 3LK7A 2O4CA 1ZXBA 4BV9A 3NYWA 1XR3A 4FFOA 3I52A 4J4TA 2NU8A 3ETDA 1BXGA 2VQ3A 4ALLA 2X9GA 3PHIA 3DTYA 4PLHA 3CH6A 5JLAA 3U0BA 4AICA 4NFHA 1GTMA 1MG5A 3GVHA 4II3A 3VH4A 2ZYAA 3JD1A 1FDUA 1SZJG 2VTEA 2NU6A 4B3HA 3RJ5A 3DB2A 4DBZA 1PEDA 4MKZA 1MB4A 2HDHA 3FNEA 4RZIA 2Q45A 4OM8A 5F1KA 2NVUB 1GV1A 4QSMA 1A4IA 2FR8A 3Q0EA 3RUDA 4CMGA 1LLCA 2JCYA 4J1NA 2VWQA 1BVRA 4MVJH 3H5NA 4RVUA 4N7RA 2VHWA 3E5RA 5IXYA 2WWRA 4GKBA 4GWKA 1Q0LA 3AW9A 3G1TA 4E0BA 4O1MA 4ZD6A 1PGNA 1ZSYA 3H9JA 3HSKA 3WGHA 5TLSA 4I5DA 4DQXA 1EUZA 3DMTC 1PGOA 4HKTA 4U7WA 3C1TA 5IDWA 1HDZA 1M6WA 1LJ8A 4IPTA 2O7SA 3PWSA 4UVIA 4BNHA 5I7EA 3QWFA 4AJIA 1F8FA 4BL5A 1PTJA 2OMEA 3WNVA 4HFNA 3ZW9A 1YRLA 2ZTVA 4DPLA 4OH1A 3GEDA 3L9XA 1VPDA 3HDJA 3MOGA 3ITDA 3G17A 3ZU2A 4RZHA 3I6QA 1VJTA 4JIGA 4E2WA 3B1KA 3ANNA 3UAGA 4CUZA 3ADOA 4WNIA 4CLRA 1NVGA 3L6DA 2DBVO 3L4SO 1C3VA 4OIMA 5EJ2A 2GN4A 3CSDA 3MJCA 8ADHA 1Y1PA 2RH4A 2FZWA 2O3TA 1PJTA 1SB9A 2WM3A 2Y99A 3PHLA 1DC4A 5JAIA 4WLVA 4RPKA 2FOIA 5EN4A 3OJLA 4ALJA 1U5CA 1V6AA 3E1KA 3OBBA 4A7PA 1RM5A 1KVQA 4P4GA 3ZWBA 3CTMA 1EVJA 4HFRA 2DPHA 3KETA 4JP2A 3WGIA 1CYDA 3ZHXA 4WLUA 4BO8A 3LU1A 1QYXA 3G3EA 3V5NA 3C1OA 5JXWA 3KBOA 3OIFA 2C0CA 3H6KA 1W73A 4EW6A 4CQMB 5FYDA 1UAYA 5IZ4A 2O3QA 1BG6A 2E82A 4GVLA 4XGKA 2G82A 1WAMA 2C2YA 3NDIA 4CQMA 1LDMA 2HMWA 2Z1NA 3TDKA 3GMSA 1H6AA 2NTNA 5JNLA 3I1JA 4OAQA 1SO8A 2NWQA 2XXBA 4TRNA 3SJUA 3WGQA 1D8AA 4QECA 3IMFA 1ZUD1 2YJZA 2YFHA 4KDFA 4D3DA 1I10A 2DM6A 2GNAA 2Q1WA 4HNHA 1Y8QA 4FC7A 2QRJA 3SC4A 4OYRA 3GRKA 1LLDA 5IDYA 3GF4A 1HE2A 3D5QA 3GA0A 2FR0A 3N7UA 3RUIA 2PD4A 2Z95A 3AUUA 4FOOA 4GAEA 5DULA 2HAEA 1J4AA 3PGXA 3OJEA 3DDNA 1WPQA 4QXMA 2Q2WA 4YT4A 4TKLA 5HA5A 4BMSA 3QRWA 5BNIA 4Y6SA 1CQIA 2Y67A 1A7KA 4JBGA 4YB8A 2OL4A 4CQLB 1WDLA 4R5MA 1C0PA 4XYGA 1QYWA 4CQLA 3C24A 4R1NA 5CAEA 1VM6A 4NR0A 4UVEA 4QFDA 4CR8A 4EEZA 2I3AA 1XKQA 2UV8A 5TX7A 3VPXA 3K2EA 3V1UA 2J5KA 4BMNA 1OC2A 3PZRA 3C8MA 1IZ0A 4BQPA 1X7GA 5HRUA 1YGYA 4I08A 1G0NA 4YQZA 2G1UA 3EUWA 3LT2A 2NU9A 1F14A 4QT0A 4PLGA 1DFGA 2HK8A 1T4BA 3I83A 3KVOA 4IDAA 1TI7A 4W4TA 4XRRA 5JMPA 1HT0A 4F46A 3EMKA 4PZDA 1YBVA 1VKOA 5HWSA 4J1TA 4IS3A 5KVVA 3IJRA 3TZQA 2OORA 3RC1A 1DC5A 1HEUA 1UXKA 1P3DA 3F5SA 3DZJA 4HUJA 2NM0A 2ZJ1A 3FPCA 3UICA 3OECA 1FDTA 1Y5RA 3OJ0A 3RASA 2A9FA 2Q46A 4BNTA 4DYVA 1N7GA 1LBEA 4HWKA 1PJQA 1A72A 2C7GA 3JQEA 1N9GB 4BNXA 2D4AA 1N9GA 3TOXA 4WECA 1DEHA 3ROKA 2GDZA 4KWIA 3VPHA 4RDIA 4ZU3A 1MGOA 3TL3A 4J4BA 1M66A 1MP0A 1RM4A 3ZCXA 2J3IA 3INTA 1KS9A 2VRCD 3GPIA 1VSVA 5A1TA 4ND2A 5KJ1A 4OL9A 1EDOA 3RBVA 1PL6A 5L3ZA 1ZJZA 4D41A 1AN9A 2CSUA 4I9UA 1C14A 3KEQA 1I2CA 3WYCA 4CMCA 2WDZA 4CL3A 4FOSA 5JE8A 3RUEA 3CMCO 3B1JA 1NPYA 3PI7A 1NNUA 4MVJE 4R54A 5CFZA 3OA0A 3AOEC 5JPIA 3RFXA 1I5RA 5T67A 1EFLA 1P1HA 3Q2IA 1DBVO 2DU8A 4IDDA 2PLAA 1M6HA 4NNJA 1O89A 