4YT2A

Hmd ii from methanocaldococcus jannaschii
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
343
structure length
343
Chain Sequence
b'NMKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAKHGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMTLQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLKAEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLFEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(2)-forming methylenetetrahydromethanopterin dehydrogenase-
publication title Towards a functional identification of catalytically inactive [Fe]-hydrogenase paralogs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
total genus 124
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03201 HMD H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1300 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yt2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yt2A01
4E30A 4YJFA 3GNQA 4M86A 3ZWMA 1E7MA 1HE4A 3AM4A 3OICA 4XDYA 4L75A 1RM0A 1F12A 1ZK0A 1IHXA 3DXFA 4BO5A 3ZNNA 1I8TA 3ROPA 2GASA 3OIFA 3H9GA 4HKTA 4PVCA 2CVOA 1K5HA 3EVTA 1ZBQA 5AVOA 4M8SA 2BELA 4RCVA 1E7RA 2GN4A 1R6DA 1JKIA 3D3WB 3JQCA 4NPCA 3GGGA 5L51A 1HDXA 3F1LA 3I3OA 2X0IA 4OGWA 1H6AA 3ZZNA 2JD1A 4LSWA 5A3VA 2XF8A 2DPGA 1E1NA 2QYSA 3AWDA 1ZIDA 2YQ5A 3PZRA 5G4KB 4DREA 5DCWA 4U0JA 4AL4A 1UZLA 3NDJA 3RU7A 4CM6A 2EP7A 2HMVA 4PCVA 2D3TA 1U4OA 1GY8A 3SBOA 1RWBA 4J0FA 1GEGA 1AHHA 3WR5A 4OOEA 3P19A 1GYQA 1GYPA 2NACA 4GMFA 2YZ7A 1DJNA 2Q4BA 3BTSA 4YJHB 3STHA 2HKIA 1D7OA 3HB4X 1JAYA 2Q2QA 4NFSA 2GO1A 4RDHA 2HLPA 3SC4A 1QORA 4FFOA 1YXMA 4NMHA 1HYEA 3HFGA 4ZQFA 4YT5A 3Q0EA 3BTVA 3TQHA 3D4PA 5TC4A 4H16A 1C1XA 5L7WA 4ZQBA 3WIDA 2DAPA 2F1KA 3AFNA 5TJ9A 3CINA 2WD8A 4J7XA 3WBBA 4DMLA 2Y05A 1F0YA 5DBGA 3L9XA 3IS3A 3WFJA 3DZGA 1NASA 2EGGA 5JBIA 1UAYA 4Z3KA 1PR3A 3W1VA 2O2YA 4J43A 3HSKA 3BMOB 2HK7A 4I1IA 3I1JA 2X23A 5ITWA 4CMJA 4OSPA 2X0RA 3UAGA 4Y6RA 1HLDA 5G0UA 1I3LA 1SB9A 2PTGA 4HADA 3FPCA 1HE2A 3AOEA 3GVHA 3GGOA 4XR9A 5IN5A 4ZJUA 5CEEA 3GRPA 5L45A 1GD1O 1U3TA 2YDXA 2W2KA 3UCXA 1LU9A 1W73A 1YE3A 3TZQA 1GPDG 3GN1A 3U9LA 2GGSA 4P4NA 4E3ZA 4AJ2A 3PYMA 4WGGA 5KNLA 3GDOA 4GPD1 1RM4A 3DOJA 3PYXA 1FJHA 2OHXA 2ZIZA 5FEUA 2YFHA 2Z1MA 1ULUA 1BMDA 1VJTA 1I10A 1NPYA 4JGBA 3FR7A 3SLKA 2WD7A 2PKQO 2AXQA 4WKGA 1KVTA 1X13A 1I5RA 4CM3A 5A03A 1T26A 4AVYA 1U28A 1BRMA 1CEQA 3OJOA 5DP2A 2Q46A 4A27A 4BKPA 4BV9A 3D64A 2NU7A 1PGOA 3IP3A 1ZW1A 1ONNA 3RUEA 4EEXA 1JLLA 2I6TA 3MTJA 4MIOA 1TT7A 2OP1A 3GA0A 2XXJA 4FR5A 3ZH2A 4BGUA 1CYDA 1CJCA 2RHRA 1MG0A 1LJ8A 2C20A 1I2CA 2DUUA 3DDNA 5A9TA 3JQ8B 1B26A 2HAEA 2QG4A 2E37A 3W6ZA 4W99A 2CNBA 1LSJA 1NHWA 3IQDB 1NVMB 3KYDB 4PLHA 4W9NC 4BO6A 1F8GA 4TQGA 5I7EA 2W90A 3H65A 2W8ZA 2YQ4A 4DXHA 2V6BA 4J0EA 4QFDA 3DBRB 2RH8A 1U2DA 2PA3A 4WLVA 4ZVVA 3AJRA 4XA8A 4XJSA 3V1YA 4NDNE 2FMUA 3KLMX 1K2WA 3OJEA 4F6CA 3HDQA 4NNJA 4AJ1A 3ZHYA 5JYEA 4IDGA 4YAJA 3JQ7A 3TJRA 2X8LA 2JL1A 5U1PA 4ZD6A 3GH3A 5IF3A 4XGNA 3NV9A 3R0IA 5KJEA 3OECA 3TZ6A 3ZHZA 1IPEA 2Q4EA 3FWZA 4LISA 3RC1A 3BA1A 1DOHA 1G6KA 3D4OA 1ISGA 4DYDA 3PJFA 2X7HA 3RBXA 4DC1A 4IZHA 4D3FA 3GMSA 3HN2A 3ZWNA 4KUHA 3NKLA 4CLOB 2RCYA 1BTOA 4D0RA 1E92A 2OBNA 4FC7A 2CF6A 3WTBA 4RGBA 3I6IA 4LRTB 2VRBA 2R00A 3RUFA 1R15A 4PVDA 4UVDA 1P33A 3T4EA 3UH1A 2A92A 3ZDFA 1B0AA 4OKNA 1CQJA 4YJDA 5FI5A 2PZMA 3JQFC 3NTRA 1UZMA 2C5EA 3PFWO 5TNXA 3HDJA 4FFNA 1GYRA 3LF1A 4MVJD 1H5QA 3WYEA 1ENPA 4CQMD 5BQFA 1I2ZA 4TSKA 2B83A 1Y9AA 3LLVA 4MVJF 4K1LA 4B7XA 3LT1A 3WQSB 1ADBA 4RL6A 1LX6A 3QQPA 1S6YA 2IEBA 2Y99A 3ZV4A 4HP8A 5A9RA 1EFKA 5KJ1A 2FPGA 4UVGA 4K9DA 1T2AA 4WECA 3NGXA 2EF1A 1F14A 5EPOA 3DMYA 1N7HA 4CV0A 5HWSA 3NAQA 4UAGA 1UXHA 4LRSB 1SEVA 3CSDA 4K6CA 4J90A 3F5QA 3A4VA 1XGKA 3KEOA 3NT2A 4OQYA 3U0BA 1BXGA 1K6XA 3DBHB 3AUSA 2H63A 2PNFA 1UXIA 2PV7A 3ZWXA 1GU7A 3QWAA 4BO3A 3EYWA 2XOXA 3I6QA 1HE3A 4E13A 5C5IA 2X0NA 3W4JA 1GR0A 4TRJA 2BH9A 5T64A 4DA9A 5KIAA 4J1SA 1JKJA 4B3IA 2Y93A 4JP2A 3JQGA 3LQFA 3VPXA 4AJIA 2SCUA 5I7VA 2EHDA 5ICSA 2PKRA 5CP8A 1NAHA 3JQBC 3F47A 1V0JA 1LQUA 3K8ZA 2GPTA 4EUHA 3WJ7A 1V35A 5EESA 4ND2A 3O4RA 5I8WA 1DHRA 2DVMA 1DIRA 1YB5A 4BUCA 1YRLA 2IZZA 5BSEA 4O1MA 4TMFA 1GADO 3OP4A 1HT0A 5FWNA 2YW9A 1Z7EA 1U8XX 4C7KA 4OOFA 2O48X 2YFQA 3E9QA 4UVEA 3SVTA 4G81A 4C4OA 3KOUA 5BNIA 4CM7A 5AQ1A 4O0LA 4ONEA 2UV8A 4Z9XA 1O5IA 1ZEMA 2AA3A 4NG5A 1WMAA 3PJDA 4I5GA 1LDEA 5FI3A 1D8AA 4BVAA 1Q2XA 3QSGA 5CPBA 4CODB 1LBEA 2I99A 2V6FA 3IC5A 2IE0A 4A26A 2DTDA 3AFMA 5JC1A 3NRCA 4I8XA 2ZB4A 4BO1A 4ZQGA 4ALLA 3CKYA 1YBMA 1JDJA 1ID1A 2W4QA 4XYBA 4YT4A 4IXTA 2RIRA 2NU8A 1Z45A 1DDOA 2BFPA 5IAAA 1PS8A 3HUDA 2JD0A 3TSCA 4RVFA 1XU9A 2Q1WA 2YDYA 4K28A 4PGFA 3WFIA 5EIOA 3ZWWA 3KM0A 4CLXA 1V3VA 2O50A 4BGEA 2X6TA 3NEPX 2VOJA 3ZWCA 4GVXA 3VAZA 3W8DA 3FNFA 1PZHA 1T1RA 1KETA 2BI7A 5L4NA 1EE9A 4FQ8A 3KYCA 4HXYA 1Q0LA 1PX0A 4R54A 5U4QA 3E8XA 3UVEA 2D0IA 4ND1A 1UDBA 4FC6A 1Z73A 3PQFA 4GSLA 2AEFA 4MO2A 1LNQA 3OJFA 1OOEA 3AW9A 3UHAA 1Y8QA 4Z3DA 1LC3A 4IBOA 4KDEA 2IRWA 1C0LA 1PS0A 4LMPA 2JJYA 1IOLA 1DRWA 2O7SA 3AI3A 3AI1A 4CR6A 4CR7A 4FGSA 4CMEA 1A71A 4ND4A 1ZJYA 2NVUA 4GH5A 2FOIA 3G3EA 1K6JA 3QVWA 