5JP7A

Ferrous leu 16 val mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAVTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jp7A00
2J8WA 4CDYA 1E86A 5JP7A 4IB4A 4IAQA 1RCPA 4CDVA 1MQVA 3ZQVA 3DE8A 3QW0A 4EIYA 4ER9A 3HNLA 5JRAA 1E83A 3L1MA 3TOMA 1CGNA 5JSLA 2YLGA 1JAFA 4WGZA 3M4CA 1A7VA 2YLDA 2QLAA 5JUAA 3ZTMA 4N6HA 3FOPA 5AGFA 4ULVA 1LM3B 1E84A 1EKYA 3HNKA 5JVEA 1YZCA 2XLDA 2XM4A 2XLEA 5B3IA 3NMKA 3FOOA 1CGOA 4JKVA 5JT4A 3NMJA 4CIPA 3TOLA 2YLIA 2YL1A 4CJGA 4NC3A 3ZTZA 3M79A 1APCA 4JE9A 2XLWA 4CJOA 3HNIA 3C63A 1S05A 2XM0A 2XLOA 3IQ6A 2XLVA 3NMIA 3M4BA 1QPUA 1YYJA 3VRCA 4JEAA 3C62A 4JEBA 1CPQA 3DE9A 1QQ3A 2YKZA 4L6RA 4CX9A 3ZQYA 4D4XA 256BA 2XL8A 3ZWIA 1E85A 4IARA 3HNJA 1YYXA 2YL7A 1CPRA 2YL3A 2XLMA 4CDAA 1YZAA 1M6TA 3QVYA 3U8PA 2YL0A 4N4WA 1GQAA 2CCYA 4D4NA 2J9BA 3QW1A 3IQ5A 5JLIA 2XLHA 1BBHA 3QVZA 2XL6A 3M15A 4U9EA 4U9DA 2BC5A 4WGYA 1NBBA 5JS5A
chains in the Genus database with same CATH superfamily
2IXMA 2MHRA 3C8GA 2YWAA 5E33A 3ZVRA 2KYHA 4PK4A 1CGME 2XRHA 3JRMO 3B0VC 3DM9B 3AG3C 1MMGA 5JP7A 3U2LA 4E7SA 4G7OF 1RKCA 4IAQA 2PNOA 3U9MA 3W4YA 4DBRA 2XL4A 1VOMA 2V26A 2Y39A 1WWPA 5CI8A 4DRHB 2DYRC 3DJNB 5L0DA 3U5SA 4YK5A 3UGOA 2XSEA 2HJMA 3ECSA 5A6BD 3AG4C 5KYUB 5F5HA 4NTFA 2YZSA 3RQEA 3N2ZB 4EIYA 3ZSUA 5JRAA 2J0WA 1FFHA 3C18A 3KKBA 3TOMA 1CGNA 1UG7A 2G62A 1T01A 2DI3A 5JSLA 3T6BA 2YLGA 1ZW2A 4FESA 2W4MA 3MFNA 2P0NA 2HFIA 1TKNA 2CYDA 3H2VA 1HE1A 3LEVA 2HMZA 2R03A 1A7VA 2YLDA 3KL4A 2X51A 3C7JA 4W8PA 3LNMB 3RVYA 4PACA 4N6HA 4C7OA 3POVA 3EGDA 1K04A 2BE5F 2ZXOA 3I4UA 4I3MA 4IGGA 5HSWA 3WODF 4CS8C 2Q9CA 3KMIA 5EK0A 1Q0KA 2KW3C 3TK0A 2CDQA 3CSKA 4R32A 4B6IA 3B29A 5A6JA 1E84A 1EKYA 1B68A 3HNKA 4YT8A 2XLDA 1U6HA 4DOZA 4OIRF 1VYKA 3IQTA 3F46A 1PD0A 4QI2A 3DD7A 5BQGA 3CZ6A 2CW0F 3V5XA 2OQMA 2Q9AA 5K0IA 3NYMA 3LLKA 5JT4A 3PDMP 3RH3A 1QZXA 3W2WA 2V3CC 4Q7CA 4CIPA 2KSFA 5B3SC 3GEHA 4E0HA 5L0HA 3MYFA 1S7ZA 1SF8A 5KYXB 1HMDA 3M79A 1V55C 1NU7D 3LAYA 4U5BE 4AK9A 4YN0B 2XLWA 1TFKB 2AP3A 1QKRA 1BDJB 1OW7A 2GFHA 3B71A 2HMQA 2LP4A 3EG9B 4O6YA 4WABA 5DVWA 4CBEA 5A6AA 3IQ6A 3S90A 4J7YA 3HTKC 4MVOA 3R2PA 4U5EE 5DQTA 2R7TA 1LS1A 1YYJA 3VRCA 2MWQA 4H54A 1FFTC 4HEAJ 4JZAA 1PCXA 1OXBA 1PD1A 1AUEA 2O9XA 2VC9A 2PBEA 2R9RB 2X0CA 3EQLF 3C62A 4CS8A 2EPLX 2VASA 4JRZA 3SXYA 2R7VA 2PF4E 4X0RA 2YKZA 1T6UA 1M2VB 3O39A 4U5DE 3GWNA 1KTMA 2VCAA 3L8IA 1Z6AA 2EIMC 5HV9A 2D4UA 3SP1A 1VMAA 4IRUA 4YL0A 2XS1A 2XL8A 3ZWIA 4BJ1A 1QVXA 4NTBA 3I5QA 5KYUA 2IBFA 4MVQA 3Q7LA 4XTKA 1IZMA 1BR1A 1N1CA 2J9UA 4N4WA 5T1DB 5L0CA 4WJ0A 3RQFA 2PP4A 2QTVA 1VK5A 3S27A 2KQ9A 3RVZA 4KC9A 4J7TA 3IQ5A 3VM6A 5E2QA 1BBHA 3ZC4A 4LACB 2RSEB 3KH2A 4I1OB 5D92A 2PX3A 3DMDA 4KNWA 4MTGA 1RCPA 2GDCA 1FNTc 1M2OA 1QSPA 2P1AA 1K05A 3RFYA 3RKOF 1IW7F 2CNWD 4JW1A 4C3DA 1Q0DA 2I15A 2OCCC 