4YT2A

Hmd ii from methanocaldococcus jannaschii
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
343
structure length
343
Chain Sequence
NMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
total genus 124
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt2A01
4QFCA 3HDYA 1E3IA 3K8ZA 4W82A 1MFZA 2FPPA 1SMKA 2VYNA 2VHVA 3OJFA 3LLVA 2BF7A 6LDHA 4WCFA 5ITWA 1XU7A 5IF3A 3DQPA 1H5QA 1HE2A 1UR5A 3DBLA 4RGBA 3B70A 3UAGA 2YW9A 1OAAA 2I99A 5EQFA 2VWGA 2Y0DA 2TMGA 1KBZA 3U5TA 2Y1GA 3GFBA 1MC4A 1N9GB 1BDBA 5JDIA 1I3MA 3ZHYA 1YO6A 1ZO8A 4R68A 4XKJA 2FOIA 3BTUA 4E32A 3ZI0A 7MDHA 4IDCA 3GNTA 3ZWBA 3GZNB 2X9GA 3DHEA 1LDNA 2LDXA 2QX7A 4KUEA 4BIIA 3PI7A 5BSGA 4CR8A 4GKBA 5I9NA 3OJEA 4PGFA 3ITKA 1XQ6A 4PLZA 1C1XA 2Y1OA 2J5RA 4FJ0A 3I4FA 1MGOA 5JLAA 5TS3A 5HS4A 3VZQA 4CMJA 1K5HA 3WQQA 5G0VA 4E12A 3FD8A 3L4BC 4HFRA 5JO9A 1UP6A 3QHAA 4BNNA 1WDLA 3AM4A 4Q3BA 4IJUA 3ONFA 1PGPA 5TQVA 3NJ8A 4BUCA 3RU7A 1C14A 4IXTA 1R4MA 4OH1A 1LSSA 1UDBA 1GQQA 1WMBA 1E3WB 3GDGA 4EEZA 1C1XB 4UREA 4BNJA 4QEDA 2X5KO 3U0BA 3E18A 2BGKA 2BD0A 1SC6A 1HSZA 3RFXA 5A06A 4NMHA 4OYRA 2G0TA 3RUIA 4BO4A 1YQDA 4XQCA 5I9LA 4N5LA 4JP2A 4CQMD 1VJ1A 4PLCA 2HCTA 4Y67A 5KVVA 2HK9A 4DC0A 1E3EA 4H7PA 5CFZA 3FN4A 4HFNA 4PRKA 1J5PA 1I2CA 4R01A 4IDBA 1VSVA 5L4LA 3GAZA 1DLIA 4MVJD 4CM6A 4E0BA 1UP4A 2F00A 1OFGA 1SAYA 4U6SA 4AJKA 3EVTA 3HDJA 3DBVO 3ETGA 1NWHA 4J2OA 5ENVA 1BXGB 2GSDA 3ZNPA 1PGOA 4FIZA 4JBGA 4B8ZA 1PU2A 3MJ4A 1XQ1A 2PFGA 1DC3A 3CUKA 3RUAA 5I7VA 3DAPA 1ENPA 1T24A 3RC9A 4L4XA 4ZQEA 3AFNA 4JP3A 1EVJA 3K9QO 2H1SA 4PVDA 1E7SA 2P68A 4AJHA 2B35A 1UXKA 2CNBA 2PGLA 2Z1MA 1U7HA 1HF3A 3OEWA 3PJGA 4M49A 2NU7A 3DBRB 4XA8A 4XB1A 4LMRA 2GO1A 4Z9XA 2SCUA 1NVGA 2IZZA 2UUPA 5T8KC 1CERA 3PIDA 3DO5A 3BYZA 4K6FA 2YZ7A 2ZTVA 4NPCA 4OXYA 3V2UA 3BTVA 4J4TA 4NZ9A 1LEHA 2C07A 4DLAA 1S6YA 3UHAA 4WUVA 1QR6A 1N92A 2NNLD 1KY5A 1Q1NA 3OICA 5IN4A 5F21A 1MG5A 1Y5MA 2I3GA 3JQGB 4J4HA 1HYHA 2YV1A 3H9UA 3M2PA 5AQ1A 4CLRA 3KYDA 4J16A 1PL8A 2NVUA 5I7EA 2CSUA 1QXSA 3WNQA 1R37A 5JMWA 1GUYA 2IDZA 1E3LA 2G17A 4XYEA 5AVOA 2ZIZA 3GDFA 3VH1A 4DUPA 4JNKA 1LRJA 4AJPA 4YJHA 1UZMA 3ZV3A 2GN8A 2CVQA 4DMLA 1XWFA 2QZ9A 3RAJA 4PLFA 3OFSA 1YE3A 1QG6A 1WP4A 4IMPA 5IDQA 4IXWA 1R6DA 1R4NA 2GNAA 1ZK4A 4BB6A 3D7LA 2X22A 2Q2QA 2EGGA 3MTGA 1FDWA 5EESA 5F5LA 1Q0HA 4NU5A 4FW8A 3AUSA 3BTSA 3F4BA 3OBBA 1DHTA 3O38A 1NHGA 3AM5A 4EEXA 3HQ4O 3V2GA 2DU8A 3HB5X 4DQVA 2B4RO 4YVFA 4RF3A 5U1PA 3DFZA 1T1SA 1BXZA 1NP3A 4GAEA 1HT0A 4E33A 1MFPA 4FJ2A 2QRJA 2FMUA 3MJCA 3STHA 3VDRA 4YWJA 1MC5A 4CMIB 5KOIA 1ULUA 2P5UA 1GU7A 2Q3EA 2JKVA 3GEGA 1NQ5A 3AY6A 2W98A 4D44A 5ER6A 3E5MA 2HJSA 5B4UA 3RC7A 1SNYA 1V3TA 4GLLA 4LVUA 1C0LA 2VNAA 5CDSA 2DBVO 2C54A 5AYVA 3UUWA 3FNEA 4FN4A 3JQ7A 4XGIA 1A7KA 4K28A 5BT9A 4JX8A 2AEMA 4TROA 5DZSA 3WJAA 5DT9A 1TXGA 4W4TA 2C20A 1UXIA 4E2WA 2BFAA 4KP7A 4ILKA 2A9FA 3CZRA 4ONEA 2DTXA 3GK3A 2CDAA 2CVZA 3JCZA 1K6XA 4Q3CA 3WFJA 4YT5A 1B3RA 2C7GA 3KZVA 5G0TA 5H81A 3FNFA 2EP5A 4Q3AA 5LC1A 5JY6A 3P5SA 3KV3O 2E6UX 1LX6A 4XCVA 3ROPA 3L0DA 3NTRA 2G76A 4L4RA 4PLHA 3GHHA 5A4DA 5FI3A 1EQ2A 4O63O 5A1TA 3WQRA 1ZW1A 1P1JA 4YDRA 3TOZA 1E3SA 1YVEI 4QO8A 3U4DA 4N18A 1E1LA 3CPSA 3RJ9A 4BO2A 1JKJA 1PL6A 2ZK7A 3RWBA 4IUYA 2C5AA 3R3SA 5L4SA 4IZHA 2GLXA 3IC5A 2C5EA 2HUNA 1ISIA 1NPDA 3NKLA 3ZU3A 2J5KA 3IS3A 3AUTA 1I32A 4A2CA 1B16A 3MTJA 1A71A 3UCEA 4ALLA 3QVWA 4RQUA 3WTBA 5K9ZA 1BW9B 2Q2VA 3AW9A 1GY8A 4J43A 2VCYA 1W73A 8ADHA 4GL4A 1PSDA 3ITDA 4M54A 1YL5A 4X54A 4OQZA 1XG5A 3U4HA 4BNZA 4GVLA 2Q99A 4XYLA 2FZWA 3KSUA 3ZV4A 4QUKA 1RWBA 3A4VA 4BNKA 4EBFA 2D5CA 4HV4A 2IYOA 3LC1O 4HBGA 2X0RA 3ZCXA 4EZBA 2OOSA 3U09A 3HADA 1QYWA 1YL6A 1NAIA 3D3WB 4FS3A 4B3HA 5KTKA 4H3VA 2C29D 5A02A 3AY7A 1GYRA 2RBEA 5EIOA 2O3TA 4RPKA 2YV2A 4IS2A 2UUOA 2W2KA 2NSDA 3PRJA 5C5IA 1UDAA 4JLWA 2EV9A 4KDEA 1ADFA 1M75A 5I8WA 4YRAA 4Q3EA 1IULA 3LDHA 1EDOA 1I2BA 3VH2A 3WWZA 2Q2WA 5J23A 2V6GA 2FR8A 3A28A 2VHYA 3D0OA 4FFOA 3JQ6A 3IP3A 5EINA 4CM9D 5GZ3A 3D3EA 5KVCA 3FBTA 1GQ2A 5JDCA 5L7WA 3O4RA 4WJZA 4EI2A 3RUDA 4Y98A 4E31A 4YT4A 1CYDA 6ADHA 3RIHA 3QRWA 4ZJUA 3SEFA 2HK7A 3QVXA 4L76A 4D42A 3EHEA 1KIFA 1IB6A 1TLTA 1DIBA 2VZ0A 4TWRA 1KVTA 2RH4A 3JYLA 1VL0A 4J90A 3TSCA 1SBYA 4CQLA 2GR9A 2I5PO 4BO6A 1VI2A 3BIOA 3DR3A 1KVQA 4P4NA 1C0IA 4M55A 3CINA 2X6TA 5DOZA 4XGKA 2Q1WA 2YFQA 2HK8A 2JFFA 3K92A 3LC7O 1YXMA 3PGJA 1ISHA 3ZHXA 4MOWA 2FY8A 1U3TA 3ABIA 2Q49A 1PX0A 1DIRA 2O50A 3ROMA 5KIAA 4AJ4A 1LRKA 4J6FA 2VTDA 3T4XA 3W6UA 4BHTA 3EUWA 2BFMA 1U28A 2VUTA 3L4SO 4GLOA 5L7TA 5DCYA 3QWFA 3KXDA 1IOLA 4PIVA 2HO5A 2IEBA 1Z7EA 3AWDA 1GZ6A 2I6TA 2PH3A 1PJ2A 2Q4EA 1OBFO 3CXRA 2Y93A 3VPSA 3JD3A 5KVSA 4XWYA 4RZHA 3I23A 4NFYA 3I1JA 3BMNB 1J0XO 4JJIA 5KKCA 3TFOA 3W8DA 1KVRA 1ISMA 3S2IA 5GMOA 3JV7A 4OJNA 4BO5A 5ITVA 2J5QA 3QVSA 1CIVA 3Q1LA 1CWUA 4GBJA 2W4QA 3DB2A 4A27A 4TZKA 1EK5A 3GA0A 4XD2A 2VYND 4GWGA 3VPGA 2WD8A 2VN8A 1X0VA 5ENDA 1YJQA 4NFHA 2JCXA 3PQEA 3E1KA 3JQAA 5CDTA 4J1SA 3ZNNA 1UDCA 3K6JA 8LDHA 2GN6A 3NDJA 1HDXA 1HDOA 3MOIA 3C7AA 4Z3DA 3QWHA 5F1KA 3ENKA 5DBIA 3PDUA 4R41A 