4GLLA 3OEWA 1VL0A 3I23A 1MG5A 1V3TA 4DVJA 4J91A 4RLHA 2PWZA 3O9ZA 3ORFA 3AM5A 3VPHA 4E2XA 3H3JA 5CG2A 4CUZA 5EQFA 2AQHA 3S2EA 3D4NA 2IODA 4NU6A 1DHTA 3RUDA 1X1EA 4AJPA 2NSDA 1E1MA 1NX6A 4FBGA 2G1UA 1MC5A 4TWRA 3TZHA 1BXZA 4BOYA 2NU6A 1PJSA 1Y1PA 4BHTA 1E7WA 2Y0CA 2JCYA 3IUPA 4CLRA 2PZKA 1N2SA 4J2OA 4OL9A 1ARZA 4RVDA 4JBIA 2X4GA 2J5RA 3WMXA 3WYCA 3PIIA 1ISFA 1AE1A 1YJQA 2AG8A 2D59A 1DFHA 2Y1CA 1E7YA 4GX2A 4HX5A 1WAMA 4MP8A 7ADHA 5JPIA 4FB5A 4UVIA 4QUKA 1KC1A 3H2SA 3HNPA 3QLJA 1A9YA 3VOSA 1EK5A 3CH6A 3CXRA 3DB2A 4CV2A 4E31A 1SAYA 3DOOA 2B4QA 5KJ6A 4ZICA 3FI9A 5KVCA 1OZAA 3DBLA 5B4VA 4P4LA 4MVJA 4LSMA 5JNLA 3D1LA 3DQPA 3SXPA 1ISIA 5TJHA 1EDOA 1HSZA 4TRRA 1PL6A 4XDZA 4NJMA 5H82A 4LVCA 5AXCA 3ZWAA 2EERA 4MVJE 3BAZA 3LLSA 1H9BA 4RPKA 1E5LA 2IEDA 1EUZA 3AOEC 2UVDA 2Y0DA 1E3WA 3FNGA 3INGA 1ZFNA 4FIZA 3PWZA 4IXWA 4WCDA 3JQ9A 4U6SA 2ZYGA 4ZRNA 3VKUA 4CMKA 1HE5A 4DIOA 3HG7A 4EW6A 3VVBA 3BTOA 3LYLA 3RKUA 3RC7A 1UDCA 4RV9A 1CRWG 3DBVO 3VZSA 4P4GA 3JYQA 1H2HA 4YCAA 1XA0A 2GZ3A 3GVIA 2EV9A 2I3AA 2NVWA 3RUCA 3F5SA 4DLLA 3B1JA 3F9IA 3AU8A 3QWIA 3BMQA 2FHSA 2FPPA 4IIUA 5TX7A 4PG5A 4Q3CA 5KKAA 1ZK1A 2ZB3A 3QVXA 4I9HA 1P1JA 3JTMA 3S8MA 3EC7A 2Q49A 1D3AA 1UP6A 4INAA 2PD6A 1EMDA 2CDCA 4BKUA 1N92A 3I9MA 3RCBA 3ZNQA 3DWFA 1QLJA 1BVUA 1A72A 3EZLA 2WWRA 4NZ9A 2P4QA 2EKLA 5JYDA 2YV1A 1VE9A 3OA0A 1CETA 3B1KA 2ZTLA 4A0SA 1YONA 1BHSA 1TVEA 3KSDO 1CERA 1D1SA 2B37A 1VPDA 4F6LA 3Q6IA 5BNTA 1GPJA 1KEUA 4YA6A 4XX0A 4FFMA 3ZWPA 4YT2A 2OFPA 3EDMA 3OETA 1ULSA 1A27A 3VH1A 4CM8B 1E77A 2B4RO 4YR9A 3RD5A 3FBGA 4YWJA 3PLRA 3TFQA 4ZGWA 1YDEA 3FF4A 4ZN6A 1FDWA 1UXGA 4N5MA 3WGOA 2GLXA 4HNHA 5AOVA 5A05A 4D79A 5I9LA 2NADA 4Z0TA 3GMDA 3F46A 2IXBA 1QMGA 3TDKA 1PL8A 2VHXA 5CDSA 1ZXLA 3BMCB 4KZPA 4QXMA 3PTZA 2GSDA 3DO5A 2I9PA 9LDTA 5C7LO 1ONPA 2ZK7A 3LZ6A 3RROA 3GEDA 3UCEA 2PLAA 3R1IA 3PJGA 4ZQHA 1SB8A 4CQLB 4ILKA 4MKXA 1HZJA 1C14A 2B5WA 3VDRA 5ENDA 1KY5A 4J6FA 2BKAA 4I9NA 3GFGA 3JQ6A 3E9NA 4WCFB 1S7CA 5JS6A 4L4RA 1OAAA 4R68A 3A06A 2WE7A 3KTDA 5JCXA 1N1GA 2GZ1A 3WTCA 1JTVA 4LCEA 4J9UE 2X0JA 2P5UA 3KSZO 4IQGA 4OIMA 1IUKA 3N74A 1YB4A 3T7EA 3DFUA 4OH1A 5EINA 4DIBA 2C2YA 4RJTA 3I9OA 3ANNA 2O3UA 4NR0A 1P9LA 4RLSA 2JAHA 2DQ4A 1TLTA 3L6EA 2R00C 2Z1NA 4N54A 4UULA 4B79A 1GL3A 4KP7A 4BNFA 4B4OA 3RFVA 1YH3A 4H3VA 4RPGA 4CJXA 5KVSA 4GAEA 3ICCA 5TQVA 4DLBA 1E3EA 4BNZA 1NVGA 1NFRA 4R5MA 1TA4A 3B1FA 1P31A 4J1NA 5ADHA 4GMGA 5HM8A 2DU8A 2FSSA 2GNAA 1EVZA 2AW5A 3IP1A 4PLYA 2X86A 5F5NA 5IDYA 3D3WA 1SPXA 2Y1DA 1UXJA 3H9JA 2NWQA 3HB5X 2QZZA 3LC2O 3OQ1A 3C85A 3H7AA 1I3KA 1SOVA 3GVXA 1JWAB 4CMGA 2V6GA 4F3YA 3H4VA 4HNGA 1I01A 3IDSA 4U0KA 5G4KA 1EDZA 2A4KA 4FJ2A 3LC7O 3M2TA 3PJEA 4IPTA 3ZV6A 1KYQA 1Y6JA 3DAPA 4JQCA 3PIDA 1O89A 2HMTA 3HN7A 1M75A 3UN1A 4JCOA 2NNLD 4J4HA 2NU9A 3E03A 1SO8A 1XLTA 4XQGA 2FZEA 1KERA 1HEUA 5B12A 3I4CA 3HHPA 1RM3A 1DB3A 3CZRA 4OO3A 1ENZA 1EVYA 3E1KA 3O8QB 4YACA 4YJHA 1HDYA 2FR8A 2OMEA 4Z6KA 3WGGA 3ANMA 1U3UA 2NV6A 1ZH8A 4PLZA 4E33A 1ISHA 1M6HA 1U7HA 4XYGA 5DOVA 3VZRA 3GNSA 4A10A 1XG5A 2ZQYA 3MJTA 5F5LA 1Y8RB 1ZEJA 3ZV3A 5ENVA 1EFLA 4R16A 2FR1A 1SBYA 2J5KA 2J5QA 1HL3A 1HYHA 2E48A 2X5KO 1DXYA 3TZCA 3W6UA 4FN4A 1LDYA 1MXHA 2BFOA 3JD1A 5DDIP 2VN8A 4A73A 2OZPA 3ROMA 1JW9B 4E4YA 2PZLA 4YYZA 5F1PA 1B8UA 3QW2A 2WE8A 3DMTA 4WK6A 1LSOA 2EWMA 3QVOA 3V5NA 3D5TA 5FYDA 4Y9DA 5G0SA 5TRTA 1J6UA 5JCJA 4WLNA 1T1SA 3BMOA 3DEYX 4BMSA 2VRCD 2X58A 1QYCA 4RF3A 2BGLA 3DTTA 4PLVA 5ILOA 4CLDA 5A06A 5HRUA 3OQBA 4U8GA 3ZN2A 4E5PA 4GLOA 3CEAA 3R6DA 5JSFA 1KVUA 1H94A 5IFLA 1B8VA 3K5PA 2OP0A 4L4XA 3RAJA 1P0FA 1C0KA 3DZIA 4PRLA 1C3VA 3VPGA 5H81A 4WLOA 3DAGA 1HKUA 3GF4A 4N7RA 4NIMA 5CPFA 1CWUA 1NQOA 1QLHA 3QV1A 2HQ1A 2CFCA 4WUVA 3V8BA 1LDGA 2QQ5A 1DPGA 5JDIA 5U9CA 4OJNA 4FS3A 1F8FA 2OXIA 1CQIA 4MINA 1PJQA 1WZIA 3UXYA 4UUPA 4HFJA 3MOIA 2FZWA 2X1HA 4ID9A 1JKFA 1IYZA 3C8MA 3NUGA 3DOCA 5L53A 3ZGYA 3AOGA 4TZTA 3EMKA 1NWHA 2HUNA 2DKNA 3C7AA 3OQ6A 3KETA 3V1UA 3BHMA 1YOVB 1BDBA 4UUNA 1PQUA 4E2YA 1YWGO 3T7CA 4DPKA 1DRVA 3GEMA 3ON5A 4ALKA 4NBUA 3WXBA 2BGKA 2NQ8A 1GUFA 3DTYA 4TVOA 4CPDA 4RVSA 1DIGA 1R12A 3SJ7A 1TB4A 3LDHA 4PIVA 4J9VA 1R4MB 3G1TA 3JQ8A 3OBBA 4EZBA 3VPFA 2UDPA 2EIHA 2JD2A 2Y1GA 1PIWA 3KYDA 3ZWBA 1HRDA 4G65A 1HDGO 4PLCA 3SJUA 5BR7A 3BHJA 5KTKA 3UOGA 4PZCA 2JFHA 2PH5A 4WEQA 4ALNA 4EEZA 1EVJA 3DBRA 4FFLA 1NWCA 5JO9A 4CMEC 1PZEA 3MOGA 1NPDA 2H6EA 4RO0A 3U62A 2YHIB 3PDJA 1PJCA 4BMVA 1DJQA 1E6UA 4JP3A 1PGQA 1I36A 4J16A 4AJNA 1R4NB 2CVQA 3KYBA 4AJ4A 4DBVO 3PQEA 4IQ8A 1VC2A 3ROQA 3U5TA 1LXCA 4ALMA 1P3DA 4DQVA 2Q45A 4XKJA 3TL2A 4GL4A 4BNVA 2EW2A 3FBTA 5AXAA 1EK6A 5H83A 3IOYA 4OXNA 3SEFA 1B16A 3GZNB 5DBFA 4QO8A 1Z82A 2AEMA 3VPSA 4CLOA 3Q11A 2AEJA 4L74A 4BNKA 3DFZA 3P2OA 4U7WA 1LRJA 2CDBA 5KVQA 2EKPA 3TOZA 1DLIA 1HDZA 1TXGA 1R0SA 5CAEA 4HWKA 4F46A 2ZCUA 3PHLA 4YTEA 2GERA 4R1NA 3GVPA 5JAZA 4BS9A 3O26A 3QWHA 1GV1A 4NJOA 1KY4A 4JIGA 1A4UA 5A9SB 1LI4A 1VI2A 4JK3A 1NFFA 2X9GA 3LC1O 4M54A 3TN7A 2ZTMA 3TNLA 2CD9A 1ZXBA 4Q3BA 4RF5A 4RVUA 4BB5A 1UH5A 4BO8A 4QFCA 2ILTA 1JVSA 1KS9A 3JCZA 4IM7A 5COQA 4XR4A 4RF4A 4RPJA 4ZU3A 4CMIB 4ZA2A 1A5ZA 3GAFA 4CLEA 3PHIA 2AQ8A 