2OOCA 4LDKA 1YAUO 2QY9A 1LPEA 1RKEB 1V4AA 4N6CA 4EUKB 2HJ3A 2YRFA 4QDLA 4CDVA 1MQVA 4JJFA 3C8GD 4DVYP 1HY5A 2AVKA 2GAQA 3GEIA 5F28E 3QMKA 3U2MA 1C02A 4PJNA 3UNGC 4RD9A 3QW0A 3EHMA 5DLJA 2PX0A 4Z9HA 3O55A 1D1AA 1FTSA 2VCCA 4MVRA 4ER9A 4HFKB 3G50A 2HZ8A 2UUHA 3ABLC 2NUPA 3LEOA 3EH2A 3L1MA 4GQHA 2G3KA 2P6VA 4JCZA 3LS1A 2NSGA 5KYXA 2R7QA 2F22A 1SZIA 1VYIA 1YA9A 1OR3A 2M64A 2DYSC 4U5CE 4UDVA 3FDQA 4CSAC 3S29A 2HS5A 4FAPB 5FCLA 1OKKA 2QLAA 3DM5A 4BJTA 1VTMP 3EG9A 4YT4A 1ZHTA 3RQGA 5DS4A 3AJMA 1L3PA 4K0DA 3AOUA 3FOPA 4BEMJ 2XXAB 1YJGA 3WG7C 3EFOB 1G4WR 3DJUB 4PJMA 3GEEA 5AGFA 3V5ZA 4E17A 3B0PA 3FHDA 1XZPA 2OG2A 2CGEA 1E2XA 2R7WA 1U89A 2JD3A 4ZLDA 1C03A 1ORSC 2IXOA 1M2VA 4OD5A 3W8IA 1Y6DA 4YJWA 2RD9A 3K7DA 3UMIA 2KNHA 5KYYB 1A7DA 1CGOA 1ST6A 3N0TA 2WVQA 4XPYA 4ANJA 3NMJA 4ONSA 4YWQA 2EIKC 4PR9A 5IY5C 3NKDA 2HV6A 3SXMA 3TOLA 1GM5A 1A7EA 3EH1A 2EPOA 3FAPB 2YL1A 2P7VA 3JTLO 4DRIB 1OXKA 2VB6A 1LI5A 2J45A 3GODA 4IAOA 3S84A 3JZ0A 3UMKA 4U5FE 4CS7A 3E70C 2PFDA 2KK1A 3LLIA 1KNYA 3JCUQ 3EGXB 2WZLA 4OD4A 3K1HA 3VYWA 4JCHA 4CSAA 4F4BA 4XLPF 2A68F 2EINC 2ICWG 2LD6A 1S05A 3C63A 2XM0A 3HNIA 3Q6NA 4J32B 5DS6A 2XLVA 2NPUA 2MYSA 3PCVA 3ZDLA 3M4BA 1QPUA 1YA7O 1OCRC 4O7GA 3MYIA 1I5NA 1GGQA 3GM1A 3AGTA 4JEBA 2XS8A 4EBBA 2ASRA 3DE9A 1NG1A 4MW3A 1UFBA 4C3EA 3NYJA 1D0YA 4G7ZF 1RKEA 3Q6MA 4P6IC 5COFA 4D4XA 2HV7A 4O6MA 5GPGB 2HUJA 4I44A 2ZXRA 3SNHA 1RJ9B 2I8BA 2LSEA 1LE2A 4MQ9F 4U5GA 1HW2A 4RDAA 3W2VA 2DGJA 3T9OA 4YT2A 2KJGA 4XQ1A 1YYXA 2LK4A 3BEHA 4OIQF 3AG1C 2B0JA 2YL3A 3SYNA 3QVYA 3U8PA 1M56C 1L7CA 1MMAA 1GQAA 5E3AA 3RW0A 3MBGA 1TWGA 4FX5A 4DBQA 3ASOC 5BQIA 2R25A 3QZCA 2R7OA 1Z3IX 4U9EA 4U9DA 4Q5SF 4CS9C 4P9FA 5D91A 1LKXA 3CAXA 1OW8A 2EILC 3BRJA 3EFOA 1C17M 1NBBA 1M57C 3K33A 1QLEC 3KPHA 1O5HA 2J0XA 2IXPA 3OA1A 3EZHA 2JX0A 2ETSA 1E86A 2Q9BA 1I4YA 1YARO 4GEHA 2FGYA 5F5FA 3UGPA 4XEFA 3C8GB 3FVYA 5KYYA 1YDIA 2WVNA 1Z63A 3IEEA 1KU2A 2R05A 4YT5A 3GORA 3GWLA 5L0IA 4OINF 1SYQA 2EPKX 3X1OA 3RF3A 4BG0A 3DZAA 4XEKA 3E9VA 2WVOA 1JMWA 2LFFA 3VAYA 2H7OA 3DAFA 4AL1A 2Y69C 3NYLA 2WL8A 1D1BA 1J8YF 2J9VA 1ZHXA 5L3VA 3ATPA 1WASA 2OU6A 3TQOA 1OCOC 2E87A 5DS5A 4JTAB 2L6HA 5EHHA 3L34A 3EGXA 4BJ6C 1WGWA 2R02A 5L0GA 1ZZPA 1JOGA 3G4XA 1LI7A 3M4CA 4WGZA 1D0XA 2W9YA 5L0FA 4AL0A 3PHF2 4MTOA 2HSQA 2LFDA 3IHUA 2R7UA 4LDQA 1K40A 2IXNA 4FWVA 4DVZA 4EBKA 4ZLCA 1Q0GA 1O87A 3JYYA 3AGUA 4ULVA 4JVSA 4CS9A 2LQGA 2GWWA 1NLXA 2W4BA 4XPWA 1T9KA 3U8VA 2R7RA 1BR2A 3V7OA 3SEOA 4MNDA 2AU5A 2B0HA 3S9OA 1ZHYA 3A9CA 1WTYA 2XLEA 4AE4B 2EPMX 2Y3DA 3NMKA 1VLTA 2J9WA 3RIPA 4JKVA 1RJ9A 1Z7Qc 5AC4A 4DRJB 1Z23A 3WAQA 4NCQA 1EI7A 3U3FA 3GM2A 4BEJA 4RBNA 1A41A 4W8KA 5A69A 2FFHA 3JSZA 3JT1A 1VB5A 1H6GA 3T6JA 2IM8A 2J7PA 4CJGA 4Z9JA 4H4KC 3ZTZA 3DWWA 1RXQA 2A1DD 1TWCA 3HLZA 4NY3A 5B1BC 1APCA 