4YT2A

Hmd ii from methanocaldococcus jannaschii
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
343
structure length
343
Chain Sequence
NMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 124
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt2A01
2BFMA 4O0LA 4QECA 1Q0LA 2DPHA 3AY7A 1HLDA 3EVNA 1PWXA 2X1HA 4JGBA 1H93A 3VZPA 1FK8A 1ONOA 1PU2A 2JFHA 4M8SA 5C3MA 3RFVA 1B3BA 1R66A 1QMGA 4E5PA 1Z7BA 1M2WA 4I5DA 4MKZA 4ZQFA 3AI2A 3BHIA 2CMDA 2ZYDA 4HP8A 4D7AA 1H6CA 5A9SB 1GV1A 1I8TA 4BNMA 2AE2A 4NNJA 2C5AA 4DC0A 4RVDA 3JQFA 1IY8A 3TRIA 1DFIA 1B2LA 3FTNA 3PQDA 2VHXA 1LDBA 4XGIA 2G5CA 3NTQA 2C2YA 3O26A 1IHXA 1AXEA 2QX7A 3ORFA 5A1TA 5TJHA 5IZCA 4PG4A 4B7XA 3EZYA 3L6DA 5JBIA 4A03A 1U8FO 4CJXA 4Z6KA 4UVHA 4KOAA 1YBVA 1UH5A 4PLVA 2OBYA 3GH3A 2X4GA 4RPKA 1ZZEA 3VAZA 1EE9A 4EBFA 1XR3A 4E31A 3AW9A 1Y5MA 5B37A 1ARZA 5CEEA 1YBMA 3FBTA 2J5RA 1MG0A 3W1VA 2NM0A 3L9XA 1QYVA 1UAYA 3GR6A 4DQXA 5KNLA 3IKVA 2O2YA 1HYHA 4CMAA 1A7AA 4TZKA 4URFA 4DYDA 1CIVA 1N9GA 1P1JA 1EUCA 1ZJYA 5DDIP 1LEHA 4FQ8A 4YXFA 1QXSA 4QFDA 4DC1A 2PY6A 4U6SA 3TPCA 2C7GA 3G0OA 4CM9D 1XU7A 1Z6ZA 3ZN2A 3SJ7A 3UXYA 3W8EA 3EHEA 1Y9EA 3KLMX 2WD7A 1W8DA 1E3LA 5DZSA 3TQHA 3VH2A 3AM3A 1J49A 5L7TA 3B6ZA 1LLCA 3L07A 3LT4A 5AXDA 1H0KA 1I3LA 3JYPA 1ZKMA 4WCFB 4Z9YA 4I9NA 2HJRA 1PL8A 4FPXA 3U4CA 3C7AA 3PPIA 1TT5B 3RUCA 1ZUD1 3ANNA 1FMCA 4JCOA 4BO9A 5TF4A 4ZICA 1UDBA 3PP8A 5G2OA 4XIJA 3PWSA 5KWEA 2R6JA 4XYLA 4DIOA 1FXSA 4YQYA 3LVFO 3IQDB 2W2KB 3K2EA 4MVJD 4QX6A 1ISJA 1D8AA 3HADA 1P1IA 2EG9A 2QRJA 4CODB 3WYCA 4FFOA 4B8ZA 2RH4A 5L4LA 4EITA 2NADA 2ZKLA 1GUFA 1RYDA 5DBIA 1DBVO 3V8BA 3CMCO 4O63O 4NJOA 1TA4A 1ZMOA 5TC4A 4BVAA 1HDZA 9LDTA 3LU1A 2GPTA 3GPDG 3JD0A 4YJFB 2O7QA 5GY7A 1I5RA 1DAPA 4E2ZA 4YYZA 3OMLA 3O9ZA 4CQMA 1DDOA 3JYLA 3PHLA 4L4RA 2BI7A 1LRJA 2WYUA 4E12A 4ZN6A 1KEVA 2JJYA 4R1NA 2H9IA 2VRCA 3KTDA 4TKLA 2JAHA 5JFOA 5AQ1A 4BNYA 4FJ0A 3PHGA 3WGYA 2EIHA 4UUPA 3ITKA 5EMHA 5IXSA 8LDHA 1IOLA 1XU9A 3H5RA 1TB4A 3NTRA 3I3OA 4JJGA 5KJ6A 3QA9A 3PZRA 4TRMA 4K9DA 4FN4A 1Q7CA 4XB1A 2NVUA 2Q1WA 4D46A 1ULUA 2XXBA 4W4TA 4Y67A 1U1IA 1JAYA 4M1QA 4YAJA 3KUXA 2DTXA 4HV4A 1E5LA 1NR1A 1GYRA 3O03A 1UR5A 4CM8A 1RWBA 4NMHA 3U09A 2C82A 3R0IA 3RUEA 3UW3A 1IZ0A 4UVGA 5TSDA 4FB5A 5IDYA 3PVZA 1QR6A 3FNGA 4A10A 3ZW8A 5KCZA 4R5MA 4DPLA 3BMCB 3JD2A 2F00A 2BI8A 4AJJA 4HX5A 5TJ9A 3UOGA 3WBFA 3KYCB 3ZGYA 3H9GA 2PZMA 3BMNA 4W9NC 4DIFA 5IN4A 4J90A 1F17A 1YL5A 4IJVA 4MIEA 3I6QA 1HSZA 1PX0A 4GX0A 4EJ0A 2LDXA 3IJRA 1H6AA 3Q9NA 2IDZA 1ZVMA 4DMMA 1CDOA 2P9GA 3NV9A 1K6JA 2JFGA 2Q50A 4TRNA 2SCUA 3DBRA 2OXIA 4CM4A 2O3RA 5JAQA 1GY8A 4BKRA 1V3TA 5LDGA 2E37A 3SC4A 4IJKA 4EW6A 3OETA 3ZI0A 3VH1A 1EMDA 1PGQA 3HJAA 2O4UX 5TQVA 4J2HA 3ZWBA 2EGHA 2O4CA 1JDJA 4AJ1A 5CEJA 4RF4A 1SEVA 2PZJA 4EEXA 4A73A 4UEOA 4ZJUA 1DIAA 2YV3A 3AUUA 3HDQA 4NPCA 4BNFA 1EEHA 3FR8A 2X0RA 4JIGA 3MWEB 1NPYA 2G17A 4TROA 4RPGA 2IE0A 1VSVA 3ONDA 4IQ0A 1JN0A 4YBZA 1B8UA 2JFFA 4IPTA 3S55A 1NPTO 1M67A 1T1SA 2O50A 5I9MA 5LC1A 1NQTA 3ZNOA 2YQ4A 4L76A 4BKUA 3PWKA 3WGHA 2AW5A 1EFKA 3TZKA 1UXIA 3UH1A 1M76A 3AUSA 5ENDA 2Q1SA 3RJ9A 4BNGA 2YY7A 3BA1A 1X13A 4Q3AA 1HTBA 1NM5A 2X58A 3HE3A 5L40A 1DC4A 5EQFA 3K6JA 4U0KA 1N8KA 4P4NA 3V5NA 1E1LA 3PDJA 4W99A 4F46A 1PJ4A 1YGYA 2GZ3A 3Q11A 4AFNA 4MIYA 3UGKA 4GSLA 5I7FA 3PI7A 3W6ZA 2RHCA 3FWNA 3RI3A 2ZJ1A 1ZW1A 5TX7A 1C0PA 3DAPA 5ITWA 5ES3A 1J4AA 2B4QA 3RC9A 2XXJA 4BO1A 1SB8A 3WGTA 1P1KA 2P91A 3A1NA 3GFBA 3I9MA 1NQOA 1BW9A 3ZV5A 3TFOA 1HSOA 3LF2A 3I6IA 2DUUA 1NASA 3DBVO 4OMUA 1CYDA 2ZTLA 4JX8A 4B4WA 1U8XX 1LTHR 1YRLA 5DULA 5L3ZA 5MGBA 2VHZA 2VTEA 4ROSA 3OQ6A 3HG7A 1QG6A 2OGUA 4A0SA 4R3NA 3WIEA 1LSJA 2FN7A 3GMSA 3E9MA 4J1QA 4PVDA 3SEFA 4KDFA 3GOHA 2JCYA 3RU7A 2I65A 1A5ZA 1I30A 1X14A 1R0SA 2DQ4A 3BMQA 4RF3A 3VHRA 4CLRB 2QZZA 4YJGA 4M55A 1O9BA 5ER9A 1GYPA 1B14A 4OSOA 4M54A 5HWSA 3GN2A 3FN4A 4Q3BA 5CG1A 5A3VA 2XPCA 2YHIA 1U7HA 3FRJA 1QLHA 2GZ1A 2QG4A 2VZ8A 4JBHA 1EUDA 4OQZA 5AXBA 2Q4EA 4CM6A 4BGIA 3CKYA 3GT0A 1K2WA 1HETA 3GEGA 2CDBA 3HNPA 5F1PA 3WJ7A 4CMIB 4GVLA 1I32A 3BTUA 2O3QA 2PGLA 4OIMA 3V1TC 1UP6A 3GAFA 4QSMA 4OKNA 3DMYA 5DP2A 3ICCA 1CRWG 5I9LA 3H4VA 2Y1FA 4F6LA 4FC7A 3WG9A 1DFHA 2DTEA 2E48A 2XF8A 4HFMA 4R54A 1ZO8A 4MKXA 5EPOA 1GFSA 4J7UA 4CLOB 1C1DB 3N74A 4OKIA 4CV2A 1C1XB 1LDYA 4CUJA 1LDEA 3ZU2A 4U8GA 2HLPA 3VKUA 4PZDA 4XB2A 4CLDA 3EYWA 3ROQA 4B4VA 1AUPA 2NWQA 4MP6A 3OHSX 3U4DA 1JA9A 5BT9A 4J49A 4A26A 2YUTA 3JQGB 3BMNB 4UUNA 4CM9A 2JHFA 3L4SO 1E7WA 4LGVA 4J4TA 5JYDA 1QV6A 1NPDA 3NT5A 4YACA 2O2SA 1T2CA 2ZCUA 3DL2A 3NDJA 3JYNA 3NJ4A 3VKVA 4BKOA 4BNUA 1UXHA 4DBVO 1PQWA 1QYDA 3WFJA 4I1IA 4XWYA 1AHHA 1T2FA 3ETGA 3AI1A 4OSPA 5IDWA 2FZEA 1YXMA 1E1NA 2C59A 3OJEA 3FWZA 2NVBA 4NJMA 1TVEA 1WMBA 3TL3A 3O38A 4BS9A 4NIMA 3HDYA 4GMGA 4EJ6A 3NT4A 2O3JA 1HDCA 1C3VA 2Q3EA 1OFGA 4GLOA 4D45A 1FDUA 3WICA 4D79A 1M66A 3AFMA 4J7XA 1U2DA 2CSUA 2P4HX 3QVXA 4MVJA 9LDBA 1BXGA 2I9PA 3AWDA 5L7WA 1I0ZA 5CDSA 2HRZA 4M49A 5KVQA 1YQXA 2C07A 1CERA 3F5SA 1XCBA 1PR9A 3WMWA 3CE6A 3PK0A 3PLNA 2GASA 2GUGA 2V65A 2VYND 4IBOA 5KVVA 