3MWDB 3O38A 1E1KA 5FFFA 2ZB8A 5JY6A 1UUFA 2Y1OA 3JQ9C 1QYWA 2HSDA 1P1KA 3AY3A 4BNXA 2BF7A 4XIJA 1X14A 3JD2A 4GKVA 4AJKA 4PG6A 1NQTA 4BNWA 3WB9A 1PZGA 2WYVA 5JY1A 1GFSA 3WG9A 4HFMA 1PL7A 3FSRA 2JHFA 3DBHA 3U3XA 2YYYA 4GX0A 5L4SA 3A14A 3RQSA 1WZEA 3BYZA 4GGPA 4XJTA 3NT5A 4PLTA 1I2BA 1ADCA 4GX5A 2OUIA 4S1VA 1LLQA 4NFYA 2AE2A 1IZ9A 5GZ6A 2E49A 3F1KA 3QVSA 3MCVA 3VH3A 1B8PA 2PKQP 1QRRA 1U8FO 1PU2A 1J5PA 1T2CA 5JAIA 4M1QA 4L8VA 4A03A 5T6BA 1FF9A 1QSGA 3FCOA 3JQEA 1E3LA 1Z7BA 2HJRA 3OA2A 1VJ1A 2I76A 4IMPA 2D4AA 3L77A 1EBFA 1E3JA 2ZJ1A 5F21A 6ADHA 4YAGA 1ENYA 3DHEA 4IMRA 3V2HA 4R1SA 2IXAA 4R1TA 2C7GA 5DZSA 3UCFA 2VCYA 4PRKA 2VRCA 3OIGA 1AGNA 3UW3A 4UVHA 4F45A 5CEJA 2B5VA 3L9WA 2NTNA 2Y66A 1K89A 3CTMA 4WOJA 4BO7A 4XD2A 1MXFA 2JCVA 3CMCO 3DZBA 3FRJA 8ADHA 1GUZA 1VM6A 2H1SA 2P9CA 5AYVA 3S2FA 5JDCA 1WDMA 1A7AA 5T8KA 1YO6A 3UGKA 4E12A 2JFFA 4KTVE 2QRJA 4G2NA 4MOWA 1Q7GA 4BNYA 5HBRA 4YT8A 4URFA 4U6QA 5BSHA 1DLJA 1LRKA 4B4VA 1UR5A 1U4SA 1WNTA 3DHNA 3H8VA 3JD4A 4XGKA 2DBRA 3ZWOA 1MA0A 4J49A 3VH2A 4I5DA 3C3XA 1I24A 4L76A 3WMWA 5G4LA 4TRMA 2NUAA 1VSVA 1YBVA 3WOHA 1X7HA 1XQ6A 2Z5LA 1N7GA 3DONA 1V8BA 4ESOA 2YUTA 1HWYA 1PTJA 5L7YA 4Y8VA 5CHEA 4D46A 4HBGA 2VZ0A 2LDXA 3IIEA 2UUPA 4BKRA 3RJ5A 3PHJA 4LVUA 3GEGA 4R9RA 3L07A 1MX3A 1AXGA 4GX1A 4N5LA 1MB4A 4N18A 1IHYA 4NK5A 3VDQA 3WNVA 4CM4B 2BHLA 4MDHA 1SCUA 2O3RA 3RI3A 1JU9A 1M67A 3D0OA 4UUMA 3ZNPA 4ND5A 3OHSX 1EE2A 2VTEA 4MIYA 3ZU3A 2C82A 5G0VA 5CFZA 4B3JA 1QV6A 1NAIA 1D1TA 2A9FA 1TT5B 2D1YA 1P1IA 4MVJM 5T5QA 2FPIA 3E82A 5EQDA 1C0IA 1C1DB 4N5NA 3I4FA 3L4BA 5IDQA 1A7KA 5A4DA 3HADA 1WVGA 3NJ4A 4E21A 1K3TA 4PG4A 3ST7A 3KSUA 2PH3A 5I7FA 1EEHA 4J7CA 1WWKA 1GAEO 2LDBA 2YY7A 3WLEA 1ZKMA 2FP4A 3K30A 4EDFA 3QWFA 2ZCVA 2OGUA 4AJHA 2C07A 4DLAA 4CMBA 5A04A 4YJGB 2P4HX 4KWHA 4TROA 1VKOA 2FRDA 4GVLA 1KOLA 2Q1TA 1O0SA 2VNSA 4B7CA 2NQTA 4OMUA 4OXYA 3KXDA 1P77A 4YDRA 2CVZA 1HSOA 2IZ1A 1RM5A 2PFGA 2BI8A 3K2BA 1T25A 3RIHA 4Y67A 1A9ZA 4D3DA 4GGOA 3PQDA 4AG3A 4D0SA 1ENOA 1NBOA 3D3EA 3EZYA 5C7IO 3PP8A 3I9LA 2VHWA 5HTOA 1CIVA 3R3JA 3VVCA 4TRNA 3KRTA 3NDRA 4DPMA 2O3JA 3BMNB 1FDSA 4CUKA 5KCZA 2VNAA 2GR9A 3AY7A 4JJIA 4WLFA 4FD3A 4CMAA 3VC7A 2FN7A 3GG9A 1LSUA 3PK0A 3JD0A 2Y68A 3FTPA 1R37A 3QP9A 1QYVA 3Q2KA 3U09A 1P1FA 1Q7CA 3JYPA 2X9NA 3PWSA 1M2WA 4CV1A 4I9UA 3HZZA 2GDZA 4E32A 1UAGA 1JN0A 1N5DA 3ZW9A 3VTFA 3OIDA 2NTJA 5DT9A 4DWVA 4IQ0A 2HJSA 4BV8A 5LDGA 1FMCA 1DRUA 1DFGA 4P8RA 5JCJD 2UAGA 1JVBA 5K9ZA 1GTMA 3OMLA 1DFIA 1PSDA 3F3SA 1PS9A 1Y5RA 4MP3A 4KWIA 3ONFA 4Y6SA 4YVFA 3WJAA 3E6AA 4AICA 2EEZA 2RH4A 1M6WA 3GFBA 4GWKA 3I5MA 3U4IA 4IJUA 5IXYA 5JDIC 1LLCA 1BWSA 5GZ1A 3ONEA 4FSHA 3RBZA 2POQX 3WSVA 2DBVO 3EHEA 3F4LA 2J8ZA 5BSGA 3VHRA 4KUEA 4QX6A 5THQA 3FHLA 3Q3CA 1U3VA 4C7JA 4FOOA 1J0XO 4QECA 2UYYA 3B20A 2X5JO 3LT2A 3D7LA 4JN6B 1C0PA 1G1AA 1N9GB 2BRUA 1ZCJA 4WEOA 3WGHA 3BTUA 4RPHA 3C1TA 2C2XA 4A5OA 2P91A 3IKVA 2J3HA 1V3UA 3ZHXA 2QZ9A 5A1TA 4MKRA 2VUUA 3H2ZA 4KOAA 3AM3A 1H2BA 3HJAA 5BT9A 5DF1A 1MLDA 1WP4A 4CQMB 1ZZEA 1BW9B 1IB6A 4EI2A 2WYUA 1LDBA 5L9AA 4BNMA 3AUAA 1DEHA 5CG1A 4A2CA 3LT4A 1PJ2A 4EGFA 3TZKA 5B37A 2PK3A 3G79A 4CM8A 4ZRMA 4OHUA 1ZSNA 5A5EA 2Y67A 1ML3A 4PLGA 2Q2VA 5JFOA 1X1TA 4NI5A 2VYND 1LRLA 1PGPA 3UF0A 4FOSA 3EUWA 2DPHA 1AN9A 1M76A 1GQYA 3BMCA 2O3QA 3ADOA 3GLQA 4RDIA 5K6AA 4H15A 2BFMA 1T2EA 5A5FA 1NR1A 2ZKLA 4YQYA 1LQTA 1DSSG 1E6EA 1PJ4A 3ITKA 3QHAA 1VRWA 3IL2A 4NBRA 1X0XA 2DC1A 4CQLA 5IJZA 2I3GA 1YQDA 1OC4A 5EERA 3NTQA 4LN1A 4LW8A 1XYGA 1FXSA 3FN4A 3KEQA 4K6FA 1BVRA 1YB1A 5G0WA 4WCFA 2E82A 4WJZA 4H7PA 3W4IA 1LDMA 5A3JA 1F06A 1PQPA 4XYLA 2Q99A 3JQBA 3PVZA 4PLPA 1R66A 1ZO8A 3M6IA 3CZMA 1EUDA 5B4TA 4JROA 1PJ3A 3DZJA 2G5CA 2GCGA 1JQBA 2GN8A 3ANLA 3JYNA 4YQZA 3S55A 1YL6A 1OBFO 2JCXA 1U7TA 1IL0A 3JYLA 3H6KA 3GUCA 2DFDA 2I5PO 4BNUA 5JW6A 4QSMA 1AUPA 4ALIA 2GN9A 2VWGA 4ZQEA 1VL8A 3PPIA 3S1LA 5JXWA 2GD1O 1N1EA 2P68A 5L40A 1IZ0A 2IDZA 4J7UA 1HZZA 3NDIA 1B14A 5DOZA 3MJSA 3QA9A 3ASUA 2CY0A 4BGIA 3OM9A 5ER6A 3W8EA 1B3BA 3K6JA 3NT4A 3OSUA 2WMDA 2ZYAA 4J4TA 4Z9FA 3JQAB 3I52A 3VZPA 2I67A 4P38A 3O03A 3GAZA 3COSA 4MVJP 2D5CA 2OL4A 1ZK3A 4NHEA 5T57A 3ICPA 1UXKA 3H9QA 1U5CA 2B35A 2HRBA 4CM9D 2VYVA 1DO8A 5I9NA 3DC2A 1OMOA 3X2EA 3V2UA 1X7DA 3INTA 2PD4A 2PY6A 4LMRA 4R41A 5HS6A 3JYOA 4R69A 3D5QA 3O8QA 4GKBA 1ZK4A 3GPIA 3GDGA 1JA9A 3HQ4O 4JBGA 4R4JA 4FW8A 4R3WA 1MGOA 2O4UX 4BQRA 1T4BA 2A94A 2HU2A 5MDHA 3ADPA 1U5AA 3VKVA 3V1TC 1XELA 5F1KA 3CUKA 1Y8RA 3FNHA 4XCVA 2QIOA 1SEPA 3GRKA 3MWEB 1Q7BA 2B4TO 2HMUA 2VTDA 3MJCA 1H6DA 5LDHA 5EN4A 1Q0HA 4L73A 3T4XA 1T24A 2YHUA 1QXSA 1L7DA 3I9NA 3WWYA 2GZ2A 3A1NA 1PR9A 1V6AA 3GDFA 3LU1A 3TOXA 3C24A 3EGOA 4BNHA 1KC3A 1V9LA 1TI7A 3GNTA 4W4TA 1ADGA 3RU9A 4RZIA 1CF2O 1GZ3A 5I9MA 4PN3A 3L6DA 3P2YA 5B4UA 5GMOA 1YBAA 1P74A 4KQWA 5JAQA 4GI2A 2R6JA 4I5FA 1H0KA 3CMMA 3FR8A 1Z75A 4YJFB 3AY6A 3RC9A 4WNCA 3MJVA 1LUAA 1LC0A 5EJ2A 2JHGA 1ZK2A 2G76A 4OAQA 1KEVA 1U2GA 2GF2A 1R0LA 3IJPA 1B15A 5JMWA 1E6WA 4O63O 1T2DA 3ENNA 3HDYA 1GZ6A 2YV3A 4MP6A 4PLFA 1I33A 2GN6A 4DL9A 2H9IA 2OORA 2D5AA 4Z0HO 1PJBA 2E6UX 5JDCC 5T8KC 3ENKA 3NYWA 4XQ9A 2I66A 4Z0PA 4CM1A 4PLWA 2EGHA 2EJVA 