4I8XA 5JAQA 1H9AA 3INRA 3HB4X 4BNXA 1TA4A 4E21A 1GYQA 1FDTA 3GDOA 2ZATA 2C7VA 4OQYA 5EJ2A 2NU8A 4A26A 4IQ8A 1PQUA 2HMTA 1P1KA 4J4BA 3SBOA 5JAIA 4WKGA 3DTTA 3MOGA 1R16A 1P45A 2OORA 3KTDA 4DPMA 1HEUA 1M6HA 1KY4A 5CEEA 3WYEA 5AXBA 4PN3A 1A72A 1GD1O 1R0KA 1M76A 3FR7A 2Q4BA 3NT2A 2VZ9A 4BNTA 1MP0A 2E37A 1ZBQA 3RUEA 3GRKA 4GX2A 4UUMA 1IYZA 2DBZA 3N7UA 5IZCA 1BSVA 3EZYA 4W99A 2Z95A 1IHXA 3PLRA 4L73A 1T25A 3OSUA 1H2HA 2EEZA 4XJSA 4BNGA 2QYTA 3GUCA 3PYLA 4J0FA 2AQKA 3JD2A 4DVJA 2QW8A 1FDUA 1TT5B 4PZDA 4E30A 3AY3A 2C82A 1ADGA 3OQ1A 3H9EO 2O2YA 2GYYA 3E9QA 1Z73A 2O4UX 3QE3A 1B2LA 4L9RA 2NVUB 2F1KA 4LVCA 1LUAA 3NDIA 1KVUA 4E5KA 4PCVA 4MVJP 1KOLA 4R1UA 4ZRNA 3L77A 3HHPA 3ZW9A 2WYUA 3T7EA 2DTDA 3JQFA 4E6PA 4BNHA 2A4KA 4QX6A 1KC1A 1U3WA 2YHIB 3F1KA 4IJVA 4MIEA 2C2YA 4IJWA 3VPFA 4B7XA 2GGSA 1KS9A 4WCDA 2HU2A 2Z1NA 4AICA 4CMBA 3CMMA 4RVHA 1T2DA 1X13A 3GNSA 4L4SA 3V5NA 4MJLA 1HZZA 3BMQB 4RO0A 4KUHA 3WJ7A 2NVWA 3WBFA 1BGVA 4AJ1A 1DLJA 4JJFA 1EK6A 1RYDA 1E1MA 3ZWNA 3ZW8A 1V3VA 4FOOA 3DZBA 4RDHA 2ZYAA 4J0EA 3RD5A 3ADOA 4BKQA 2OP0A 4ESOA 4WCFB 1V8BA 1CETA 2IZ0A 5LCXA 3O26A 3D4NA 5IDXA 4PG4A 3KETA 1JKFA 4NJOA 2BI7A 3FNHA 1J6UA 3ON5A 3Q6IA 5JFOA 5JY1A 3RUCA 1R4NB 1ML3A 1LSOA 3KLMX 1I3LA 2O3JA 3ANLA 2V65A 2BI8A 1E5QA 4WLEA 4J7UA 1UJMA 2X8LA 2ZYDA 9LDBA 2PH5A 5K0ZA 1LU9A 4NDNE 4YA6A 3VDQA 5A05A 2VQ3A 3ETDA 3MJSA 4IS3A 2X58A 1JKIA 4BQPA 3BMNA 4D43A 3I6IA 3RROA 1I0ZA 1PJLA 1Y9EA 4KZPA 2X7HA 4UVHA 4UVGA 3JYPA 1VKNA 3G17A 2JCVA 4O1MA 4RPGA 4XGNA 3WOHA 4CLEA 5JYEA 3L6EA 5L53A 1Y81A 2PY6A 2X0JA 5IXSA 3CMCO 3IOYA 1L1FA 1VRWA 4YJFA 5IDYA 1B7GO 2B5VA 2UAGA 4CR6A 3F5QA 5JDCC 3RSHA 3IDSA 4FPXA 1XYGA 1C1DA 3U62A 1JA9A 2DUWA 1IPFA 5ILGA 4U5QA 2ZJ0A 1JVBA 2O4CA 5T67A 3ZU2A 1NVTA 4Z9YA 3DEYX 4LRTB 3P2OA 1ONPA 2RHCA 4R3WA 3RFVA 3LSYA 4BV9A 1RPNA 1Q0QA 3PGXA 1B8PA 5U9CA 5C37A 5KJ6A 2P2SA 4BOYA 4ZVVA 2Q45A 3O8QB 4LGVA 1KEVA 4IBOA 2O2SA 1C1DB 3VTFA 4YQZA 3BMCB 2NU6A 5A3JA 1EFLA 3HFGA 3FSRA 3MWEB 4EW6A 2PNFA 3PDJA 3PK0A 4B3IA 3WNVA 2ZB4A 2D1YA 4NR0A 4R1TA 4I5GA 2PD6A 2CDCA 1PJBA 1P33A 4W7HA 4Y8VA 2FWMX 1W0CA 1CQJA 4N5MA 2R00A 2DBRA 3ZWWA 3WFIA 4NFSA 3ZV5A 1HDCA 1E1NA 3ZHBA 3GG9A 3NTOA 1DAPA 2WTBA 5EPOA 5CP8A 4DTIA 3K2EA 4BV8A 3R6DA 5BR7A 4GX5A 5L9AA 4YJGA 4L8VA 4ND4A 3GLQA 4WNIA 3T4EA 1P1IA 4IQGA 4E2YA 1T2FA 5T8KA 1KYQA 2VRBA 3TN7A 5TRTA 2DAPA 3WSWA 3RFTA 2WD7B 1E1KA 1B14A 4DC1A 4M1QA 4Z3KA 2GCGA 3OQ6A 3WGQA 4CM5A 2QRKA 2ZYGA 5HRUA 1L7EA 2NLOA 4R54A 1R12A 4GQAA 1P31A 4FFRA 1R4MB 2ET6A 2I3AA 2WDZA 4LMPA 2VZ8A 4PLPA 4WLUA 4F6CA 3Q11A 1I24A 4NBUA 3GVPA 4UVEA 4C7JA 4B7UA 1ZMOA 4J1NA 4MPDA 1EUCA 2RIRA 3JQ8A 3PXXA 3PZRA 4HKTA 5FF9A 5A9TA 3WSVA 2CZCA 3BMOA 2P9CA 3RCBA 4ALNA 4O5OA 5TC4A 4J49A 1YDWA 4MVJF 1HE5A 4JGBA 1OOEA 4GWKA 2B5WA 4WECA 2EJVA 2W2LA 3EGOA 4IM7A 4CM9A 1H6CA 2WJPA 1NPTO 3WGYA 4P4LA 3TZ6A 4CMHA 4G2NA 1KEWA 3ZWVA 4WPGA 2BGMA 1U5AA 3WGHA 1R15A 2OFPA 4NQZA 4AJLA 1E77A 2D2IA 4D7AA 2DUUA 5BNIA 3I9LA 1I01A 2VRCD 4CUJA 4A5OA 1QMGA 1YB5A 1QYCA 4U6QA 1HETA 3NAQA 1X0XA 4DIBA 5HM8A 1EUZA 4LK3A 1T2AA 3D1LA 5TX7A 3HJAA 4DBVO 2PR2A 4YJFB 2EKLA 1GQYA 1X7DA 4CPDA 2DQ4A 3K96A 2HRBA 4JBHA 3PJDA 4ZQBA 1GPDG 3S2GA 3GGGA 3DZIA 1I30A 4ZQGA 3TWOA 2OBYA 1K2WA 2W8ZA 3VC7A 2CVOA 4BNFA 3EMKA 5CDGA 1DOHA 2X9VA 3IIEA 4HP8A 4OXKA 4YRBA 3UICA 3OECA 2HQ1A 2NTNA 3GEDA 4WGGA 3SLGA 1P44A 3QVTA 3BHIA 4OIMA 4WLOA 1YGYA 3N74A 2I66A 3DBLB 2WMDA 1E7RA 3C1AA 4R5MA 1Q0LA 2EERA 4UULA 2O3QA 3QQPA 4ALIA 1CF2O 3HFSA 1EQUA 3GN1A 4Y9DA 1HL3A 3VHRA 3S8MA 1LI4A 4A03A 4CV3A 1B8VA 1PJCA 1GCOA 1HSOA 2ZCVA 1ISFA 3LK7A 3OIFA 3W4KA 1P0CA 5A9SA 1GYPA 1UH5A 4YQYA 1U1IA 5FYDA 2FRDA 1WAMA 3WXBA 3WTCA 2EHDA 5EQDA 4OOFA 4G65A 2ZQZA 3IKVA 4YR9A 4JROA 4PLVA 1DC4A 2C59A 1JQBA 4GGOA 3ORFA 1CDOA 2CD9A 2EW2A 2FSSA 2YYYA 2J6IA 3C85A 3P2YA 3Q2IA 1QRRA 4M8SA 3RQSA 1EBUA 3P19A 3DTYA 1LSUA 1E6UA 3A06A 1P3DA 4I9HA 2ILTA 3E9NA 4CUKA 3E8XA 2JHGA 4C4OA 1F8FA 1LTHR 1W4ZA 3JQBA 5JS6A 4FSHA 5KJ1A 3W6ZA 2GERA 4LW8A 5B4VA 4W6ZA 3LU1A 3QSGA 3WLEA 4OMUA 2I67A 2UDPA 3I9MA 5CPBA 3DZFA 5IFLA 4O6VA 4KQXA 4KTTE 1HDRA 3X2FA 4RJTA 4ZGWA 2Z5LA 1U4SA 3BMCA 1P0FA 3H2SA 1PJ3A 1V6AA 3VH3A 1XA0A 2P9GA 5AXDA 2O48X 3FCOA 2Y67A 4S3MA 1PGNA 5L95A 3W8FA 3PPIA 4ALKA 3TFQA 3ONEA 4GMFA 4EGFA 3VKVA 3JYOA 4IPTA 4ND1A 4BMSA 4NK4A 1K6JA 3LT0A 4YTEA 4WK6A 2VHWA 1Q7BA 1ZSNA 5K6AC 2P4QA 2JAPA 3D5TA 3KSZO 4WLNA 3ZWOA 1L7DA 2D3TA 3D4PA 1HLPA 1RKXA 2W90A 4J9UE 5ICMA 1MB4A 2ZQYA 3D4OA 1T26A 4YJHB 5G4LA 3SJUA 3GGPA 1LC0A 4FFLA 4UEJA 4YPOA 2PGJA 4BGIA 4GKVA 1HDYA 1ZXLA 3PWZA 4CM1A 4RF5A 2C0CA 3TZHA 1ZK0A 5H83A 4BNWA 1PZFA 3I3OA 4FFNA 4GGPA 3MWDB 3TL2A 1N7HA 2FPGA 1EZ4A 1NNUA 2A35A 5KKAA 4WLFA 3PWSA 3DOOA 4AJNA 3JQGA 4UUOA 4WEOA 3WGZA 5C3MA 4QECA 1I33A 3NT4A 5A3VA 2PGDA 3GMSA 3ZGYA 1BVUA 1BTOA 1ZH8A 3PP8A 4L74A 3ULKA 1O9BA 3VVCA 1DRWA 4CMEA 1UAGA 1YB1A 1PZGA 3BMOB 3CZMA 3HUDA 2JD1A 5HTOA 4GI2A 3IKTA 2RHRA 1T2EA 4HADA 5CG2A 4RV9A 3HG7A 1DJNA 2VHXA 3QY9A 2G1UA 3L4BA 4ZD6A 3UOGA 3OQBA 4PG8A 3V1TC 1ZKMA 3I83A 1LJ8A 3KYCB 3PJFA 4TQGA 4CJXA 1PS9A 3PYMA 