2L81A 4JE9A 1NFOA 3M1CB 1H9TA 1D1CA 2DB4A 2WB7A 5BUOA 3B9QA 4LLEA 4BJ6A 1DOWA 4J30B 3QTHA 2Z15A 2XLOA 2ZPAA 4KBLA 4N06A 3X2QC 5L3QA 3NMIA 5T3TA 5DQZA 3JRTA 4OIPF 1MNEA 1ZW3A 3ITFA 4E7ZA 2H7VC 3K6BA 4NTAA 4EBJA 5COMA 2W45A 3TJ6A 2CNWA 3A11A 3L0IA 3ZIBA 4K7BA 3SXKA 2Q3TA 3LS0A 4DXWA 1QQ3A 4YL3A 4A2NB 4CX9A 1T6QA 3ZQYA 2C03A 256BA 4E18A 1DOVA 2WZGA 3F47A 2AWYA 3HKKA 4NQFA 3WHNA 3S0XA 1YVIA 2AWCA 1ZU4A 2EPNA 3R7CA 1MNDA 4E0IA 4XPXA 2NUTB 3LUTB 3MLGA 2ZXPA 3G4ZA 2JPUA 4MVMA 1E85A 4HFFB 4IARA 4DJ9A 4I1MA 3HNJA 2FAPB 1NSGB 4G0HA 5AC5A 4CIHA 5B1AC 1CPRA 4JURI 3NG1A 2XLMA 3TJ5A 4CDAA 1YZAA 1BZ4A 3EHNA 3JSEO 2L6GA 1V74B 2OKUA 2YL0A 3IQCA 3TD7A 1JPJA 2CCYA 5CI9A 4LERA 1FR0A 4OIOF 5TJ5E 1TQGA 3K1IC 3K66A 3L8JA 3QW1A 3UMHA 5JLIA 1G8XA 2XLHA 3DXJF 1O3UA 2VH3A 3EJNA 1T5OA 1ZU5A 1LE4A 3ASNC 1FMVA 1NU9C 3H65A 1D0ZA 2R7XA 1H7IA 3EZIA 1Y4CA 4MW8A 2YEVA 5JS5A 2A0BA 1ORJA 5KYWB 2J8WA 2HSBA 2L7AA 1ZHWA 2J46A 4JIOA 3H2UA 2H8AA 4CDYA 5A6BA 3ABKC 4KI2A 2QE9A 4U5HA 2OJQA 4IB4A 4AE4A 1OCCC 4GYTA 2IYLD 1JR8A 3O6XA 1BR4A 2A6EF 2C04A 5COGA 3VF0A 1J8MF 3GM3A 3ZQVA 5T3WA 4AX2A 3DE8A 1HMOA 1PV3A 3J06A 1EQ1A 4O79A 1W2WA 2KC3A 2A69F 1XWJA 3HNLA 3B0UX 1ZVZA 2KGOA 1SR2A 1WOLA 2WZFA 4PFPA 4A4AA 4QI0A 4G7HF 1U0BB 3ABMC 1JAFA 1F1MA 4ULWA 3IPMO 2IOQA 2L9JA 1YLMA 2OJED 2NUPB 2XXAA 1H9GA 2R7SA 5JUAA 1MMNA 3C8ZA 3K1IA 4PFOA 2P61A 2D5RB 3ZTMA 4MTFA 3NKEA 3W8HA 5BQHA 4BJ5C 1WATA 1I4ZA 1Q0FA 3MX3A 4M63A 2OEXA 1AEPA 2LCHA 3AQBA 3KYIA 1LM3B 1OW6A 4PJLA 1ORYA 2OEVA 1LS4A 5JVEA 1YZCA 4PJJA 3AG2C 1FMWA 4IWBA 2NSFA 3JYHA 2XM4A 4JC7A 2A0UA 2TMVP 5B3IA 4YL1A 1NZEA 3U9JA 3FOOA 2GA0A 4XLNF 5KYNA 3OWTA 4IJJA 1TWAA 2QUPA 2EIJC 2Q7RA 3KYJA 4XEVA 1JRAA 1AVOB 2NUTA 4LLCA 3FXHA 3OEOA 1R5ID 1ZHZA 1OCZC 2H7BA 2VCBA 2YLIA 2ZXWC 5FZTA 3S28A 4P9TA 4NC3A 4JJGA 5EGYA 1R4TA 1SMYF 2Q4FA 2YVKA 1TFOB 1GS9A 1JPNA 4CJOA 2LIGA 2YHSA 3V5YA 2J7PD 2BL2A 3CQZA 1OKKD 4C7OB 1LVKA 1EA8A 3U0CA 2ZD9A 3EGDB 3U3BA 3O10A 1TWHA 4JTCB 3AQCA 1VLSA 4BJ5A 3US6A 4JEAA 4KNVA 3FMSA 2QNLA 3LESA 1TR2A 1WN0A 4MS2A 1CPQA 4MVZA 5KYWA 4L6RA 3DI5A 1OQCA 5CIVA 2Y3BA 4G78A 3NRHA 3I5PA 3DAGA 5L0JA 1Z5ZA 4Z9IA 2UUIA 1RMVA 2Y3HA 2Y3GA 4MVSA 3HJCA 3FAJA 4K1OA 4EHPA 3PMRA 3DKAA 4XWJA 3ZG1A 1T6IA 4EKWA 2NG1A 1G5ZA 1XZQA 3EPVA 3T4RA 5E3CA 1HW1A 3RYLA 3T6GB 2Q00A 2YL7A 1MMDA 4JTDB 3GANA 1OR2A 1A0BA 2A6HF 4HE8D 3UR3C 1M6TA 1NFNA 3LNRA 3SZRA 4MVUA 4BPMA 2L6FA 3NDBB 4D4NA 1V54C 2J9BA 3LJBA 4Q4ZF 1LIHA 1ZYRF 1FAPB 1HE9A 4O6NA 1Q0MA 3QVZA 2XL6A 3SXZA 2G3VA 3M15A 4C3BA 3CEXA 4EWCA 2BC5A 2HKVA 2YQYA 3Q7GA 4LDRA 4WGYA 3TULA 5A6KA 2M4EA 1E83A 3N24A 1G4US
chains in the Genus database with same CATH topology