4ITUA 4ZRMA 4PG8A 2GGSA 4AJPA 1I32A 2X0JA 5COBA 1B14A 3CE6A 4JP3A 4B4UA 1MLDA 3L6OO 1GYPA 3GN2A 2FPGA 4M1QA 3H8VA 1TVEA 1GYRA 4ZQGA 5HM8A 3FN4A 4J9VA 4B79A 4ID9A 5ILOA 3SBOA 1KEPA 3DAFA 3C7AA 3QW2A 5L4LA 4YXFA 2VWPA 2F1KA 3H65A 3SLGA 3PJEA 5FWNA 2XF8A 3ZWVA 2GN6A 1FF9A 4P4NA 2PK3A 3VDRA 3NJ4A 1P1RA 3WGYA 1KVUA 1NQAO 1G6KA 3RSHA 4DYDA 4RO0A 3JQBC 3OQBA 3PHGA 1P44A 2NU7A 4X54A 2C07A 1J6UA 1Y8RB 3MEQA 5ITVA 1QG6A 3JQAD 2VYVD 1Y8RA
chains in the Genus database with same CATH superfamily
2CXOA 2J6HA 5F98A 2O1EA 2B8WA 3MOIA 3OUUA 2QUKA 1ZCAA 4N6CA 1V3QE 4NICA 3HJAA 1V4VA 1BE1A 4KN6A 1HQYE 4EKWA 4W9NC 5KU7A 1XZLA 3FYUB 1OGJA 3CLUC 3FYUA 2IX3A 1Q7EA 3ELWA 2C58A 3GFOA 1UFVA 2X14A 3EXEB 4Q3CA 3EXEA 1XKXA 2GPNA 4N12A 2BRUA 1N8SA 2HF9A 4AP5A 4LBVA 4AKGA 2B4QA 1PKEA 3OLYA 4KFRA 2AH5A 4JEMA 4IZIA 1E8NA 2YC2C 1YJBA 1G3QA 4BO7A 5AM3A 2VEOA 5BW4A 1IE3A 3DW3X 2X5KO 3MC1A 3NR2A 1UOEA 2VT6A 4P2BA 2Z2JA 2GUGA 1EHYA 3CPJB 4O2BF 3AUXA 1XA4A 2Y68A 1UDBA 3D8TA 1QOZA 4MCJA 1NJ8A 4ER9A 4PHGA 4XOIA 3SJ7A 1LI5A 3NHZA 3BXZA 5A4FS 4EZEA 1SOVA 5FO0A 4J0CA 2IBTA 3CISA 3MQ2A 3SMQA 1U2RA 1NVTA 2XIJA 2MMCA 1UFQA 4YAKA 2M2IA 4MB0A 4GGPA 1RMYA 4H77A 3B70A 4PGHA 5E7IA 1N2HA 4BEBA 2ZD9A 4GLOA 4A6EA 1WW3A 3HI4A 1PJ8A 5JMOA 1OFIA 5TSDA 2BDEA 5SZHB 1N36B 1XPRA 4IGIA 1HDOA 1ZG3A 2YCLA 5IUKC 1VG0B 4DRJB 2EX0A 2EF0A 1EESA 2NYUA 5LPNA 1F1JA 4DMUB 1IY9A 4EHBA 1L5NA 1KIMA 1E6EA 3DDZX 4BQIA 5EXSA 1NJ2A 4DABA 5JYDA 3IHUA 3ODPA 1Q11A 1J0CA 2X3UA 4E30A 2OFWA 4FNOA 1TKAA 4S12A 1IBRA 1MV8A 3WBJA 3RWBA 4PYIA 3TE7A 3B85A 4WOBA 2OPHA 3W1VA 1E69A 1M75A 4D6PA 4Q1VA 1TCVA 2C4HA 3RNLA 2BGRA 1DXHA 3KR9A 4YV0A 5IFKA 3HFJA 4QGSA 2GZHA 3M4CA 1PQPA 2EV9A 2HYIC 2COKA 1CUBA 5KCZA 4WINA 1KYQA 4IIXA 3IEEA 2V3CC 3CGGA 3LY9A 1SRQA 2D5AA 2JI7A 4NCIA 5DB4A 4YJ2B 5TMBA 4YJ2A 1TZ2A 1FJXA 1FEZA 2WYOA 1A98A 4WCVA 1P80A 4BFLA 2C1XA 3TZBA 3HN2A 5ALMA 1Q95A 5TPZD 1SFRA 2QT1A 1RCUA 2E4WA 4CM9D 1UXOA 4EO4A 5BWBA 4BPRA 2OV4A 3GUHA 3FMIA 1ADYA 1JDTA 4FLFA 1NBOA 3DQZA 4O4HF 1ZIYA 3NS7A 5BN5B 3VJKA 5BN5A 2BKLA 4PANA 2QX4A 2JF0A 4QBHA 1YE3A 3S27A 5FTLA 3KYIA 1UC5B 1XU4A 4B09A 3LE8A 4MGEA 4HMQA 5FOQA 2QN9A 5GONA 1PK9A 5JAOA 3PCVA 1CDZA 4ZO7A 3W77A 1SKQA 4J0KA 1NBME 1JLRA 1N6HA 1Z4JA 2IXMA 7REQA 1Z7Qc 3TNFA 4ISCA 4CMKA 4OUKX 2JPUA 2V54A 5JTTA 5JV5A 3QIVA 3KEMA 4LS3A 4UHEA 4I2VA 1EJ0A 4BNFA 2VTVA 5IJ9A 2AVKA 1ISFA 4Q4JB 4E5DA 3G6WA 5JS2A 3OCUA 4BAZA 5FFNA 3CKYA 5FX2A 1VBKA 5F7JA 3O3NB 1KZHA 2ZCVA 1JJ7A 2BFCB 3S2IA 1EDBA 3V8PA 3AVPA 1NBAA 1Z5ZA 1PVOA 2GJ4A 3F5FA 1X13A 5JNVA 4XD7A 3T1HB 2ZBUA 5J2UA 1YF3A 2LUOA 5I7OA 4EENA 3N9IA 4J0GA 4KWHA 4Z9YA 3ESZA 3X1MA 1OLUB 2YVKA 2JGDB 2HRQA 4OLJA 3T7SA 1OBHA 2WE7A 1JR3D 4JJIA 5SYAA 1HV8A 3RK4A 2YHUA 4JB0A 4DTCA 3ZLJA 5KNLA 3KZXA 3UT0A 3IJEB 1QYCA 5EIAA 2BTQA 2XX3A 3LO5A 4Y6GB 