1XG5A 3QWHA 1WAMA 1HF3A 2J8ZA 2EKLA 1FDWA 5JDCC 5TT1A 5TGDA 1BDBA 1HZJA 2J5QA 5L7YA 4IXTA 4U6QA 1CETA 5HRUA 1DIHA 1VL6A 1LX6A 4DQVA 3GEDA 1SAYA 3D4OA 1OOEA 2VNAA 2POQX 4N18A 4NBUA 3WGOA 5AYVA 1E6UA 3GPIA 2IXAA 3QVWA 3KETA 2X8LA 3E6AA 4J9VA 2VWQA 4ONEA 3F1LA 5K0ZA 4AJNA 2B36A 2ZB7A 1EK5A 1MA0A 2BKAA 3P2YA 2EKPA 4ZVVA 5AXCA 1NQAO 4YJHA 3RD5A 2AQ8A 3KXDA 4YEDA 5J23A 1ZK2A 1ISIA 1YQDA 1SB9A 5JW6A 1WVGA 4RO0A 5T5QA 5U1PA 1P1HA 1LA2A 2DT5A 1YOVA 5F1OA 5COAA 4B79A 1GV0A 1B15A 2BGLA 5C7IO 3H7AA 1VM6A 5H83A 3P5SA 3C7DB 4DQUA 4OH1A 5EN4A 3BZUA 5C7OO 3ONEA 1VL0A 4MVJH 5CAEA 3JYOA 1ADCA 1F8GA 1HYGA 5JNLA 4D0SA 3G1UA 1EUZA 2EEZA 4FFRA 2A4KA 1R4NB 5ENVA 1XA0A 4D43A 4QFCA 3TZ6A 2DFDA 3RAJA 5IF3A 2DM6A 4BO6A 1VE9A 4R16A 4ND1A 4HNHA 2IYPA 4KTTE 3W6UA 4WE3A 4WPGA 4CUZA 3L9WA 1PIWA 3IIEA 2NU9A 2HAEA 1OMOA 1XELA 3B1JA 3BAZA 2GR9A 1NP3A 1M6WA 3NJ8A 4BNVA 4BNTA 2CVQA 1NYTA 2YHIB 3HDHA 4GLLA 2E6UX 1HT0A 5ILOA 2EW8A 3F1KA 2OZPA 2C54A 1NWCA 3JCZA 1V3UA 4EZBA 2VHWA 1U5AA 3WR5A 4TKMA 4K26A 1E5QA 3DQPA 2HCTA 5G0VA 3ZWWA 1MP0A 1ZSYA 3WB9A 4R9RA 3QVTA 1MC4A 4BO4A 4E3ZA 3DHEA 2DTDA 4BB5A 1LDMA 1NR7A 4JBGA 2OHXA 1PTJA 4GVXA 2HQ1A 1YWGO 3DB2A 5F5LA 4D0RA 3AI3A 4MVJI 5FEUA 1QLJA 1KC1A 4IIVA 1BSVA 2NTNA 4Y6SA 5A5EA 1D7OA 3I4FA 3NRCA 4Z3DA 3MJ4A 3WYEA 1L7EA 3CXRA 3HFSA 4HFJA 5KTKA 5IJZA 4Z0HO 1QP8A 2NU7A 3E8XA 1D1SA 3KBOA 3RCBA 3PJFA 2OO5A 4XEHA 1T25A 1GQ2A 4XA8A 1Y1PA 3ZWPA 3H5AA 1PR3A 1HXHA 3C7CB 5BQFA 4JQCA 4BNNA 4RQTA 4ID9A 2WYVA 3UCFA 3PFWO 2B69A 4ILKA 4BL5A 1P0FA 3QVOA 4NQZA 2PLAA 2VOJA 1I33A 3EW7A 2VT3A 3COSA 1B26A 3DBHA 1ZXBA 4Y9DA 3MEQA 5T8KA 2HMUA 3ZDFA 5DBGA 1OC4A 2WJPA 1PWZA 4XDYA 4BUCA 2P5YA 3D5QA 1EZ4A 1ZEJA 1I3KA 5T57A 1C0IA 1O5IA 1WLYA 4NJMB 1E3EA 3WGIA 1R16A 2DU8A 1PJCA 1ISGA 3E5RA 3JD3A 4RVFA 1A71A 1B7GO 3BHMA 4M89A 4RGBA 4DVJA 5DF1A 3ZZNA 3WSWA 4YDRA 1C0KA 2I5PO 1JW9B 2O23A 4JK3A 2B0JA 1IPEA 2PGJA 5TS3A 1OAAA 1KS9A 5ADHA 3I9LA 4L4SA 1YH3A 3I5MA 2VQ3A 2J3KA 2XAAA 2R00C 4ZRNA 3TWOA 2RCYA 4XRRA 2BFPA 3X2FA 2FWMX 6ADHA 3EY4A 4NH4A 3W8DA 1LUAA 4YAKA 4YT4A 5KVSA 4N7RA 2EXXA 3ZNNA 3HWRA 1IZ9A 4WOJA 3S1LA 1PJQA 1SEPA 1A72A 3OQ1A 2C20A 5DCWA 4EEZA 3VPFA 3A9WA 4KUEA 1PJBA 3R1IA 3RSHA 1E6WA 3JQ7A 3PYMA 3MJCA 3O8QA 3BTVA 1CF2O 3GGPA 5JDIC 5DCYA 4XQGA 2GN8A 2RIRA 1QRRA 2WDZA 2X0IA 4PFJA 4A2CA 4PLFA 1N5DA 4C4OA 1DJQA 3ZHBA 4PLCA 3QW2A 3H3FA 1J5PA 4W9NA 4AJEA 1E3WA 3TZQA 3EDMA 1PJ3A 4WLOA 5GZ3A 1N7GA 3F5QA 3KZVA 5C37A 3L6EA 3FR7A 3QJ5A 1E77A 1A7KA 1MGOA 3OJLA 4YJHB 4TSKA 1OC2A 3ZU3A 4E4YA 5AVOA 5K6AC 3QQPA 1IHYA 3C3XA 4WCFC 2WWRA 3F3SA 2VRBA 3FF4A 1GADO 3WOHA 3RC7A 3V2GA 4ALMA 4CMEC 3AJRA 4B8WA 4J91A 3OJOA 2WSBA 3VOSA 4XCVA 2JL1A 1NXQA 5C7LO 1B3RA 3M1AA 4YVFA 5GMOA 1T4DA 4IDGA 1ENZA 2PR2A 4R1TA 5B1YA 4J4HA 3WWYA 1GQQA 1JWAB 2UVDA 5DT9A 1X15A 4DLLA 2HMTA 1PGOA 5G4KA 4HADA 4P8RA 2Y1CA 3GG2A 3JV7A 4IIUA 4UVIA 5BR7A 2UV8A 3GF4A 4AJIA 2FP4A 4I8XA 3I9OA 1SBYA 1YL6A 3DZKA 2X5OA 1QSGA 3IKTA 3D4NA 1UXJA 4BV9A 3GGGA 4BOYA 1P1RA 3L0DA 3ZWXA 8ADHA 1K6XA 2TMDA 3INRA 1YKFA 5F21A 1LLUA 4B3HA 3NEPX 4EUEA 3CTMA 4R51A 2AG5A 3JQAD 4R69A 4K28A 1JVSA 5L53A 5H82A 3ZNPA 1T2AA 4J1NA 1GTMA 2CFCA 3E03A 1N2SA 5CDGA 1FDSA 5G0SA 4DGSA 4JJFA 2DBZA 3QE3A 3SLGA 4LMPA 3Q9UA 3BYZA 4RVGA 1WZIA 3DC2A 4Y8VA 2B37A 4PG6A 1DC3A 2YFHA 1RKXA 1R12A 4KMSA 4WEQA 1U2GA 2IRWA 2VWHA 3M2PA 4L8VA 4BNIA 4GKVA 2EJVA 5I8ZA 3JTMA 4RVHA 3L4BC 3SJUA 3UN1A 1YVEI 4AL4A 4NR0A 4Y6RA 5EINA 1DB3A 3LT0A 1ISFA 1R4MA 2VYNA 2GYYA 4NU5A 1A9ZA 1PQPA 2JD2A 1G0NA 4EUFA 3A06A 3P2OA 1LDNA 1WDKA 2PD4A 3Q6IA 1CJCA 4K1LA 2AEMA 3U9LA 2NACA 1U4SA 2O3UA 4RDHA 3KSDO 4LVUA 3GEMA 3I83A 1JQBA 3IP3A 1QORA 4JXKA 3AU8A 4IM7A 4KWIA 1DFGA 1LSSA 1ZFNA 4B4UA 2J3HA 3RROA 4G65A 3E1KA 4RPHA 1CQIA 1EFLA 5ER6A 4AJ4A 1Q0HA 5HA5A 2IXBA 3ANLA 4MVJF 3DDNA 2Z5LA 3PRJA 1SO8A 4ESOA 1MFPA 4TVOA 3WGZA 2EHDA 3AOEC 3A28A 3KYDA 1WW8A 1Y81A 2DPGA 1GPJA 1KEUA 4HY3A 2HO5A 4BGVA 1HE5A 4TRRA 4IQGA 4N5NA 4YAEA 1LI4A 1U4OA 5F3RA 3GMDA 5TNXA 3H9QA 3IL2A 4UREA 1U28A 1U3TA 3HDJA 3RUAA 3HN2A 3NGLA 4WLUA 4JJIA 2X9VA 1E7SA 3AOGA 5I7EA 5EIOA 1T1RA 3GUYA 1LJ8A 3TL2A 4IXWA 1NHGA 3U62A 1A4IA 1K89A 1ZJZA 2QHXA 3CH6A 3LK7A 1DSSG 1ID1A 3DZGA 1DIRA 3ZHZA 3UFXA 2VTDA 4D42A 1E3SA 2CF5A 1X7HA 2AMFA 3L77A 3MWDB 3W4IA 3GRKA 5JCXA 5I9NA 5TIIA 2UUOA 3BTOA 4OYRA 4YWJA 1MG5A 2RBEA 2VNSA 3WJAA 2J3IA 3UUWA 3INTA 1U5CA 3V1YA 3MJVA 4IDDA 1SOVA 1Y8QA 2YZ7A 1E3WB 3ROMA 3GUCA 1BTOA 2WE7A 1PZFA 2YDYA 4WOKA 4Y6PA 5TLSA 4J7CA 4NI5A 1I2BA 4EGFA 5CPFA 2AE1A 4FW8A 4B7UA 3PTZA 2EP7A 4OGWA 1BDMA 2PH5A 4CL3A 3O4RA 2JCVA 1C0LA 2HK7A 1N9GB 2Q2QA 3QSGA 4ITUA 1VLLA 3RFTA 3GNTA 3C1OA 3ZV3A 3K96A 1LBEA 4ZGWA 3JQEA 4ND2A 1NFQA 4XDZA 2C7VA 4IINA 1Z45A 5HBRA 4YAIA 3GHYA 4E5MA 1VKNA 2O3TA 1UJMA 1K3TA 3DTTA 1ZCJA 1PSDA 4CM1A 3LDHA 2ZYAA 2Y0CA 5JO0A 2WD7B 5EERA 3CINA 5FYDA 3DMTC 1KOLA 3RBZA 4WJZA 1AHIA 2X86A 1XYGA 2AEJA 4UVDA 3KO8A 4LN1A 3P7MA 2GLXA 3H9UA 3GRPA 4QO8A 5G4KB 1QV7A 1HDGO 4RJTA 1WNTA 3W8FA 3WQSB 2P4QA 2PKQO 4DYVA 4RLSA 2UUPA 3KSZO 4PLZA 1VJTA 2EJWA 4GPD1 4QUKA 5JDCA 