2J8WA 4CDYA 1E86A 5JP7A 4IB4A 4IAQA 1RCPA 4CDVA 1MQVA 3ZQVA 3DE8A 3QW0A 4EIYA 4ER9A 3HNLA 5JRAA 1E83A 3L1MA 3TOMA 1CGNA 5JSLA 2YLGA 1JAFA 4WGZA 3M4CA 1A7VA 2YLDA 2QLAA 5JUAA 3ZTMA 4N6HA 3FOPA 5AGFA 4ULVA 1LM3B 1E84A 1EKYA 3HNKA 5JVEA 1YZCA 2XLDA 2XM4A 2XLEA 5B3IA 3NMKA 3FOOA 1CGOA 4JKVA 5JT4A 3NMJA 4CIPA 3TOLA 2YLIA 2YL1A 4CJGA 4NC3A 3ZTZA 3M79A 1APCA 4JE9A 2XLWA 4CJOA 3HNIA 3C63A 1S05A 2XM0A 2XLOA 3IQ6A 2XLVA 3NMIA 3M4BA 1QPUA 1YYJA 3VRCA 4JEAA 3C62A 4JEBA 1CPQA 3DE9A 1QQ3A 2YKZA 4L6RA 4CX9A 3ZQYA 4D4XA 256BA 2XL8A 3ZWIA 1E85A 4IARA 3HNJA 1YYXA 2YL7A 1CPRA 2YL3A 2XLMA 4CDAA 1YZAA 1M6TA 3QVYA 3U8PA 2YL0A 4N4WA 1GQAA 2CCYA 4D4NA 2J9BA 3QW1A 3IQ5A 5JLIA 2XLHA 1BBHA 3QVZA 2XL6A 3M15A 4U9EA 4U9DA 2BC5A 4WGYA 1NBBA 5JS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8W A;  4CDY A;  1E86 A;  5JP7 A;  4IB4 A;  4IAQ A;  1RCP A;  4CDV A;  1MQV A;  3ZQV A;  3DE8 A;  3QW0 A;  4EIY A;  4ER9 A;  3HNL A;  5JRA A;  1E83 A;  3L1M A;  3TOM A;  1CGN A;  5JSL A;  2YLG A;  1JAF A;  4WGZ A;  3M4C A;  1A7V A;  2YLD A;  2QLA A;  5JUA A;  3ZTM A;  4N6H A;  3FOP A;  5AGF A;  4ULV A;  1LM3 B;  1E84 A;  1EKY A;  3HNK A;  5JVE A;  1YZC A;  2XLD A;  2XM4 A;  2XLE A;  5B3I A;  3NMK A;  3FOO A;  1CGO A;  4JKV A;  5JT4 A;  3NMJ A;  4CIP A;  3TOL A;  2YLI A;  2YL1 A;  4CJG A;  4NC3 A;  3ZTZ A;  3M79 A;  1APC A;  4JE9 A;  2XLW A;  4CJO A;  3HNI A;  3C63 A;  1S05 A;  2XM0 A;  2XLO A;  3IQ6 A;  2XLV A;  3NMI A;  3M4B A;  1QPU A;  1YYJ A;  3VRC A;  4JEA A;  3C62 A;  4JEB A;  1CPQ A;  3DE9 A;  1QQ3 A;  2YKZ A;  4L6R A;  4CX9 A;  3ZQY A;  4D4X A;  256B A;  2XL8 A;  3ZWI A;  1E85 A;  4IAR A;  3HNJ A;  1YYX A;  2YL7 A;  1CPR A;  2YL3 A;  2XLM A;  4CDA A;  1YZA A;  1M6T A;  3QVY A;  3U8P A;  2YL0 A;  4N4W A;  1GQA A;  2CCY A;  4D4N A;  2J9B A;  3QW1 A;  3IQ5 A;  5JLI A;  2XLH A;  1BBH A;  3QVZ A;  2XL6 A;  3M15 A;  4U9E A;  4U9D A;  2BC5 A;  4WGY A;  1NBB A;  5JS5 A; 
#chains in the Genus database with same CATH topology
 2IXM A;  2MHR A;  3C8G A;  2YWA A;  5E33 A;  3ZVR A;  2KYH A;  4PK4 A;  1CGM E;  2XRH A;  3JRM O;  3B0V C;  3DM9 B;  3AG3 C;  1MMG A;  5JP7 A;  3U2L A;  4E7S A;  4G7O F;  1RKC A;  4IAQ A;  2PNO A;  3U9M A;  3W4Y A;  4DBR A;  2XL4 A;  1VOM A;  2V26 A;  2Y39 A;  1WWP A;  5CI8 A;  4DRH B;  2DYR C;  3DJN B;  5L0D A;  3U5S A;  4YK5 A;  3UGO A;  2XSE A;  2HJM A;  3ECS A;  5A6B D;  3AG4 C;  5KYU B;  5F5H A;  4NTF A;  2YZS A;  3RQE A;  3N2Z B;  4EIY A;  3ZSU A;  5JRA A;  2J0W A;  1FFH A;  3C18 A;  3KKB A;  3TOM A;  1CGN A;  1UG7 A;  2G62 A;  1T01 A;  2DI3 A;  5JSL A;  3T6B A;  2YLG A;  1ZW2 A;  4FES A;  2W4M A;  3MFN A;  2P0N A;  2HFI A;  1TKN A;  2CYD A;  3H2V A;  1HE1 A;  3LEV A;  2HMZ A;  2R03 A;  1A7V A;  2YLD A;  3KL4 A;  2X51 A;  3C7J A;  4W8P A;  3LNM B;  3RVY A;  4PAC A;  4N6H A;  4C7O A;  3POV A;  3EGD A;  1K04 A;  2BE5 F;  2ZXO A;  3I4U A;  4I3M A;  