1PEDA 2QW8A 3H5AA 5HS4A 4ITUA 3EW7A 4IDDA 3MJ4A 3EK2A 5CDTA 5F1OA 3WSWA 1E7QA 2NM0A 4AFNA 1ZSVA 3B70A 1QYDA 5FF9A 3IJRA 2Y0EA 1E5QA 4YEDA 3OFSA 3CPSA 4I08A 4I5EA 1SOWA 2TMDA 4YB8A 3PZBA 5C3MA 1BG6A 2B0JA 2RHCA 5JAMA 4JNKA 3L0DA 3QWBA 3RSHA 4YPOA 3BIOA 1W6UA 1NM5A 2QYTA 2WEKA 1YOVA 3E5MA 2VUTA 3WGYA 1DIAA 1YVEI 3QRWA 4IJKA 3VZQA 1ISJA 4E5KA 4X54A 2PR2A 4BQPA 1I0ZA 3RASA 1G0NA 4LCJA 4OQZA 4BIIA 2WDZA 1GV0A 2BLLA 1NHGA 2HK8A 4QEDA 4DYVA 1R4MA 4NU5A 3K92A 2YV2A 1ZSYA 2FR0A 4GSKA 1KVSA 1Y81A 3GZ4A 4FCCA 4AJJA 1C1XB 2EKQA 3GT0A 2DBZA 3Q9NA 4XGIA 5IZCA 4D44A 1ORRA 2Q1SA 1E1LA 1KVRA 1R16A 1QYXA 3PGJA 4IDFA 4RQUA 4Q39A 5ER9A 3L4BC 4FFPA 3WGQA 3ZV5A 2ET6A 4U5QA 1WLYA 1XDWA 1KBZA 4RQTA 3RVDA 3TPCA 2VYNA 4M49A 1QKIA 1T2FA 1ZUD1 1IULA 2VWHA 3QIVA 2YHIA 3AUTA 1YL5A 3KVOA 1OI7A 1W8DA 1MC4A 1HXHA 3WNQA 3VH4A 1O9BA 3OH8A 5C37A 4OXKA 1UDAA 3RUIA 4UUOA 2V65A 1PQWA 1R4NA 2AG5A 4HUJA 1A4IA 2VOEA 4GQAA 3TF5A 4JJFA 1NYTA 4XZ3A 4EJMA 2J3JA 2W2KB 1GQ2A 2H5LA 3M1LA 4L4SA 1E0DA 2CSUA 1RYDA 3GN2A 2OO5A 2G17A 3I9KA 3KZVA 3SLGA 4E0BA 3NX4A 2C7VA 2HDHA 1E3SA 4NQZA 4TKLA 4EBFA 5GY7A 3WYBA 4QT0A 2P5YA 3K9QO 1IPFA 4W82A 2VZ8A 3GZNA 4KUGA 1XEAA 1I3NA 4GWGA 4II3A 3ZWVA 4BKQA 4DTIA 3U4DA 1I30A 5CDYA 4PFJA 1KEPA 3GUYA 2WD7B 3ZU5A 1I3MA 2W98A 1WPQA 5DCYA 2O2SA 2FSVA 3ONDA 1EVIA 1BSVA 2C54A 5MGBA 1U1IA 2BMAA 5JE8A 2PZJA 2X22A 2WYWA 5A9SA 5DBIA 1JWBB 2GRAA 4IY1A 4B8ZA 2W2LD 4E2WA 4B7UA 3I83A 5KWEA 5TT1A 3QVTA 5DCUA 5JMPA 4AJLA 1LEHA 1W0CA 4JBHA 1RPNA 1H6BA 2Q1UA 4CMIA 3HDHA 3INRA 1P44A 2ZATA 6LDHA 3RKRA 2VHVA 4Y6PA 1Z6ZA 4CLHA 4XQCA 4D41A 1NFQA 1LSSA 4FDAA 4CM9A 4WASA 2ZTVA 2C5AA 5TS3A 1JAXA 1XIVA 3EAGA 3JV7A 3E48A 1HYGA 3DR3A 1NPTO 4DQUA 1DIBA 3K73O 4OKIA 1H93A 5TIIA 1BXKA 2IZ0A 2C0CA 4FGWA 3BZUA 3JQ7B 3C1AA 3PEFA 3WICA 4EUEA 2PGDA 1M66A 1WW8A 3ETGA 4BO2A 4TZKA 3QE3A 4PG7A 3KBOA 1LTHR 4ROSA 5TSDA 3ZCXA 2HRZA 1XHLA 4S3MA 1DBVO 2E4AA 2G82A 2DUWA 4D7AA 1O95A 4HY3A 4JX8A 4D43A 2R2GA 1HLPA 4XRRA 5DNAA 3GK3A 3GQVA 4W7IA 1DIHA 4ALJA 5LCXA 3OF2A 3ASVA 4RVHA 1J49A 4XEHA 3ZU4A 2Q3EA 3DZHA 4PZEA 4YRAA 5JO0A 3EVNA 3KLPX 4WE3A 2QRKA 1XR3A 1QG6A 2O4CA 1DC5A 2FWMX 4NBTA 4ND3A 5KKCA 5TF4A 5ILGA 4XRGA 2FY8A 5C7OO 4BGVA 3E18A 2AQKA 5G0TA 2DLDA 2VQ3A 4YRBA 4W6ZA 4EITA 3N7UA 4FFRA 2CUKA 1BGVA 1PGNA 4J4BA 3ZU2A 2BFAA 4IS2A 3RJ9A 3E9MA 4E2ZA 2O7QA 3DZKA 3F4BA 4EJ6A 3PRJA 4QTZA 3ETDA 2Y1EA 3P7MA 1ZNQO 4JJGA 1YQXA 2WJPA 4YXFA 5IDWA 5L7TA 1SNYA 3Q1LA 3TWOA 4D42A 1P0CA 1VLLA 4MIEA 4RF2A 1P45A 4TKMA 9LDBA 2V7PA 1NTOA 1QP8A 3GG2A 1E7SA 5K6AC 4RVGA 1ZJZA 4EYEA 3WLFA 2I65A 3U4CA 1MUUA 1H6CA 2OBYA 3A28A 1KIFA 3ULKA 5I7SA 1DC6A 3GC6A 3OEYA 4MKZA 1HDCA 4P22A 3WX0A 2VUSA 3PDUA 4IZIA 1DAPA 3X2FA 1WMBA 2J3KA 1EQUA 4DQXA 3RUAA 4DPLA 3RFTA 3H9EO 1PZFA 4WCFC 5COBA 3IUSA 4IINA 4KDFA 4E5NA 4XB1A 4UEKA 1BXGB 1LA2A 1CDOA 5DULA 4R1UA 2B69A 4BL5A 3IAHA 2AQIA 4XQEA 4CM4A 3TL3A 2HCTA 1XKQA 2B36A 1Q0QA 3ZI0A 5BSFA 1SMKA 2DBQA 4BNNA 3UFXA 1DAOA 2JFGA 2ZJ0A 3JQGB 4M89A 1E3IA 1MP0A 3MTGA 4YAIA 4BKOA 1TT5A 1NVTA 4IS3A 3LVFO 3GR6A 2GYYA 1NR7A 4Z9YA 3TFOA 3DHYA 1C1DA 4NH4A 1VL6A 3G1UA 3C7DB 3G49A 2PD3A 1SC6A 2XPCA 3KB6A 1QV7A 4L0QA 1GQQA 1NQ5A 3P5SA 3KO8A 1F17A 4L9RA 1W4ZA 4E6PA 2HMSA 2EJWA 4IDBA 1U3WA 5TLSA 1H9AA 3JQAD 1ZMOA 4E5MA 4JLWA 2ZB7A 3CIFA 4XYMA 4B3HA 4LK3A 4II2A 4UREA 5JLAA 2QHXA 2DFVA 1UP4A 5G2OA 5DP1A 1R0KA 3PXXA 4QO7A 4YJGA 3RFXA 3WGZA 4IGFA 1FDTA 2BD0A 2WM3A 3OJ0A 4WLUA 1Y9EA 2ZTUA 4CM5A 2GUGA 3L4SO 5KJCA 5TGDA 3C7CB 3UUWA 3QJ5A 2HMWA 3AUUA 3B6ZA 3RUHA 4NFHA 1IY8A 3K2EA 4CV3A 4IUYA 3L6OO 4BNIA 1YGYA 4NBVA 1RKXA 2X5OA 3EY4A 4UEJA 3IKTA 4IDEA 3H5RA 2NVBA 2UUOA 4O5OA 3K96A 3WDSA 5ICMA 4YRDA 2VYVD 2VHZA 1XWFA 3AI2A 4BNGA 3GGPA 3DAFA 2P9EA 5IN4A 1QR6A 3RBVA 3BMNA 2QX7A 5J23A 4XIYA 1B3RA 2XAAA 3MZ0A 4EJ0A 3QY9A 4DBZA 1RJWA 4BO9A 4FJ1A 3U4HA 4CUJA 3WWZA 3M2PA 5IXSA 2WSBA 2W2LA 5CEFA 2EW8A 1NQAO 1PGJA 3KYCB 4HFNA 3ZWYA 3R3SA 1PJTA 4WLEA 1YS4A 1YL7A 4AJEA 4D3SA 2OOSA 5A02A 2JAPA 1KEWA 2EP5A 3C1OA 3PHGA 3OJLA 4DC0A 1BDMA 4B4WA 3Q2IA 3SX2A 4XYEA 3PI7A 2O3SA 1Y8QB 4B4UA 1Y5MA 4CMCA 5JC8A 1ONOA 1NP3A 3WQRA 3DMTC 4W9NA 2EXXA 1HDOA 5EMHA 2TMGA 5L4LA 1MFPA 4MVJH 2PGJA 4IIVA 3WQQA 3PLNA 4Q3NA 5GZ3A 1K0UA 5L95A 5CDUA 2NVUB 1LLUA 2DM6A 4M87A 1DC3A 2WTBA 3ROKA 4RORA 3PFFA 1X0VA 2AHRA 1ADFA 5LC1A 3JSAA 3ZNOA 1UJMA 4E5YA 5ITVA 1XQ1A 4R01A 3G0OA 5DN9A 1Q1NA 4M55A 1UZNA 3WBFA 4MPDA 4GBJA 3W8FA 4A7PA 2IYOA 3ZHBA 3GY0A 3KV3O 3GPDG 5IDXA 5AXDA 1GEEA 1RYEA 1FK8A 2XXBA 1ZMTA 4BMNA 4LGVA 5B1YA 3PYLA 5IG2A 4XB2A 4Q3DA 1N9GA 4WOKA 4CMHA 3BXXA 2VHYA 4DRYA 3FNEA 3PWKA 5COAA 1YKFA 5EL0A 4G5HA 3A9WA 2HK9A 4BB6A 4CLRB 4W7HA 4JXKA 4TVBA 1K6IA 5T67A 1O6ZA 4OYRA 5HA5A 1XU7A 1I32A 2AE1A 4OM8A 4QQRA 1MV8A 1YQGA 2D2IA 2VWPA 3H9UA 4WPGA 3VTZA 3WGTA 4CQMA 1BW9A 4J1TA 4BNLA 1PWZA 3AU9A 4J2HA 1OFGA 2QRLA 1AXEA 3GOHA 2G0TA 4J3FA 3F6YA 5IZCC 1O8CA 2DTEA 4KTTE 8LDHA 3JQFA 3GHYA 1GZ4A 3MJEA 4BNJA 3S2GA 4CR8A 4IGEA 4ZHSA 3DBLB 4DGSA 3LT0A 5KOIA 2VT3A 5THKA 5KVVA 3PGXA 2V6MA 4R5HA 2J3IA 2Q2WA 4KMSA 1TEHA 5ES3A 3H5NA 1EUCA 4NJMB 3NGLA 4J1QA 3N58A 5L3ZA 2CDAA 4XWYA 1E3WB 3M1AA 1HTBA 4R51A 2O3TA 2D8AA 