2ZB3A 4FD3A 5H82A 4NBTA 2XAAA 1WZEA 3DZHA 4ND2A 4ID9A 1PGQA 2BELA 3H9GA 3L9WA 5TF4A 3WGIA 1ENYA 1Y8QA 3JQ7B 1ZSYA 2J3IA 4BNUA 3L9XA 1PEDA 4M89A 3KRTA 2GUGA 4G81A 4I9NA 3JQEA 2Q50A 5DP1A 1GFSA 2JD0A 3EW7A 3JYNA 1CEQA 3PZBA 4I08A 3VH4A 1N1GA 1OI7A 3WX0A 3VAZA 1ENZA 1HDZA 1ZK1A 1GR0A 1RJWA 3UH1A 5IDWA 4LCEA 2P9EA 3G3EA 2V6BA 3OA2A 3G1TA 3VPXA 4DL9A 2Y05A 3JQBC 1YWGO 3TZKA 3I9OA 1I2ZA 1LC3A 1DBVO 3JSAA 2NVBA 5ICSA 4IY1A 1SEPA 3WQSB 1LDEA 4YXFA 5JE8A 4RVDA 1FJHA 4TSKA 1WNTA 1DXYA 4BO9A 1WXDA 3KVOA 2GZ2A 2Y1FA 2QYSA 1N2SA 2EP7A 5AXCA 1YH3A 5HA5A 5BNTA 3WR5A 1NAHA 3UF0A 4CM8B 1U2GA 1WDMA 2JHFA 3R1IA 5COQA 4Z9FA 2H9IA 3AI1A 5COAA 4JK3A 1DPGA 3O9ZA 2B4TO 3KOUA 4YJGB 1DRVA 1HYEA 3OJ0A 3TPCA 3A1NA 3Q9UA 3HDHA 4FQ8A 4RCVA 4L0QA 3AOEA 5G0WA 1D8AA 3QLJA 3VZPA 4N5NA 5GZ1A 2HMUA 2HMSA 4K26A 1WDKA 1EVIA 3H3FA 1LA2A 1BXGA 1E92A 1XU9A 1D4FA 1I3NA 5COBA 2Y1CA 5DBFA 2FZEA 1D1TA 4AG3A 1V35A 4BMVA 1R0SA 1PJQA 1EBFA 1E5LA 4TRMA 2D5AA 1T2CA 3QWBA 5L4NA 3PHLA 4XYMA 1OC2A 4IGEA 1V0JA 4RVUA 2UV8A 1GL3A 5LDGA 1WLYA 3KHUA 3OJLA 2HMWA 1LLDA 1VSUA 1IY8A 3PHJA 1BHSA 2J8ZA 4JBIA 3AM3A 3VTZA 4XRGA 2XPCA 4BGEA 1JTVA 3W4IA 3L07A 1T4DA 3Q0EA 1KC3A 4IQ0A 3H5AA 4OGWA 2VOEA 2VYVD 3LT4A 3I9JA 1CRWG 4C7KA 3GG2A 1UZLA 4TVBA 5DDIP 5CDYA 1E6WA 1AHIA 1C0KA 4YAEA 3CKYA 2DPGA 1B3BA 4D3SA 4TKMA 2FHSA 3K31A 1GEGA 3B1JA 3R0IA 2FSVA 1DC6A 3V1UA 4CR7A 5JW6A 2RH8A 4EJMA 4MKZA 2B36A 3KB6A 4ROSA 3IJPA 2PZMA 5T64A 3H5NA 1SPXA 1HE4A 3ZWCA 1D1SA 4Q39A 1DC5A 3GVXA 5CEJA 3PJEA 1DIAA 2PZKA 4J1TA 5FWNA 3RC1A 4XYGA 1NR7A 4WNCA 3JQ8B 4D0SA 4MO2A 3M1LA 1JU9A 4RF4A 3WGGA 3VZSA 1W8DA 3KEQA 1KVSA 4NJMA 2JL1A 1NR1A 1R0LA 3OIDA 4KWIA 1ID1A 2R6JA 2ZCUA 4BNYA 4MIYA 1DAOA 4G5HA 1ZFNA 4FGSA 1XSEA 2DFVA 4RDIA 3GGOA 1DHRA 1DFGA 4D41A 3U49A 1Q7GA 1WW8A 3INGA 1P1HA 2WE8A 1DIGA 2H6EA 1D3AA 1YBVA 2AE2A 1GV1A 4K1LA 3EVNA 5IAAA 1FDVA 3I4CA 4R9RA 3ZU5A 4E2ZA 1O8CA 3GQVA 1ISGA 1QYVA 1Z45A 3B1FA 3DXFA 1N9GA 4J7CA 4YT2A 1G0OA 1OZAA 2AW5A 4DPLA 1B0AA 2HKIA 1GUFA 1PS0A 1ZJYA 1JAYA 2JCYA 2YFHA 4WEQA 5HS6A 4A0SA 4ALMA 3AU9A 5CHEA 4BKUA 2VHZA 1XHLA 1P74A 1PL7A 3PTZA 2A94A 3EC7A 4IDFA 5THKA 1YKFA 2BRUA 1I5RA 1PWXA 4XJTA 4OXNA 4MVJH 4NHEA 4FB5A 1H6BA 1G1AA 4Z0TA 3DHNA 3U4CA 3L6OO 4E13A 1O5IA 1ZEJA 1LDBA 3CE6A 2FP4A 3DMTC 5CEFA 2J3JA 3WYBA 3M1AA 1KETA 2B37A 4Y6PA 3GOHA 3RKRA 4CV2A 4E4YA 4CMKA 1NHWA 1Y9AA 3KYDB 4KTVE 5F3RA 4BQRA 3HSKA 4DREA 5I7SA 2O3UA 4MVJM 4FOSA 4EUEA 4UEOA 3W4JA 1WPQA 1Y6JA 4ZA2A 5DN9A 4GSLA 3FHLA 1YOVB 3IL2A 4CMCA 4QTZA 4UUPA 3WIDA 3QWIA 2ZJ1A 4JJGA 4IIUA 4RPHA 2BFPA 3NRCA 3U4IA 2Y1DA 4E3ZA 1C3VA 2BKAA 3OM9A 4RF2A 3AU8A 2CDBA 2DTEA 1T4BA 4MKXA 3C7CB 1PJTA 1GEEA 3SXPA 2WEKA 3KEOA 4HUJA 2Y99A 4GH5A 4FFPA 4R69A 1X7GA 1NVMB 4NBRA 1A9ZA 2HJRA 3H9QA 2NADA 1YOVA 1ZJZA 4R9SA 4ZN6A 2VT2A 2Q1SA 1QP8A 3KUXA 1XELA 2NTVA 4TMFA 1F17A 4CM4A 3AK4A 3H2ZA 2CF5A 2NTJA 3DOJA 1O6ZA 3F9IA 3D5QA 2WD7A 3H6KA 4H15A 1N5DA 3H3JA 2AE1A 1E3WA 1IHYA 3EDMA 1E6EA 3C7DB 3HWRA 3WWYA 1SCUA 3OETA 1UUFA 2BLLA 1LQUA 2AG5A 4IJKA 2NACA 5DCUA 1H94A 1RM3A 4AJOA 3CTMA 3F46A 4PLGA 3LLSA 1U9JA 2P5YA 4MKRA 1QSGA 3FBGA 4WOJA 1EFKA 3E48A 2POQX 3UFXA 4YBZA 3HE3A 4LCJA 4B8WA 3ZWXA 5THQA 5CG1A 5T5QA 3AFMA 4TRNA 4EJ6A 4BO7A 3OH8A 4P8RA 5K6AA 4FC6A 3QIVA 4YAJA 3JQ9A 3ZNOA 4AJ2A 4Q3DA 3DFUA 1LSJA 2EKQA 4CL3A 3UN1A 4D3DA 2EIHA 4H16A 5IG2A 4B7CA 5L45A 5CAEA 5A9SB 1N8KA 3WGOA 5I9MA 5TJHA 5TNXA 3O8QA 5GY7A 1PZHA 4FJ1A 1KEPA 4ZRMA 4XDYA 4YAIA 1G6KA 3KYBA 1I10A 4E2XA 4J1QA 3VVBA 2NQ8A 1K0UA 1B15A 3QWAA 5BSFA 1GPJA 3D64A 3FF4A 1UXJA 1EVZA 3WLFA 1ZNQO 2B83A 1EDZA 2NUAA 2QZZA 4ITUA 2V7PA 2Y0CA 3IQDB 3TZQA 3H5RA 5A9RA 3WMWA 4XIJA 4AJIA 4R1SA 2UYYA 3NGLA 3PFWO 1YBAA 4E5PA 1AGNA 2EGHA 1YONA 2HRZA 4URFA 4DLLA 1B26A 5JC1A 1VE9A 4YAKA 3ROKA 3C24A 2IRWA 4LRSB 5I8ZA 1ZXBA 3GAFA 4CLOA 2FN7A 1IE3A 1QLHA 1LQTA 4R4JA 4XR4A 1J4AA 4BNVA 1W6UA 1A7AA 3ONDA 4HFJA 1ZEMA 4KDFA 4UUNA 1U8XX 3ENNA 1A27A 2RAFA 4II2A 4ALJA 5CDUA 4MVJG 3V1YA 2O3RA 4QT0A 3N58A 3JD1A 3K2BA 3F5SA 4XR9A 3PQDA 3E82A 3RBVA 4RLSA 3RKUA 4KOAA 2J3KA 2WYVA 5EL0A 2VUUA 3FNGA 1ISJA 5G0UA 2DM6A 2FR0A 3GY0A 4CMIA 4ND5A 3L6DA 1H2BA 4CQMA 2AA3A 1ZZEA 3RUFA 4QFDA 4AJEA 4FFMA 4IDAA 1TVEA 4CM4B 1ORRA 1NASA 4P38A 1YRLA 4XEHA 5F1OA 1GAEO 1N7GA 2OUIA 1PR9A 2ZTLA 3PHGA 1OMOA 1NFFA 3GC6A 1ZMTA 4D79A 3H4VA 1BRMA 3IUSA 5DOVA 2DBQA 4CLRB 2JD2A 3KLPX 3F1LA 4CM3A 2H5LA 2I76A 3E03A 4OKIA 3Q2KA 3ZH2A 3WIEA 4A7PA 4TRJA 5BSEA 1ARZA 1YL7A 3BTOA 5TT1A 3GN2A 4EJ0A 1M6WA 1PQPA 4RZIA 5DNAA 4HFMA 1XKQA 1X14A 3GZNA 4R5HA 4II3A 2OHXA 1EEHA 4MVJE 2O3SA 1YB4A 5I7FA 5JDIC 2DKNA 3BHJA 4BGUA 4MVJI 2YJZA 4OM8A 2NWQA 4LSMA 1U3UA 2NV6A 1O89A 3WGTA 2BMAA 4IGFA 3DZGA 4J2HA 1AXEA 5C7IO 5IXYA 3ANNA 1A5ZA 2B0JA 1GTMA 2H63A 4YJDA 5JCJD 3NJ4A 2VNSA 3KYCA 3PHIA 3GEMA 5IN5A 4XB2A 3DBHB 3WG9A 2EKPA 1HKUA 4IIVA 1VKOA 4TRRA 1JAXA 4CUZA 1X1TA 4RORA 4XQGA 1OC4A 2GZ3A 4A73A 2X5OA 1U2DA 4MVJA 3OMLA 1NX6A 1K6IA 3SLKA 1XCBA 3MEQA 5AXAA 3IAHA 1TEHA 3QJ5A 4FGWA 4BGVA 5A5EA 3EAGA 2GRAA 2XF8A 4JIGA 4J9VA 3PLNA 1ZIDA 5FFFA 3LF1A 3NUGA 3OHSX 