4IGG A;  5HSW A;  3WOD F;  4CS8 C;  2Q9C A;  3KMI A;  5EK0 A;  1Q0K A;  2KW3 C;  3TK0 A;  2CDQ A;  3CSK A;  4R32 A;  4B6I A;  3B29 A;  5A6J A;  1E84 A;  1EKY A;  1B68 A;  3HNK A;  4YT8 A;  2XLD A;  1U6H A;  4DOZ A;  4OIR F;  1VYK A;  3IQT A;  3F46 A;  1PD0 A;  4QI2 A;  3DD7 A;  5BQG A;  3CZ6 A;  2CW0 F;  3V5X A;  2OQM A;  2Q9A A;  5K0I A;  3NYM A;  3LLK A;  5JT4 A;  3PDM P;  3RH3 A;  1QZX A;  3W2W A;  2V3C C;  4Q7C A;  4CIP A;  2KSF A;  5B3S C;  3GEH A;  4E0H A;  5L0H A;  3MYF A;  1S7Z A;  1SF8 A;  5KYX B;  1HMD A;  3M79 A;  1V55 C;  1NU7 D;  3LAY A;  4U5B E;  4AK9 A;  4YN0 B;  2XLW A;  1TFK B;  2AP3 A;  1QKR A;  1BDJ B;  1OW7 A;  2GFH A;  3B71 A;  2HMQ A;  2LP4 A;  3EG9 B;  4O6Y A;  4WAB A;  5DVW A;  4CBE A;  5A6A A;  3IQ6 A;  3S90 A;  4J7Y A;  3HTK C;  4MVO A;  3R2P A;  4U5E E;  5DQT A;  2R7T A;  1LS1 A;  1YYJ A;  3VRC A;  2MWQ A;  4H54 A;  1FFT C;  4HEA J;  4JZA A;  1PCX A;  1OXB A;  1PD1 A;  1AUE A;  2O9X A;  2VC9 A;  2PBE A;  2R9R B;  2X0C A;  3EQL F;  3C62 A;  4CS8 A;  2EPL X;  2VAS A;  4JRZ A;  3SXY A;  2R7V A;  2PF4 E;  4X0R A;  2YKZ A;  1T6U A;  1M2V B;  3O39 A;  4U5D E;  3GWN A;  1KTM A;  2VCA A;  3L8I A;  1Z6A A;  2EIM C;  5HV9 A;  2D4U A;  3SP1 A;  1VMA A;  4IRU A;  4YL0 A;  2XS1 A;  2XL8 A;  3ZWI A;  4BJ1 A;  1QVX A;  4NTB A;  3I5Q A;  5KYU A;  2IBF A;  4MVQ A;  3Q7L A;  4XTK A;  1IZM A;  1BR1 A;  1N1C A;  2J9U A;  4N4W A;  5T1D B;  5L0C A;  4WJ0 A;  3RQF A;  2PP4 A;  2QTV A;  1VK5 A;  3S27 A;  2KQ9 A;  3RVZ A;  4KC9 A;  4J7T A;  3IQ5 A;  3VM6 A;  5E2Q A;  1BBH A;  3ZC4 A;  4LAC B;  2RSE B;  3KH2 A;  4I1O B;  5D92 A;  2PX3 A;  3DMD A;  4KNW A;  4MTG A;  1RCP A;  2GDC A;  1FNT c;  1M2O A;  1QSP A;  2P1A A;  1K05 A;  3RFY A;  3RKO F;  1IW7 F;  2CNW D;  4JW1 A;  4C3D A;  1Q0D A;  2I15 A;  2OCC C;  2OOC A;  4LDK A;  1YAU O;  2QY9 A;  1LPE A;  1RKE B;  1V4A A;  4N6C A;  4EUK B;  2HJ3 A;  2YRF A;  4QDL A;  4CDV A;  1MQV A;  4JJF A;  3C8G D;  4DVY P;  1HY5 A;  2AVK A;  2GAQ A;  3GEI A;  5F28 E;  3QMK A;  3U2M A;  1C02 A;  4PJN A;  3UNG C;  4RD9 A;  3QW0 A;  3EHM A;  5DLJ A;  2PX0 A;  4Z9H A;  3O55 A;  1D1A A;  1FTS A;  2VCC A;  4MVR A;  4ER9 A;  4HFK B;  3G50 A;  2HZ8 A;  2UUH A;  3ABL C;  2NUP A;  3LEO A;  3EH2 A;  3L1M A;  4GQH A;  2G3K A;  2P6V A;  4JCZ A;  3LS1 A;  2NSG A;  5KYX A;  2R7Q A;  2F22 A;  1SZI A;  1VYI A;  1YA9 A;  1OR3 A;  2M64 A;  2DYS C;  4U5C E;  4UDV A;  3FDQ A;  4CSA C;  3S29 A;  2HS5 A;  4FAP B;  5FCL A;  1OKK A;  2QLA A;  3DM5 A;  4BJT A;  1VTM P;  3EG9 A;  4YT4 A;  1ZHT A;  3RQG A;  5DS4 A;  3AJM A;  1L3P A;  4K0D A;  3AOU A;  3FOP A;  4BEM J;  2XXA B;  1YJG A;  3WG7 C;  3EFO B;  1G4W R;  3DJU B;  4PJM A;  3GEE A;  5AGF A;  3V5Z A;  4E17 A;  3B0P A;  3FHD A;  1XZP A;  2OG2 A;  