3JSAA 4ND3A 2DFVA 4P4LA 4R01A 3TOZA 5U9CA 3ENKA 3DO5A 3OA0A 3WDSA 4R5HA 1HDRA 4CPDA 2HU2A 4A7PA 2HK8A 4GWKA 4Z9FA 1KBZA 4YTEA 3ZNQA 3VZSA 1ENYA 2BD0A 1IULA 2NTVA 4A5OA 1H9BA 3DEYX 1P44A 1RJWA 4S1VA 3KHUA 4FOSA 1D4FA 4UVEA 2VZ0A 4N5MA 3UAGA 2PD3A 2DBRA 4BV8A 1F06A 3FD8A 2DAPA 3NT2A 3ZCXA 5ILGA 3VPXA 3JQ9A 1YJQA 2JKVA 3C24A 1KVTA 4CQMB 3PHIA 4CM5A 1R37A 4II3A 4G5HA 4J4BA 2CUKA 3E18A 4DRYA 4FJ1A 4INAA 2I76A 3WFIA 5EESA 2YDXA 4PCVA 5JS6A 4IS3A 1KIFA 3WTBA 4CMJA 3C1TA 2CVZA 3RKUA 1GCUA 1I3MA 4KUHA 4WKGA 3WX0A 5IDXA 5HM8A 3GDOA 3QRWA 3IOYA 3RUIA 3ZHYA 4HBGA 2P2SA 4LRTB 4WECA 4EUHA 5COQA 4AJKA 4XD2A 1YB4A 4XQCA 2JHGA 4I5GA 3RBXA 3JQ8A 4TRJA 4GKBA 1R0LA 4OXYA 1EVIA 2NVUB 5ITVA 3ZWOA 4QO7A 3SVTA 4O1MA 2EERA 1OBFO 1H9AA 3DHYA 4CQLA 4Q3NA 1UZMA 2O3SA 2IEBA 4PLYA 4CM8B 3RFXA 4NFYA 3HUDA 4FFLA 1VC2A 3OBBA 1BVRA 4NFSA 3D3WA 4MO2A 1YL7A 3EZLA 3OF2A 3JD1A 2GNAA 2GO1A 3H2SA 4FFMA 5KIAA 3F46A 4L74A 3KVOA 1VJ0A 2IEDA 1X0XA 2F1KA 4GGOA 3W4KA 3M2TA 1XDWA 2VWGA 3TZHA 4NFHA 3GVHA 4YA6A 1BG6A 1DRUA 1IB6A 4E32A 2Q45A 3VVBA 1E1MA 4DA9A 3UHAA 4IMRA 1GAEO 1I01A 2WD8A 3IDSA 1A27A 1UXKA 3CIFA 4AG3A 3RUDA 3RASA 4Z3KA 1HZZA 3ASUA 3IJPA 3I1JA 3DZJA 3T7EA 5KJ1A 4WLFA 3DBRB 1JKFA 3KEQA 3FNHA 4CM4B 4PLTA 4OJNA 2Q1TA 4FCCA 4FS3A 3MZ0A 2FSVA 3JQDA 3WQQA 3FPCA 4FFPA 1UUFA 3QHAA 4YRDA 1T26A 2EWMA 1XQ1A 1GZ4A 5EQDA 5L45A 2FPGA 4F3YA 3S2IA 3G3EA 3Q1LA 3TOXA 3K5PA 4I5EA 4H3VA 4PGFA 2VT2A 2R2GA 4LSWA 4BHTA 3Q2IA 2OL4A 1LRLA 3GDFA 3JQAA 4NK4A 1T2DA 2FOIA 2VHYA 3VPHA 3HB5X 1NFFA 1G1AA 4PRKA 4BB6A 1UZLA 1JAXA 2D8AA 3RBVA 1PS8A 2W8ZA 4IZHA 5KJFA 4LK3A 1BRMA 5JCJD 5U4QA 4DLAA 1F14A 3DBLA 1PJTA 1L7DA 3FHLA 2UAGA 3HQ4O 4MP3A 5L95A 4E21A 2O7SA 2CDCA 3GG9A 5B4UA 3LT1A 4J0FA 2G76A 2Y1OA 4BNLA 4JBIA 4DUPA 2O48X 3ANMA 2Y1DA 3W4JA 3OECA 5CP8A 3LZ6A 4FJ2A 4NBTA 4LISA 3UF0A 2HMVA 3FSRA 2BELA 1ZK4A 5A9SA 3E5MA 2W4QA 4ZD6A 1R6DA 4LRSB 4BMNA 2OUIA 4FSHA 3ZU4A 4OO3A 1LQTA 5COBA 3AFNA 3LYLA 4Z9XA 5BSFA 3GN1A 4IJWA 1Z82A 3M1LA 3FI9A 4BO0A 4E0BA 4BMSA 1SCUA 4MOWA 3U5TA 1GZ3A 2NUAA 3Q2KA 4JROA 4ALJA 5BNTA 4DBZA 3NGXA 1V35A 3ITDA 5CEFA 4CLEA 4PZEA 5A9RA 1LLDA 4W6ZA 4GX2A 4J0EA 4AJLA 5KKCA 3PLRA 5BNIA 2AQKA 3GFGA 4D3FA 3AM4A 1BW9B 4UUOA 5FI3A 4D3SA 5IAAA 1NHWA 1ONPA 3P19A 4CM3A 4BNJA 1Y6JA 4DTIA 2I3GA 1E7QA 3HFGA 5H81A 1I24A 3JQBC 1U3UA 4GGPA 1AN9A 3K9QO 1JTVA 4YR9A 2CNBA 2H63A 1C14A 5KKAA 2YW9A 2WM3A 4HUJA 3LLVA 3GGOA 4W82A 1ZEMA 3GVPA 3LF1A 1E3IA 3T4XA 2X0NA 2EKQA 1WXDA 4C7KA 2FSSA 1I3NA 2IZ0A 2WMDA 3AUTA 1F12A 3UVEA 3EAGA 4OM8A 1ISMA 3DZIA 3B1KA 2PZKA 1PGNA 3WTCA 5K6AA 4Z0PA 1ONNA 3BMQB 4HNGA 4WLEA 4WCFA 4PVCA 4YJGB 2D1YA 1LC0A 4CMEA 2NVWA 2FHSA 1H94A 1QYWA 1TT5A 5T64A 3IAHA 5F5NA 1EQUA 5A05A 2RAFA 1D1TA 4ZU3A 2X5JO 3MCVA 2HRBA 1ML3A 1VI2A 1TI7A 3GA0A 1FDTA 3OH8A 3UICA 2WE8A 2Q2WA 4MPDA 3OP4A 1VRWA 4E5NA 3WXBA 1NTOA 3OSUA 4O5OA 3PJEA 4CR6A 2I99A 5KJCA 4L75A 4GWGA 4IDAA 2W98A 3JQ8B 4MINA 1DAOA 4U5QA 3LC7O 4H16A 3PGJA 4EI2A 5A03A 3I9KA 4BO5A 3OICA 3VDQA 4IS2A 2Y66A 1LLQA 4PIVA 2P9CA 4HKTA 3RWBA 4CQLB 5I8WA 1T24A 3OIDA 4AVYA 1HDYA 3MJSA 5BSEA 4NK5A 2D4AA 3BTSA 4N5LA 5IZ4A 5CHEA 1DC5A 4YJFA 4HFRA 2BF7A 3ST7A 1W4ZA 3E9QA 2BFOA 3H6KA 4DLBA 4JNKA 4ND4A 4WCDA 2VHVA 2Y1GA 2ZK7A 4MJLA 5JAMA 1SZJG 1Y7TA 2Y0DA 2NTJA 1W73A 1E1KA 1E7RA 3ONFA 1JKIA 1LXCA 1NAHA 3ETDA 4JP3A 2Q49A 1RM3A 1HKUA 2LDBA 4RF5A 3E9NA 1RM4A 1EDOA 3PZBA 4MIOA 3T4EA 1Y9AA 2A9FA 3KB6A 3DZHA 2E82A 3L4BA 1EBFA 1EK6A 2VUSA 3ZU5A 2FR8A 5JMWA 3X2EA 2P68A 4ZQBA 2C5EA 4E6PA 4UAGA 4OQYA 4II2A 1PQUA 1XHLA 5JAIA 4PG7A 5CG2A 3ZH2A 5BSGA 1MUUA 3DOJA 3HZZA 3ZWCA 2PA3A 1V0JA 3CPSA 3OIFA 1Z75A 2VCYA 4E33A 1BXGB 1Q7BA 1PJSA 1LQUA 2ZB4A 1CWUA 1M75A 1WDLA 1KERA 1FJHA 1J0XO 4P4GA 1KYQA 3PGXA 3FCOA 3G17A 2HMSA 1YDWA 4LVCA 2PGDA 4HXYA 4ZQHA 4WGGA 3BHJA 5IDQA 4QEDA 5DCUA 3EGOA 1BHSA 4XZ3A 5JC1A 3DBLB 4WUVA 5K9ZA 5CPBA 4DMLA 5L4SA 2PV7A 1M6HA 1Q7GA 3VZRA 4YT8A 2V6MA 2A35A 3AOEA 3F47A 3GNQA 1ENOA 5T6BA 1X0VA 4GX5A 4MP8A 4R9SA 1BXKA 1VKOA 1N92A 4CMHA 1U3WA 5ICSA 4J1SA 1NFRA 3OQBA 1Z7EA 1P45A 3RC2A 3LT2A 2J3JA 1GQYA 3IC5A 4YRBA 2G0TA 3K30A 1EVYA 1JWBB 3HN7A 4E5KA 1TEHA 1E6EA 2AXQA 3ABIA 3PQEA 2OOSA 4J16A 4ND5A 3PJGA 1N1EA 3S2GA 3GZNA 3VVCA 4B4OA 1GR0A 2BRUA 5DP1A 2GN6A 1HYEA 1NBOA 3NAQA 3H9JA 2TMGA 1YOVB 4FGWA 4D44A 4YAGA 3LQFA 2DUWA 3HB4X 2YV2A 4AJ2A 4I5FA 2B5VA 3DHNA 3MOGA 3MTJA 3NTOA 2E4AA 4Z0TA 1ULSA 3KSUA 3TJRA 1HLPA 2YYYA 5G0UA 2V6FA 1S7CA 3DAFA 3L6OO 4WK6A 1XEAA 4QQRA 4R1UA 5F1KA 2AQHA 1H2BA 3H2ZA 2JD1A 4DPKA 4CL8A 1V6AA 3WWZA 2G82A 4GMFA 3DFUA 3PIIA 1ZBQA 2OP0A 3U3XA 3NDRA 2Y1EA 4XYGA 1LSUA 3QWAA 2PD6A 1NAIA 1GZ6A 1MXFA 3LSYA 1O89A 1BXZA 1LRKA 4WASA 4BNZA 2X9GA 2DBQA 2Q4BA 2JD0A 5KOIA 3D7LA 1GEEA 3WLEA 4RZHA 3DWFA 2V7PA 1P77A 4YB8A 3GZ4A 2V6BA 1G6KA 4OAQA 3H65A 3DMTA 4BO2A 4B3IA 3I9JA 1KC3A 1Q1NA 4GI2A 4FOOA 3QY9A 2B4TO 2VOEA 1P3DA 2QRKA 4NHEA 2ZTUA 4AICA 2EV9A 1PJLA 1IPFA 1HWYA 3OEWA 1XQ6A 4DWVA 2ZJ0A 1YBAA 2NQTA 1L1FA 1X1EA 2ZATA 3PHJA 4CR7A 4ZHSA 1AGNA 2GSDA 3ZV4A 3RKRA 4RZIA 1I2ZA 2Y67A 1K5HA 3CEAA 3PWZA 4IJUA 1W0CA 