1GDHA 4R16A 3HNPA 1E0DA 4HWKA 4E5NA 1LNQA 4CL8A 3JQ9C 3UKOA 1YBMA 2ZTMA 2LDBA 5KJFA 2BH9A 5A04A 3BZUA 4XZ3A 1Q7CA 4NBWA 3NT5A 3ANMA 4BS9A 4IINA 1HZJA 2QIOA 4PLWA 1YQGA 2FPIA 2VWQA 1UAYA 3WBBA 1MXFA 4DWVA 3S1LA 1N1EA 2CMDA 3JD4A 4CV1A 4DLBA 4YT8A 2HSDA 1ZK2A 1KEUA 2X9NA 3RJ5A 2AMFA 3PFFA 4NBVA 4RVFA 1ZK3A 1Z6ZA 5GZ6A 2QRLA 7ADHA 4BNIA 1PTJA 1VM6A 3CSDA 3BXXA 2GZ1A 1MX3A 1S7CA 3NDRA 5EERA 1GADO 3B20A 4GMGA 2CUKA 1NQAO 4OAQA 1NPYA 4PVCA 1AN9A 1EE9A 5KNLA 1T1RA 3ASUA 4DIFA 4CLOB 3ADPA 1JDJA 4GPD1 3F3SA 4J3FA 1UXGA 1MUUA 2YUTA 4IMRA 1QYXA 3G0OA 2IXAA 4N54A 2GDZA 5B12A 4OSPA 3WDSA 3O03A 1SZJG 4WASA 3M6IA 1G0NA 1JWBB 2VOJA 2AQHA 4HNHA 4MIOA 1RM4A 3DAGA 1TB4A 4R3NA 5DBGA 3RBXA 4R51A 3EK2A 2ZTUA 3CEAA 1SOWA 3E5RA 5DF1A 4KWHA 3OF2A 2PD4A 2E48A 4O0LA 3FWNA 5TLSA 4XDZA 2PKQO 3ICCA 4AJJA 1QKIA 1Y8RB 2BHLA 4JCOA 2GN4A 2RCYA 1M2WA 2Q46A 3I6QA 1I36A 3ZN2A 1O95A 2JAHA 1LXCA 1MLDA 4R1NA 3K73O 4NIMA 1XIVA 2JFGA 4TKLA 2HDHA 1HXHA 3VKUA 2C2XA 4CMGA 1EE2A 4DBZA 1BG6A 4O59O 4HX5A 4YYZA 3DWFA 3QV1A 1U4OA 1Y1PA 2J3HA 1AHHA 3TDKA 3WICA 1QYDA 3G49A 3MCVA 4D3FA 1HYGA 1NBOA 3RVDA 4U8GA 1HDGO 4K9DA 2EG9A 4Q9NA 3SVTA 2W2LD 4OHUA 1F8GA 1UZNA 1HLDA 3QVOA 1LLUA 3SC6A 5IZ4A 3I52A 2G5CA 3IP1A 4K6CA 1TI7A 4PLTA 4E5MA 3PIIA 4BVAA 2Y1EA 3FR8A 3GVIA 3HN7A 3ZWMA 4BKPA 1CJCA 3UCXA 4OOEA 2GF2A 2EW8A 5ADHA 4AFNA 2W2KB 3GPIA 1HE3A 2PV7A 2YQ4A 3G1UA 3F6YA 1MXHA 1BVRA 4ND3A 4UEKA 1GZ4A 2ZB7A 3HDQA 2VT3A 3RASA 4J7XA 4BKOA 1AUPA 1SB9A 4DYDA 5ER9A 1U3VA 2CF6A 3TZCA 1DFHA 1PJSA 1BMDA 1ONNA 2PZJA 4EUHA 4I5DA 4DA9A 2YDYA 4ZQFA 1X7HA 2YV3A 1BDMA 2IE0A 4MP6A 4XRRA 5MDHA 1NYTA 4CV0A 3DOCA 5JMPA 2D0IA 4BL5A 3P7MA 1U7TA 5EMHA 1HWYA 2BFOA 3DMTA 3NGXA 3RUHA 4Y6SA 5BQFA 1VJ0A 2QQ5A 4Z0PA 5BNFA 3BA1A 3BAZA 4GX0A 1PIWA 1R66A 1XGKA 5A03A 2Q1UA 3PVZA 1PWZA 5LDHA 1E3JA 4PLYA 1XEAA 5JYDA 4P22A 2D4AA 1TT5A 2AEFA 4CLDA 2OBNA 4JN6B 4P4GA 5JSFA 4LN1A 4A10A 4NH4A 3ZHZA 3NX4A 4INAA 3INTA 3AJRA 1JN0A 1WVGA 4DRYA 2EJWA 3GMDA 2NM0A 4TVOA 4Z0HO 5JC8A 3GT0A 3EYWA 3C1TA 4AVYA 2V6MA 3PQFA 1ULSA 3H8VA 1EMDA 1P1RA 2GN9A 4YCAA 1K3TA 1NQOA 1DB3A 1E7QA 2X4GA 4WLVA 3PEFA 2IXBA 1LDMA 3MJTA 1V9LA 2AEJA 2VTEA 2ZB8A 2OMEA 4BB5A 1I8TA 2I65A 4GVXA 2X0NA 2CFCA 2Q1TA 4MP3A 5JNLA 2PK3A 5TJ9A 1WMAA 4IZIA 1DIHA 1F06A 4N7RA 4CM7A 4CODB 4M87A 4YEDA 1PR3A 3S55A 3GRPA 2PKRA 2X0IA 4KMSA 4L75A 2WM3A 4QXMA 3ST7A 3RC2A 3JQAB 4RPLA 2AG8A 5EN4A 3H9JA 4J91A 2V6FA 3SJ7A 4FCCA 3AI2A 2WYWA 1IZ9A 4DQXA 1Y8RA 1A9YA 1IZ0A 3GZ4A 2IYPA 3IMFA 4IDDA 3DONA 1P9LA 3K5PA 3W1VA 3R3JA 2OXIA 1CQIA 3JYQA 5JBIA 5MGBA 2DT5A 3MZ0A 2WWRA 3ETEA 3AUAA 3S2FA 4GX1A 1O94A 2VWPA 1LLCA 1QLJA 3G79A 5AOVA 4RLHA 4BO8A 4WOKA 3I5MA 2X86A 4PRLA 1DO8A 4U7WA 1ONOA 4XQ9A 5A5FA 1LDGA 4BMNA 2G82A 1FK8A 2PA3A 3FPLA 4TZTA 4PFJA 3WS7A 1D7OA 3MJEA 4MINA 4B4OA 1JVSA 1Z74A 3BHMA 2XOXA 3JQCA 4PG5A 3GNQA 2YQ5A 3B6ZA 4EUFA 5ILOA 3C3XA 3FTPA 5G4KB 2B4QA 5FEUA 2HMVA 2DLDA 3VOSA 1C0PA 1PZEA 5JAMA 3OJOA 1WWKA 2VUSA 1DDOA 4IDGA 3TOXA 4D0RA 4BNLA 3F4LA 1GCUA 1NXQA 1A4UA 1DFIA 4LSWA 2ZKLA 4JQCA 3AUUA 3JQFC 4U0KA 4B79A 4D45A 4ZHSA 5JAZA 3GVHA 3T7CA 3UCFA 2XXJA 1YJ8A 4Q3NA 1QV6A 2AXQA 4UVIA 1BW9A 5KWEA 2O7SA 4OO3A 1NFRA 4BO0A 3DBHA 5HBRA 3ZWAA 2WE7A 3EY4A 2A92A 2AHRA 1MG0A 1BXKA 4QSMA 1ZSVA 3U3XA 4UAGA 4IDEA 4BNMA 2QHXA 1P1FA 3EZLA 5F1PA 3DAFA 4I5EA 2OO5A 2DVMA 4W7IA 5G2OA 5DCWA 1HRDA 1A4IA 4ZU3A 4F6LA 2EF1A 3K30A 3TF5A 1O0SA 1DJQA 1U5CA 1SO8A 4NNJA 3KM0A 3RBZA 4YAGA 1K89A 5L40A 2GPTA 3IUPA 1Z7BA 3DBRA 3KO8A 2HLPA 2VYVA 4YRDA 3LF2A 1VC2A 1I3KA 1ZCJA 2YDXA 1LDYA 4F46A 2YHIA 4D46A 5DP2A 3AI3A 1AE1A 3SX2A 4CMAA 2CY0A 5B37A 2R00C 4NK5A 1EVYA 3DMYA 3PHHA 2JFHA 2D8AA 2X5JO 1H9BA 3KSDO 4F3YA 1IPEA 1UXHA 4HXYA 4QO7A 1E7YA 2NU9A 1JLLA 1H6AA 3TNLA 2AQ8A 3SC4A 3ZV6A 2DC1A 4PZEA 3OIGA 1NTOA 4B3JA 3TJRA 3ZU4A 2YY7A 4DQUA 4EYEA 2PZLA 4I1IA 3DZKA 5TGDA 1EUDA 1YQXA 3BMQA 5JPIA 2PWZA 2P91A 5T6BA 5B4TA 1QV7A 3OP4A 1Z82A 3JQDA 4RPJA 4EITA 5JO0A 4BO3A 2PTGA 5FI5A 3AOEC 2IODA 3GR6A 1ADCA 5TT0A 3ICPA 3M2TA 3I9NA 4M86A 4F45A 3GH3A 2E82A 3WYCA 3GF4A 2Y66A 3ZNQA 1ZVMA 2O23A 4UVDA 4WE3A 4E5YA 2EXXA 5BSHA 2R2GA 4BO1A 1F14A 1GUZA 3DDNA 3ZWYA 3LT1A 3VZRA 3FTNA 3TRIA 5T57A 1YDEA 1FXSA 2X1HA 1MV8A 3OEYA 4FC7A 1UP7A 1PS8A 4CM8A 4OKNA 3V2HA 1H0KA 3FRJA 2JJYA 3U9LA 5KJCA 1QORA 1J49A 1GZ3A 3JTMA 3LT2A 4W9NA 3DC2A 4MDHA 4CLXA 3LQFA 3Q3CA 3Q9NA 3A9WA 3JD0A 2Y0EA 4XYBA 3ZWPA 5U4QA 3IJRA 5G0SA 1Y5RA 5DULA 1NWCA 3F47A 1PJ4A 1F0YA 4FBGA 4HY3A 4Y6RA 1RM0A 1YS4A 3OA0A 3PYXA 5C7LO 1HTBA 1RYEA 2VRCA 3HZZA 2QG4A 3ROQA 3ZDFA 4CMEC 3GFGA 5ES3A 2OP1A 1M66A 4PZCA 5TSDA 5TIIA 1ADBA 1PQWA 3I9KA 1JWAB 1WZIA 1RM5A 5G4KA 3NEPX 2PKQP 1DRUA 3RU9A 3C1OA 1IUKA 3ZZNA 1V3UA 2E49A 2P4HX 1X1EA 4FR5A 4RQTA 2HAEA 3GHYA 3LYLA 3CIFA 3DHYA 3QP9A 2BGLA 1SEVA 4S1VA 4PG6A 3NTQA 1LBEA 1H93A 1Z75A 2B69A 3JQAD 5CPFA 4BKRA 4DIOA 4ZICA 1Y8QB 4YACA 1AXGA 1XLTA 3H65A 1M67A 3E9MA 3FWZA 4ZQHA 4RVSA 3X2EA 4EDFA 4DYVA 1ZUD1 1Y7TA 5JCJA 1FF9A 4YB8A 3NV9A 1MA0A 1BWSA 3NYWA 1XR3A 3S2EA 1JW9B 4AL4A 5F5NA 1VPDA 5L51A 1NQTA 3H7AA 2DPHA 