5AXBA 3U49A 4RPLA 2Z95A 3LF2A 4OSOA 3KUXA 3JD3A 5I8ZA 4UEOA 5IZ4A 3UICA 4DMMA 3WGIA 2ZYDA 1YDWA 4O6VA 1P1RA 3V2GA 1KVQA 2IYPA 3H3FA 4IJVA 4BO4A 1HF3A 3BMQB 3IMFA 2NTVA 4NBWA 5CDGA 1WDKA 2F00A 4PZDA 4IDAA 3UKOA 4MJLA 1J4AA 2C29D 2CF5A 4D45A 4HV4A 3ITDA 4Q9NA 1X7GA 4BNTA 4FJ0A 4AJOA 3DZFA 1GCOA 3CE6A 4IJWA 4O59O 3SC6A 2RBEA 2Y1FA 2VZ9A 4WNIA 1ISMA 3FPLA 3RWBA 4IDCA 1U9JA 2C59A 1LDNA 2HO5A 1L1FA 4CL8A 4YAKA 1G0OA 2DTXA 4DIFA 1VSUA 3WS7A 3PHHA 1EZ4A 2VWQA 2J6IA 1UP7A 3E5RA 1GCUA 2PGLA 4YAEA 5K0ZA 1Z74A 3HWRA 4Q3AA 3JQDA 2VT2A 1X15A 3W4KA 2CMDA 3FWNA 3MEQA 5F3RA 3JQAA 1XSEA 1FDUA 3HE3A 1O94A 2ZQZA 4EUFA 1OC2A 1GUYA 1XCBA 3ABIA 1P1HA 1ZVMA 1D4FA 2X9VA 4NK4A 1YJ8A 3ETEA 1B2LA 2BGMA 1WXDA 3FD8A 1HETA 3LK7A 5BNFA 4Q3EA 1MFZA 4CL3A 1PJLA 3NJ8A 2AMFA 1SZJG 1T4DA 4R9SA 3KHUA 3ZW8A 1FDVA 4RZHA 2RAFA 4KQXA 5TT0A 2NLOA 4BO0A 1GDHA 3I9JA 2JKVA 3GHHA 4R3NA 7MDHA 2EG9A 3TRIA 5KJFA 4DUPA 1PWXA 3S2IA 2YJZA 1IE3A 4B8WA 2A35A 1LLDA 1B7GO 3FTNA 4K26A 3RC2A 1EBUA 4MVJI 2O23A 1EQ2A 1Y7TA 2P2SA 1HDRA 4Y98A 3GVCA 3G17A 1DC4A 3Q9UA 4YBZA 1NXQA 3WIEA 1WDLA 3HFSA 2Q50A 3LSYA 4MVJG 2P9GA 1L7EA 4PG8A 4FPXA 1NNUA 3NTOA 1N8KA 3BHIA 1AHIA 2CZCA 1VJ0A 3DL2A 2DT5A 4HFRA 3K31A 1VKNA 3AK4A
chains in the Genus database with same CATH superfamily
1G9TA 3OOWA 4IO1A 4EB6B 4OD0A 4S24A 2XVZA 3ANTA 4KE9A 3ZNNA 4YO7A 2CVOA 2A5GA 5HZHA 3EN0A 4CDGA 4K3VA 3JQCA 1ES9A 4TTRA 2DPGA 2QYSA 2LR0A 1FSFA 2DWCA 1U0RA 3C6QA 4PCVA 3SBOA 4Q5IA 3WE7A 3P19A 1E86A 2XMQA 4TLAA 4H7FA 3BTSA 2EQ5A 4EBBA 5AR1A 1MHTA 4ZEXA 1MAUA 3TEFA 4FFOA 1YXMA 4G0VA 4EJ2A 4X7PA 5CT9A 5B2ZA 4Q12A 4K46A 5C5CA 4Z3KA 5LQJA 5E3HA 4CMJA 2OZLB 4LNAA 1DC7A 2HV9A 4QD3A 4X6YA 5EIWA 3TRFA 4IHJB 1NUTA 1E6KA 2NGRA 8MHTA 4X61A 4E3ZA 3H0KA 2LXNA 2W2OA 1EXNA 4JT2A 5TEWA 5JI2E 2Z1MA 4S04A 3DUWA 1VJTA 5KYWA 4N48A 2AXQA 1X13A 1I5RA 5A03A 3LLUA 3HU2A 3P0HA 5F3WB 4X0EA 4JLMA 4LHWA 5AT1A 3SM3A 1ONNA 1IXRC 1C7RA 3K1AB 2IOQA 2AXNA 2QXTA 5BR8B 4O5AA 3HCCA 3AO0B 3N2KB 5H3LA 4I4NA 5H59A 2PZFA 5HQ3A 1GAWA 4C0HA 3SXKA 4QZVA 4OLBA 1URPA 2O9XA 3AEZA 1NVVR 3K32A 5JYEA 2GCOA 5ALYA 3NV9A 4LXIA 4XB6B 4RZUA 2Q5EA 2PWYA 2LFFA 2IDJA 2W2PA 3JASA 1WQ1R 1KJWA 3ZWNA 2ZVJA 1JECA 4FILA 2CF6A 5DHUA 3RUFA 1RXSA 1X1SA 4WJLA 3KZXA 3P0FA 1E5VA 3QFHA 4KN9S 1NV9A 4N9WA 1WXEA 2QM8A 4EG8A 1G7TA 1Q15A 2QI9F 4B7XA 4K1LA 3LT1A 2CFTA 4PZ9A 1CQWA 3S2UA 1GZDA 5AW2A 2D3WA 1JLHA 2XKBA 2C42A 2XI4A 4Y2GA 2IA5A 1XDUA 2B1RA 1WOYA 1EIWA 1USVA 2RHOA 3UJHA 3A4VA 1DO0A 4OQYA 4ABTA 3DBHB 1R64A 3D0KA 3HABA 2JEZA 1DX6A 3WK7A 3I6QA 3T5CA 1FB5A 1S2MA 3OEHA 2EZ8A 3FVRA 4KN6A 1FRFS 2PT7A 1UK9A 4Z8YA 2HKVA 5IAEA 5JTTA 1FTGA 4BUCA 3V32A 4XIIA 1HNWB 1E1QD 3NZEA 3PDHA 3L8YA 5KX5F 1HNZB 2H4FA 4FYPA 1N3BA 2BF4A 5ALZA 5TQ2A 4N41A 4NG5A 4R0NA 4U63A 5BVHB 1D8AA 1WMSA 1Y82A 3O9VA 4BECA 4MQ9F 5JAOA 3D8UA 2V7WA 5HKAA 4EQ6B 3FUVA 2WIAA 3HUEA 4EEKA 4EI7A 3VAYA 1YDHA 4TX1A 2DPYA 3BE4A 4J03A 1U7WA 2PGOA 4KV9A 3I76A 5C8DA 1ZINA 4UTPA 1SCUB 1M8GA 4KLRA 5I5GA 1OOEA 1YC2A 1GKYA 4GR5A 2VDOB 1UFOA 1IOLA 1D9XA 2J0UB 3HEAA 2AMVA 1XXHA 1S8NA 1OCZC 2DGJA 3G8AA 5AKJA 3TZBA 1RYMA 5I8PA 2AQHA 1VYKA 1JLRA 3QFCA 1WJGA 2YKGA 4DA0A 1ZNYA 3AOUA 1C3LA 1IIBA 3K1JA 4RVDA 4JBIA 3ADKA 1MW9X 3CZ5A 4HX5A 1IMOA 1QU2A 4QUKA 4DEYA 1KC1A 2IZ6A 4FS8A 3WHPA 3SU8A 4G86A 3P9QA 5KTRA 4KW7A 2VHCA 2XRMA 1TQHA 1BR2A 3TTUA 1PZMA 2R4TA 5D3MB 3TTTA 1E3WA 4CMKA 4O0MA 1VLZA 2VCCA 5T3WA 2GCIA 2VP5A 1Z4JA 3LPAA 1SVMA 1G8KA 1J42A 2EIKC 2RGXA 2FN8A 5KKAA 1R1DA 1T9GS 1Z7Qc 3ER9A 3TB6A 2CDCA 1N92A 2R25B 3U16A 1SHTX 3U7QB 4H4KC 3AF4A 2DYKA 3DNFA 4LERA 4JMPA 2JI7A 4LXYA 4WAUA 4HN2A 1V74B 2D06A 3PPYA 3EW9A 2OFPA 3EDMA 5AH0A 5JR3A 1BJRE 2AL7A 2L18A 2VHXA 4TL9A 5LWQA 3Q10A 2MU1A 5C7LO 2Z3VA 2WP0A 1JHMA 1YB7A 1T4CA 3F74A 1A0OA 4PANA 1YCHA 2BUBA 1IJBA 4J9UE 2FPKA 3QKSB 3T7EA 4TYQA 3ANNA 4RLSA 2Z5VA 4UULA 4NL4H 4CJXA 1T0IA 5REQB 4V38A 1S9DA 5CI8A 2CFIA 2Y8EA 3WBKA 5I01A 4MSUA 4CIXA 2Y1DA 2QVGA 3OQ1A 3V6LA 4JKOA 5DHTA 4JQCA 1BZ4A 5EHNA 3KKMA 4CCWA 3WA7A 3SMQA 3CZRA 1GGFA 3RQGA 3LQRA 3VYTB 4RGVA 5ARCA 3TKAA 3C5HA 3K4PA 2VJKA 2FDRA 2W2XA 3MJTA 5IJWA 1Y8RB 4CKEB 2VXYA 2E4YA 3EZ6A 1E1RA 1WOMA 2ZYVX 1MXHA 3HA2A 4HFKB 2C8VA 3CA8A 3ZE0B 4HVTA 2QE6A 3OEHD 2GVDC 2BGLA 3DTTA 4HWPA 3OPYI 2FWNA 3A9CA 3TLBA 2CFRA 1OAOC 5ALMA 4L02A 4GOOD 1E60A 3QV1A 1MMAA 3LGAA 4GECA 5IT4A 3T5DA 2AFVA 3M3HA 5CH5A 3NUGA 3DOCA 2LIGA 5DI9A 4ALKA 4M37A 2FI1A 2BJVA 2ZRDA 4H1WA 4AYWA 3IBGA 1YQTA 1GA6A 3PQ8A 2JGLA 3ICQB 2JD2A 3B9PA 2Y1GA 4J3NA 1HW1A 1PIWA 1MNQA 4HDCA 2JFHA 4WEQA 3ANXA 1JIXA 4DADA 2QGZA 1NWCA 4CWAA 4RO0A 2VPZA 2YHIB 5FJIA 2J9RA 4RADA 3QEBZ 1K0FA 2ACKA 2DQKA 3LLKA 1NF8A 3C3MA 3CN9A 4L5CA 3ZGXA 1N1MA 2EW2A 4X1KB 3SEFA 3GZNB 2VZEA 4CIAA 4N7JA 1TYAE 5E38A 1NDQA 5K3CA 4NYJR 4XQ0A 3SIPA 2GHTA 5EMKA 5CIQA 3QOWA 4C1BA 3PHLA 1VL2A 1TUEA 3ZCQA 1NFFA 2X9GA 1FOEB 3BB3A 1QG0A 2VH3A 3HL4A 5AW8A 4DTCA 1UUFA 2Q4DA 2Q3CA 4F8JA 1X14A 3JD2A 3ZTTA 1HRKA 1NQTA 1JTFA 1KZYC 1RAGA 5DLPA 5PNTA 2WMYA 3K0AB 4X9XA 4QLOA 3RQSA 1K1EA 4FX5A 4EGAA 4WFKA 2E49A 1B8PA 5TJ5E 3ZZUA 1OCEA 4DDKA 5T6BA 2NO7A 2JCSA 1IBLB 4EECA 1HE1C 2ZJ1A 5FWYA 4ZCRA 5L0HA 3O3MB 