1SNYA 4P22A 4IZIA 1DJNA 3FPLA 5JY6A 1A4UA 3TFQA 5JY1A 3PYXA 3TF5A 2AHRA 3GVIA 4E5YA 5JC8A 2DC1A 5JCJA 3OIGA 4XX0A 3ROPA 3IUPA 4XIYA 1VSUA 5G0WA 2CF6A 2GRAA 4XJTA 1O6ZA 1HDOA 5A5FA 5L4NA 3OJFA 1PGJA 1NNUA 2IZ1A 1DRVA 3SLKA 3RU9A 4GSKA 2X5KO 1P0CA 2CZCA 5T8KC 6LDHA 3LC2O 4I9HA 4CLRA 5JAZA 1NQ5A 1DLJA 4E2XA 3DZFA 4KQXA 1FDVA 1DPGA 2FR0A 1YJ8A 2D3TA 1O8CA 3WIDA 4BO7A 4PN3A 2H5LA 3PHHA 3VZQA 4PRLA 2PWZA 1MC5A 1MXHA 1OZAA 3IMFA 3K2BA 4CMIA 3DBHB 4OHUA 2HSDA 4GX1A 3GLQA 3D3EA 1FF9A 4CV0A 4XGKA 4XJSA 3ZHXA 3M6IA 4E2YA 4YPOA 2RH8A 1WWKA 4AJOA 3WGGA 3AK4A 1WP4A 2X6TA 3EMKA 3NKLA 1NVMB 4Q9NA 2JCXA 3D5TA 3EUWA 2X0JA 3HSKA 3OFSA 4JLWA 4KUGA 4E2WA 3DOCA 4BKQA 4CLXA 4G81A 1ZXLA 1AE1A 4CV3A 4CLOA 1C1DA 2WEKA 4C7JA 2W2LD 1C1XA 1V9LA 1NVTA 3JQFC 3QP9A 4GAEA 3D1LA 4NBWA 4PZCA 4D41A 4E13A 5BSHA 1ZH8A 2GCGA 2WYWA 1PS9A 2A92A 3I52A 4JP2A 3SX2A 2I3AA 5A06A 4HWKA 1P9LA 3G79A 3WBBA 5IZCC 3ASVA 3BMOA 2UYYA 1ZSVA 2QYSA 4RLHA 2Q2VA 3Q0EA 2EGGA 1YONA 4BQPA 4QTZA 3JQGA 2YQ5A 3CMMA 3G49A 3NX4A 2NV6A 3GY0A 3JQ7B 5GZ6A 3O8QB 1KETA 4X54A 1UAGA 3UKOA 2JAPA 3ZWYA 4WNIA 1U3VA 4UEKA 1MV8A 4BNHA 5DOZA 4RORA 3RC1A 1Y8RA 3LLSA 2YFQA 4WEOA 5JYEA 3QLJA 4GQAA 4M87A 4GH5A 3DOOA 3PIDA 2C29D 3K8ZA 2BH9A 4F45A 2B4RO 2VYVD 2HUNA 5B12A 1NX6A 3DTYA 3WSVA 4NZ9A 3WMXA 3N7UA 5TT0A 1DC6A 3CZRA 2NSDA 1XGKA 4ALKA 4BGUA 1XKQA 3ADOA 4R1SA 3GZNB 1ZSNA 4CMCA 2DKNA 4R68A 4YCAA 1BWSA 1DXYA 3B70A 1B8PA 5B4TA 2PTGA 3EK2A 3KYBA 3WNQA 4RV9A 1RM5A 2RHRA 1BGVA 4KQWA 1TLTA 3KOUA 2GGSA 3K31A 4RPJA 2IYOA 3OEYA 2ZB3A 3CZMA 1LC3A 2BFAA 1I2CA 2DBVO 1BMDA 2GD1O 1SOWA 2IZZA 2PH3A 2PNFA 3PXXA 4NDNE 4MKRA 4P38A 4BNKA 1TXGA 4OOEA 4RF2A 3PDUA 1IUKA 1V3VA 4ALIA 1WZEA 5LDHA 2Y68A 3DR3A 1R15A 1B16A 4MVJM 5L51A 4RVSA 1KVSA 4NG5A 1U9JA 4XGNA 4DREA 2FPPA 2PK3A 2OORA 5C5IA 1JKJA 4RCVA 4ZRMA 3E82A 3F6YA 1GEGA 3KM0A 4FR5A 1ZNQO 1Z74A 4EYEA 5A04A 1F0YA 1UP7A 2ET6A 3U4IA 4WLNA 3DAGA 5HS4A 2IODA 5AOVA 3GQVA 4AJPA 3PYLA 1P31A 3PJDA 4RVUA 4GL4A 5A9TA 5AXAA 2PKQP 2W90A 3EVTA 5THQA 3ZV6A 1DOHA 2ZYGA 3WGQA 4TWRA 5THKA 1GCOA 1N1GA 1QKIA 3ROKA 2H6EA 1X7DA 3A14A 2Q46A 3V2UA 4LW8A 1SMKA 2AA3A 3WYBA 2GN4A 4J1TA 4G2NA 4L73A 4CMGA 5EL0A 1DRWA 5KJEA 5DBFA 2Y0EA 2BLLA 1B8VA 3AY3A 2B83A 3STHA 7MDHA 3VPGA 2XOXA 5I7VA 5JO9A 2NLOA 4ZA2A 3ZW9A 4BO8A 1MX3A 1E92A 4KTVE 1DHTA 1PEDA 3GVXA 4NBRA 1EVJA 4CR8A 3N58A 1VPDA 1R4NA 3H5NA 4BIIA 1PS0A 4BNWA 3VH3A 1R4MB 2YV1A 2X7HA 1HE4A 2DLDA 4R4JA 3G1TA 4KDEA 2AQIA 4I08A 1ORRA 3JQBA 3AM5A 5JE8A 4XYMA 4YJDA 1HEUA 1LSOA 1JLLA 4EDFA 2GDZA 2PKRA 3HHPA 5ICMA 4O59O 1HL3A 1ADGA 1SC6A 5CDYA 3NYWA 1Z73A 1CEQA 3TDKA 3OA2A 1UDAA 1KEPA 4XKJA 4IDBA 3QIVA 4IUYA 4WNCA 2EF1A 2BMAA 1X1TA 3PFFA 2FMUA 4W7IA 4BQRA 4YQZA 3ZWVA 3OM9A 3RIHA 3QV1A 3JQCA 4J43A 4O6VA 4GBJA 4ALNA 3DXFA 2VUTA 4FD3A 1GU7A 1YE3A 3EC7A 3KYDB 1E0DA 4AJHA 4FBGA 1P1FA 1DLIA 2QIOA 4PLWA 4QXMA 3TZCA 2ZTVA 3QWIA 3D4PA 2GZ2A 3KRTA 3I4CA 1Q2XA 4D3DA 2CD9A 1XIVA 1B0AA 4J9UE 4DXHA 1S6YA 1JVBA 2ZCVA 1AXGA 4MDHA 2D5CA 2Q99A 1GUZA 3QWFA 4U0JA 3ETEA 3IS3A 3H3JA 4M86A 4H15A 4IDFA 1P74A 1ENPA 1ZK3A 1RYEA 4CUKA 5JLAA 3VTZA 1VJ1A 2PZLA 3IUSA 3BMOB 3K73O 1P33A 3R3JA 5CDUA 2BGKA 3ZWNA 1UDCA 3TSCA 3F4BA 2I67A 5IG2A 3T7CA 4CLHA 3RQSA 2HMWA 4H7PA 4XQEA 4MVJP 3R6DA 4OXKA 4L9RA 5T67A 4RDIA 1QYXA 5IFLA 1GUYA 4R41A 3FNEA 5KVCA 2CDAA 3ON5A 3U4HA 4IGEA 4CV1A 1O0SA 5IN5A 1GD1O 2P9EA 2DVMA 1H2HA 1Y8RB 2E49A 1YB5A 3WNVA 5EJ2A 1DO8A 2YHUA 4FFNA 3JYQA 1OI7A 1G0OA 4IDEA 1E7MA 3OJ0A 2VZ9A 3R3SA 4XR4A 1Y8QB 1XSEA 4A27A 4I9UA 4BGEA 1R0KA 4J2OA 2Z1MA 4N54A 4BKPA 5TRTA 4J6FA 3KEOA 4LCJA 2GF2A 2FPIA 2GERA 3S2FA 3DFZA 1GDHA 3CSDA 1F8FA 2WTBA 3ICPA 3JQ6A 3NUGA 1HE3A 1HRDA 4CQMD 4DPMA 4DIBA 2A94A 5DN9A 1ZMTA 2FRDA 3DZBA 3BXXA 2J6IA 3I9NA 2VRCD 4W7HA 1HDXA 1ZK1A 2HJSA 1K0UA 4MVJE 5B4VA 3VTFA 2BGMA 1ISHA 1H6BA 3GHHA 2C2XA 5JSFA 3WLFA 5CFZA 4UEJA 3QWBA 3PEFA 3UCEA 1UP4A 2Z1NA 5FI5A 2QQ5A 1O95A 3PQFA 1IL0A 1PZGA 4BO3A 2YJZA 5JXWA 5MDHA 2R00A 2FR1A 3FNFA 2NNLD 1N7HA 4FIZA 1LDGA 1X7GA 1K6IA 4CM7A 4RQUA 3UCXA 3MTGA 3NDIA 4RPLA 4L0QA 3V1UA 4UUMA 2EP5A 1EBUA 2Y05A 4PLGA 1GPDG 1Y5RA 2J5KA 2ZB8A 2VN8A 1GL3A 1I36A 3D64A 5JDIA 5LCXA 3SXPA 3U0BA 2OMEA 4DL9A 1H6DA 1SPXA 3ZWAA 3ZWMA 1XLTA 5L9AA 1GYQA 3JQ9C 4J3FA 1U7TA 2CVOA 4Q3EA 3H8VA 5JPIA 3E48A 1NWHA 4EJMA 2OP1A 3SC6A 1D3AA 5G4LA 2ILTA 1LU9A 4Q3DA 3Q3CA 2QZ9A 4RL6A 2I6TA 1PGPA 5BNFA 3RUFA 2X22A 4LSMA 5IXYA 2X23A 2W2LA 2D0IA 1EE2A 2EW2A 4KZPA 4K6CA 1QYCA 2VWPA 3VDRA 3VPSA 3RUHA 4OL9A 1EDZA 2OFPA 2X9NA 4WLVA 4Y98A 2D5AA 3ENNA 4MVJG 1UZNA 4ALLA 5JMPA 4YRAA 5A4DA 4NU6A 4B7CA 1V8BA 1UXGA 4IDCA 1PL7A 3KV3O 5HTOA 1A9YA 4L4XA 1PZHA 3S2EA 3D0OA 3FBGA 4TQGA 1NVGA 3BIOA 4U7WA 4YT2A 5I7SA 3RVDA 2C0CA 2OBNA 1Q0QA 3SBOA 3GK3A 3GC6A 2AG8A 3S8MA 4IMPA 3ADPA 3I23A 2W2KA 3WQRA 4TZTA 2ZQZA 4Q3CA 4ZQEA 2P5UA 3AUAA 4E30A 4UULA 1VL8A 1E7YA 1KY5A 4HFNA 5G0TA 5A02A 1KEWA 4TVBA 4KWHA 4LCEA 1PZEA 4FC6A 1ADBA 1TT7A 1PJ2A 2D2IA 2VYVA 5FWNA 3VH4A 1DEHA 1BVUA 3TNLA 3C85A 1YB1A 4B3JA 1YO6A 3U49A 4BNXA 1LNQA 1DIBA 1ZK0A 3D3WB 1T4BA 3VC7A 2Q1UA 