5JCXA 1B8UA 1E7MA 1TT7A 4MP8A 2NQTA 5L3ZA 4DMMA 5B1YA 3PWKA 1DSSG 3QA9A 4HNGA 4B4VA 4B4WA 1NFQA 2WSBA 1VL8A 1E7WA 1H6DA 2OZPA 3UGKA 4U0JA 3B1KA 3LC2O 2FR1A 3TQHA 4OL9A 3KBOA 4KQWA 1U8FO 1FDSA 5HWSA 4Z6KA 3LVFO 3UVEA 3QW2A 2TMDA 4PG7A 4KUGA 2IZ1A 4RL6A 1LRLA 2EWMA 4NJMB 3COSA 5KCZA 1VLLA 2OL4A 4FDAA 1VJTA 3CH6A 1X15A 3MJVA 1F12A 1PGJA 4B4UA 3V8BA 1IL0A 2IEDA 3DZJA 4XQEA 4XIYA 2AQIA 3GUYA 3GVCA 1KERA 2GD1O 3A14A 3E6AA 2PLAA 4DPKA 4NU6A 3HN2A 4WCFC 4CLHA 5KJEA 2GASA 5C7OO 3WMXA 2D59A 4I9UA 4XX0A 9LDTA 2UVDA 5JXWA 3FPCA 3AOGA 2YHUA 5IZCC 1FMCA 4DGSA 1NM5A 2DFDA 4DXHA 2OGUA 3W8EA 2PD3A 1LLQA 1P77A 2VWHA 3UXYA 4JXKA 3D3WA 1SOVA 1VL6A 3RI3A 4RVGA 4CQMB 4NI5A 3TL3A 4LISA 4CQLB 2X23A 2XXBA 3FI9A 3GPDG 5IJZA 4NG5A 3LZ6A 2Y68A 4GSKA 5L7YA 3ASVA 3C8MA 2E4AA 1ENOA 1DEHA 1SB8A 2O7QA 1XDWA 4OSOA 5KVQA 3VPHA 1GV0A 3UW3A 3DL2A 3WB9A 4QQRA 4W9NC 4I5FA 1Q2XA 2I9PA
chains in the Genus database with same CATH superfamily
2FCRA 3K8ZA 3TCNA 4W82A 1MFZA 4DA7A 3OJFA 1XF9A 3TEFA 3QEBZ 4YAOA 4LF8B 4WCFA 3A2NA 5ITWA 1XU7A 1CQJB 3NO4A 4TQAA 2P9QA 3BBLA 3DQPA 5ETJA 1H5QA 2YBEA 1UR5A 3SJZA 4RD1A 3UAGA 1V41E 2ZBQA 4A8TA 4ZYYA 2OHHA 2I99A 2JLXA 2ES4A 5KC8A 2VWGA 4PBTA 2Y1GA 1YOBA 1BWRA 1UJCA 1BDBA 3GFBA 1U0EA 5EMMA 5FTWA 4BZPA 1GM5A 2WOOA 1V8FA 1U63A 1Q92A 4OHMA 3T94A 3ZHYA 3R3VA 1UWCA 4R68A 7MDHA 1T8YA 3TLMA 3M1CB 1D1AA 5M2QA 5HZHA 2O8NA 3ZWBA 2Q2OA 2JX0A 1VPWA 3MILA 2LDXA 4W1QA 2H85A 3NBAA 3TLEA 3GLIA 5AI5A 4W1PA 3HNRA 4B43A 4DB2A 2ISSD 3OJEA 2IBFA 3ITKA 5BWMA 1DTWB 4DR3B 2ZB2A 3KSAC 2XMGA 2DI3A 5HS4A 4XTCS 2W2XA 1U9IC 4QFMA 1X39A 2EX1A 3VO1A 1K5HA 5G0VA 3CS3A 4M8SA 3MOSA 3FD8A 5B64A 3U16A 2DH5A 3CJRA 4MYCA 3NEAA 2G4CA 1RYYA 3DFMA 4BNNA 1WDLA 3Q0IA 1KRWA 2B8EA 1CY4A 2F43B 3HEMA 3ONFA 5TQVA 2FW8A 2IS4A 5FLYA 1BO6A 1R4MA 2H17A 3IMGA 3UT6A 3GLIB 1T8SA 2ZIVB 4JURI 1LPAB 1QRTA 1UDBA 5IJ0B 1CW2B 3OT1B 2A9QA 3HWSA 4UVHA 2D1RA 4EKNB 4L02A 4I5IA 1C1XB 4IYJA 4Q24A 3BULA 1OXVA 1W8IA 2HTEA 5L0JA 2YIMA 4Q9KA 5DYGA 3U0BA 1AZLA 2J3MA 1CVLA 4LZPA 1XWWA 5ALEA 1YJGA 5INTA 1OW7A 4Y1EA 4NMHA 4LECA 3RUIA 4B6PA 1YQDA 4QUAA 5CT9A 2GCNA 1O94D 1VHLA 1P39A 1IXZA 2W58A 3LP8A 1EXNA 3LXMA 2D2VA 4N5LA 4OYLA 3ZY6A 4JP2A 4ETIA 1D2CA 3TIVA 3QPWA 1ABBA 1FFXB 2GS9A 5D86A 3LTEA 4N0PA 3AJDA 3WK4A 3ZZ1A 2QVGA 2H1WA 3QLUA 5DNCA 2VHTA 4J0CA 3DE2X 4TLBA 4RSRA 3VSEA 1L3CA 4DC0A 3FN4A 4HFNA 2I7XA 4LOLA 1T3ZA 5CFLA 5CFZA 2YH2A 4AECA 1EAYA 1P75A 4AKTA 1CUSA 1WKVA 2G88A 5I01A 1VSVA 2HYDA 3EGXB 1DC8A 3F73A 1DLIA 4QM7A 2ACEA 1GU1A 4ZTUB 3SNHA 4MVJD 2KB0A 1UP4A 2YZGA 4ZT6A 4ZCLA 3UJPA 3LY9A 3KKNA 1ZVKA 4OQEA 3FMPB 1YZGA 4BLSA 1OWLA 4P0QB 4KIFA 5IC6A 3O2JA 2I4MA 2EQAA 2P30A 3FOCA 2O7NA 2WWIA 3CQ9A 4FIZA 2BFBB 1GZ5A 3GA7A 1PU2A 3IHUA 1YB7A 1JHMA 1SOMA 4L7QA 3RVBA 3SK0A 1CY6A 1ENPA 3HACA 1G7RA 4ENTA 1HM5A 1VPLA 4ZQEA 1HE1C 4JP3A 3ABOB 1PFGA 4KC0A 4PVDA 3K1IC 2FLKA 5DVZA 4M9QA 2CNBA 2LFDA 3OEWA 5T67A 1HF3A 3ZZMA 3HKEB 4TKUB 3DBRB 3QVMA 3CURA 4U5FE 4LMRA 1XZIA 4XB1A 1XDZA 4ZDKA 4M60A 4GPEA 4OXYA 5T8KC 3UV7A 3TW6A 3VHLB 2ZTVA 3K94A 5CVDA 5CEEA 4BBJA 1WD5A 3QLUC 4PONA 1Z9BA 1QNFA 1MO6A 2JBWA 2ZIAA 2ZYRA 4WADA 1E84A 4DXWA 4DRXB 3KHTA 4MV7A 4UBOA 1Q2UA 3T5DA 5JH7A 5JVDA 1DT3A 3KYJA 2GHQA 3LS2A 1C81A 3OICA 2Q62A 4IEEA 4ANJA 1MG5A 2Q5QA 2QT1A 1HYHA 2H51A 1GVHA 3B13B 4MK4A 2D5IA 4MRNA 3L0PA 3AETB 1PL8A 4QU9A 1H8HD 1XEWX 4KLNA 2IX3A 2OXEA 3QMMA 2IDZA 1TFRA 4QLAA 1RMYA 4MUIA 4V38A 1NRIA 3CWCA 1L4MA 3HBJA 3HKCA 4C2AA 5HG0A 3T41A 4JR0A 2Y0BA 3N2KB 4IH4A 2ZUTA 1W9MA 4M7RA 4JWTA 1UZMA 4M76B 2V1XA 1OWPA 3IALA 5FPHA 2ZRHA 3IESA 1B4DA 1GG2A 1HQCA 2XT6A 4OQ4A 3RAJA 3EXFA 1OR2A 5KHOC 2HZ7A 3EXG2 3KZKA 1K7FB 4Y2GA 2F9LA 3B3JA 1WP4A 1P2TA 4NG4A 3Q3IA 4P86A 4IXWA 2IPMA 1R6DA 1I3OA 2GNAA 5DGCA 4BB6A 1SIUA 2B8JA 3D7LA 4F84A 3A6EA 2OJQA 2X22A 4I1SA 3MTGA 3MRSA 1C9KA 3E81A 3UJAA 5ERYA 1JFRA 4FW8A 2BKXA 3AUSA 2P67A 3OBBA 2DFTA 2XE6A 3B12A 4BVFA 5FFNA 3AM5A 1CZRA 2XD4A 3L02A 4H35A 2XXAB 1ZM7A 1TW3A 3HQ4O 2N1MA 4JC8A 4CCYA 2WKPA 4D74A 4EP1A 5CDFE 1ILEA 5AKZA 1Y6RA 3LNTA 3H2YA 1S3GA 3R0ZA 4U9UA 4OGKA 1M8FA 4JBXA 4GQHA 2ICAA 4RF3A 5U1PA 3TB4A 1NXVA 1NP3A 2RHBA 3ODGA 1JQ5A 2HBZA 4HAZA 4R2KA 1NL3A 1FX1A 1TK9A 1TUIA 2I71A 3BXFA 3MJCA 1YCFA 2QZSA 3STHA 4KPEC 2PXXA 4DRIB 4A2PA 5HPYB 2QLBA 3A4LA 4IRMA 1MRSA 2Q3EA 1H22A 1T29A 4AZ0A 1YZTA 1JQ3A 3AY6A 3PQ7A 3UJ3X 2W98A 3AKCA 3NYQA 2OQMA 2BIFA 3E5MA 1CS0A 3RC7A 1YR7A 5KTOA 1P4SA 2OCXA 2RBGA 3BFXA 2BHRA 4KVZA 3MTQA 3SR0A 3B6JA 4YJWA 1YFJA 2ACKA 2KX7A 4FGKA 3I92A 1N25A 2FAPB 4LHVA 4CF7A 2FEAA 2BL2A 1GPKA 1ZQ9A 1WXXA 2XUJA 5ULLA 1HFKA 3TOSA 3I2GA 5DXFA 5KPJA 1H3EA 6YASA 2XNHA 3GEBA 4QBKA 3SQNA 2G9RA 3KQLA 4PYRA 3OWTA 2C20A 3I01A 4K0DA 5JPCA 3T34A 2VEOA 3LQ2A 2GCOA 3FRIA 5EMNA 3LP5A 4BN5A 4BLVA 1VCNA 4TYWA 2QRNA 3FYDA 2PQ2A 1HO3A 2QTRA 3EGIA 3GK3A 3OX4A 2CDAA 1RYZA 1NF8A 4MW0A 4N6GA 4OL0A 4DSNA 1K6XA 1VIDA 2XCLA 3WFJA 1YF3A 1UQTA 2XBMA 1ESDA 1DDIA 3CT4A 1TOAA 3NEYA 4H1VA 1EQAA 3IULA 4Q3AA 1YUMA 1OXTA 1X9IA 1JI0A 3KYIB 1WA5A 3L7KA 4MQ6A 3UK0A 2E6UX 3TD6A 3VYRB 1BN6A 1F0NA 