3G02A 3L9WA 3HO1A 1FVOA 1K89A 4HB4A 3AVWA 4UUQA 3SEOA 1UPXA 5ADVA 2WB4A 5T8KA 4G2NA 4MB0A 2GYWA 4HLDA 4PGHA 3HVHA 2F8MA 3N8IA 1WNTA 2DBRA 4PS1A 1M34E 1TM1E 4KFSA 1YBVA 1T0HB 5CJ2A 2XD4A 4AUMA 1A76A 4BVHA 2UUPA 2X5XA 4M1TA 7GPBA 3L07A 1MX3A 4DIKA 1EEXB 1G8YA 3EEQA 4YUWA 2MSCB 1FFTC 4PXSA 4IFTA 5J1SB 1OXUA 2VTEA 3LHDA 4FINA 4IFBA 1U9ZA 3K5WA 3B6JA 5EQDA 1C1DB 3TE7A 3DF9A 3ZQ4A 3T3EA 3D8NA 2JAUA 2WTAA 3KSUA 3U40A 3THYB 1GZSA 521PA 3ZTMA 2Q3MA 3OAAA 5B53A 3COVA 5A04A 4B3XA 2ANBA 2GLUA 1NOKA 2WVNA 5A4IS 4OY3A 5FPQA 2ZKIA 4U7JA 1CZLA 4GZ5A 2QY9A 4KQMA 1FMFA 1HQKA 4D3DA 1AKRA 2JFOA 3OZSA 1NBOA 1NUSA 5CM9C 2VHWA 1MT3A 4CMAA 4ZVRA 1YZAA 3DW1X 4WJ0A 5IYZA 2DR3A 4BJ6C 1QYVA 5KTNA 2WAYA 1FYDA 5JQGA 3CWQA 3VTFA 4BRZA 4YH1A 1XDZA 3SFTA 3CV3A 2F55A 2G9UA 5K9ZA 1W5AA 4Y6SA 4MWOA 3GFBA 4Q4CA 3LV8A 4NECA 3ONEA 4DG5A 2PCJA 1H9CA 4QECA 2R7XA 2O2JA 3FPHA 5JNRA 4BB0A 3GCWA 4WEOA 2Q0SA 3U9JA 2ZROA 5HTKA 1EX1A 1LDBA 4RD3A 4EGFA 1UJBA 1NJ6A 3G79A 1DWQA 5LOVF 4F6RA 3H11A 2P3SA 1USIA 5AICA 2YV4A 2OWDA 3HP1A 5KTSA 1XDSA 3DLCA 5EJIA 1SXJB 5K6AA 1NOIA 1O87A 1NRJB 1RWQA 1Q0KA 1AM4D 1YZVA 4TKZA 5THXA 3NBXX 5GJVC 3SNHA 1BVRA 1FTWA 3EA0A 3W4IA 3PXGA 4PLPA 4AWBA 1R66A 2UZIR 1ZO8A 3WYNA 1IZZA 2F8LA 1OBFO 1U7TA 4BY9E 3P8ZA 3E7DA 2Q7OE 1UBNA 4ZQEA 1O6BA 1T35A 1UBLS 4DWOA 5FUVA 1KP9A 4P54A 4BGIA 3OM9A 1RCPA 3OSUA 3U1VA 1F48A 4XWOA 3VR4H 3PC2A 1E2MA 2OAGA 3GLIB 1SCBA 2DQZA 3INTA 3ZGZA 5FAXA 1DAHA 1V95A 1Q3HA 1XA3A 3LKBA 4R69A 3NMJA 2GM4A 1M5UA 3K70D 4WADA 4ON9A 4YRTA 1T4BA 3JALA 2HMQA 4UE2A 2VEDA 2A94A 3MNFA 2AFIE 4NV1A 4UMVA 5JANA 4G0UA 1WCXA 3LUBA 3GDFA 4AG5A 3FTFA 1MRZA 3EVZA 4G23A 4RZIA 1CF2O 5JUAA 3CWCA 1Y7IA 3KUUA 2R6JA 2J4CA 1Z75A 1TD1A 4MITA 1LUAA 1NBHA 3UWOA 4H6PA 1U0JA 2HN9A 2PSJA 1P72A 1MBZA 2COUA 2W11A 3ENKA 1IN6A 5ALTA 1S0UA 2I66A 3WYFA 1PEDA 3H5AA 4M0MA 1E58A 1C4KA 3FMIA 2OHHA 1BIFA 1I1QB 4YPFA 4FEGA 1GARA 3QUAA 1H3FA 4JNKA 2QRZA 3ESXA 1Y4AE 5EIHA 4PQEA 3PA8A 4AN1A 1Z2CA 2QE7D 3FXHA 1R4MA 4FP9A 4F5DA 1Y81A 4L08A 1T36B 3M9XA 1XC7A 5CNJA 1GRQA 3V4OA 1T9BA 4O4IA 5DLDA 1LI5A 2VYNA 5DHFA 5JISA 3JSZA 4ZJYA 5IT9A 3QIVA 3ZJYA 4FYWA 3RUIA 1R4NA 1SIOA 5LJIA 1YU9A 3AHCA 5JAHA 3M1LA 5BWBA 4LZJA 6GPBA 3R75A 2O2XA 4MRPA 4LRWA 4QT0A 1QANA 3HM2A 1IPFA 2PMKA 1XEAA 5BV8A 3OAAD 1M1YB 1I30A 5C8YF 1DCTA 4IQFA 3DV0A 4TXNA 2FSVA 1EVIA 4AWXA 3ER8A 2Y1LA 4QG3A 3IEMA 3E7FA 5A9SA 4NYMQ 4E2WA 4Y2RA 4B7UA 2PYZA 1G5ZA 1K7CA 3EOAI 1ZJ5A 1FNDA 3G23A 3RWMB 4YUYA 1CK4A 4BLVA 2QDXA 4LWOA 4XQCA 1N6OA 2YIMA 2C77A 4CFSA 2ZU0C 3WZLA 3JQ7B 4TZKA 2O59A 5TSDA 2C2MA 4PPYA 2C3OA 5LCXA 4KLNA 3D8TA 1KSFX 5E2AA 2R03A 4NBTA 4KQHA 3U0CA 2R5WA 3N7UA 2XDAA 2QTVA 2NO9A 1EFPB 3SQDA 4EJ6A 3ASOC 4M8IA 1ZL0A 4RF2A 3OQHA 3DB1A 1AKTA 4QNNA 5FX2A 3K09C 4L8FA 1ZI6A 3E3NA 1DCFA 3MCTA 2Y1KA 2ANCA 5ULLA 4HAYA 2J3KA 2OYRA 4HGZA 1Q92A 4IINA 2HR1A 3NHBA 2RAUA 4UEKA 3QUTA 3RYIA 5L3SB 1JQ3A 3ZI0A 5BSFA 4Q9AA 2GVZC 1GDDA 4PWZA 2JFGA 3R40A 5SV2A 2W43A 1TT5A 1NMSA 5AIAA 1RHMA 3UANA 2YWRA 1AKNA 4ZVTA 3CRNA 3N2YA 3IMCA 2IWHA 1HFKA 4QO7A 5IJ0A 2OXRA 3W2WA 3FVVA 3WDSA 2RI6A 1A41A 5EZQA 4IRMA 5AD1A 3CNOA 4R9VA 3BWEA 5K3EA 3IQTA 2QD1A 4Y1RB 2OV1A 4B84A 4MYCA 1Y3DE 3EQ2A 3HKDA 4ZOBA 2O06A 3H1PA 3OTWA 1Z39A 2LCQA 1YUNA 4O6NA 4HTFB 1PJ8A 1UJMA 1PFUA 3IEIA 3T9EA 1XQ1A 1X7XB 1Q1NA 1JHRA 3NCHA 2VHTA 4BMNA 3HM9A 1R88A 1AQYA 2VHYA 4JXKA 4PYOA 1XU7A 5A4KA 3VTZA 1WUYA 3D0QA 4YI3A 1PWZA 4BLQA 4UU0A 3BFVA 4ESHA 1KYYA 4KXVA 1ZD3A 4KTTE 1MNDA 4EY7A 5DPMA 3H2BA 3D6VA 5FUXA 3M81A 3MM4A 3AIKA 2R7AA 2HCFA 2OWEA 2D8AA 3RIGA 3DF7A 3URKA 1FR0A 4P33A 2FE4A 2H3HA 3IAUA 2A0BA 2ZZKA 1Q20A 1R0WA 3P9SA 4F1JA 5FT9A 2YFKA 3V97A 4BO4A 5CTAA 3BMQB 3LBAA 1F6BA 3KQOA 5I48A 1NL3A 3BJRA 2XJ4A 5EKSA 3G68A 3SC6A 2OTCA 5L3RA 4PO9A 2B1JA 5CA0A 3QKSA 5U4XA 4R83A 3DEHA 3DTNA 2P1AA 2J41A 1FP7A 2ZQZA 2GPNA 1XCBA 2IBSA 2MIIA 1ZIOA 2X9VA 5KOJB 4CL3A 1PJLA 4NYJQ 3H1AA 1SZJG 1KBOA 3STYA 3QK7A 3WL3A 3DL4A 1PWXA 4DIDA 1O95C 4NHOA 1AJEA 4M8KA 3T3IA 2B82A 4J0QA 3CXUA 1RXWA 4F56A 2PL9A 5DFAA 1G9SA 1I8TA 1D2HA 4JVOA 1ORYA 3G5AA 4RJJA 4RCVA 4O4LB 3IILA 2HS5A 1F8YA 1VHQA 2Z43A 4HR7A 2YQ5A 1BX1A 4R2KA 1UZLA 2PL1A 4D6XA 4Q03A 2D62A 2NU9B 1TJ3A 4I7EA 3EASA 1NLXA 5HZKA 4HNAB 4GYJA 1BKDR 3K8YA 1DAIA 4S2UA 2XQJA 1TC2A 4EGCB 1EJ6A 1JE0A 2X19A 2HLPA 2B8JA 4NMHA 1F3LA 2MOKA 2ZBEA 5CLJA 4LQDA 5DBGA 4DWJA 1NASA 2IHTA 1Q77A 3SDSA 3QFTA 3WOVA 3TCKA 3PB3A 3FFAA 1E1CA 3LM8A 3OLVA 3FMSA 2X0RA 3TI7A 2GAAA 5EEHA 3O4JA 2FHPA 5IN5A 3GRPA 3Q12A 3PHCA 4ER6A 1C2TA 1TAGA 5ICFA 4URZR 1H5UA 2O57A 2PS9A 2QN2A 3CYFA 2SBTA 2OESA 3OCCA 2CHGA 4Y7DA 1XKXA 2ZIZA 5J4YA 1NPYA 3CUWA 3HV2A 3UPDA 2GYVA 2IYFA 1ICIA 1P39A 2REQB 4MX8A 1NT4A 3V8VA 2CXRA 2DUNA 2R7WA 3T1QA 3LLIA 1PGOA 3KTFA 1QAMA 2QRMA 3H05A 2WL8A 3ZH2A 4D92A 5EJ9A 2QNRA 1OI4A 2C20A 2DUUA 3O8OB 5KREA 5A9TA 3JQ8B 4KE8A 3NALA 2CNBA 1F8GA 3DE0X 2YQ4A 5JLIA 4A8JC 1N5KA 3O83A 2JJ1A 4COOA 2OQ2A 1K2WA 3E2PA 2A7QA 2P75A 1JFFA 1K2VN 4ZK2A 1A95A 2NSYA 1QRUA 3F6EX 1IPEA 4ENWA 2Q4EA 1ZUIA 3RC1A 4PSDA 2ACVA 2X7HA 3ED5A 4KUHA 1QGUA 4CLOB 4AN0A 2NTEA 1E2NA 3KTAB 2WF5A 5IK2A 4RGBA 5DNVA 1U7ZA 2HRCA 2ZE6A 2P0NA 