2CGE A;  1E2X A;  2R7W A;  1U89 A;  2JD3 A;  4ZLD A;  1C03 A;  1ORS C;  2IXO A;  1M2V A;  4OD5 A;  3W8I A;  1Y6D A;  4YJW A;  2RD9 A;  3K7D A;  3UMI A;  2KNH A;  5KYY B;  1A7D A;  1CGO A;  1ST6 A;  3N0T A;  2WVQ A;  4XPY A;  4ANJ A;  3NMJ A;  4ONS A;  4YWQ A;  2EIK C;  4PR9 A;  5IY5 C;  3NKD A;  2HV6 A;  3SXM A;  3TOL A;  1GM5 A;  1A7E A;  3EH1 A;  2EPO A;  3FAP B;  2YL1 A;  2P7V A;  3JTL O;  4DRI B;  1OXK A;  2VB6 A;  1LI5 A;  2J45 A;  3GOD A;  4IAO A;  3S84 A;  3JZ0 A;  3UMK A;  4U5F E;  4CS7 A;  3E70 C;  2PFD A;  2KK1 A;  3LLI A;  1KNY A;  3JCU Q;  3EGX B;  2WZL A;  4OD4 A;  3K1H A;  3VYW A;  4JCH A;  4CSA A;  4F4B A;  4XLP F;  2A68 F;  2EIN C;  2ICW G;  2LD6 A;  1S05 A;  3C63 A;  2XM0 A;  3HNI A;  3Q6N A;  4J32 B;  5DS6 A;  2XLV A;  2NPU A;  2MYS A;  3PCV A;  3ZDL A;  3M4B A;  1QPU A;  1YA7 O;  1OCR C;  4O7G A;  3MYI A;  1I5N A;  1GGQ A;  3GM1 A;  3AGT A;  4JEB A;  2XS8 A;  4EBB A;  2ASR A;  3DE9 A;  1NG1 A;  4MW3 A;  1UFB A;  4C3E A;  3NYJ A;  1D0Y A;  4G7Z F;  1RKE A;  3Q6M A;  4P6I C;  5COF A;  4D4X A;  2HV7 A;  4O6M A;  5GPG B;  2HUJ A;  4I44 A;  2ZXR A;  3SNH A;  1RJ9 B;  2I8B A;  2LSE A;  1LE2 A;  4MQ9 F;  4U5G A;  1HW2 A;  4RDA A;  3W2V A;  2DGJ A;  3T9O A;  4YT2 A;  2KJG A;  4XQ1 A;  1YYX A;  2LK4 A;  3BEH A;  4OIQ F;  3AG1 C;  2B0J A;  2YL3 A;  3SYN A;  3QVY A;  3U8P A;  1M56 C;  1L7C A;  1MMA A;  1GQA A;  5E3A A;  3RW0 A;  3MBG A;  1TWG A;  4FX5 A;  4DBQ A;  3ASO C;  5BQI A;  2R25 A;  3QZC A;  2R7O A;  1Z3I X;  4U9E A;  4U9D A;  4Q5S F;  4CS9 C;  4P9F A;  5D91 A;  1LKX A;  3CAX A;  1OW8 A;  2EIL C;  3BRJ A;  3EFO A;  1C17 M;  1NBB A;  1M57 C;  3K33 A;  1QLE C;  3KPH A;  1O5H A;  2J0X A;  2IXP A;  3OA1 A;  3EZH A;  2JX0 A;  2ETS A;  1E86 A;  2Q9B A;  1I4Y A;  1YAR O;  4GEH A;  2FGY A;  5F5F A;  3UGP A;  4XEF A;  3C8G B;  3FVY A;  5KYY A;  1YDI A;  2WVN A;  1Z63 A;  3IEE A;  1KU2 A;  2R05 A;  4YT5 A;  3GOR A;  3GWL A;  5L0I A;  4OIN F;  1SYQ A;  2EPK X;  3X1O A;  3RF3 A;  4BG0 A;  3DZA A;  4XEK A;  3E9V A;  2WVO A;  1JMW A;  2LFF A;  3VAY A;  2H7O A;  3DAF A;  4AL1 A;  2Y69 C;  3NYL A;  2WL8 A;  1D1B A;  1J8Y F;  2J9V A;  1ZHX A;  5L3V A;  3ATP A;  1WAS A;  2OU6 A;  3TQO A;  1OCO C;  2E87 A;  5DS5 A;  4JTA B;  2L6H A;  5EHH A;  3L34 A;  3EGX A;  4BJ6 C;  1WGW A;  2R02 A;  5L0G A;  1ZZP A;  1JOG A;  3G4X A;  1LI7 A;  3M4C A;  4WGZ A;  1D0X A;  2W9Y A;  5L0F A;  4AL0 A;  3PHF 2;  4MTO A;  2HSQ A;  2LFD A;  3IHU A;  2R7U A;  4LDQ A;  1K40 A;  2IXN A;  4FWV A;  4DVZ A;  4EBK A;  4ZLC A;  1Q0G A;  1O87 A;  3JYY A;  3AGU A;  4ULV A;  4JVS A;  4CS9 A;  2LQG A;  2GWW A;  1NLX A;  2W4B A;  4XPW A;  1T9K A;  3U8V A;  2R7R A;  1BR2 A;  3V7O A;  3SEO A;  4MND A;  2AU5 A;  2B0H A;  3S9O A;  1ZHY A;  3A9C A;  1WTY