1RWVA 4CN9A 4CR6A 3LESA 4YP6A 1SBZA 3BUSA 2QYSA 2Y3IA 1WM1A 1A9QA 2J0QA 4XWWA 1HQDA 1Q22A 4DLLA 2CWWA 3NDRA 4LTDA 4MKXA 3JQGB 2J9UA 4F4FA 2F9MA 1T6XA 4IVQA 4X1YA 2HZBA 5BSWA 3CYFA 1O8BA 3PX2A 3ZZUA 4P4LA 1N4DA 4EITA 4DXDA 3RSQA 3QVKA 4MYSA 3TOCA 3D64A 2JJ8A 4O79A 3HA2A 2XRYA 1FPQA 1Z8FA 1FNNA 2VF4X 1GA4A 1J0AA 4K86A 3GFSA 2SICE 1A71A 3EOZA 3F71A 4B31A 3RB8A 3ZLTA 4X8HA 4DIMA 3N24A 5LWQA 5A6SB 1BMQA 1JAYA 4DW8A 1B1AA 1FNMA 5G2OA 4PY2A 3GODA 3LLSA 2HUJA 3U4HA 5CYPA 4FOTA 1A5ZA 3EZHA 3EE6A 2P6MA 2HNKA 5AVUA 4E4RA 3COJA 4H18A 3SZRA 5COFA 4G0OA 3VDNB 4EG4A 2H08A 2OSVA 3IEXA 4N7MA 2FJ0A 3DEFA 2A30A 1T2UA 3VJRA 4YA6A 3BSFA 1DOZA 1O97C 3PFNA 4RA6B 4AF8A 3NH6A 3HU1A 5E9AA 3C45A 4GX1A 5HP4A 5DWQA 3LW7A 2YZMA 5BUSA 1BE0A 4AP9A 4C04A 5KC9A 1JUDA 1IIBA 3AXSA 4CKZA 1NXTA 4QUEA 1SCAA 5EEHA 2HIAA 1RTTA 4WCFA 3VPAA 1JTEA 4DV2B 1IXZA 5JAQA 1LA2A 4D9IA 4BAGA 4EABA 2W43A 4RGVA 4CEHA 4DLSA 4YRRA 3OCZA 1A0OA 1VBFA 5IZCA 4BLUA 3ZHSA 2ZIXB 2XOKD 4F3TA 4G9BA 4D4KA 1HDEA 3I61A 4KUEA 3SYNA 4AS3A 1NSGB 3ZCVA 2BHRA 4JB8A 2OO5C 1FB5A 3BZWA 3D4BA 1QHSA 1EXVA 1PFUA 3QE3A 2EIMC 3HVHA 2ZJFA 3LRXA 4COOA 2HNBA 4I55A 2A58A 1RZVA 2GN9A 1YL7A 4HN9A 1EIZA 1UBNA 4IUDS 4Y0VA 5ER9A 2V4ZA 2AL7A 1E99A 1R0SA 4Q4HB 1L9KA 4GP9A 3EH2A 5E6SB 1T1GA 3BMQB 2WB2A 4Q4HA 1U0FA 3RYIB 5BR8B 4EQ6A 3RYIA 3PPXA 1GADO 3LDFA 3QKRB 4K9DA 4XQCA 5GINE 1PQUA 2A59A 1GLNA 3QTHA 1FVXA 1TADA 4WRRA 1KR5A 2VAVA 1N1MA 4LRWA 1HR0B 4BXOA 3F3YA 5G3YA 2Z1MA 4QBTA 4DGQA 3D0QA 4UTOA 3V1LA 4BMZA 3E8SA 2BR3A 1BQ4A 5A6KA 1D04A 3ZQ6A 3KJGA 4J3JA 6PFKA 2FG5A 3UH1A 4Q34A 4K26A 3T15A 3I6YA 5EZYF 5KIAA 4L57A 4ZOAA 3VGJA 4WXEA 4S04A 5TR9A 4Y1GA 2FB9A 3AF4A 1ZISA 4RKEA 2A5JA 1AMOA 3J81k 3DF7A 1P0PA 1BFKA 1V26A 1GPWB 3O2JA 3OIVA 2GFQA 3W6NA 1RWWA 1T43A 2CXHA 2IFTA 4RKYA 1PR0A 4WBNF 3AEUB 1P6UA 2B94A 3AEUA 4DLZA 3I9FA 1CGOA 5BUOA 3ZI4A 2VG8A 4OHVA 4P9NA 4WPGA 3FR8A 1U2ZA 5CYFA 2XBUA 2H1OA 3CLSD 2UVDA 4C7XA 5I4IA 3AHFA 1WEKA 4RKFA 3W9SA 2D54A 2PZMA 5CJ2A 4F6RB 3KTDA 4MHOA 2HRBA 3CH7A 1HDRA 1LRKA 5FPKA 3T34A 4FW9A 3ZWWA 2QTCA 2AN4A 1ZJ5A 2Y93A 1L5KA 5BWLA 2W4QA 4CIBA 1C2YA 3UPTA 4XDZA 1OIVA 2FQYA 3K70B 4NECA 4TS4A 1QNLA 3FPHA 3AF5A 1QO7A 1RYBA 4CLOA 3O8CA 1K6EA 4R2HA 4EY7A 5EWMA 2O8FB 3DYVA 1U4SA 1Q19A 3BTUA 1NN0A 1Z8NA 4RK1A 1O4VA 5HJ7A 3O3MB 4BKPA 3ZPXA 3K6SB 2OFPA 5FPPA 4B6JA 3GRVA 3N2GB 3HKDB 3N2GA 2DUWA 1HX7A 3X1KA 3HKDA 4FDUA 5CEFA 1U7DA 2PXHA 4XIFA 2Z9DA 2OCAA 3AF1A 1OI4A 3V1TC 1ULUA 3VNBA 4FPXA 3C8HA 1H3FA 4Q4DA 5H70A 4AJJA 3EGXA 1ZXLA 2JVJA 3S2UA 5LXTB 721PA 3NPAA 2BCJQ 3ZE6A 3MSCA 4B7CA 4QOIA 3EHEA 1L1RA 1E1QD 1DJMA 1TMKA 2VT3A 1CB0A 4QM7A 1D9XA 3OIWA 2PT9A 4RLHA 1X6VA 4WGYA 2DMRA 5DBEX 4RVNA 4HZIA 2FX2A 1H2HA 1TIPA 4C3BA 1X8KA 4HGRA 5WRFA 4FZVA 2X9LA 5IBRA 4B4VA 2EFDB 3ICVA 4DUGD 3WLOA 3RFFA 2DH6A 1PG0A 