3GAZA 5FF9A 1JU9A 4IGFA 4JN6B 2ZIZA 1IYZA 2H1SA 2GN9A 1E3JA 4NBVA 3FTPA 1EQ2A 3GDGA 4Q39A 3B1FA 1KVUA 1YDEA 3F4LA 4FGSA 1XWFA 4IY1A 5CDTA 1O94A 4PLHA 1W6UA 4XYEA 1PL6A 2HKIA 2UDPA 2HDHA 4BMVA 4XRGA 4PG8A 2B5WA 1ADFA 4XR9A 3RJ5A 2V6GA 1MFZA 4OXNA 4ZQGA 4FDAA 3A4VA 3K92A 1KY4A 4S3MA 2CY0A 3AY6A 5FFFA 1YQGA 1YS4A 4CMKA 2HK9A 2PFGA 3C1AA 2ZTMA 2NU6A 1KVQA 2FZWA 3JD4A 1I10A 2VUUA 4LMRA 3V2HA 1HE2A 1ZIDA 3DONA 3GVCA 4OOFA 1WPQA 3MJTA 4PLPA 5A3JA 7ADHA 4F6CA 1EVZA 1IE3A 2D59A 2QRLA 3H9EO 1CQJA 4KP7A 2Y99A 4QT0A 3TN7A 2Y93A 3B20A 1H5QA 1RM0A 5HS6A 4TMFA 4PG5A 3JQAB 1MLDA 3INGA 2B35A 3MOIA 4IQ8A 4XQ9A 5GZ1A 4R3WA 2NU8A 1DHRA 3IP1A 4CMBA 2FY8A 3LC1O 2ZQYA 4K6FA 1J6UA 3AU9A 3C8MA 3ULKA 2QW8A 3BMCA 1DIGA 2BHLA 4YT5A 1RPNA 3GNSA 3F9IA 1WDMA 4XYBA 2NQ8A 2QYTA 2I66A 3KYCA 3WS7A 1WMAA 3KLPX 2Z95A 5DNAA 1MB4A 1T2EA 2G1UA 3MJEA 1KVRA 3QVSA 2AEFA 3CUKA 5DOVA
chains in the Genus database with same CATH superfamily
2BFMA 1VMEA 4C5AA 2PVSA 2H0QA 5ECYA 2WAOA 4BLSA 2R97A 3BHIA 3B12A 4AMBA 1JP7A 4O2BF 3TRIA 1B2LA 4A2PA 4XWOA 3NTQA 3NBUA 1JI0A 4ZQCB 3WGNA 1DI0A 1TM4E 1C3LA 4ZO8A 3AW9A 2D2VA 5KSWB 2OPBA 2R751 4S12A 2C8VA 3NAGA 1A7AA 2EOAA 3VO8A 1DEOA 2PY6A 3L0CA 1YS2X 2CBZA 5EPEA 1ZVVA 1D2HA 2F1OA 3VH2A 5ALYA 4C43A 4K46A 1PLJA 5AXDA 1VKJA 3PPIA 1AUVA 3H84A 1PTJC 1TFRA 1UDBA 4LZJA 4JSTA 4FUQA 5DWQA 1SQGA 5YASA 3F6CA 1ISJA 2QA5A 3EJNA 4JUDX 1U89A 1DBIA 3DQQA 5EGYA 5KPDA 1GUFA 4Q7JB 4JOQA 4B6GA 1ZD8A 4HGPA 1KSHA 4F5DA 4E12A 2VRCA 3PL5A 5E4TA 4LCBA 2VCHA 4O25A 4LBVA 3SEQA 1KQGA 1K1EA 2V5VA 1Y6FA 4QUAA 3DPSA 3SJAA 2XVMA 4F71A 4KR9A 3X1OA 5I8PA 3MVEA 3R4CA 4PFKA 1RWMA 5AP9A 1QR6A 4R5MA 2I03A 1YQ9A 1KU6A 1AS3A 4MYSA 3CQ9A 4IDOA 1HSZA 2LDXA 3FLEA 5CR9A 3PPXA 1KZHA 2OAGA 4XUDA 2WQ7A 1DCKA 4RPCA 1GY8A 1TE2A 4QWWA 4KQ1A 2EGHA 3E53A 3WGLA 5EAIA 4A73A 2MSWA 1VIMA 2X0RA 5E0OA 3IPAA 3BH6A 1TQ4A 3N53A 1YS1X 4FFBA 2CE2X 1NA5A 3CZPA 2YRXA 4Q4AB 3TZKA 1Y33E 3EQ2A 4GXRA 1X13A 1KXZA 3G9UA 1H2WA 3D0KA 5L40A 3PFBA 1PE0A 4MIYA 2J9RA 3URMA 4DCSA 4YJ2A 3RI3A 2DQSA 3J06A 2XXJA 5FTJA 4NXMB 3DE8A 3N5CA 5EEHA 5AVUA 3OCVA 3TLEA 3K20A 4DR3B 3SZRA 2ZTLA 1KTVA 3HJFA 1LBQA 1H8HA 3UM9A 4ROSA 3W2EA 1QG6A 2OGUA 3DT8A 4C6RA 4JI6B 3N7AA 2Y9MB 3VHRA 2KE5A 1ZVQA 5BO5A 1B14A 4MV1A 4JJKA 3SFZA 2XPCA 1B6RA 1RKBA 4UMEA 4BGIA 3E1GA 4FDLA 2XODA 4JZKA 2PGLA 2HV8A 4QSMA 4OKNA 3A1SA 1U02A 3THOA 3HB0A 4MRMB 2II6A 5GPBA 3EXEB 3EEFA 1DTSA 1GFWA 3G2QA 3GM1A 5BV1A 4KQMA 3QNWA 4ENWA 4NJEA 1ZOPA 2JHFA 3HSYA 3NRBA 5DRYA 3IJEB 3NT5A 5FL7A 3A6EA 4CT5A 3FUTA 3MD0A 4WOCA 3EZ6A 4TSRA 2PGIA 1KK1A 3LA8A 5SYNA 3OOHA 3KQHA 1TVEA 4AS2A 2XUAA 1W8IA 4GE0A 4Q7CA 2R66A 1CE8A 5CDSA 3NZEA 1VB5A 3JWHA 3OJCA 2BUCA 3PLNA 2CCJA 3UG7A 3O90A 3BJRA 1IXZA 4GKJB 2BMDA 4HYQA 4MWZA 1GZ7A 1NBHA 2ZJFA 5TDHA 4LX8A 1IG3A 3KLNA 3WYFA 3KAPA 4C0QC 4AJNA 1F0KA 4IFEA 3C7KA 5F98A 3QFCA 5JSZB 1UBLS 4RO0A 4GZ6A 4L9SA 1YV9A 1P5JA 5F1OA 1GV0A 3C6ZA 4OH1A 1PR6A 2QSUA 4MVJH 1K7YA 3H1BA 4ZV7A 4NBKA 1FMFA 3SFTA 1JHMA 2CHFA 1YK1A 2EKDA 4JUFA 3R40A 2P35A 2ZIEA 2HAEA 1NULA 4R2JA 1OWOA 1CZRA 5GVSA 1NYTA 2H7XA 4IRUA 1HT0A 4KYUA 3LCCA 1U0JA 1XFDA 2IZ5A 2EBWA 3WB9A 2Y6UA 4WBNA 3UJBA 4JBGA 5F5LA 4LY6A 4UW9A 4ZLDA 4C07A 1HYBA 1SUEA 1QCDA 3D7KA 1HFWA 3HFSA 5IJZA 2I80A 4UHBA 3W2IA 1VL5A 3KKMA 5KREA 1HXHA 1WUHS 1JRAA 4ID9A 4PS1A 5AI4A 2AFIB 1JHZA 1QP0A 3ASNC 4K88A 4A0HA 5HQ3A 4FXOA 4EAAA 1R16A 5AVJA 4RVFA 4DVJA 4F4UA 1ESZA 1NXTA 3FCCA 4X0EA 1OAAA 1US8B 5E6UA 4JR0A 3TWOA 2RC6A 2RCYA 4UBNA 3KKZA 2XCTB 3DFIA 2GXQA 4YAKA 1AF7A 2EXXA 1UFBA 3DB1A 4QI0A 4EEZA 2FFAA 2DKOA 1AV6A 2DH5A 4KXQA 4Z1OA 4RK0A 5EKSA 4PPNA 4OAPA 2H1RA 1UPFA 4WZAA 4OD4A 3EBLA 3F5QA 4XIGS 1U63A 3TTYA 4N49A 3T9BA 3OJLA 4MGYR 3DVAA 4FT4A 2FMIA 4BX3A 3AEXA 1K2VN 1ZMXA 5AVXA 2WSBA 2JGAA 2Z9DA 2NZ8A 4PICA 2BEVB 3M1AA 3ICQB 1ZM7A 2B1RA 1L7CA 1M8PA 4IB4A 1XRPA 1SBYA 3FSGD 1P7PA 2YW2A 4B3HA 1LLUA 1U7ZA 5LLTA 1T2AA 1XQWA 4N6OA 1N2SA 3A36A 3WSTA 3TAUA 2PDAA 1VOMA 1BS2A 2DBYA 3RHZA 2N75A 1GAQA 4V03A 5DB4A 2IC5A 5C8YA 3VGPA 1ISFA 4Y1RB 3NYJA 2JD2A 1G0NA 2FNAA 4KN9S 1EXNA 3C3KA 1CJCA 2IZ6A 1JQBA 1QCYA 1DWPA 4AO7A 4DCTA 3FUXA 2H9AA 1J90A 2Z5LA 4XEFA 1T0BA 3D6TB 4WY5A 1GPJA 3A9RA 1XMQB 1PX2A 1L7AA 1THZA 3SM9A 3RUAA 1CDDA 3NGLA 5AVYA 3K94A 3N0VA 4IXWA 5H8WA 2YWJA 2R4TA 4XDHA 3ZE8A 1JSCA 3ED1A 1SVMA 4BVKA 4FN5A 2JRCA 5C1IA 2CFOA 1MG5A 2J3IA 3WMRA 4R1LA 2N47A 2YWFA 5AW8A 5AI5A 1JAZA 1Z6TA 1XLWA 2R6ZA 2KJQA 5C4GB 4OBXA 3ZV3A 4JC4A 4ZGWA 4G0YA 3EZHA 2C7VA 3GPBA 4IINA 4E5MA 4AU1A 3EVFA 3HTKC 2JIMA 4KYIB 1KI6A 1Y6QA 3DMTC 1YRAA 4WJZA 1EQ1A 3GP3A 3GYBA 2VYQA 4OQQA 1KOFA 3FKJA 1Y6GA 1DT3A 3PICA 1WNTA 1AGRA 2EJBA 4G1UC 5A6SB 3QLUA 4JI3B 5EJGA 1U3FA 2F8LA 3D2AA 2IHUA 1UT5A 4DWOA 2NTVA 5EG5A 1D4FA 2L17A 3RWMB 5B1IA 3A3OA 2OCDA 4JXJA 3BEDA 1P62B 1VG1A 3CLHA 3L8IA 3ZHCA 2HK6A 4Y6LA 2VDUE 1XP8A 4OQMA 3BCUA 2PMCA 4UBLA 3MBOA 2PRKA 3ICEA 2ZSAA 1QWSA 1R0LA 3FVYA 1O96A 2Q9BA 1RXYA 2VJLA 5I7UA 2XGGA 1GLNA 3W9UA 3KUUA 2O5RA 4WKBA 4X5OA 3VNUA 4NFYA 5COGA 2YXLA 3OKCA 4MO2A 2VDVE 4P5DA 4QDLA 3HCCA 3IE2A 