A;  2XLE A;  4AE4 B;  2EPM X;  2Y3D A;  3NMK A;  1VLT A;  2J9W A;  3RIP A;  4JKV A;  1RJ9 A;  1Z7Q c;  5AC4 A;  4DRJ B;  1Z23 A;  3WAQ A;  4NCQ A;  1EI7 A;  3U3F A;  3GM2 A;  4BEJ A;  4RBN A;  1A41 A;  4W8K A;  5A69 A;  2FFH A;  3JSZ A;  3JT1 A;  1VB5 A;  1H6G A;  3T6J A;  2IM8 A;  2J7P A;  4CJG A;  4Z9J A;  4H4K C;  3ZTZ A;  3DWW A;  1RXQ A;  2A1D D;  1TWC A;  3HLZ A;  4NY3 A;  5B1B C;  1APC A;  2L81 A;  4JE9 A;  1NFO A;  3M1C B;  1H9T A;  1D1C A;  2DB4 A;  2WB7 A;  5BUO A;  3B9Q A;  4LLE A;  4BJ6 A;  1DOW A;  4J30 B;  3QTH A;  2Z15 A;  2XLO A;  2ZPA A;  4KBL A;  4N06 A;  3X2Q C;  5L3Q A;  3NMI A;  5T3T A;  5DQZ A;  3JRT A;  4OIP F;  1MNE A;  1ZW3 A;  3ITF A;  4E7Z A;  2H7V C;  3K6B A;  4NTA A;  4EBJ A;  5COM A;  2W45 A;  3TJ6 A;  2CNW A;  3A11 A;  3L0I A;  3ZIB A;  4K7B A;  3SXK A;  2Q3T A;  3LS0 A;  4DXW A;  1QQ3 A;  4YL3 A;  4A2N B;  4CX9 A;  1T6Q A;  3ZQY A;  2C03 A;  256B A;  4E18 A;  1DOV A;  2WZG A;  3F47 A;  2AWY A;  3HKK A;  4NQF A;  3WHN A;  3S0X A;  1YVI A;  2AWC A;  1ZU4 A;  2EPN A;  3R7C A;  1MND A;  4E0I A;  4XPX A;  2NUT B;  3LUT B;  3MLG A;  2ZXP A;  3G4Z A;  2JPU A;  4MVM A;  1E85 A;  4HFF B;  4IAR A;  4DJ9 A;  4I1M A;  3HNJ A;  2FAP B;  1NSG B;  4G0H A;  5AC5 A;  4CIH A;  5B1A C;  1CPR A;  4JUR I;  3NG1 A;  2XLM A;  3TJ5 A;  4CDA A;  1YZA A;  1BZ4 A;  3EHN A;  3JSE O;  2L6G A;  1V74 B;  2OKU A;  2YL0 A;  3IQC A;  3TD7 A;  1JPJ A;  2CCY A;  5CI9 A;  4LER A;  1FR0 A;  4OIO F;  5TJ5 E;  1TQG A;  3K1I C;  3K66 A;  3L8J A;  3QW1 A;  3UMH A;  5JLI A;  1G8X A;  2XLH A;  3DXJ F;  1O3U A;  2VH3 A;  3EJN A;  1T5O A;  1ZU5 A;  1LE4 A;  3ASN C;  1FMV A;  1NU9 C;  3H65 A;  1D0Z A;  2R7X A;  1H7I A;  3EZI A;  1Y4C A;  4MW8 A;  2YEV A;  5JS5 A;  2A0B A;  1ORJ A;  5KYW B;  2J8W A;  2HSB A;  2L7A A;  1ZHW A;  2J46 A;  4JIO A;  3H2U A;  2H8A A;  4CDY A;  5A6B A;  3ABK C;  4KI2 A;  2QE9 A;  4U5H A;  2OJQ A;  4IB4 A;  4AE4 A;  1OCC C;  4GYT A;  2IYL D;  1JR8 A;  3O6X A;  1BR4 A;  2A6E F;  2C04 A;  5COG A;  3VF0 A;  1J8M F;  3GM3 A;  3ZQV A;  5T3W A;  4AX2 A;  3DE8 A;  1HMO A;  1PV3 A;  3J06 A;  1EQ1 A;  4O79 A;  1W2W A;  2KC3 A;  2A69 F;  1XWJ A;  3HNL A;  3B0U X;  1ZVZ A;  2KGO A;  1SR2 A;  1WOL A;  2WZF A;  4PFP A;  4A4A A;  4QI0 A;  4G7H F;  1U0B B;  3ABM C;  1JAF A;  1F1M A;  4ULW A;  3IPM O;  2IOQ A;  2L9J A;  1YLM A;  2OJE D;  2NUP B;  2XXA A;  1H9G A;  2R7S A;  5JUA A;  1MMN A;  3C8Z A;  3K1I A;  4PFO A;  2P61 A;  2D5R B;  3ZTM A;  4MTF A;  3NKE A;  3W8H A;  5BQH A;  4BJ5 C;  1WAT A;  1I4Z A;  1Q0F A;  3MX3 A;  4M63 A;  2OEX A;  1AEP A;  2LCH A;  3AQB A;  3KYI A;  1LM3 B;  1OW6 A;  4PJL A;  1ORY A;  2OEV A;  1LS4 A;  5JVE A;  1YZC A;  4PJJ A;  3AG2 C;  1FMW A;  4IWB A;  2NSF A;  3JYH A;  2XM4 A;  4JC7 