3PUIA 4D8UA 2ATCA 2R7LA 2G76A 1FS5A 2NQ2C 3IMEA 1A69A 3L0DA 2WM8A 1Z36A 1SKQA 3IAS1 1QIGA 3OCYA 2I55A 5ALDA 4AYWA 5M34A 1EQ2A 4IAOA 1IW7F 1KDRA 4KFTA 3RSLA 1ZW1A 3TOZA 3ADDA 4Z54A 1ECBA 4R6WA 2BUCA 1A9OA 3U4DA 4FS8A 4XVUA 2Q3LA 3V7UA 4HN4B 4RD4A 5EXTA 1X19A 3R8XA 3O9VA 4BO2A 3HO8A 3S3TA 4LKOA 4JNCA 3VNAA 3R3SA 1M6VB 2OOKA 2VK1A 4AP9A 4E11A 2Z43A 2OLKA 3VYTB 1N5RA 2GLXA 3IC5A 4ULVA 4O4JB 1P8AA 3UKJA 3VNUA 1ISIA 3SF8B 1DBPA 1JH8A 3ZU3A 1MAVA 4BMCA 4A2CA 1M34A 3AV0B 4TMZA 3OWHA 2R44A 3A6PC 1GTL1 3A6DA 1WVIA 5LA6F 2IK8A 4C3EA 1GY8A 3V1NA 1NVDA 3OO1A 1KDTA 5JZVA 2ZUFA 3MCAA 3ZYZA 3FGOA 5C3UA 3TYXA 1V1RB 4M54A 3SX4A 1ISPA 1WU7A 3AR8A 3DQZA 3F90A 3PD7A 3U4HA 4BNZA 2CLOB 4XYLA 5I5EA 2R7VA 2VP4A 3KSUA 3AEUB 5T3YA 3TVDA 1FP7A 1RWBA 3T0FA 2FTKE 3EASA 4TMXA 3O39A 1XNJA 2D5CA 4OUKX 4HV4A 1CLEA 4ZMSA 4OF4A 5AUPB 3GJXC 3V7WA 4DFDA 1HL7A 2AWOA 2ZVJA 2FN9A 1RQLA 1YL6A 1GA1A 2X14A 3D3WB 4FS3A 3ACCA 4B3HA 5LBIA 3EAFA 1G8PA 1SPBS 3JZ0A 2YFKA 1YYXA 3ID6C 1I6KA 1RYMA 4M63A 2PPLA 5GM1A 5C31A 4W5WA 3ZGZA 1GTJ1 1GYRA 2KK1A 2O3TA 5EIHA 4OIRF 1Q16A 2J9FB 3KAPA 3EBLA 2CEAA 4B35A 1H2WA 5C5IA 4KDEA 2EV9A 3PGMA 2ZUBA 4E88A 2C2OA 1V5IA 2BUBA 5AKXA 1M75A 5F77A 3PFCA 2B2XA 2IYTA 2HO4A 4EF4A 7AT1A 1M5RA 1X94A 3LDHA 1I2BA 3FZYA 1TAHA 3BIWA 1G41A 2FR8A 3T5PA 1WQ1R 2VHYA 3OOEA 2AB0A 4C7MA 1UWVA 4Y9SA 1CDDA 1WCV1 4NF2A 5EINA 5E8JA 1GL9B 3CF4G 3D3EA 4CM9D 3EZXA 1F4LA 1W5TA 3O4RA 3LVQE 2BLNA 4Q3KA 3ESQA 4E31A 3M6XA 4Y3UA 1CYDA 1M7BA 5DW3A 2O1EA 4QYMA 4ZJUA 1O8BA 4YUVA 5FOQA 2HK7A 2W8BB 2C0PA 5B1SA 4D42A 2DKFA 4FT4A 4O2LA 1D0VA 4LV5B 4OQFA 1K4MA 3FWHA 4P0TA 2XUQA 4TWRA 1Y42X 4MI9A 1SZCA 5DNEA 1FE8A 2CCKA 1NXOA 1OZHA 4HG2A 1QVVA 1SBYA 3E3MA 3NANA 3NG1A 2WHXA 4KX5A 3TSYA 3SS7X 1W94A 1YK0A 1J5XA 3HCRA 2I5PO 4GS5A 1JDBB 2OU6A 2ZBVA 2IW1A 3TR5A 1TJPB 1VBFA 3ZZTA 1REQA 5E3JA 4PNEA 3WYDA 1L4FA 1RE0A 3F6CA 3QMKA 2XOKD 4M55A 3RRMA 5CFNA 4COOA 5EUBA 1P0QA 2YFQA 3HCOA 4IX9A 2JFFA 3JALB 3PGJA 2BGUA 3P9RA 2YWJA 5HFJA 3BRWD 3CW9A 3M6VA 1SCJA 2EL9A 2Q49A 4HB2A 3RLIA 4Z4HA 1Z4IA 4YV0A 4JMLA 5JWOA 1W96A 2ZSBA 3GQBA 5GJCA 4EYGA 4IUCS 5AI9A 5B3JA 1M1UA 5K0EA 1RAHA 4B09A 2BFMA 3AONB 1DGQA 1AN0A 1YRBA 2OKUA 3G9TA 2F3RA 2PDAA 4GLOA 4RW0A 4RJKA 3WJ1A 4LF9B 1TCCA 3E2PA 2C8KA 4BXOA 1IOLA 3U2QA 4RTKA 2IEBA 2WSSD 3AWDA 4EY6A 1P80A 4HNQA 5HOQA 3ZIUA 1GQOA 4DJ9A 1OVMA 2I6TA 3QG5A 1WL8A 1PJ2A 5C35A 1E2UA 2WUWE 2Y93A 3JD3A 3V4OA 1AT1A 4XWYA 4RZHA 3I23A 3U3DA 2XGGA 1P60A 4JJIA 1V4BA 3ZHCA 1TF7A 2C5HA 3S2IA 3USCS 3KP1A 4OJNA 4BO5A 4DCCA 5FL7D 3R7CA 2BR4A 4TN5A 5CXQA 2R7QA 2W4QA 2YJNA 3ZU6A 3DNFA 4LBVA 4H18A 4UEQA 3AEKA 1CQXA 2O0MA 3FLEA 4AZSA 5CHYA 2JDID 1W0JA 3M7IA 3ZLTA 1PV1A 1NYQA 2H4JA 2W83A 4NFHA 3LUAA 1L2TA 3FCEA 5EJ9A 1OXKB 1U1EA 1GU0A 4FZ5A 4EW3A 1FMWA 3G4XA 3KPUA 4REMA 1OASA 4M83A 5CDTA 2GN6A 3ROTA 5LU8A 1XCLA 1HDXA 2YCLA 3BA6A 3PRKE 2QTBA 1KPHA 1M1ZA 3DEZA 3L0CA 3NRJA 3RNOA 4B0OA 3QWHA 4DA0A 5FAKA 4C0XA 5LJLA 5DBIA 4IJQA 4HS9A 3W5HA 1H4TA 5BR1A 5JAQA 1H9AA 4WBSA 3HB4X 4JT4A 2HSBA 4O2AF 3ZZ0A 3M82A 1O96B 3DKAA 4ZAFA 4E21A 7ABPA 1GQFA 3JZDA 2C2HA 5DRTA 5LQJA 2IXOA 1PFYA 2VSFA 3ZDDA 1AGPA 5EZYF 1G19A 2HMTA 3G88A 2PNJA 3SHVA 2PU7A 1QLEC 3FPAA 2G3VA 3JRMO 1Y6GA 1R16A 2P1RA 3O6XA 1FNCA 4JYBA 1HEUA 2IU3A 3NP9A 1Z7YA 1KY4A 1SZDA 2D7JA 3WYEA 1YD7A 3UJCA 1A72A 1GD1O 1NBWB 2QA5A 1G5RA 2Q4TA 2VZ9A 4IHJF 1W52X 5F5HA 1MP0A 1ZBQA 3RUEA 3GRKA 4CF6A 5BVHB 1GL7A 1EA7A 3K2IA 4H27A 3FDQA 2XLEA 1G5QA 3EZYA 5K8IA 2LCIA 4FHDA 1IHXA 3PLRA 3ZCSA 1JBQA 1T25A 2ZWOA 4NICA 2D7CA 3AUJB 1AUXA 4AKHA 1RZ3A 3LUPA 3L1UA 4J0FA 4K81B 5EZ6B 3JD2A 1ZESA 5ISMA 1FDUA 2JIOA 3VR2D 4AG5A 4EHBA 2ZAOA 1G8AA 4ZFNA 5JI3E 1PX2A 3QXHA 1V4AA 2YHSA 2N1BA 1L6IA 4UHDA 1Z73A 3KXPA 3Q6NA 1OLOA 2ODTX 2PANA 3FH0A 3ZXXA 1V96A 4AL0A 1B68A 3JZAA 3QE3A 1JFVA 2BDEA 2NVUB 4LVCA 1LUAA 1TMGE 2R9RB 1KARA 4MI6A 4LWZA 4XEUA 4YMSA 4MVJP 1KOLA 1E61A 5LN1A 4R1UA 5CM9C 4C08A 2NUPB 3C3PA 3PI6A 4JT8A 2ZUEA 1ZW2A 2TRSB 3A0UA 3MWFA 4M1OA 8ATCA 2WZLA 4F93B 5JYCA 3PNOA 1ZC4A 5CXUA 3ABQB 1RXQA 5DLDA 4DV5B 1G3MA 2LWIA 2Q7RA 3FAPB 1VCMA 3JQFA 1WKCA 3I0NA 4LDKA 1H2XA 1QHHA 3GPBA 4TLCA 3ZCPA 4DMGA 1HORA 2XVZA 1U3WA 4MIEA 2GPNA 3AO0B 2BBTA 2PX2A 1WB6A 3EZ9A 1E8DA 5JEEA 3ZI7A 2Q6OA 4CEJA 3BL5A 1R5BA 1E9SA 2GK3A 1QUFA 2JVKA 16PKA 1KS9A 1XWIA 1ZICA 4AK9A 4D3ZA 3HYCA 1JEYA 2G04A 4UNNA 2O8FA 3W3ZB 2IHVA 2AMYA 1KQFA 2SKCA 1T2DA 3NEJA 4QUGA 3PV0A 1D5WA 4X24A 3FIJA 1WCXA 2FOLA 4ZCPA 1R8XA 3FZQA 2ZJZA 3E3AA 3K4HA 4EJSC 3T3PB 5JS7A 1T34A 3FTQA 4UTZA 4PHTA 1N8TA 2FMFA 5BSVA 2X1MA 1RLTA 1BGVA 2AOUA 1EK6A 1FVXA 1E1MA 2OHGA 3W8IA 4FOOA 2F22A 1BN7A 1OCRC 1R1DA 2IT1A 2ZYAA 1G17A 2ODNA 4J0EA 5ABPA 4WCFB 2ZLBA 1OTHA 1DXOA 1P9WA 1CETA 4LDPA 3M5PA 3ZH9B 3DMDA 3GFPA 2E89A 4U2DA 4NJOA 3QVGB 5E33A 5JY1A 2BKEA 1Q12A 1TDJA 3UC9A 3KLMX 2O3JA 2ONZA 2L9JA 1LVHA 1M5TA 2IF2A 3ESDA 5BW5A 3OU7A 3HP4A 3A9CA 2QF7A 2XI4A 1N8SA 4R2XA 5CA0F 5LZ9A 1LU9A 5H80A 1JA0A 4YA6A 3O94A 1QB7A 2JGFA 1V6CA 1GTSA 4Q9IA 4HYTA 5JBNA 3SXKA 2MHCA 1TQ4A 4X41A 2AWNA 3V46A 3AF0A 4BQPA 2YINC 