3PFHA 4ID3A 4DIOA 3AY3A 2ISCA 2GKSA 4ZRNA 4FZRA 2DAPA 4YTEA 1KZYC 4DQUA 4RESA 2HBQA 1FFEA 3KOMA 5D84A 1KZGB 1Q1QA 3CLTC 5G0WA 2PL5A 1U94A 3ACDA 2VDQB 3KBBA 4OQNA 4TS3A 3AFGA 3F0TA 3GIWA 5ADWA 3OZDA 3AESA 4Q05A 4AK9A 3RNOA 3EFOA 1VA5A 1RYHA 3Q7GA 1O54A 1I3CA 1CZNA 5HPYB 4ENSA 4LJ6A 3ZGVA 4DUZB 3H5AA 3HKBB 1Z7YA 2CLCX 2P4SA 1CEQA 2XEDA 5ITWA 3U9SA 2Q07A 3W5UA 3A9RA 2HW8A 3JWGA 3WGLA 4MVOA 3KU1A 1P74A 4EATA 1H6CA 4YHHB 1DO0A 1MRZA 3VAAA 1RHQA 2BEWA 4C05A 5IFLA 1HDXA 3ZHBA 4U5CE 1FJHA 4AIIA 4IMIB 4ZLDA 4WKPA 1WETA 5EFOA 1HURA 1NVWQ 4O6YA 1ZO8A 4PHCA 5T3UA 4N49A 2PP4A 4GOND 3D7LA 4PXYA 5C9ZA 4RHTA 3WAKA 5LVAA 4EB0A 4YP0A 2NZ8A 3TD9A 4FWTA 3DEZA 3WOVA 1KOJA 5C18A 3VR1A 3K1IA 4HV4A 3C85A 3UJDA 3E22A 1T9GS 4Q3BA 3RT7A 2ZJ2A 3BN3A 2O2EA 3IAS6 5H9VA 1C2TA 1AUPA 2PZGA 1T6YA 1XGKA 1WUYA 1GZ6A 3R9IA 4DCMA 1PIWA 1GTRA 2JIMA 3RKSA 4JC0A 3WA7A 1NASA 1MX3A 2MHCA 4LC9A 2QZ4A 5E6UB 1OAOA 4N41A 5AKGA 2VQSA 4OXKA 2CMHA 4OIRF 4FDAA 1DDOA 3K35A 2OBXA 5CDYA 5BRJA 4Z5XA 2AK3A 3LLVA 3CNQS 4XM1A 2FWRA 1W36C 3WDKA 2BUCA 2BHTA 3V8MA 3CZ5A 4KP7A 2AD1A 1ELOA 4U1RA 3H1BA 5F2NA 4P9TA 1GT91 1R12A 4URYR 4S35A 1SVNA 3CEAA 5DDIP 4MQEA 1G59A 4MA4A 4FDTA 2X8LA 4HAZA 4DADA 2XE8A 1AHPA 1MB3A 4LSGA 3E5MA 2EFGA 3FAZA 3IXQA 1RHJA 3K0KA 2M32A 3CKKA 3OQJA 3MG9A 5CUQA 3PPIA 5JANA 1JKJB 1CPRA 5BV7A 1JKJA 4XGRA 3TFQA 2LKDA 2GO7A 1QWOA 3CZ9A 1PBTA 3HB7A 2PTHA 4QA9A 2OCYC 1A9RA 3DC2A 2AXEA 4GM0A 1NSYA 2QE6A 3WHNA 1UK6A 1ESEA 3W6ZA 3U4MA 2GXQA 5DASA 3CQZA 3A1CA 1H1LA 2YY5A 3WNCA 2G08A 3AUFA 1T5IA 3FVRA 2XXJA 4FONA 3FTEA 2DGJA 1U2DC 4HZGA 4EX6A 3FF1A 1VP9A 3Q7PA 3Q3CA 3RI3A 4NPCA 1H8ED 421PA 4WFJA 4NYMQ 4XCQA 1ICIA 3O2NA 1CETA 1A9ZA 2VQDA 5U1PA 3WLKX 3E7WA 4BWVA 4CTJA 2IP4A 1KFKB 4H4KC 1GGJA 3URMA 4A0FA 1XVUA 2YWAA 3DL4A 2ZTMA 4UBJA 4QI2A 3WWDA 3C16C 1A76A 4N0DA 4TTAA 3EJNA 1VHWA 2P79A 1JF8A 2RHMA 2O4CA 3NYWA 2E89A 5ICFA 4PLHA 3CH6A 4EKDA 1RQRA 4BJHB 3RJ5A 4LY0A 2R0QC 1L8OA 5L3SA 4GNRA 1A8IA 1M0WA 4FEAA 5JG7A 4MS4B 1Y4ZA 2J0VA 4GWKA 3AW9A 3QTLA 4E0BA 4BRSA 4ZD6A 1KZ1A 1FSZA 4C0WA 2WMYA 4IFEA 2P3SA 2O7SA 4L22A 2ZSBA 1VI5A 3KKOA 3KT6A 4DPLA 2OHFA 3CZQA 1NM5C 4RD2A 1BNCA 1GL6A 1X9HA 2A9JA 1M73E 3PXUA 2JCGA 3PNBA 3OFKA 4P08A 2RH4A 4QM6A 1RI3A 4MHTA 1C0EA 2FOIA 3KT0A 1V6AA 4AF7A 2C3YA 1YLMA 1EVJA 5K51A 3LBYA 4M0UA 1HFEL 4JP2A 1IIRA 1O2DA 1L5GB 5FUYA 4EKNB 3CU5A 3BQNB 3H6KA 3HNIA 5IZ4A 4GVLA 2G82A 3NDIA 2YYSA 4ZMRA 2O52A 4RKRA 1M5TA 2HJGA 1YBFA 3WLNA 3IMFA 1KRWA 1UOPA 5FOSA 3CRVA 1VDZA 2GNAA 4C07A 1LE4A 4P83A 4OQPA 4ZAFA 4GAEA 2P65A 2HAEA 1E6KA 3O8OB 3QEOA 2FEPA 3O8OA 1RW4A 4DA8A 3SNHA 4I4LA 3PZRA 1I4OA 4LDJA 3MMNA 4PLGA 1UBSB 3CVUA 1L5ZA 4NU8X 1L5VA 2EQ5A 2XNKA 5AW8A 2I29A 1M2OA 2JARA 4LA4A 3FPCA 4U2DA 3O7WA 4P34A 4J30B 3RASA 2OXEA 3OD1A 3GW8A 2EWVA 3JQEA 4PSUA 3CEJA 3ZCXA 2J3IA 