A;  2A0U A;  2TMV P;  5B3I A;  4YL1 A;  1NZE A;  3U9J A;  3FOO A;  2GA0 A;  4XLN F;  5KYN A;  3OWT A;  4IJJ A;  1TWA A;  2QUP A;  2EIJ C;  2Q7R A;  3KYJ A;  4XEV A;  1JRA A;  1AVO B;  2NUT A;  4LLC A;  3FXH A;  3OEO A;  1R5I D;  1ZHZ A;  1OCZ C;  2H7B A;  2VCB A;  2YLI A;  2ZXW C;  5FZT A;  3S28 A;  4P9T A;  4NC3 A;  4JJG A;  5EGY A;  1R4T A;  1SMY F;  2Q4F A;  2YVK A;  1TFO B;  1GS9 A;  1JPN A;  4CJO A;  2LIG A;  2YHS A;  3V5Y A;  2J7P D;  2BL2 A;  3CQZ A;  1OKK D;  4C7O B;  1LVK A;  1EA8 A;  3U0C A;  2ZD9 A;  3EGD B;  3U3B A;  3O10 A;  1TWH A;  4JTC B;  3AQC A;  1VLS A;  4BJ5 A;  3US6 A;  4JEA A;  4KNV A;  3FMS A;  2QNL A;  3LES A;  1TR2 A;  1WN0 A;  4MS2 A;  1CPQ A;  4MVZ A;  5KYW A;  4L6R A;  3DI5 A;  1OQC A;  5CIV A;  2Y3B A;  4G78 A;  3NRH A;  3I5P A;  3DAG A;  5L0J A;  1Z5Z A;  4Z9I A;  2UUI A;  1RMV A;  2Y3H A;  2Y3G A;  4MVS A;  3HJC A;  3FAJ A;  4K1O A;  4EHP A;  3PMR A;  3DKA A;  4XWJ A;  3ZG1 A;  1T6I A;  4EKW A;  2NG1 A;  1G5Z A;  1XZQ A;  3EPV A;  3T4R A;  5E3C A;  1HW1 A;  3RYL A;  3T6G B;  2Q00 A;  2YL7 A;  1MMD A;  4JTD B;  3GAN A;  1OR2 A;  1A0B A;  2A6H F;  4HE8 D;  3UR3 C;  1M6T A;  1NFN A;  3LNR A;  3SZR A;  4MVU A;  4BPM A;  2L6F A;  3NDB B;  4D4N A;  1V54 C;  2J9B A;  3LJB A;  4Q4Z F;  1LIH A;  1ZYR F;  1FAP B;  1HE9 A;  4O6N A;  1Q0M A;  3QVZ A;  2XL6 A;  3SXZ A;  2G3V A;  3M15 A;  4C3B A;  3CEX A;  4EWC A;  2BC5 A;  2HKV A;  2YQY A;  3Q7G A;  4LDR A;  4WGY A;  3TUL A;  5A6K A;  2M4E A;  1E83 A;  3N24 A;  1G4U S; 
#chains in the Genus database with same CATH homology
 2J8W A;  4CDY A;  1E86 A;  5JP7 A;  4IB4 A;  4IAQ A;  1RCP A;  4CDV A;  1MQV A;  3ZQV A;  3DE8 A;  3QW0 A;  4EIY A;  4ER9 A;  3HNL A;  5JRA A;  1E83 A;  3L1M A;  3TOM A;  1CGN A;  5JSL A;  2YLG A;  1JAF A;  4WGZ A;  3M4C A;  1A7V A;  2YLD A;  2QLA A;  5JUA A;  3ZTM A;  4N6H A;  3FOP A;  5AGF A;  4ULV A;  1LM3 B;  1E84 A;  1EKY A;  3HNK A;  5JVE A;  1YZC A;  2XLD A;  2XM4 A;  2XLE A;  5B3I A;  3NMK A;  3FOO A;  1CGO A;  4JKV A;  5JT4 A;  3NMJ A;  4CIP A;  3TOL A;  2YLI A;  2YL1 A;  4CJG A;  4NC3 A;  3ZTZ A;  3M79 A;  1APC A;  4JE9 A;  2XLW A;  4CJO A;  3HNI A;  3C63 A;  1S05 A;  2XM0 A;  2XLO A;  3IQ6 A;  2XLV A;  3NMI A;  3M4B A;  1QPU A;  1YYJ A;  3VRC A;  4JEA A;  3C62 A;  4JEB A;  1CPQ A;  3DE9 A;  1QQ3 A;  2YKZ A;  4L6R A;  4CX9 A;  3ZQY A;  4D4X A;  256B A;  2XL8 A;  3ZWI A;  1E85 A;  4IAR A;  3HNJ A;  1YYX A;  2YL7 A;  1CPR A;  2YL3 A;  2XLM A;  4CDA A;  1YZA A;  1M6T A;  3QVY A;  3U8P A;  2YL0 A;  4N4W A;  1GQA A;  2CCY A;  4D4N A;  2J9B A;  3QW1 A;  3IQ5 A;  5JLI A;  2XLH A;  1BBH A;  3QVZ A;  2XL6 A;  3M15 A;  4U9E A;  4U9D A;  2BC5 A;  4WGY A;  1NBB A;  5JS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...