4D43A 2ZUWA 3CX4A 3I6IA 5BWBA 2DERA 2JS7A 2YS6A 4UVGA 1MX9A 1H1DA 3P20A 1SC4A 3G17A 5DN6A 1LB1B 2HQRA 1A9XA 2PY6A 2X0JA 1XNHA 1L4LA 1L8XA 1VRWA 1YZYA 4RSMA 5IDYA 3AVUA 3H3XA 1M1NA 2IHBA 4F5YA 3QENA 2KW3C 3RS3A 1WHSA 1JDZA 2RGCA 3DMHA 4YMWA 5TJ5E 1K3UB 3D6MA 4ZEMA 5IASA 4FPXA 3TNYA 1VHJA 2WIGA 4KXXA 1C1DA 1Z5WA 2O5EA 2XNJA 1JA9A 4LQDA 1IPFA 4KGZA 2QRGA 1EUQA 1E5VA 3TG8A 3DEYX 1IBKB 2JPDA 3SBEA 4Q4HA 3UNXA 2JGJA 1WSBA 1IHDA 1SU6A 2F9MA 3ZLBA 4CIBA 5MFPA 3IQTA 1XV5A 1ZNYA 2PSDA 3BJIC 3LSYA 3G8BA 4RU1A 4BV9A 4UOQA 5U9CA 3FKSD 2FW0A 2P2SA 3JT1A 3GJ5A 4MX8A 1YJ5A 4UOZA 5L0CA 1NE7A 3QFCA 5DGXA 4LGVA 4LRQA 3RO7A 4AF6A 2ANBA 5A3JA 4UM9B 1UMBA 4JD5A 4OHWA 3QITA 1ZWLA 1JXAA 3FSJX 4V3BA 2JEOA 3O3MB 3T7DA 3NHYA 2P35A 3I9FA 5K0LA 2OAEA 4BB0A 4EFKA 3PXAA 1AS0A 2A30A 4YWQA 1ODIA 2UZ1A 3QQ5A 1QQ6A 4IVNA 1BS9A 2FGJA 2R85A 1W75A 2EAUA 3PSAA 1EA8A 1U4NA 4GM1A 4MRMB 2AH5A 2IV2X 1FZTA 3Q3VA 3U3MA 3SY8A 3ZUPA 1YKGA 3G5LA 1S8AA 2QJOA 2AJCA 2Q00A 2OFOA 1QP0A 3ZHUA 1TAQA 1PFUA 2Z57A 4R9UC 1XJ0A 4JKYA 5BQ5A 3HGMA 4S35A 4NXNB 5CP8A 4DTIA 1U90A 2O2EA 5TPWB 4MUXA 2H11A 1X86B 4KLRA 1FA9A 2W70A 4DIMA 5BR7A 2ATEA 2JIRA 2J9XB 3U40A 5GADl 4ND4A 3GLQA 2OZLA 1J8YF 3QKWA 1P1IA 1KDVA 3F9RA 1T2FA 1RVV1 5T8KA 2PRKA 3INNA 4QJ4A 3RFTA 5HTKA 2FZLA 4U5GA 2RGXA 1B14A 2C8LA 2WD7B 4JZYA 3T99A 3I61A 2Y1LA 4M1QA 4Z3KA 2GCGA 1MMFB 3WGQA 1ULAA 3DEFA 3R9XB 4EY7A 2G80A 1MQVA 1QX4A 1T0PA 3MAJA 2NLOA 3ELBA 1MABB 1R12A 4GQAA 4OG2A 4R54A 1KF0A 1P31A 3WIUA 5LMUB 2WDZA 4LMPA 4DNOA 1ZLYA 3GL9A 1TWHA 4G0QA 4NBUA 4UVEA 3TRJA 4C7JA 1EIWA 1HY3A 3GGJA 2F3SA 5TV2A 4GR4A 4B7UA 4JRZA 4HLNA 4DNPA 1EUCA 3PZRA 3SJAA 4MA4A 1OXKA 2QVCA 4P7GA 5A9TA 3RF7A 4G26A 4EQZA 2RAVA 2ZFUA 1OWMA 3RCBA 4ALNA 5HHTA 1EFRA 2QAJA 1E1DA 1IG0A 1H0HA 4J32B 4MVJF 1UPAA 3MTBA 1VBMA 3EPLA 4TS4A 3HUFA 1V39A 5AT1A 3U9MA 1WMEA 2CNOA 3EGOA 2FRXA 4JH0A 2GEVA 3ZHRA 4ZTZB 3TIFA 4FCVA 1GXSB 1H6CA 4MRVA 3PEVA 3VC3A 5LXTB 1QQBA 3RF3A 3WGJA 3A2MA 3WGYA 4EB8A 4EM6A 1T6NA 4EVIA 5JIBA 5KEIA 4P7KA 4DV7B 4CMHA 5MN5A 2H8AA 4K9LA 5BORA 5BQHA 1UBOS 3AXSA 1M2OB 2PXHA 4KODA 4WPGA 2BGMA 1ZBDA 3IUEA 5D2CA 2XTMA 5CR9A 4BIMA 1MPXA 3I0ZA 1R15A 2OFPA 5GP1A 3SHTA 4AJLA 2WMNB 5GVRA 4P3YA 2MSDB 4QEKA 5JSKA 5BPHA 1NBHA 3MAGA 2KC3A 1YE8A 3SZUA 2DUUA 2JJ2D 3BRSA 1T6IA 4ZTBA 3UMFA 4CW7A 1QMGA 5JHGB 3NYRA 1UDXA 4S1NA 3NAQA 1OGYA 3GRFA 3IQGX 4R6XA 2IP4A 3IXMA 1Y6DA 4P32A 4L5IA 4RD0A 2L6HA 4N6HA 4LK3A 3D1LA 1A2KC 2G5GX 3HRHA 2QROA 2X6QA 1X7DA 4PWYA 4W6QA 4CPDA 3K96A 4G1CA 2I4OA 2X19A 4JBHA 3CRNA 1YDGA 2IZ6A 4L3OA 4PBSA 3AYZB 4QQ8A 5F2OA 1U2QA 3FMIA 1XKTA 3HNOA 1I30A 4B84A 4US2R 3CVYA 3F6SA 3Q8LA 3G82C 2RHOA 3NYJA 1IOVA 1UBJS 3ZVRA 2PS1A 4US0R 3VC7A 3VOBA 1LK0A 5C1PA 3UJ9A 3EMKA 3ZTTA 4X97A 5AICA 4KBLA 2JASA 4ZJZA 4XWKA 1KK2A 4LC0A 1OZ0A 2ZPTX 2Z3ZA 3KDPA 3MINA 4Y7CA 1TKRA 1L4YA 2HQ1A 3WZLA 5I47A 2WUGA 4FFBA 1T5BA 2V3VA 3TUIC 5HR5A 3SLGA 3PRYA 3V8EA 1EX7A 3QVTA 2FEMA 1YS9A 4KVGA 3UKDA 5JRZA 3TSWA 3D0KA 2HPVA 3DOEA 2HSEA 4GI3A 4DF3A 1E7RA 1KPIA 4KO3S 1KP9A 1YZNA 3KFLA 3FZEA 1BKYA 1IBMB 2IOFK 2A8YA 2L6FA 2IYLD 2ANCA 5FBKA 1D6NA 4NYMR 4QL3A 2NTYC 3J06A 3HFSA 2OYSA 5FPQA 1EQUA 4ALIA 4GP7A 1G8FA 3R4CA 3VHRA 1UKBA 1LI4A 4CV3A 1JQDA 3CNHA 2AJDA 1Y4CA 2EZUA 4HDNA 5FHQA 4EZIA 1OU0A 1XYYA 5AK5A 1JHOA 2ZCVA 1ISFA 3LK7A 3OIFA 4ARBA 4WBNB 1P0CA 2Y77A 3OIWA 5EXEA 3W2HA 1NULA 4CRWB 2KWIA 1UH5A 2EDCA 2VHUA 2WAXA 4ECAA 4D4GA 4F3TA 3BVPA 3LWZA 3WMFA 3COVA 4NAHA 3FCCA 3WXBA 3WTCA 1NBBA 1CDEA 3ERCA 4QPZA 5CLJA 4DY6A 4N12A 1M3SA 2I80A 2HL6A 2IU6A 4OOFA 2G6TA 4QIHA 4O08A 4QOEA 5CLGA 1LI7A 4YDHB 5LP6B 4KQIA 4DKXA 4IIJB 3RWMB 4YR9A 1CR0A 2P2YA 4PLVA 4JEUA 5CLIA 5HBGA 5BUCA 4Z4EA 1DC4A 4C29A 1BX3A 4F86A 4QELA 3KNZA 1R4ZA 2YVLA 2ONKA 2VPYA 3ORFA 1CDOA 2CD9A 3MNFA 3C85A 4MQ9F 1YFZA 2QE7D 2H0RA 2XUGA 4MWTA 4ZO4A 3RQSA 4MVYA 1EBUA 1ZITA 5ALHA 1DEKA 5K05A 4MMZB 3IEVA 3P19A 3DTYA 3EEBA 2X7JA 2P7HA 2AI3A 4DLTA 4B6EA 1U2DC 2DBYA 4DY4A 1Z33A 4EHAA 5BT8A 4QVGA 2ILTA 3MB5A 3DJUB 3QLTA 1IWOA 5JJBA 5BWOA 3SLRA 2C4NA 1L1RA 1LTHR 3JZMA 5AOBA 4G2TA 5KJ1A 3MELA 1ZIOA 3DS8A 3RB8A 4Q5IA 3FM9A 3W6ZA 5B4VA 1ZYRF 4QYIA 5C8YF 3LU1A 4EG5A 2ZIGA 4ZAXA 3PUZA 2I67A 5ALFA 2UDPA 1IK4A 1N1DA 2WP8J 3RS2A 1M56C 3Q3GE 4GOJA 4G5SA 4TMTA 5LBTA 2REBA 4UUQA 3VKWA 2W2NA 4KTTE 3X2FA 4CF4A 4MW3A 3BMCA 1P0FA 2A4MA 2FWIA 3PXCX 3VH3A 1LPEA 1QQTA 3EGVA 1LNZA 4JTAB 5AXDA 3X1YA 5DHUA 3G5MA 4F5ZA 4YAUA 3FCOA 1JECA 3LKZA 1MO4A 2PF4E 3O8RA 3SWWA 2G0AA 1DXQA 3LHIA 4YP1A 5FWYB 5L95A 4KAAA 3GWLA 2VG8A 3PPIA 3QU4A 1J39A 4ALKA 4F56A 4GMFA 4MUGA 1D8TA 1HA3A 1SOAA 3KR9A 4IPTA 4ND1A 1IEWA 1KTIA 1J21A 2A1IA 3VJRA 5K3CA 1UEJA 3LT0A 2AKEA 4S04A 2XMSA 4YTEA 5K6AC 2VHWA 1Q7BA 4JASB 3O8LA 3ZWKA 2FPOA 5ELXA 3D5TA 3KSZO 1KU0A 2D74A 4WLNA 3AVOA 1JHDA 1L7DA 3W4YA 5K45A 4TXHA 4H31A 2JW5A 3JYHA 4FIDA 4D4KA 1A8HA 4C3DA 3V5ZA 2RSEB 1JKMA 2WICA 4K3UA 1RKXA 4GOLD 5BYKA 4WNAA 1MB4A 5IP5A 5EWMB 3D4OA 1T26A 1HPLA 3PNPA 3G59A 3TQIA 3DKPA 2AZTA 5DGDA 5T4FA 1G3UA 4BGIA 2ZYUX 2AX4A 4CM1A 1M1YA 2C0CA 3ZJ4A 5H83A 1T5OA 2ZETA 3R4VA 