1CX9B 4WMLA 1C9DB 4ND2A 1CZKA 4R0VA 5LN1A 1BGXT 1JB9A 1GA6A 3LJKA 4AO8A 4JYZA 2ZCJA 2VPXA 5B2FA 2WIDA 4G56A 3RFXA 1FUUA 1EFLA 2DU8A 1O89A 1FFWA 4TT3A 2ZT6A 5HEKA 1XMPA 3PQ5A 3FMFA 4TTRA 5JJLA 3ER8A 1TVMA 1FF9A 2OYSA 3BBPA 1DBQA 1NQAO 3RSHA 4KPUB 2NU7A 2G9QA 1XRQA 1J6UA 1HTWA 1GTZA 3QW4B 2Q3MA 2C4WA 3DR5A 3A4LA 1PF7E 1NTOA 4MVJP 3PUKA 5JJ5A 1UJ6A 1I7LA 2WAYA 4F2DA 4G25A 3HNLA 5CBPB 3T1QA 2F2TA 4XWJA 2ZPAA 5JD5A 5C81A 2BGKA 4XTCS 3LWNA 4GUAA 1E9RA 2KS6A 1EAMA 4OUDA 3X44A 2ZSJA 4CLHA 1VPLA 1Z33A 4QC2A 1A9XB 1XVIA 1MFPA 3LH5A 2ZSFA 5DT9A 1II9A 1A9XA 3ANSA 4L7VA 2VRBA 4C30A 4HQRA 2J30A 4FOPA 4PACA 1KGSA 4ZVRA 4HNRA 4C6TA 2V7UA 2GZDA 1ARZA 4BLTA 3EIEA 2OENG 1CJMA 4XPIB 3L6BA 3GJ3A 2J1LA 1ULAA 1V74B 1FPMA 1YE8A 1TUBA 2V65A 4E07A 1ZS9A 2FJUA 1A9YA 3I30X 1LJLA 1YUMA 3H18A 3R40A 3IAS1 2PZKA 1UWVA 2GZMA 1B1CA 1J7KA 2V9PA 2H1VA 5DTIA 3GEEA 4YCMA 3RRJA 1VCMA 4BU0A 1QRAA 1H9AA 2XVAA 4Z0PA 3WWYA 4QLAA 2ECPA 4P3NA 3VXKA 2CMFA 2HQSA 4XWTA 1JQBA 4RDAA 1ODIA 1M1YB 3VH1A 3O38A 4RY8A 1KDRA 4HQ6A 3CPSA 3LKBA 3O5AA 3TOSA 2SHKA 1EP9A 1JILA 1FU7A 1E7WA 3OP4A 3PLAE 1W6RA 4U7FA 5T8KA 4ND5A 1YCFA 1A88A 1R66A 1W88B 1YAUO 1VCIA 2WF6A 2V4MA 3WK9A 2OLJA 2DT5A 8GPBA 4KQWA 2MINB 5KOIA 2ORWA 1UM9B 2ONCA 1DADA 4D6XA 2MINA 4S2EA 1T36A 2ZPUA 1HNNA 2FEKA 1QQ6A 1DC3A 3V55A 3WRVA 1YA6A 1OFHA 4DL9A 2V7BA 3AFHA 3L0IB 1EUQA 2QW1A 4PX5A 1Z45A 1B42A 2M4EA 5BOVA 3UMJA 2AVDA 4DR1B 4I9NA 4B9EA 1L4YA 3D4NA 2DWOA 5AM0A 3S28A 4CKYA 2KNHA 2WU8A 3L7YA 1J9EA 3I1FA 2PBFA 3ZIBA 5LLSA 1SC9A 1H5NA 4HD8A 4V0KA 4HYTA 1PDWA 1XZCA 2Z8YA 1E1CB 3TZLA 1E1CA 3KB6A 2NQ8A 4O4JB 4O4JA 2XLCA 2QAGA 2E0IA 1LVGA 1PT7A 4BWFB 5EIWA 4TMYA 5FJJA 4ESEA 4PC3A 2KB0A 5H82A 5CXQA 1R4TA 1NOJA 5GJCA 4CM1A 1T1IA 3I2YX 1DX4A 4HS4A 4KIFA 4CDGA 4ZOLB 3VX3A 5F5LA 2GK4A 3ASVA 3DSRA 1ONOA 4RF2A 1T1RA 3JZDA 4BB5A 3IQ5A 4F9GA 5GGXA 4JWTA 1WLYA 4RJTA 3OZUA 2CJYA 3PA6A 5KNDD 4YWJA 4EUKA 5JAMA 3D1VA 2NVUA 4RQTA 4GPTA 5DWVA 4XX1A 5LP6A 4MRMB 1MJNA 1SK8A 4UVGA 3ABOB 3WP1B 1GP2A 1UMDB 5KTMA 2ZAYA 3EJ6A 3DCYA 1PBNA 1J9GA 5BPHA 3OPXA 1RXVA 4Q9HA 4O1HA 4X6UA 3R4VA 2E18A 1U1FA 1DUIA 1QMPA 3V8RA 4BNWA 2NPUA 3OJCA 2E5LB 4BOYA 4IF4A 3UB3A 4PYNA 4BCCA 1BN6A 1RYYA 2VFAA 1CQPA 2ATVA 3RTEA 2QMYA 1LFDB 3PKZA 2F4VB 1W4ZA 5DI9A 1UDXA 5HIKA 4BVEA 3O92A 2C99A 5F3DA 1THZA 3ZWOA 2NLOA 3IQHX 3OU6A 2CJPA 2PUJA 3ZTTA 4WJZA 5CX1A 3SDZA 3AL3A 3QVZA 1LPOA 2JJ2A 2I62A 4RF5A 4QJ3A 4V24A 5C51B 1JWLA 3FZYA 4IM7A 2O1SA 2QRPA 5GZ6A 3M15A 1HMOA 3DZKA 3DDCA 3JQBA 2ZRHA 3IOYA 3KVNA 3DBVO 5BNFA 4ZAVA 1FX0B 2JLBA 4CF7A 1XLWA 2AUNA 4BNDA 1LDNA 4YP9A 1XTVA 3BRWA 4IWYA 2PRKA 1H9TA 1V8DA 1I2AA 3OVMA 3AFNA 4UTVA 3HCNA 2J0UB 1GDDA 3PGLA 2W7TA 2J0UA 3QKIA 1A8QA 3C5EA 3H9GA 2JJMA 4JTDB 1TZCA 3K7EA 4MRPA 5ITZA 1DKPA 5EKSA 3P9YA 2UYGA 5CPFA 3OHMA 2BONA 2QPLA 4HUTA 