1MCZA 4Y0VA 1XDWA 1EFRA 3B36A 4BRUA 3T9CA 5JNUA 4ODIA 5AM4A 3ZLJA 3NKFA 3GFSA 2BGGA 1KYWA 4QG7A 5KTPA 3JVVA 1TF5A 3L7MA 1VA5A 3FMFA 2FOIA 3P4UA 1O6CA 5FO0A 1UZLA 3RBVA 4IZHA 5JI3E 4OX9Y 4AT1A 3D2CA 3EOAI 3CHYA 2H4XA 1MDBA 5JWHA 1KRXA 3W4JA 3EAQA 2IHTA 2HMVA 3OX3A 3IUJA 1XI2A 2OUIA 2QOEA 1E8DA 2QTGA 3V1MA 1YR9A 1A76A 4LXQA 4FZ3A 2ZRLA 5L0IA 4ALJA 3KU1A 3ELWA 4YR7A 3R5JA 5CEFA 1R6XA 4Q05A 1LLDA 2WM9B 4GX2A 4UTRA 3L92A 1NHWA 3FLAA 2NO7A 2KHZA 2FDCA 5K8UA 1ZW2A 3LF1A 1E3IA 3EAGA 1VPTA 1A9QA 4C2TA 1NF9A 4QNMA 5HGJA 3AB8A 2NVWA 3FOWA 3GLHA 2CB9A 4Y1FA 1UJ5A 4K8RB 5A4MS 3HO6A 4NCAA 2YCLA 3BJEA 4IDAA 3B3QA 2Q5JA 2Y66A 3G7SA 1W1IA 5KNDA 3GGSA 2WIAA 2B2CA 5GJCA 4LYJA 1OV4A 1PKEA 1LKZA 1XC7A 2VHVA 5HRCA 3NKEA 1A82A 2NTJA 1O3YA 4FHDA 1RM3A 1T29A 3KALA 3AF6A 2A6HF 2D7JA 1LE2A 2I8CA 4YP1A 3FAJA 3R0XA 5AC5A 1KK0A 4IEIA 4MUFA 1Q3KA 1L7PA 1NR5A 2FPGB 2UZ1B 3HZZA 4OBEA 2Z1DA 4RD2A 3OD1A 4DRJB 3C5CA 2YLDA 2ZIVB 1ZVZA 1B4DA 3BE5A 1XRRA 1OD6A 2P2ZA 3RSCA 1Q7GA 3NMIA 3WBKA 1P9NA 4OVKA 2Y3IA 3OI7A 1ZD2P 2HMZA 1UK7A 3HN7A 2P6UA 5E33A 1E6EA 3BCSA 4DKXA 4EPVA 3HUTA 2TMGA 4NPAA 4KW7A 5MHTA 4INJA 5CVDA 1YRWA 3JZIA 4EGJA 4Z0TA 3KSUA 1BMQA 3AG5A 3TRHA 4QXRA 1IBMB 3PUKA 1J5XA 3VHQA 1UEJA 3II6X 1JBQA 3ISJA 4UNRA 4WASA 4G0ZA 2QXTA 5JANA 1JPNA 3UGTA 1MC8A 2XX3A 1PW5A 1K68A 1VXOA 4FGKA 4QICA 5HZKA 1W75A 2GWHA 3GRYA 3KPWA 2R48A 2QUAA 4XIYA 5G0WA 4XJTA 3KOXA 1NSYA 8MHTA 2X40A 2J9BA 3OLYA 2JATA 2ZT5A 4C0AC 1YKSA 4CG0A 1LH0A 3DGFC 3PQCA 4JB0A 2VO1A 1UC9A 5B6JA 5JQGF 4E2YA 4LY9A 3ISTA 2X6TA 5BQ5A 4Q9NA 5IANA 3PV0A 4YRJA 3O0DA 2X76A 3T06B 2EVWX 1TM7E 3QXXA 2GCGA 2WYWA 2ZYVX 5A06A 3ZVNA 1V26A 2PJRA 3G79A 4GYJA 5F9FA 3KQSA 2IW3A 2RGDA 1YONA 2GK6A 2REQB 4ZOLF 4KOEC 3JQ7B 5JCOC 1EM8A 5C18A 2JAPA 1T0JB 3RS5A 1ECJA 5EUBA 3DLPX 1CUXA 3EDCA 1RBYA 1OFIA 3AHEA 2JGDB 4R2XA 3PIRA 2NSDA 5K5EA 4HATA 3B5JA 4R1SA 3D8UA 2DECA 1PFQA 3HWWA 5D1NA 1MT0A 2JEOA 5JJ5A 1G41A 3ESXA 1MTZA 2BFAA 4W5NA 4FZ5A 4DA9A 4MHTA 3PPYA 5LDHA 5CW2A 1A7EA 1W4BA 4G5GA 4CTMA 2RHWA 4XGNA 1U2TA 4RTMA 2XB4A 4PSDA 2PXCA 4AJPA 4JJ7A 4IIJF 1DOHA 3A9TA 3A14A 1FFDA 3WYBA 3KQUA 1GSIA 1RTTA 3TL6A 1JEQA 3ZYZA 3OKPA 1QCCA 1P8AA 4JSRA 4Z7NB 2XOXA 121PA 3WRYA 3D6MA 1OBVA 3G5UA 4Z9HA 4H17A 1TZ2A 2K7FA 2FP3A 4R1OA 1B0UA 1OWMA 2CL0X 5JE8A 1LSOA 4ZZ1A 4GQBA 3LGXA 4V39A 1L4FA 1Y34E 3A25A 1CX9B 2QTFA 1KEPA 2C9YA 3E7DA 1NNSA 1FUUA 3T12A 2OO7A 4XTRA 1E0DA 1XDDA 1Z39A 1U31A 1SXJC 4L8WB 3IPXA 1XIVA 1PDWA 5T1DB 1AXGA 2WSLA 2R7VA 4ZI7B 1T5IA 1DXHA 1LPBB 2HWKA 1FSZA 2I34A 4YREA 4C2BA 2ZXPA 2YKGA 2R1UA 1QYXA 1CBUA 3X1WA 3WLKX 4I1YA 2NV2B 2E4ZA 5AUPB 4AG6A 1Z9BA 2COEA 1T4GA 4WKOA 2C3OA 2EFJA 3TRDA 3T5MA 1TPZA 3DFZA 3JQ6A 4G5XA 2XTJA 4DPMA 1XNJA 2XE8A 1IH8A 1GNVA 4JJZA 3G0IA 2VQFB 2NO6A 5B4VA 1EKYA 4TMWA 4QPZA 1WXEA 4LJ6A 3N5KA 5FI5A 4ZDJA 3C70A 4MYTA 3RDPA 4FNMA 2R00A 2FR1A 1HURA 5FYQA 4RPLA 2N42A 2BM0A 1O6FA 4B5LA 2CXXA 2JI8A 4WGZA 3E48A 2XJ9A 4EJMA 2OP1A 5D3KA 3HJGA 3EFOA 2I6TA 4JY7A 3HYRA 1FP6A 2FW6A 4HFFB 1LNSA 4FNOA 2ZJ8A 4MZXA 2X8JA 4O4IA 4EUKB 1IBKB 3RF7A 1EDZA 3KV3O 1Q0RA 2YVLA 1NVGA 4C89A 5HIKA 1FDOA 4NE2A 3SBOA 1ZN9A 4P34A 2FLVA 1Z5UA 3WQRA 4B46A 2ZRHA 4MLCA 3T7SA 5I7HA 1ADBA 2D2IA 3R5SA 2UVPB 1K3FA 1VIAA 2AJLI 4MWBA 3LAWA 3S1AA 4Y2HA 4CDGA 1VRCA 3TJ6A 4TKUA 2NXJA 4RK4A 1QGDA 5C7YA 4OXNA 2AHOA 2P62A 4S3MA 2JRLA 1KYXA 2PFGA 3WY9A 4LPSA 1F9EA 2R7KA 1AKRA 1N3BA 1UQRA 3FNQA 4NP6A 3AG4C 2VSYA 4PG5A 4ZOQI 2YASA 1OAOA 2BFWA 1EWKA 3DC7A 1YSCA 3CNHA 3ZGOA 4B3CA 4XWTA 1DJPA 1ECBA 1WMAA 1Q0KA 2BGUA 3DNPA 1J39A 3QEMB 1VXRA 2G83A 1T5OA 3S29A 4NTBA 3ONNA 1SCUB 4XEKA 4PG4A 3Q0TA 421PA 3ZI7A 3O55A 2X4GA 1WN0A 2QRPA 1Y5MA 1YBMA 4C4AA 4JOBA 4TWZA 4NY3A 2CDRA 6REQA 3TPCA 3EQLF 3SJ7A 1SM4A 3DS8A 3O82A 4YMIA 4DANA 3QELA 4QM7A 2H7BA 2BJHA 5BORA 5FLEX 4I9NA 1KQFA 5AK4A 2VHTA 3M0EA 4DJ9A 4K2AA 3I09A 4GR5A 1RWWA 2F9LA 2VJKA 2PX0A 1E84A 1GUAA 4MVJD 1FW6A 2XUGA 5I47A 1Y4AE 5DNDA 4KQIA 4PZUA 1D6JA 3HXTA 4B48A 4EFDA 1U7XA 4CXMA 2YV5A 3DCIA 3OQMA 4CQMA 1DDOA 2CXHA 2ZYIA 1FXWA 5DBEX 4EW3A 3IQZA 1FR0A 1C3JA 1W0JA 2EARA 2P3SA 2UUIA 1NLFA 5EMHA 4Y3UA 4ZYWA 1KBQA 4EHJA 2QNLA 4D46A 3UAVA 3D3QA 4R98A 5FTNA 4YAJA 1MX5A 1KU2A 4MV0A 1PBTA 4TL8A 1UOPA 1RPJA 3LLUA 1ADYA 3FNGA 4U2BA 4ZO4A 4LYYA 4HX5A 4W9NC 4CS8A 5AQEA 5ALQA 3T6JA 4DMMA 3T5GA 3OM1A 4WA8A 4DQLA 3GLRA 5AD1A 3MUFA 2LCQA 1RXSA 4I6GA 2JIZD 3QKSA 3AV0B 4E07A 1PGQA 1I7SB 2M1XA 4BUZA 4Y30A 2ZIFA 1A5SB 1QBGA 1NGSA 1P29A 2VH5R 4JL5A 2G17A 3AHIA 1VSVA 4P86A 4IPTA 3TW4A 3IMCA 1VDZA 3QFRA 5CLQA 3G2KA 2BISA 3PWKA 3BJZA 2QN3A 4MCIA 3OUUA 2AW5A 4O4JF 3UH1A 5FDFA 3JATA 4CDYA 5J58A 1PWYE 2C58A 4EBJA 3RJ9A 3WYNA 2YY7A 4I3HA 5I48A 1HTBA 3HE3A 5EQFA 3AZOA 5TVGA 2YN0A 4W99A 3V4FA 4EB3A 2GZ3A 4WXRA 5I7FA 1ZD1A 2FLWA 1J4AA 4BJ6A 4F8EA 1U90A 2G9RA 3LOUA 1XMXA 2AMYA 3AUFA 1S02A 3TLBA 1FSPA 2ZZKA 2XQGA 1EFVA 1VECA 4FWVA 3KZXA 4MB2A 4E7PA 4G5FA 1RYYA 3GMSA 4IZ6A 4M53A 1X14A 4J0QA 3V7NA 5JFTA 4WXPA 4BRSA 1QLHA 4RWEA 5IFKA 4JBHA 1NQVA 3DVLA 3VDNB 3GT0A 3HNPA 5JCPA 1UP6A 2QZSA 5EGNA 3MILA 3KAJA 3C87A 