4LV6A 4BNWA 2FEXA 5DM1A 4FFNA 4GGPA 3V5YA 4RA6B 5DFAA 5GV8A 5CLLA 5KWSA 1CZNA 3EDQA 3G13A 5AW7A 2O9XA 1P7YA 1OXMA 4FILA 3DFFA 2WVHA 1VHWA 4UUOA 3VNSA 3VU9A 1C9EA 3NT4A 3CRMA 1CT9A 3B60A 4QICA 3IX7A 3BE6A 3GMSA 1SURA 2Q5HA 3JAWB 4EVQA 1BVUA 2HWWA 3PP8A 2WJWA 2HF8A 4CMEA 2ZRAA 1COZA 1UAGA 3QUQA 4MH0R 1PR4A 2AN3A 3FIUA 4D96A 1PZGA 4C7XA 3L8MA 3OEED 2JD1A 2ZIEA 3B6MA 4K03A 4GI2A 1G8XA 1BYIA 4L57A 2GILA 2R1VA 4MW1A 2VCAA 1OLXA 2H65A 3FYUB 1A88A 2G1UA 1XMSA 2YJ5A 1WUYA 4MR9A 3UOGA 2E4YA 4JSTA 1U2TA 2FSUA 1ZKMA 5J1TB 1WBDA 1QS0B 1AGXA 5DNUA 1CDZA 5C51B 3PYMA 3AKYA 2J9RA 5DWDA 2XZDA 4MS1A 4NBTA 4NU0A 4S0ZA 5H5JA 1RWNA 2J9YB 3LLUA 5FR2A 1SQ5A 3FMVA 5BMOA 2R751 1LKXA 1PGQA 1ESNA 2WW8A 3D7KA 3H9GA 3ZCQA 3WGIA 2ZANA 5K0JA 3JQ7B 1XJ5A 1CP3A 3B9BA 5DCLA 1P6UA 1VMEA 5LA6B 4KN5A 1V55C 4C6RA 2REQB 1XN4A 1V26A 3GJSA 2CVPA 5DP1A 3EW9A 2JH3A 1GFSA 3BF7A 4HQ0A 3EW7A 4L5AA 1Z56C 3REGA 1ZMXA 3VGJA 1KHHA 3ESZA 1CUHA 5M04A 1OI7A 3L1JA 3WX0A 3I1YA 2CE2X 1ENZA 3OKFA 3DZAA 1ZK1A 3UH1A 4P83A 5IDWA 2JFPA 2VJCA 4I1RA 4LCEA 1ESMA 3V42A 4V2UA 5ITZB 1EWVA 3ESXA 4LBYA 3OA2A 3G1TA 2J0VA 4ZT5A 3R5XA 1CVRA 1MKYA 4JLPA 1T36A 2G8NA 1YGPA 2WB4A 1XLTC 2F67A 1VYUA 3I9OA 4X0RA 2DHRA 2WJHA 1XROA 2HQBA 3GYGA 3BFVA 4ISCA 3PRHA 3HO1A 5E38A 3PKIA 1JQKA 2PSFA 1SEPA 3WQSB 1HFJA 4YXFA 1FJHA 3WO1A 1TM4E 4HTFA 1WNTA 4EHJA 1YZVA 2GETA 4BO9A 1WXDA 3QKRB 2GZ2A 4UHBA 3S7ZA 1N2SA 1L9XA 1RCUA 5HA5A 1NP6A 3N59A 3I72A 5BNTA 2VQFB 2B78A 2JH9A 1ANKA 4OHOA 2AF4C 1NAHA 3WYAA 2PWPA 1C4WA 5J2TF 1VL5A 2VNKA 4WZ6A 4CM8B 3JWGA 1FMTA 3MXTA 3AI1A 4I46A 1DQYA 5HK8A 3FXAA 4JBLA 2JFXA 3ET4A 2Q6LA 3KOUA 5A5DA 5HJ5A 1DRVA 4BU1A 2PGXA 1Q6ZA 3IAS6 3A1NA 4EF6A 3WDKA 3HGTA 1BFKA 1DP4A 2OBLA 2L42A 3EQLF 2WFMA 4KVFA 2HJ9A 1Y7PA 3Q7IA 3AOEA 2CLEB 2VK4A 1C8VB 2VA9A 3UMSA 2HMSA 4K26A 5JECA 1EVIA 3H3FA 2Z2YA 5KINB 3SMVA 3SKVA 4O5AA 1KMHA 2CNKA 3WNBA 3T3DA 2FZEA 4LZZA 3H13A 1D1TA 3NAGA 5T41A 1WPXA 1FU7A 1KR2A 3KAQA 1E5LA 4CSAC 4EJFA 1XZAA 3OCXA 4U7FA 4TT3A 3L0SA 1JFFA 4B34A 4E1AA 1GPBA 3WIVA 1T8TA 1GAXA 5LDGA 4NE9A 1XNGA 1V74B 4HAIA 3VYSB 1VSUA 1KKUA 1T9DA 1CXZA 1BHSA 1XPJA 3OOWA 4LFBB 3PD0A 3AM3A 4JBIA 5FIUA 1KNQA 4XRGA 1X87A 2QZPA 5C5EA 2DG2A 1AURA 2VF5X 2GJ8A 2ZSHA 3LCMA 2QT9A 1T4DA 2XA1A 3KIPA 2HHAA 3LY7A 2PBFA 1DKNA 4OGWA 2P0NA 4PAWA 4B73A 4C7KA 3EVBA 4D02A 1E9BA 3D8TA 2CXXA 1TRKA 3OPYI 4IIEA 2R6AA 2QRVB 1YYJA 3I2YX 4RFLA 4JE9A 3W78A 1ORJA 4YAEA 3MK31 4UDVA 3WWOA 1KMMA 2XLBA 3OCZA 3HBNA 4LYFA 2E2WA 1Y3CE 1RRGA 2H3EA 3B1JA 2IA5A 3JR7A 1DIOB 3ND6A 4X1YB 3SZGA 2CKMA 1H4QA 2IIVA 3ABRB 5IJ0A 3UWDA 2QENA 4BV3A 5FUBA 2VDOB 3G2JA 3KB6A 2P7VA 1KE2A 2FMKA 1QF6A 4LZOA 1KYXA 3H5NA 3VHQA 5JADA 1SPXA 4EX6A 5BQ3A 4C9BA 5FADA 2F1OA 1M7HA 2WAAA 3B8HA 3ZWCA 3D6JA 3RYHA 4MICA 4PO1A 3TGWA 1U0LA 2FMXA 4P0PB 1D6MA 3B6EA 3H2VA 2ZRPA 2BTQA 2R25A 3OIYA 2YY6A 3RBAA 2X2FA 3AJ9A 4JELA 3M1LA 1C9DB 1BFDA 4QATA 3KFXA 4KKVA 3WGGA 4G86A 4TYNA 3CLUC 1VBNA 3KEQA 1QPUA 4UDXX 5CA1B 4TL8A 4BVHA 5JISA 2XEDA 4BB9A 2J9WA 4KWIA 4BNYA 4P6IC 2WU3A 3W2IA 1QGAA 1KAQA 1HTWA 3EUFA 5G53C 5HQTA 1ZFNA 4FGSA 3R8FA 2YNMA 1EFCA 3HYRA 4EG3A 3C43A 3FPGA 1RC8A 1Y34E 1G6HA 2OCAA 3I9V6 3PNYA 1LS6A 1G6OA 4DT1B 5AFSA 3AFOA 1DFGA 4D41A 4DIKA 2OGSA 3BIXA 3U3FA 2QSJA 3PA6A 4IFIA 1Q7GA 1MTOA 1EINA 3INGA 3NBQA 1DIGA 4JYCA 5B57C 5IM4A 4QAQA 2J9BA 3DOUA 1GV1A 2ACWA 1LV8A 1QHFA 4K1LA 3KX2A 2J07A 1E2IA 1FDVA 1C7QA 5DGIA 1GN8A 1P8JA 4HLCA 3ZU5A 2TECE 1DS6A 3BB3A 4YO7A 2I78A 1T0HB 1N9GA 4Z5XA 1W88B 4HZIA 1B0AA 2G4LA 4W5QA 3Q72A 3QUBA 2JCYA 4YX9A 1JAYA 2IIBA 2YFHA 5LU9A 3E0XA 4A0SA 1B0ZA 4BKUA 2VHZA 4ZYZA 1XTIA 3OOYA 3WG7C 1XT6A 5CT6A 4IDFA 5EKUA 5SYAA 3UXMA 4XJTA 3RQIA 1PWXA 3Q88A 4B48A 4DLRA 4LRWA 2G63A 4BTVA 4MVJH 5CBPA 4NHEA 4EPTA 1P3Y1 3B9QA 4DRHB 2GVDC 2GZRA 2ZBFA 3DBIA 3GXOA 3JSEO 3KJQA 3QE0A 1G1AA 4Z0TA 4EJSB 2JBHA 3JAMA 2JK0A 3R8CA 4OXXA 2IS6A 1ZEJA 4C0BA 5BRJA 2FP4A 1Z7Qc 5CEFA 2J3JA 3RRBA 1WCIB 3HP7A 3D6VA 3BZBA 5KNCA 1FSZA 1A0OA 1GDDA 4ROTA 1YR9A 4ENUA 4J0GA 2FUKA 3GOHA 4LXHA 2AZXA 1P5RA 1XK7A 3EQ8A 1CR2A 4QHYA 3IKLA 1NHWA 1Y9AA 2GBGA 2ECPA 3KJEA 3QPVA 4KTVE 3HSKA 3JZFA 5CVEA 3WLHA 4GSYA 2AV6A 1XQ9A 4LI0A 1CHNA 1DV1A 4B33A 3MVEA 5U4QA 3ONNA 4D9KA 3VR5D 1KDYA 4L6AA 2JKYA 3TZBA 3L82B 4LXXA 3RC3A 1GP2A 1Y3DE 3U7RA 1EAMA 2A1UB 2MINA 4MTOA 1IXRC 2XGMA 2JCGA 3LL4A 1KAEA 3NRCA 5BWCA 2W48A 2Y1DA 4D6YA 3EZIA 2H2IA 1SUCA 4BFTA 4I7EA 4Y9RA 4JLVA 1U8CB 1OH8A 2FQQA 3BEOA 5FOUA 1T4BA 1VMAA 1EP2B 4ENQA 3UJ8A 1GEEA 2WEKA 2XDAA 5AKKA 2ST1A 4DCSA 2EIMC 1X7GA 2OSBA 2K2QB 3DEHA 1A9ZA 3GIWA 3I45A 2O2JA 5CFOA 4DMUB 3AGPA 1KORA 3H97A 2XXAA 3HRKA 1U1FA 4X7MA 5DKFA 1OIVA 1FYXA 5JLIA 1RLIA 4Y1RB 1XELA 2Y9MB 1F17A 2NYVA 1E6CA 2VQDA 3BWEA 3HJHA 1QVAA 1PWEA 4MRSA 4C7OA 4MV8A 3HCWA 2IYZA 4MW5A 4PYLA 3RK0A 1UBGA 3USZA 3IPLA 3V7NA 5DK4A 3F9IA 3SSMA 3ADBA 1VKHA 3H6KA 4H15A 4RK1A 2I8BA 3GT3A 3H3JA 3QPUA 1M57C 2YV5A 3DI5A 4GYWA 4PHGA 5FPPA 5AVZA 1E6EA 2VHEA 3C7DB 3DYBA 1EG7A 5HXAA 1YVPA 5B1EA 4CU2A 4KQ2A 1VFPA 2CZGA 3L93A 2AG5A 2PT9A 1GG5A 1ZR4A 3O1HB 1YR8A 3KXLA 1BZ4A