1P7WA 4NF2A 1LSSA 5FLXA 1FW6A 1GGKA 3IT0A 4LYHA 3ILSA 3ROEA 1Q0MA 3FBTA 3I72A 2IUTA 4HWSA 3B2EA 3TW6A 3DL7A 4ON9A 1JEQA 2XLEA 2OXRA 1F2UB 4FXOA 5AHWA 3F9CA 1YCDA 4PPQA 3AWIA 2NZ2A 1ADJA 3FFBA 3TCXB 2H9IA 3LUDA 1SVUA 4IP0A 1NDUA 4IY1A 3MWEB 2LWIA 2BGMA 1JHAA 2W70A 1WMDA 3RE1A 2PE5A 3AVVA 3NT4A 2H16A 3H97A 3KQMA 2BHSA 4JLKA 4IMJB 4JASB 4R9SA 4HN4B 1ZOPA 4S1OA 1G6HA 3B6MA 1D9ZA 1BCSB 1O7JA 4Y30A 2Q0HA 1GGNA 2EEPA 1OYOA 4KVAA 3PXGA 2AWOA 1ETUA 4QFBA 4L3OA 2XD4A 4OP2A 2JIZA 1GNQA 1TEXA 4CR7A 4LQDA 4UUAA 1KZ6A 4DV6B 1Y6QA 5TMPA 2NV6A 2ZM6B 4FJ2A 2IHZA 5LB2A 2B4KA 1B8VA 2R7AA 3ADKA 4AKIA 1TTPB 5FL3A 2ZWOA 5BSKA 4B43A 2NQ2C 2C04A 1I80A 3JSXA 1F38A 3GG2A 2XMDA 2EZTA 4IH4A 1F9EA 2H1LA 2VAWA 3HMKA 2NPOA 4D5EA 5K8JB 3E7XA 3FX2A 1NBEA 1U3VA 1Z2CA 3TKAA 3IR7A 3IPRA 4M0PA 2YASA 1PJ4A 4TWJA 1DG3A 1CUUA 1U7OA 1BVYF 3W4YA 1Y6ZA 2XCOA 1NFNA 3LUJA 3UJCA 2F90A 1BJRE 4KQFA 3LQKA 1L1FA 2O2YA 4BFWA 2R8RA 5KYUB 1NNSA 4KXUA 3V1NA 2ZJ3A 1JEEA 4XEFA 3HS3A 1MA0A 4GLJA 4MLPA 4WEQA 4DMCA 4GPD1 1PQYA 4MKFA 1DXOA 5K1ZA 4DQLA 3VRHA 5JO0A 3EA5A 2Y69C 1KFCB 2NO6A 4R2MA 1SXPA 1SUCA 1QYIA 1ZH8A 1IZYA 3L8DA 4NDNE 4YMGA 8OHMA 1XD2B 4CRWB 3QPWA 1XD2A 2C20A 1CY4A 3K09C 2AYXA 5BT9A 2A7QA 2C2HA 3RWOA 1OIXA 1NNI1 3DMHA 4JVSB 1BDMA 2BZ0A 3NATA 4JVSA 1EB8A 3FTQA 3C98A 5EESA 3RC9A 3NQ41 2B69A 3MBKA 1IHXA 1C9EA 1YZ3A 5JD3A 3IOBA 1VRWA 1W4CA 2QLNA 2WP0A 3FB4A 2YWHA 3GDWA 3P0FA 1C0KA 1NQUA 2ZI7A 2O2SA 4HXFB 4S2UA 2HJRA 2X0NA 5DXAA 2G09A 3S4YA 2CJWA 1K40A 1KAQA 1WXHA 4NS4A 4BFTA 1L3BA 1UC4B 4MVCA 2I6GA 2MR5A 1WU7A 1FFHA 3ZX4A 1G21B 4K9LA 4JY7A 4B1FA 5D87A 4KQ9A 1J9ZA 5EP4A 4IQ8A 4CM4B 3HJCA 1T3HA 4MW9A 2WW8A 2JIBA 4G7ZF 1MUUA 4JDUA 5LQDA 1DZIA 3LRTA 1HLDA 1M1NA 1Q6YA 2PWYA 5A7HA 1P0QA 2ODTX 1PCXA 3JW8A 1V9CA 3UK7A 2HQOA 4GE0A 1DO8A 2HLHA 2PTGA 1X1DA 2ZB8A 4IIYA 3RJ9A 3TS1A 2ZOSA 1XZHA 3VNQA 3RVLA 5MHTA 2BGGA 1Z7EA 3ECAA 4EUEA 4DNXA 2X2FA 3RW0A 3BEDA 3UBTA 4G6ZA 4J4HA 5JRAA 1SQ6A 1NW8A 2GAFA 2WFLB 1NIJA 4OHUA 4S1PA 4M88A 3K16A 4TKZA 4FMCF 4WVLA 4KQHA 3LCRA 2OWDA 4LE0A 3VZRA 3R09A 4DXHA 1QV7A 4ZYLA 1E77A 5HOEA 3Q6NA 3PC6A 3LYUA 1SHKA 1TTHA 3SOZA 2NO0A 1ZGZA 3TLGB 3TLGA 3V6LA 3G2PA 4FVTA 3T3EA 4AG6A 4C2TA 3C5WP 3HSSA 4MV7A 3TTUA 3TRJA 1IOZA 2EFHB 1KMIY 1DWUA 2DBZA 2OMKA 2IOFK 1GUBA 3MAAC 3GNSA 1ZD3A 3LPAA 3NMIA 3O82A 4CDAA 4TYYA 3PYMA 5BUQA 2EW8A 3PB3A 1II0A 1DU4A 4GPEA 1R64A 3TLCA 5IU6A 1A7AA 3L06A 4ZHSA 4KSBA 3OEHD 4WXHA 4LZNA 1E2JA 1NFQA 3QKWA 2ZE7A 3EXHC 3PEFA 1C1XA 2O8VA 4HQOA 2VI5A 1XDUA 2F9LA 1RI5A 3CSKA 1VLHA 3Q87B 4POOA 4N6GA 3P26A 4UTPA 2DFTA 4C20A 3BXHA 3QSGA 4JMPA 1K06A 5HE9A 4F84A 1KXZA 3BWYA 4ARVA 3L0BA 1E79D 4ZT7A 2XLVA 1W4LA 3W79A 2ZSKA 3SXZA 1BX3A 4KK3A 4IDFA 3WNBA 4CUJA 3HO6A 1NLYA 2DXIA 4BN0A 1JGTA 1ZVMA 5LYJF 5G3ZA 1XZJA 3IA7A 1BGVA 2HYDA 2X9QA 5C8VA 4A8JC 