5BWMA 5EPOA 3CNEA 4FILA 2GFQA 5COFA 2RFLA 1LDYA 3M15A 3TGPA 1WVMA 1KDPA 2GAFA 2NXEA 4NS4A 4QDZA 1YHYA 4C03A 1L1RA 3BMNB 2ECQA 4EZIA 3DH0A 4DBVO 1QYDA 3AI1A 1JJIA 4U7HA 4WKPA 5KS2A 5AUQA 3OEOA 3R6WA 3ZS8A 1CP2A 4BS9A 2HY7A 1O08A 3RAGA 3CWCA 2NZUG 2BBTA 5AW7A 3EFEA 1ZVJA 2V9CA 1NC3A 4PRZA 4DMGA 4YECA 2GM9A 4CCSA 1G8HA 3H13A 4IXTA 5ALKA 4Q1EA 3GEDA 1PEKE 2VQEB 3VSDA 1BMFD 3QVWA 2L82A 2OO3A 3MLEA 3F1LA 2Z3VA 1OIXA 2ZB7A 4C7OA 1MA0A 3GQBA 2JH9A 4ZPXA 3RD5A 2P9YA 5T5QA 3BF7A 1GS9A 2O0KA 2O2HA 4JBNA 3MD9A 3ADBA 4H0NA 5TPWA 5LDDC 2C1ZA 1X1SA 3UFBA 5IS2A 2R1TB 3AF4A 5HXAA 3JYOA 3M5DA 4N8SA 1ADCA 4D99A 4FOPA 3SEOA 1E6CA 1XBTA 5EJ6A 3HNJA 4OIQF 3TZ6A 4B6PA 3BDVA 4ND1A 3MGBA 4MGIR 2BEWB 4CUZA 5DK6A 4E17A 4HMOA 2QSZA 1CCWA 4P1ZA 5EQTA 2CXPA 4OBWA 4V0RA 3WL5A 2RARA 1DKQA 3ABLC 1NWCA 2HWWA 3JCZA 4EZBA 1RRMA 1MP0A 3QVTA 1M6NA 3DHEA 4PSCA 4WXHA 5EA2A 5JMTA 3A2NA 1NF8A 1TMOA 3KG2A 4H6PA 4ZIRB 2O8CA 2NU7A 2I78A 1YRHA 3DDOA 2WWGA 4U5BE 2P1ZA 3N0RA 2VF2A 4P98A 2WYVA 4WESB 1P0FA 3QVOA 2VOJA 3IEEA 2FN9A 1Q1ZA 5JISA 2UYQA 3Q7TA 3SQDA 2YL1A 4F8YA 4WRRA 4NJMB 1WLYA 4YMGA 3DUFA 2XRYA 5DYGA 5AVQA 2XZOA 1HYQA 4R2WA 2GJKA 4PWYA 1W5SA 2VF8A 3ZIBA 3ANXA 4TXNA 1PNVA 4TTQA 4YGYA 2XNDA 1LS6A 6ADHA 2MJLA 2A0FA 5F78A 4KFTA 2HNAA 5KVSA 4PQFA 1PJQA 4HH3C 1A72A 3IT0A 1PJBA 4BWGA 4I9GA 3MJCA 5DCYA 3ZUGA 9MHTA 1BXRA 2RIRA 3UXMA 4A5SA 3O6VA 1TADA 1NIJA 4QUEA 1L5RA 4LJLA 3UMHA 3AUYA 2A3NA 2Z9BA 3LRXA 4NCKA 3BWBA 4TXMA 4KI2A 3OQOA 4X3CA 4XD7A 5J3JA 1SRRA 3QQPA 3C3XA 4AUEA 3V2GA 3QNUA 4RYDA 3P9IA 4YVFA 2FGYA 1IOVA 1A8PA 2NUPB 5J5CA 3ME5A 1AX9A 1JUDA 2IYTA 3MC1A 1KZ7B 4FQ7A 1Z8DA 4PC1A 3ZWXA 2TMDA 4Q6BA 2AN1A 3O39A 5JBQA 3PDHA 3Q0IA 3ZZMA 3AUXA 1BQ4A 3BYZA 1E9CA 2HLDD 3ZJ5A 5L3QB 1EVKA 5FBWB 1U2GA 3IXMA 5TQ0A 1DJLA 1NONA 2AI3A 1UFQA 3UMRA 4NR0A 2YXEA 3K1HA 3ABKC 2WAXA 3R7DA 3VU9A 2JLSA 4JCZA 3ZQYA 5HFNA 4KNVA 3I62A 3PJRA 2NACA 2NU6B 3IEUA 5B6IA 1HY3A 4ZEWA 3SZGA 1SVWA 5ER6A 1OVMA 2W6OA 1QO0D 4MXDA 1NXWA 2HU7A 3WGZA 1AM4D 4I55A 3R3WA 2Z0MA 2LCFA 1K40A 2H1CA 2J67A 3BRCA 3LS0A 1T1RA 1DOAA 1YVPA 4MYUA 5KX5B 3VKWA 4HAYA 3ZHZA 4D42A 3ZDRA 3HBJA 4ZVPA 2CV1A 1JJBA 4TKVB 1POWA 4QDUA 4S35A 1NU7D 4UM7A 3LUGA 4FBLA 5EYPA 4F5ZA 5CPFA 4EZEA 10MHA 4JX9A 4CL3A 3KHKA 2R6GA 1MH1A 4M8NE 3OJWA 1Y7LA 3DP9A 2WZBA 4KPYA 2HJVA 5IKOA 1ZICA 2ZAIA 1CS0B 2O3TA 1PSDA 3KHTA 2Y0CA 2FPWA 1KJIA 5LB4A 2AEJA 3KO8A 2A9JA 5CHYA 1E0AA 1O97C 2A1TS 2WYHA 1YA9A 4BNDA 3U4QA 1FX0A 2FP4B 4WACA 2UUPA 1VJTA 5FAXA 4P4LA 3WDSA 2D7DA 4POAA 4YTEA 3LT5A 5D2CA 1W5BA 4QTYA 3TZBA 3GXBA 3JQ9A 4RIFA 1YJQA 4BQEA 3TDMA 4MKFA 4PXYA 5THXA 3JVIA 1DWQA 2YDXA 3ZLTA 2H5EA 4MCHA 3HLZA 1USVA 1NFNA 4ZREA 4OGFA 3VNRA 4HBGA 1Y3CE 2DQYA 1YB4A 2ZE6A 3AO0B 5AOAA 5BSVA 3DMRA 3ESYA 4OXYA 1EVIA 2NVUB 2ISQA 2OYCA 1XOIA 1RWQA 1R10A 1QF7A 3LECA 2XCSB 1Q7RA 3B78A 2FPKA 1CQIB 3T9FA 2DWCA 4Z4GA 4X1KA 2IBTA 3ZV7A 5MFZA 3W5UA 3IEKA 1YL7A 4P82A 3F46A 4L74A 4BJ5C 1GA4A 1XMVA 4GOJA 3U0CA 5JH7A 4JW1A 1BG6A 1XA3A 4NV1A 3L0YA 5GONF 1NXXA 4PCAA 3DZJA 4KH1A 2ECPA 1BCRB 2VJNA 1K75A 1EA7A 2B5OA 4NCNA 4WK0B 2Z04A 4Z7OB 2V5AA 1WDTA 3GDFA 3V1LA 1T2DA 1MH9A 1NFFA 4PRKA 1U7UA 3FNBA 2ANBA 5BV7A 5GGXA 4L6CA 2WHPA 3PXEA 4DG9A 3KPJA 4ZCPA 3CRQA 3RYIA 1B0ZA 3ZHVA 1M2NA 5CT5A 2A9QA 4S0ZA 5CA0A 3H5TA 4O5AA 4Q9AA 1SCIA 3O74A 1DBPA 1M5UA 4KFRA 1DARA 2Q0HA 3DXYA 1FYDA 5JXIA 1J1IA 4X20B 4YCSA 4GI7A 2GK3A 3TOLA 4QLAA 1RC0A 2HA7A 3BEOA 3HFGA 1OLXA 5IAOA 1LTQA 4CEHA 3W1WA 1C14A 1ST2A 3CUUA 2X0NA 4C7KA 1N2EA 3DZIA 1BHJA 1C2TA 2X3YA 3JAWA 2GPYA 3JWPA 4Q5SF 3MT7A 1RYZA 1RYHA 3TJMA 5T64A 3IAHA 1ORDA 3K8YA 4ZU3A 5JSUA 3NR2A 3GA0A 1Z3IX 1SUDA 4LTMA 2YWGA 1EA5A 4L75A 2ERCA 2QROA 5M34A 2H92A 3IQIX 3SQOA 2AG0A 1COWD 1T24A 4NK5A 3BTSA 4RHFA 1U3DA 3LCRA 4BEJA 4D97A 3V8MA 2Y1GA 1J00A 1PUIA 2WILA 3LWBA 1PR5A 1DEKA 3R7SA 1N75A 1EBFA 3VZCA 5CI9A 5HK8A 4OQYA 4RGVA 1MW8X 5CFRA 3LY8A 4NZYA 3T0GA 3MFNA 1LF0A 2IPLA 1CWUA 3TEMA 2LBPA 4MCAA 1E2GA 1PK8A 4Q5IA 4ZQHA 2D8MA 4QEDA 4KC9A 5CK5A 2QE9A 4CNQA 4J29A 3ASZA 4RE6A 3EIUA 5DM70 1P3Y1 3S84A 1E2EA 1MB3A 2G0TA 3REQA 4J16A 2WUGA 1YI8A 3VVCA 2X3FA 1FFXB 2J33A 5INTA 1YYXA 2HDOA 2OESA 3VJLA 3EXFA 1DU4A 5NULA 4YAGA 1UMDA 3TQOA 3FOFC 3NTOA 2AFHA 3I3SR 4U6NA 1O0BA 1D1CA 1P61B 3JW8A 1JQEA 3C8HA 5A5DA 3PQ5A 5BUOA 4CL8A 2G06A 4MGZR 1HE8B 1LSUA 2PD6A 5FCDA 2FH5B 3O93A 3EMDA 4RZHA 5ICCA 2V7PA 5AW0A 3DZDA 4OAQA 4MEAA 5J43A 4WJ0A 1L7NA 4ETMA 3LUCA 2A9OA 2RK6A 3HC7A 4D4LA 2P9QA 3EH2A 4X24A 1NVDA 3RQFA 2GRAA 2ENUA 2YCBA 3T9DA 4HDRA 1BE1A 3PGLA 1FDVA 3RYCB 4AZ0B 1NZFA 1QDUA 3WIDA 4Q15A 2OJQA 1XRNA 2HSDA 1XZJA 2BFCA 2QNIA 4B87A 4FYHA 5FBHA 4Y2YA 2X41A 2WT9A 4QPDA 2ERXA 4EI9A 3RC8A 1VJCA 1P9LA 3FW1A 5TVKA 3BMOA 3TUIC 2QYSA 1XQ9A 3BXOA 3C43A 1K05A 1RRGA 1N78A 4ZDWA 3U80A 1BH6A 2HREA 4ISCA 1Y8RA 4MR7B 3PC4A 5CIWA 4EHLA 3QLJA 4M87A 2B2XA 4YQEA 4GH5A 2ZYTX 1GLGA 5J5VA 4A8JC 2L81A 4M0FA 4BYGA 3L0IA 2Z9CA 5E4YA 1UMKA 3GZNB 2DKNA 4I4TB 5B4TA 3K4HA 4FOLA 3COJA 1J8MF 4YAUA 2DERA 4XWGA 4JYPA 2JLAA 2IHNA 4NZPA 2IYOA 3A6KA 2A0WA 3U5ZB 4G4JA 1VE7A 