3ZDFA 1V9CA 4MW4A 1RQXA 3AV0B 2PQ0A 3NTRA 3HDJA 2BDUA 4L5YA 2W2TA 5EIBD 3R2JA 4RL6A 2QORA 2Y99A 1EFKA 4JASB 1O8BA 5TXGA 5EP2A 3KCQA 4OK3A 1F14A 8ABPA 3MXTA 1MKYA 1PNOA 3DFFA 5CJJA 1MHPA 4G6ZA 4EB3A 1WQ4A 1BDJB 5IVDA 1SF8A 4PHHA 2PNFA 3EYWA 4C05A 1Z15A 4ER9A 1JSXA 4YRSA 3JQGA 5ICSA 3HJTA 3UK1A 4EWCA 3O4RA 4Q4DA 1YR8A 1QG4A 4KFUA 2IV3A 3OX3A 1TVCA 4LTNA 5COFA 2ZSKA 1IBCA 5MFZA 2J32A 2R7NA 1Z83A 3G9TA 2JFWA 3RS0A 3AFMA 3TUZC 5AVQA 2LPMA 3C6ZA 4MLZA 1YBMA 4D5EA 1JDJA 1PR4A 4XYBA 4YT4A 2HWYA 4G5OA 2RIRA 4YRRA 1XU9A 3EZ9A 2PX5A 5H02A 3QZUA 4MW2A 4DQDA 3US6A 4C4ZA 3IBFA 5I7AA 1YMQA 3TE6A 4IBOA 2V3CC 2IRWA 4JYMA 5EJEA 1LY1A 3RNLA 2HH9A 3U1TA 2XNJA 4F8EA 1QPUA 3KXPA 1FZQA 4J91A 3CT6A 4RA6A 3S2EA 1JEQB 3X1ZA 4OHCA 5AI0A 2IK8A 2RSEB 4OQNA 4HD8A 1ARZA 2CL6X 2A3NA 1U4NA 3PIIA 1TGYA 2D59A 3WQBA 2H07A 1RHUA 3VOSA 4JODA 1Z5ZA 1NYRA 4UTOA 2ZRIA 3L3BA 3A2NA 2ISSD 4XUEA 2XECA 4RBNA 3VPBA 5AVKA 1CS0B 4J2TA 1EDOA 3IP6A 3N2LA 1NF3A 4NWIA 4Z2YA 1JAZA 3LUAA 2UVDA 1ZFNA 1A5AB 4WCDA 4AY6A 3HNIA 1DBWA 4EW6A 4PINA 3RSZA 1CRWG 3QTLA 5JCZA 3OT5A 5AJZA 3AEYA 3VV2A 2GZ3A 3GVIA 4N06A 1Q21A 2FHSA 4LXTA 3WNZA 1CF9A 4IIUA 2ZB3A 1MW8X 3WK4A 1D3AA 5LMNB 1CZHA 1A8SA 1E20A 1L3BA 3U3DA 1QLJA 4DQKA 3OU2A 1CY0A 3EEYA 3OZDA 1VPLA 2YV1A 1VE9A 1JQEA 2WG1A 2L42A 3DYVA 1BHSA 4WZAE 4B7AA 5KB3A 1Z33A 2WZQA 5INTA 1ECJA 2CUNA 1YNOA 1GWNA 4DCSA 1P0MA 1FBTA 3VH1A 1ZRNA 2B1IA 4YR9A 2BZGA 1LNZA 1GTSA 3D1JA 2IXPA 3DHVA 1LW7A 3ENVA 1NJ1A 1WCWA 4MYTA 9LDTA 4Z53A 2GRUA 3VHQA 3N8DA 4WK4B 1CUBA 3PJGA 3KUDA 2R1VB 3VDRA 4AROA 2VSQA 2JJ1D 4I9NA 2MR6A 2HRRA 4IO0A 2H11A 3PBKA 1JI0A 2WE7A 1RJGA 1NE7A 2FXIA 1L7CA 1ZCAA 1E2QA 1OY1A 4IQGA 1X92A 4IJ6A 3LQ2A 2C2YA 4PCLA 2C04A 3FFBA 4W5NA 4H0NA 4RJ2A 5IDYA 5K0LA 3C45A 1I3KA 1SOVA 3H4VA 3GJYA 1EDZA 3PUXA 3PJEA 2C92A 1OLXB 4MVXA 2JIPA 1HEUA 2OGTA 4B45A 2E1RA 2FR8A 1XNJA 4UHHA 3O6XA 1OLSA 3WGGA 1Z2OX 1YAHA 3CW9A 3Q9LA 4EA8A 1S96A 3ZV3A 5K3FA 1SBYA 3TH5A 3MIIA 1U0OC 2PX2A 4Y2YA 2G80A 4W5QA 5JNUA 5TRTA 3Q1KA 5JCJA 4O2RA 2GFQA 1UK7A 2X58A 3I34X 3Q5DA 1L7BA 4PLVA 3TW4A 5JVDB 3OQBA 2RGDA 1PUIA 1B8VA 3IT0A 2J9ZB 3QEJA 1QLHA 1K7YA 4M6WA 4EB0A 3E4CA 1GAXA 1QRDA 1MO5A 4X8HA 4JY7A 2N1BA 2V7EA 1JKFA 4JC8A 5LQDA 1KWGA 4UARA 1IAVA 3NHWA 1Z68A 3KETA 3IXQA 3K0HA 1OW6A 1K75A 4NBUA 1J0CA 1SCIA 3BWBA 1YTLA 3G59A 1JHXA 3TVDA 1XTKA 3NRHA 1YBHA 9GPBA 2VJMA 2PX3A 2PS3A 5CCBA 1BYUA 1YMUA 1TK2A 3ZWBA 3SJUA 1JDUA 3UQYS 2E2WA 1KZ4A 1XRLA 2IYQA 1PV3A 1O6FA 3NHFA 1NPDA 2H1LA 1PJCA 3QELA 3CPJB 1L3IA 4L7VA 1ZHWA 3JAWA 6NULA 4W5WA 2OKCA 4PZ0A 1G66A 4OP3A 4BFLA 3R74A 2QAGB 4W9RA 3Q8MA 1I0IA 3GFQA 1TXGA 3L06A 3FTCA 3TOCA 3CLHA 1PVVA 2ZTMA 4BB5A 5DHQA 4LOIA 4IFEA 2QDKA 2PRKA 4K87A 3PTLA 5GM1A 4RF4A 3DVQX 3QLUC 1EFPA 4LXHA 4NCNA 5EJGA 4YLGA 1K3UB 1JI3A 3PHBE 1PL7A 3V34A 3KZNA 2IYUA 3TEMA 2XTMA 4EP1A 4GGPA 2H51A 4C4PA 2I6GA 4FE4A 3MCVA 3VH3A 1V54C 5AJHA 2UYOA 1L5OA 1KFKB 1NSTA 3E3AA 5E6UA 1DBIA 3L77A 4V0QA 2ZJ4A 2GTPA 4F4UA 1N78A 4KRFA 3T1YB 4BO7A 4I1MA 4F3KA 1XT6A 3K0CC 4UE3S 3EG5A 3G7UA 1WDMA 5K4AA 1V55C 2G5PA 5D3KA 3U80A 1Z2AA 4KXLA 2BP7B 3OTOB 4K9QA 1RI5A 5FUBA 3ROFA 4PZUA 5HQJA 1I24A 4AMVA 5G4LA 1KO8A 1YYJA 4JI1B 1JEOA 5I9IA 1OXMA 1NXPA 4LE2A 1V8BA 1KO4A 5L7YA 1PTJA 5CHEA 2WM2A 3IIEA 4LVUA 1AXGA 2YW2A 3B3JA 3S44A 3GLGE 1U31A 3SJZA 3MX3A 3I42A 4B3JA 4PYNA 2ZS9A 3C6XA 4ZVMA 3OF5A 5E1BA 4QWMA 4WGYA 3HY4A 3R6GA 4ENTA 1QIEA 3I1YA 2YJTD 1WCIB 4EDFA 1OU0A 4RY8A 1G2IA 3R7DA 2IUFA 1IIRA 3HCNA 1OUMA 4MRNA 1O0SA 2R7KA 5J58A 1H65A 3EIXA 3SHFA 4C89A 4D9CA 4Y67A 2GEDA 4GICA 4AKSA 3KE8A 3EBOA 4H3KB 4DPMA 1MVNA 2PUBA 4A6PA 4JJIA 4F4FA 4F93B 1NMYA 1FNSA 5J4HA 5L3QA 2X9NA 5JJBA 2XVMA 1SKBA 4ZGGA 3C3PA 4G24A 1TO1E 3UB2A 5CT6A 4C7XA 2NTJA 5JCJD 1DFIA 1PSDA 3N9IA 2H2IA 4GWKA 3U4IA 5JDIC 1FFXB 1DQPA 2IPXA 3HNKA 1EJBA 4KUEA 3QG1A 1U3VA 3R44A 4JI5B 5FBWB 4RTQA 3KQUA 3B20A 3BEHA 1G1AA 5FUMA 3BTUA 2E5FA 1MMNA 3UMVA 4EHPA 4O1IA 2VUUA 4KOAA 4LJRA 4CEHB 1IB6A 5JARA 2IHJA 1SC1A 1GTG1 2TMYA 4EYOA 1VMKA 2J3LA 2G9QA 2V03A 3WLOA 2Q2VA 2PDAA 4LZLA 3N5KA 5CBKA 4U7FA 5SYAA 3E9ZA 2BKLA 3H75A 2BFMA 1V7PC 4J16C 4G2TA 1MAVA 3RJTA 3D7SA 1I7PA 3W8RA 4NOJA 5FBZA 5KWVA 1LDMA 4LDKA 1G60A 1PQPA 1Z47A 4RHCA 3ZKWA 5DM0A 1SVNA 2CL5A 3CKMA 4JX9A 5KX5B 1KI3A 3P32A 1AUPA 2CJWA 2FX5A 3KV1A 4HDNA 2WIKA 5JXWA 3GRRA 3OE5A 4HS9A 1IZ0A 5FR2A 4URXR 2M2IA 1YZYA 4PZYA 3FHTA 4TMKA 3U3OA 4AUNA 4XXHA 2QF7A 3S27A 4J4TA 1SCQA 3AP2A 3ZY6A 4IG9A 2G71A 4XWWA 3ICPA 3HP4A 3WZ2A 1TUBB 1UINA 2CMGA 3X2EA 4L6RA 4MW8A 1YJXA 2FUCA 1USKA 3GPIA 3QLVA 3I5AA 2VTKA 3GRAA 3ADPA 1G3MA 5F1KA 4MKHA 1NNEA 4PU0A 3GD7A 3KB1A 2FPLA 3HYRA 3I9NA 1EK0A 1TI7A 2PFSA 5IW8A 1TKNA 2ZANA 4OAQA 2X41A 1KDVA 3M89A 3CR7A 1XTBA 3K0FB 3NNDA 4ZAGA 4YRNA 2Y2VA 2E6UX 1G8MA 4IKOA 4Z0PA 4ZQCB 1H4SA 5DX1A 3TFWA 4AFNA 1ZSVA 3UJDA 2DQSA 3N5CA 1HT1E 5CTJA 3PZBA 5I5EA 1IN5A 4KAAA 1W6UA 1NM5A 2YASA 3KP1A 1ECPA 1GPUA 1JG2A 3K92A 1KVSA 5CA1F 5KYGA 4IWXA 5AHWA 1R16A 2CLHB 2OAP1 4RQUA 4WBNF 2VWHA 3O8OA 1M0TA 2OBMA 5DLEA 3RYFA 4S0XA 1BS9A 2J3JA 5AKGA 1ZHYA 3KZVA 3PSHA 4ND7A 3WSTA 1O54A 4MS3A 4NQZA 4JZYA 4G56A 4NCBA 1ST6A 3ZIAD 2GBLA 1J24A 1RRPA 