2JH8A 4BEWA 3GLUA 3QYPA 2QR3A 5J47A 5AVVA 2W11A 3LPCA 3H5OA 1SCJA 2R8OA 4DSOA 5K0TA 1E2EA 3BTOA 5DTRA 2NZWA 4YCCA 2WYUA 3M6UA 5T64A 4YMUA 4GPIB 4YRBA 3EZIA 3AVXA 2V26A 4M9ZA 3BGOS 4XSGA 3LX5A 3BE5A 3OA1A 4MR8A 4E6EA 3WICA 3AYZB 3G88A 1Z15A 2QXUA 2X58A 1DDGA 4TUYA 1WZIA 2GAJA 1EGVB 1YB5A 2LV8A 2CXUA 1CJCA 4MQ5A 5E4YA 4CIAA 1CRPA 2OSBA 3FMVA 3MPOA 5B12A 1Y1LA 1EA7A 2MTBA 3TOZA 2HRCA 3EW9A 1HQCA 5DTMA 1I9CA 3TI7A 4HAVA 3H9CA 1KBQA 4YT2A 2P35A 1DAMA 1WQ4A 3C41J 3C43A 2NYVA 4RMGA 4QL3A 5EHZA 5JPDA 2DFDA 2WA2A 3D4IA 3W78A 3OX1A 4RJKA 1D3AA 4B83A 1SBCA 1CKEA 1N1CA 2PGXA 2MOKA 4RXTA 3Q8XB 2GCNA 2HKIA 3O8DA 3EEQA 4TZ6A 1ZCJA 3VUFA 2L2QA 5K3OA 3ESDA 4IV0A 4R2WA 2AMJA 3NIFB 3R0JA 2Z6UA 3KQVA 1EBBA 4IIUA 4R16A 2XNSA 2CDAA 2BFFA 2C7RA 4S1NA 1XAGA 5BN3A 3QW0A 3MYFA 2DBRA 1JEAA 3NEYA 4CMAA 3ENVA 2DQYA 5AJXA 1HNXB 3TNDA 4E70A 5JS6A 4Y6PA 1PWEA 2DC1A 4HPJB 3THWA 1AXGA 1J56A 3B3QA 5FOTA 3LLCA 1V6SA 3Q8LA 4W1PA 2WT4A 3P2JA 3HLZA 4KYTA 2D00A 4Q24A 3K9NA 2HA4A 2X0IA 5HFAA 3BF8A 4Q1BA 1Z0AA 3X2EA 4L76A 2OQ2A 4HB3A 5FRDA 1N6OA 1V25A 3A6LA 3PKJA 1UDRA 2C1ZA 3ROFA 3E35A 1NULA 1MNEA 1U0TA 1JAHA 3FOFC 5FCLA 2GN0A 4DCPA 4MDYA 5H4GA 2W6ZA 1YIDA 3ABKC 3RV4A 2ZRDA 2E37A 2PZAA 5LQKA 1DTEA 1TUGA 1M72A 4Q1AA 1EQAA 2AR7A 4BQFA 3WIDA 2BV3A 4N3BA 1G98A 1WV1A 2XMCA 4L5AA 3GCWA 1LSOA 1LY1A 1VQ1A 1OBOA 4EG7A 1GPKA 3SBEA 2PPLA 4LDRA 3NHPA 2CHFA 4ZJUA 1YQXA 4LMBA 5JC8A 5J9FA 1I6LA 2R1TA 2GLUA 1TA4A 4IHJF 3EVCA 5BMVF 5ULLA 2BFEB 3PXBA 4PO9A 2BFEA 3AB3A 4WJ0A 3HDYA 1JN0A 1JIIA 1LW7A 3TB6A 3CB2A 1DKQA 1I24A 1HA3A 1SVMA 3BGSA 1WO8A 3FCCA 2ADOA 4GXNA 1VL6A 5JTUA 3L0DA 2VHCA 2VP3A 1L4KA 2X1VA 2ZDGA 5KYVA 1RQ7A 1ZXBA 2EL9A 1XR3A 4ALLA 3OZXA 3X1ZA 3PHIA 5JLAA 3SQDA 1TKCA 2NU6A 4LPKA 3CSSA 1U6KA 3QI2A 3MOSA 4M0KA 4QSMA 1RXEA 4MUGA 1U2PA 1T5TA 2GYUA 3N2NA 1RE1A 3KYIB 3BSYA 1C8LA 3EVBA 4QUDA 2QLFA 2IXFA 4OGKA 3FCUB 1F8FA 4BL5A 4JI4B 5GONB 2A7XA 3MOGA 2OGZA 3ZU2A 4RV5A 4X9XA 2HGSA 2BIFA 4Y2UA 7REQB 2DWQA 5GOZA 2HH9A 5AJHA 4GR9A 4MEAA 4QPDA 3L05A 2FZWA 3FCEA 5IJ9B 3UK6A 5JAIA 1VI6A 1E62A 5A0TA 3F96A 4XJXA 1P7CA 2XRMA 2ETVA 2ZBEA 5MGNA 1RIIA 4OLAA 3ESBA 3B5IA 3PDCA 2VPZA 4PRYA 1D09A 3GMSA 4CNBA 4IIDA 1TYDE 2XXBA 5B1SA 4YRFA 1QLWA 2HPHA 1CUWA 3C4VA 4X71A 5J2UB 4W9MC 3EDYA 1IY1A 2GPWA 2HCFA 5DHQA 3PL1A 2PD4A 4XSVA 1NXVA 5AVQA 3F9RA 5T6MA 4RD3A 4HBZA 3UKDA 4QEKA 4DLUA 1XZPA 1C7ZA 2AR0A 3G8BA 3ZQ4A 4L4ZA 1BFUA 5JWHA 9ATCA 3MBOA 4UNQA 4WFQA 4ZC8A 1JRAA 5HK8A 1I4LD 4FDLA 1YC2A 2P1AA 1G0NA 3TUIC 5J40A 4UM9D 3KVOA 2B2CA 1FMLA 4U7HA 2X76A 1NE7A 3N0VA 3TZQA 2BTQB 2Z6QA 5EJ8A 4BP3A 2A9FA 2Q46A 3X1WA 1N7GA 5KVAA 4BNXA 3C74A 3FKJA 3WKAA 1FSGA 2JASA 3O95A 5D5HA 5A1TA 4Q48A 2CBGA 1I2CA 4X1YB 1NNUA 1QPZA 3F7OA 1DBVO 1SJ9A 1M6HA 1CIJA 4J07A 1DP4A 1GYPA 2YV4A 3SAJA 4B79A 4J9VA 4MKGA 3UJHA 4WL0A 2F1KA 