4OOEA 3WDLA 3KKBA 5K6TA 1QUEA 1U65A 1W5FA 3PNLA 2EPNA 4EFMA 1Y1LA 1X1AA 1ESDA 3DF7A 4JMPA 4O2BA 2AC7A 5AOVA 2VH2A 5BNWA 4GL4A 3LGAA 1QOPB 4WDQA 5THKA 1N1GA 2H6EA 3LTNC 5ALRA 2HDWA 4G2NA 5KJEA 1CB0A 5AFSA 1IFXA 5FV4A 5EHGA 2NLOA 4BO8A 1M2VB 3F5DA 2GXUA 2V7XA 3H5NA 2BWJA 1HE4A 3A6LA 1AD2A 1J2EA 1VIVA 4ZAXA 4HCJA 1HEUA 5J5AA 3HHPA 2P7IA 2Q6IA 2PNJA 1JQJC 4TWBA 4XKJA 4IDBA 2EC5A 1OI3A 2CLCX 3OM9A 4LECA 1XV5A 4ULVA 1TMKA 3DXFA 1UEIA 3KYDB 4HQKA 3V2IA 5HR5A 3S4YA 3Q7PA 2CYAA 3D8SA 2P2CA 3PEYA 1JVBA 2H06A 3QYJA 2OCPA 4IDFA 1RYEA 5JLAA 2GHQA 4FMDF 2XYRA 3VC1A 5JS7A 1SCJA 2XLCA 1UT8A 5KVCA 4IGEA 1F1JA 4TLEA 2PYZA 2WMNB 4FW9A 3ZLVA 1YFJA 1G0OA 2KYHA 4YRFA 2PWAA 4JBLA 3A4TA 3JZDA 2OB1A 1QE3A 4LCJA 1GFIA 4HN4B 5HKAA 1ZMTA 4QJIA 4A15A 1JU3A 1W1UA 2ZJ7A 2I4MA 2P75A 2ZDHA 2F43A 3L8YA 4YP5A 1TYAE 7ABPA 2P8JA 4YGXB 2Z6AA 5KUTA 1XN4A 4TLBA 1SA0A 2I2DA 4L0QA 1OBOA 5EJMA 1TFOB 2KBFA 2J5KA 3KIPA 4JC0A 1HW2A 3BGWA 3CRZA 4LOJA 2H2HA 3SC6A 2J87A 5HX7A 4ZCLA 2AJDA 1UJ6A 5BNFA 4K3UA 5IXYA 3K9GA 4FAPB 2VH3A 1RXUA 2CMFA 4UPDA 2VWPA 3WQBA 1GQAA 3Q3JB 4Y98A 1KI1A 5DVZA 5HTOA 3OTIA 3TTVA 4BUJA 4Q02A 3WL8A 3GK3A 1E85A 4QYWA 3SM3A 4FC6A 1PJ2A 1B00A 3RRBA 1DEHA 3TNLA 2WJYA 1YO6A 5CVVA 4ER7A 1SCKA 1A2QA 1D0IA 4XTKA 5FF9A 3CKMA 3IGFA 3QKIA 1QX3A 3FG9A 5CFMA 1GPBA 1TPYA 3DBIA 3V5ZA 1QG4A 4Q6WA 2ZTMA 2X2PA 1JECA 1HE2A 4ZU6X 3C14C 1NVEA 3EH1A 2Y71A 2FY8A 3QOFA 1A8HA 4ZXPA 1VYUA 4R1MA 4JB2A 1Q1EA 1XXHB 4QDXA 2QW8A 2JASA 4FSXA 2O8EA 1ZC4A 4JODA 2XWJI 3KT6A 3D43A 3KUCA 1QHFA 1T4MA 3QBJA 2AXNA 4YRSA 4UTZA 5CTJA 2AE2A 4HNAA 1YVRA 4NDAA 3PQDA 3ORFA 1IHXA 4KAJA 3RAFC 3L6DA 1LM3B 1GA6A 3GM3A 3VZBA 4UHCA 2MR5A 3ZDBA 2HEIA 4C0LA 2XA9A 3PEWA 1EUCA 3UEOA 1S1CA 5HUJA 6Q21A 2CJYA 4EHDA 4U9EA 2C7GA 2VPZA 2W93A 2F48A 3W8EA 2QD1A 4TMTA 4F04A 2WD7A 3GLFE 1E3LA 2H3HA 5LP6F 3M4XA 3AEUA 1OPRA 4EG4A 5BN5B 4ZC1A 4HEAJ 5ALGA 2MSNA 4WN9B 1G8SA 4M7PA 1L4NA 3K2EA 3SY8A 4M1OA 1QGED 2I1LA 2GN2A 3HADA 4EY8A 2Q4RA 2ZKLA 5KTYA 4ASUD 5DBIA 2CV2A 3CMCO 3G50A 3O4JA 1WD7A 3D4IA 2QN8A 3B7GA 3ETCA 1AQ6A 2WF6A 3OMLA 4FFWA 4DLSA 2DR0A 1LRJA 2ZYWX 4CFZA 4YFVA 3SZ3A 1GCGA 2EIHA 1DADA 5ITZB 4N01A 4ZDKA 2ATXA 3NI2A 4XJVA 1OLUA 4EMTA 3MYIA 2LGJA 2Y2UA 2XLOA 1OYOA 4I0WB 4NMHA 5KDDA 3U09A 4LJRA 1YYJA 2AMVA 3BB3A 1YAUO 4HDKA 3RT7A 2WAMA 2F00A 4HEA6 1A7VA 2WF9A 3V4PB 2QRHA 2PZMA 3A0RB 1U0SY 3IMGA 2PBLA 5IVIA 3FTQA 4OBBA 3RK0A 5BVGB 5LU9A 5F7ZA 1YCHA 1L5HA 4TYMA 3I5QA 3VR3A 5TQVA 3ZWBA 2O4CA 4B9EA 1SEVA 1T5BA 1O58A 2JARA 3RT1A 3U39A 3KFXA 2EINC 1T1SA 1UOQA 1V41E 4L27A 2PL5A 4UARA 2FSHA 3QU2A 3Q88A 5E8JA 4FYJA 2MT9A 1RJEA 1ZOSA 4M7OA 3PDMP 5ALNA 4HVTA 1SG6A 2GKOA 5F51A 2OHGA 4E11A 1N0HA 2YWBA 4JASB 3HVJA 3I5XA 5KOHB 1BZ4A 3K1YA 3ZDAA 3R24A 1M34E 5L3ZA 3OE4A 3A2KA 1X19A 1R6UA 2WU0A 1U0FA 4KRFA 1G21E 3DNFA 3SEFA 1ZCFA 2Q4FA 2J85A 1XYVA 3LHFA 3GN2A 4Q3BA 5A3VA 4PPFA 3V00A 4BRWA 3REGA 1K2WA 4CMIB 1IBSA 3TLAA 2OT3B 1C17M 4BEVA 3KWFA 4MRSA 1V37A 1EK2A 2WUDA 3W7AA 2GEJA 2HSZA 3NYLA 3HKDA 3IELA 3FAZA 5FWYA 1VGQA 3ZX4A 3TW6A 4MYCA 5BT9A 5EP4A 4CM9A 3PDCA 3WB2A 4YDHB 1C7QA 1UDRA 5CD9A 3WNZA 5EHIA 4KSYA 2WKQA 4G1EB 1XTPA 4JENA 3TSZA 4P53A 3EQ6A 3DE4X 1DPFA 2FN8A 2P27A 4PX3A 3SEAA 4Q19A 4WZBB 1TFUA 2OAEA 1EI9A 4GLOA 4NMLA 2IBMA 4XOIA 5AMXA 4D79A 2ICWG 2AB0A 2FPXA 1N7JA 4GC5A 4IXNA 1NU8A 4BQIA 4BV2A 3QUCA 3LS1A 1AGYA 4ZYTA 4EBBA 3GBSA 3AF0A 1RKCA 2W6MA 5HHTA 1CETA 2PH1A 2VVTA 3D1JA 3C8DA 1WGWA 5KHOC 2POQX 5JSYA 5C81A 3LOQA 3SXUA 4YJHA 2F7SA 3KXDA 1ZK2A 1TUIA 3W0LB 5EMLA 5JW6A 5U1PA 3AR2A 2K2QB 2BGLA 4C87A 3G4ZA 1GVHA 1T10A 1FOEB 4TYNA 2Z2ZA 1U8AA 4Q1VA 2CJPA 1H42A 1WV1A 1V48A 2VTBA 5LP6C 1OXKB 3E4CA 1BWPA 3GLKA 5IF3A 1G9XA 2QP3A 4WPGA 2QRGA 1VYHA 1ZG3A 4IVPA 4LYEA 2REOA 1NP3A 1S01A 2ES4A 2R60A 3PNVA 2X9QA 2E6UX 3DXJF 4QIHA 2C54A 3WLNA 1NKTA 1CPQA 3OZIA 1V55C 4EVSA 2A14A 4E5UA 3N8IA 4D0RA 4JLDA 3IALA 1G5ZA 5JROA 3I4FA 4WK4B 2XT9A 4YLYA 2JLQA 3TOVA 1GSOA 1I4ZA 3PJFA 1XL1A 5E6SA 1PR3A 2BFFB 5BT8A 4Q1CA 3NVMB 2BMVA 2YZGA 4GZ5A 5GJBA 3COSA 1B26A 4Y9DA 2IPOA 2G3VA 1GNLA 1Z36A 2WJPA 3R7WA 4PGAA 3RPEA 1SXQA 1N3YA 3IULA 2FJ0A 4UQPA 4FFVA 9GPBA 3U7RA 1KWGA 3E5RA 5J4VA 3PR1A 1IQUA 1A7DA 2W6JD 2AH5A 5FX2A 4XRRA 4HGZA 3G88A 1L4HA 2PMWB 1N2GA 1OR2A 3W8DA 1LUAA 2Q5FA 2HJMA 3MYFA 3GXOA 1PFUA 1IZ9A 2CXQA 1JMKC 4OQLA 1SU7A 3RSHA 3MINA 3H5IA 1OASA 3BTVA 2J9UA 1UBNA 3E9YA 3LNTA 4O2AF 1WPXA 5TQJA 3J80A 2GEUA 5LL6P 4KR6A 3D59A 2Q3HA 4MS1B 2X5XA 2NPOA 2Y3GA 1GADO 4TTSA 4ALMA 3OJOA 2O8FA 2R1ZA 3AIIA 4BP8A 1A8UA 5FUQA 2WLSA 3FTCA 2PR2A 3GFPA 4HAWA 3WWYA 3O2QB 3RS3A 3TRFA 3GG2A 4IIEA 3C6YA 3QFHA 1VBNA 1IAQA 1OB5A 2YWEA 4MEBA 1Y1QA 5EJAA 4R69A 4UM5A 4XH9B 1NBWB 5ESWA 2H7YA 1FDSA 3HDVA 2DBZA 1HX7A 1HPLA 3BB1A 2O1EA 3EASA 3ONWA 1QVRA 1APCA 5I8ZA 2DEUA 4RHXA 1V6SA 3KTOA 3JTLO 1C5KA 1M2EA 5LOVF 1DELA 3A06A 4Q93A 2B8TA 2WKWA 4PHHA 1DAKA 4TV8F 1IBCA 3ZWKA 2WMOB 2W70A 3MTQA 1CQJB 4I1OB 2L6GA 2IXNA 2WF7A 3RS7A 5A2QA 1QSPA 4HY3A 2JAUA 5DI3B 1BQ3A 2V4MA 2W58A 4DN6A 4PNHA 1V5IA 4NH0A 1ORSC 4L51A 5HKKD 1U0OC 4WY2A 2QHXA 3MSXA 3LK7A