2H00A 3CJTA 3H1BA 1KEPA 2CXPA 2GESA 1EK2A 5JJLA 3WWDA 4AKHA 4QEKA 2C54A 1ZUNB 1M2VA 2WYWA 1L5ZA 3IV7A 1M74A 3V4PB 1N0VC 1FFSA 5G1OA 2XY4A 3LQKA 2JIBA 2R4QA 1BMFA 3GT3A 4PE5B 1G8FA 1KQOA 2AB0A 2V8BA 4I1YA 1JDZA 1TMOA 1DEAA 3OOYA 5FOQA 4YDSA 3KBOA 1LTHR 1ODFA 3KLOA 2W0MA 1OZHA 4PNHA 5KZMB 3K9BA 5IUKC 3ZU4A 4YRAA 2HJGA 3QV2A 3SFZA 5TF4A 4K88A 5EHXA 4AG6A 3RSOA 3VPCA 1WB9A 2Y1EA 5L7TA 1G21A 2I8AA 3FHJA 3LCRA 3I5PA 3GG2A 2W58A 3CE9A 3VU9A 1ELOA 1X77A 3S5UA 2YC4C 4UQPA 3WX0A 1EQUA 4DQXA 4G9EA 4DPLA 3RFTA 4TTSA 5AM5A 3THOA 3UJPA 4MV5A 3AKCA 3TD2A 3UGQA 1NVBA 3P9PA 5SZIA 2C95A 4BNNA 2O54A 3KS9A 1NE2A 4DR2B 1UK6A 5IARA 3DHYA 2J0XA 1KK3A 5A0TA 1HZZC 3EY9A 2AR9A 5KAPA 4P4TA 2BMFA 3RS4A 3U2MA 5TLSA 1D6SA 4OMDA 4QUEA 4XYMA 3PPVA 1PFWA 3RFXA 3WGZA 1V96A 3FUWA 4HAIA 1U0LA 3G2IA 3AUUA 4NFHA 3K2EA 3SKYA 3C6KA 3H5RA 3DLBA 3HCOA 1GGKA 3A6GA 5L0CA 3S29A 2D7CA 5KYYB 1SU8A 4XIYA 3JVDA 3V7UA 4YV2A 4FJ1A 3WWZA 1GLNA 1T0UA 4DB4A 5CEFA 1I1NA 1PGJA 1WMDA 3VNQA 3KYCB 4AJEA 4D3SA 1UM9B 4RY9A 1BDMA 3AF3A 3Q2IA 4HOYA 5IASA 3CLRC 1MX1A 1LE4A 1UOEA 3C7KA 3UMIA 3L0IB 4NYMR 3K33A 2WIGA 2VR1A 2ZVPX 2PL5A 3DAYA 2YWJA 3E8SA 2V6IA 1QKKA 4C22A 2NVUB 2G07A 3N7AA 1Z8NA 4F3NA 1BHJA 4HUTA 3ZHBA 2I2CA 1OYOA 5NULA 3MJRA 1GEEA 3D8HA 3OU6A 4Q3DA 2QW0X 2J09A 1C8VB 1VE5A 1FNNA 3BXXA 2F9MA 2QP9X 3PWKA 4BBZA 3HVKA 2PZ8A 3HU3A 1NA5A 4W7HA 1N6KA 2ZIVB 5J2UA 4QQRA 3AB3A 5DM70 2N9UA 1OFUA 3B3AA 3JTEA 5IKEA 1IRIA 4X84A 4J2HA 1OFGA 1HOTA 3VKHA 1KJ8A 1AKUA 4JFRA 1P5ZB 1QO7A 4IGIA 3VQTA 5KOIA 3GLHB 2VT3A 3PGXA 1FYEA 4MMYB 1DKNA 2Q2WA 4GPZA 5AHOA 2O7RA 1JRAA 4HDRB 4RPLA 2OO5C 4DBLE 1TFRA 1R0XA 3ZDBA 3KJGA 3AEKB 1YDWA 2HL6A 2EYQA 4ITVA 1KVQA 2HQBA 1W1IA 2IYPA 3BICA 4CI9A 1T8WA 1EZ1A 3DVSX 1J4AA 1KORA 5I7HA 1V71A 4N40A 1W0JA 1Y1QA 2YZ2A 4W7SA 1L7MA 4CL8A 2L69A 4JP1A 5K3DA 3LUCA 2ERCA 4DBQA 5EPEA 1UT8A 2B2CA 4DRIB 1QQ7A 4EDHA 3LCMA 1U2SA 3STTA 3UOAB 4V0MA 4LZOA 4XPWA 3DEIA 4GXNA 2JKVA 7MDHA 2EG9A 1OLXA 1WU7A 2WR8A 2UU9B 4I1VA 3GJZA 3TR0A 5GJCA 3CBQA 2WVGA 3L02A 3P2KA 4G0YA 4E30A 4E6EA 3ZJTA 3AM4A 4HXEB 4E07A 1YZFA 1BCSA 4EL0A 4KN5A 4L0DA 3IBTA 2BELA 3CW8X 3L8HA 4I19A 2J0EA 2YOFA 5IMSA 4E7ZA 3A0RB 4EX6A 1P2VA 3BXGA 3WR5A 4OOEA 5AO9A 2ODAA 1D7OA 4NFSA 4CVNA 4NCJA 5CI9A 3SC4A 4HAOA 4YNBA 3D4PA 5L7WA 2Y05A 3I8XA 3MWKA 5A5DA 5DWQA 2NXWA 3ZVKA 3PUIA 3H1EA 5ITWA 5C3UA 2P6MA 1HDIA 3EWSA 1BDIA 1RKUA 4MUHA 1EK1A 3C3AA 3PYMA 5EJ7A 2I7DA 4HZUB 1P9WA 2Q2NA 1JYFA 4K86A 3RHFA 4P84A 4ZV9A 4F12A 5DGXA 4IJ5A 1ZVZA 1Q7TA 1V7CA 1I10A 2ZOSA 3NBMA 2WW8A 4P83A 2FSPA 1BRMA 4D80A 2NU7A 2HTFA 5LOVB 3FWKA 4PFOA 1TT7A 4BGUA 1CJCA 3DMGA 3MQFA 4YMTA 4BCDA 2PEYA 4EGSA 4LEIA 5UKDA 2Z5FA 3W6ZA 1SZIA 1LSJA 1PT9A 3IQDB 4W9NC 3I32A 2W90A 3OZUA 4ARSA 1JU3A 2EW1A 4NDNE 2FMUA 1P4AA 1II8B 3KPUA 4P7KA 3ZHYA 4B6QA 3ZTWA 3FSGA 3H13A 4B3SB 2A58A 5ANRB 3R0IA 3HB0A 5DM4A 3ZHZA 1X1DA 3RB8A 3BS4A 2VK4A 3FWHA 5CLLA 3R9XB 4DANA 5MF6A 1CUEA 3ZK8A 2VKTA 2SNIE 1A2QA 3KOMA 1U80A 5CAEB 5IU6A 1P33A 2DOKA 1Y80A 3TGWA 4YYEA 1Q12A 3KHKA 4LRUA 2AFHA 5C1PA 2CLCX 1AQJA 3FM9A 2JG3A 4IKEA 3CSSA 1QKJA 4UHEA 2BR5A 4ZRDA 4FFSA 4JC0A 4F85A 1OIXA 3X1OA 4U2DA 3D31A 5JSZB 1K6XA 1AGPA 1YNSA 3I2FA 4NABA 4AMYA 4BX2A 1ABFA 3TO5A 4US1R 1ZYUA 2A1UB 4N03A 2JX0A 2FW8A 5CP8A 2WA1A 2WVJA 2RJ3A 1ZJWA 3TOMA 4A0GA 3OP4A 1HT0A 5FWNA 1D6JA 3BE6A 3H5WA 5CDHA 3WAJA 2JLRA 5FA6A 3DEAA 1DQRA 2UV8A 5FI3A 3IC5A 4JI0B 1Z6GA 1Q0FA 1J8VA 1NBIA 4I8XA 4OGGA 5FWAA 5B64A 3D2LA 4EPRA 5KHAA 3TSCA 1EXWA 1CUDA 2GXQA 3RG8A 3KJXA 5L4NA 3HKBA 5GV8A 4HXYA 2O8EB 1UBGA 1QLEC 2AEFA 4LXQA 3E1GA 3ELBA 2GA8A 1STOA 2B4AA 1M6EX 1VA5A 1Z34A 4IUDS 4UHKA 4YL3A 4HATA 2HSGA 2XS1A 1NZDA 4CHGA 2W5UA 3VPHA 5C8YB 4FI3C 2OORC 2EZ9A 2ODEA 1X1EA 3RUDA 2JI9A 3Q3IA 2XQGA 3RNOA 4RKRA 1AE1A 3G0CA 2B1GA 4QOSA 1E1RD 4KXWA 4E31A 3CH6A 1EWVA 3CXRA 2CCGA 2FPXA 1C4XA 3RLIA 1DBRA 1YQWA 4KPYA 2R2AA 3BC1A 1EWQA 2AX4A 4JXXA 1SXHA 2VSYA 4LJ4A 3FZNA 3QBEA 4AQYB 1RLIA 1IHPA 3W9YA 3IH5A 2Y0DA 3WG7C 4MUEA 4PO3X 4ZRNA 4HEQA 4O4JF 1U2EA 4LF8B 4GLBA 4IEFB 3KPYA 4TT8A 3JXEA 1XA0A 3QWIA 2JZOA 1ZK1A 3K9LA 1JG4A 4I9HA 1P8AA 2H5EA 2YWHA 4KNWA 4P5PA 1KSHA 4INAA 5HHTA 3W5AA 2I8CA 1WKVA 3DWFA 4H4DA 3LA6A 3CZAA 5AVXA 2P4QA 1JQJC 3R8CA 2VDWB 4YK7A 1FMVA 2C9BA 2R7SA 1E9RA 3PKIA 4U00A 1L8OA 1G291 3B82A 5AK0A 5JS1A 3FBGA 4OLFA 5K0JA 3MCUA 5AOVA 2NADA 3EIEA 3GMDA 3DW3X 2ZRLA 2NTYC 2R6DA 4LI0A 2ZK7A 1HZJA 1C14A 4FN5A 3DD1A 5LDDC 4WCFB 1OAAA 1K97A 4YFVA 1N1GA 4LSZA 1NW6A 3ETCA 3OPQA 4AQDA 2OZEA 4YX9A 3EA5A 2PRSA 1BROA 2Z1NA 4EB6A 3IA7A 3W1EA 4B75A 4OHPA 2QLTA 3FPBA 1T29A 5HFAA 1DDGA 4GG1A 1EHYA 3I6YA 2WJGA 1X87A 4HNGA 1A98A 4Z4HA 4OD4A 2PO5A 2XGSA 2VCEA 3AY0A 3UG6A 1MH9A 1FNTc 4F21A 3HH8A 1QDUA 5DOVA 3VZRA 4G1UC 2ZQYA 4C29A 3A7EA 1W96A 2JDIA 3UW1A 5AI9A 1GLGA 5FYDA 5G0SA 3WO1A 4V0LA 3VXKA 2OZLA 1KNQA 5GONB 2BN4A 3PUWA 1J97A 1IZYA 1P8JA 1KVUA 4IHJA 3ILYA 5A0VA 2ZUUA 3DZIA 1XZPA 4RJLA 4PRLA 1Y3CE 2IHUA 4Y30A 2OYSA 4R2XA 3ISTA 1A5TA 3DCIA 1JTEA 4LV8B 3LOPA 4QOHA 5BNZA 2NT3A 3TRJA 1NWHA 2EVWX 1LCIA 3GJ3A 3K1AA 4DJEC 2DSTA 3AJAA 3SJ7A 4EY5A 4DA4A 4AIRA 3N2KA 4C06A 3FE2A 3T9CA 1FJXA 1YRWA 3T5BA 4II7A <