3Q7RA 3A6ZA 2ZAGA 2IJGX 3NJ4A 4WKNA 1ZD1A 5MF6A 3HBAA 1V8OA 3MEQA 3VISA 2PZBA 4Z9XA 2OFOA 4F21A 3A6PC 3MJRA 1GG5A 3ZXSA 1TKNA 3GLKA 4KBYA 2X40A 1YRYE 4MGZR 5FJIA 2GD2A 4QD3A 3QJYA 3L84A 4PTYA 5AJZA 1X1TA 3GRFA 3KFLA 2YWFA 4CF6A 3PUVA 4YRGA 1JJVA 3AC0A 3CUVA 4B85A 1KK1A 1GIAA 3EC1A 1K5HA 4EL5A 2IDKA 1AURA 3MPUA 3WRYA 1WXIA 3F2VA 5DM0A 4WCFB 1QQ5A 3ZDBA 2XH8A 1IHPA 2BKAA 3ZOZA 4K9NA 1YOVB 4WESA 5EWJA 1YOVA 4CEHB 1EXWA 2AQHA 2EU8A 3LBFA 2CV0A 4URFA 1FC0A 3M34A 5TQ2A 1QU2A 5BQGA 1AGNA 4F4DA 1T4DA 1ISGA 2D8AA 3EGCA 3F6RA 2Q5IA 3INNA 1ZVQA 1VI2A 3RUEA 1DPGA 3H4MA 3FHTA 2FMHA 3R3XA 2IZZA 1JU9A 4PR0A 4I55B 4DIUA 2RJ3A 3W3AD 1VBMA 3K33A 2ILTA 4FJ1A 3DEKA 3KR1A 1O9GA 4IEEA 2AEMA 3G5AA 3W0LB 2ZYRA 2Q7DA 3FYTA 4LF8B 4BX9A 4ZHQF 2E9SA 2H57A 4EQ6B 4RSMA 5B3IA 3WDMA 3C5HA 3AHDA 2X2EA 3BJEA 3CGWA 5TEVA 2FPLA 1IW7F 1YR1A 3H4VA 1BR4A 5F1PA 2HCTA 4GECA 5ECGC 2K2QB 4DPKA 2WU1A 4DDKA 4BXOB 1TJPB 5E7MA 3TJ5A 1VG1A 2BGJA 3RBXA 2OHVA 2JK1A 3GGGA 1V9SA 3T9BA 4FYVA 2B6HA 1TA9A 2UXCB 4G7OF 2WZCA 2PUFA 3G4ZA 4NBVA 2ZRMA 3ENKA 2AI1A 3RVPA 4G24A 3HSYA 2QQEA 3WLEA 4IDHA 3KRTA 2P75A 4QVGA 2OE2A 1GV0A 3DP7A 2AB0A 3EF3A 3QVMA 2KC3A 4C3VA 2QM0A 1LWOA 3D6NB 1BIFA 4JBLA 2QQ5A 3HB0A 1N6KA 4OMCA 2BFMA 2C61A 2DVMA 3WB0A 4UQPA 2QMQA 1RXIA 4E33A 5F9MA 2XUZA 4WIAA 4FNAA 5EQTA 1ECFA 3AB8A 4W7HA 3N8GA 3PGJA 3N8NA 4DMGA 2BOVA 2XRZA 2R68A 1YDGA 2J6IA 1YJXA 3KKLA 2VNHA 1XU9A 3IJPA 1P60A 3M6LA 4OM7A 1MJHA 3EWSA 3SMVA 1XEFA 2JA2A 3GLHA 1T8UA 4KO2S 4S05A 4J6FA 1ZEMA 4F71A 1LPPA 3PIIA 1XIVA 4CI9A 3WKCA 4UAUA 5GADl 1FQJA 4FR5A 1TJ4A 3S44A 3UJ7A 1NG9A 4KO4S 4EHDA 1UBLS 4EFDA 3FI9A 3ERCA 1N2JA 1CUAA 5LQCA 5DVWA 3KZMA 4IXWA 3F67A 1BA2A 4KPYA 4NCXA 4C03A 1ZK0A 4ECAA 1NLXA 4ZZ0A 3RC7A 5CT8A 2C88A 3CJRA 4BGDA 2RKWA 1R50A 3LQ1A 4CLOB 3DFZA 1BVHA 4CL0A 1QHNA 4JQSA 5AVZA 5FWXA 1SEPA 4CV2A 3I8OA 1XXHA 4LRUA 4TWBA 4YYEA 4FYMA 5EWMB 4E3ZA 3UBMA 3JATB 3JATA 1C80A 4JJZA 4ZVKA 5HIMA 4EGCB 4G09A 3KOOA 3HWSA 4CKXA 1IY2A 3EZ7A 4D0SA 1N75A 4BX2A 5A9TA 2J3KA 4WBSA 1EUDB 4L4SA 1EUDA 1N33B 1RCPA 2J3LA 3ORHA 1A96A 1WASA 1NJ6A 3IXMA 5DCWA 2XADA 5IAOA 2XTZA 5KBYA 1TWHA 1VYTA 2Z6AA 1YULA 3EGXB 2O7QA 3GT3A 6Q21A 4COKA 3UA3A 1D1SA 1HLFA 4P3PA 4YO8A 5JY1A 2P6RA 2HDWA 4A4AA 1XTPA 2WC1A 2VYQA 5LL6P 4UBOA 4XQ9A 3T1OA 1WDKA 4XWOA 1E2NA 1N2CE 5JEEA 1AKNA 4MGKR 2QR2A 1AHNA 4ZKEA 2E4AA 3P9CA 1NRWA 3LUPA 4ONEA 4XE5A 3STUA 1BE6A 3TW8A 1TQ8A 5CNMA 2W6JD 4K9PA 3UT5A 4I0WB 1WCWA 1NFOA 4JQYA 2RFLA 1XF9A 1KNQA 3IESA 1SVIA 3KQOA 2FG6C 5CA0B 3BMXA 1JLHA 2QXTA 4UCWA 3JPYA 5CA0A 1QF7A 1VXOA 4MVJG 2Q1TA 4K88A 4E12A 3DHWC 4CJXA 2J07A 2KE5A 4Q3KA 4IWBA 1W2HA 1JLMA 4GGOA 2V7VA 3AESB 1CUFA 4UHDA 2F67A 1USWA 1J00A 2I3GA 3EFOB 2QMHA 3GLGA 2C7BA 1JEDA 3K1YA 2N3ZA 5B58T 3F4BA 5D8DA 4EJSC 2Q5FA 3FY4A 5EEGA 4EKEA 4YQFA 1UAGA 2G0TA