5JP7A

Ferrous leu 16 val mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAVTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
molecule keywords Cytochrome c'
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jp7A00
1YZAA 4JKVA 1QQ3A 4D4NA 1M6TA 1E84A 3M4CA 4CX9A 1A7VA 2YL3A 1CGNA 1RCPA 3IQ5A 1EKYA 4IARA 3DE8A 2YLGA 3C62A 4NC3A 4CDAA 3ZTZA 3ZWIA 1LM3B 2XLDA 2CCYA 2XLMA 2XLHA 3M79A 3VRCA 256BA 4N6HA 1E86A 2BC5A 4IB4A 1S05A 4IAQA 4U9DA 3TOMA 2XLWA 3ZTMA 3M15A 5JT4A 1E83A 2XL6A 5JS5A 2XLEA 4ULVA 4JEAA 1QPUA 3M4BA 3QVYA 3HNIA 4CIPA 1E85A 2YL1A 1CGOA 1BBHA 3QW0A 1YYXA 3FOOA 3IQ6A 3QVZA 2YKZA 1GQAA 4L6RA 4D4XA 3C63A 2YL7A 3TOLA 3FOPA 3NMKA 3DE9A 3NMJA 2XLOA 4U9EA 2YLDA 2YLIA 2XL8A 3HNLA 2XM4A 1JAFA 3ZQVA 2XM0A 1CPRA 2QLAA 5JP7A 5JRAA 1YZCA 4JE9A 5B3IA 2XLVA 4WGZA 2J8WA 3U8PA 5JVEA 5AGFA 3L1MA 4CDYA 4CJGA 1YYJA 1CPQA 2J9BA 4WGYA 2YL0A 3HNJA 4N4WA 4CDVA 3NMIA 1MQVA 4EIYA 1NBBA 5JUAA 5JSLA 4JEBA 5JLIA 3HNKA 1APCA 4CJOA 4ER9A 3ZQYA 3QW1A
chains in the Genus database with same CATH superfamily
5DS4A 1RKEB 3DD7A 1H7IA 3O39A 4CIHA 2OJED 3GM1A 3B0VC 1A0BA 5KYYB 2V26A 3NYJA 1JPNA 2HSQA 4N6CA 4ULWA 2W4BA 1Q0GA 2CGEA 1N1CA 3L8IA 2OU6A 2L81A 1RCPA 1ZHWA 5T3TA 2LSEA 3DAGA 2UUHA 2H7OA 2QNLA 5BUOA 2ETSA 2CNWD 1AEPA 2WB7A 2NG1A 2R7OA 1OW8A 3EGXB 1KTMA 2Y3HA 4RD9A 4U5EE 2J46A 2KYHA 3JRTA 2NUPB 3K66A 4GYTA 2LFFA 4QI2A 4WJ0A 2YLGA 3C62A 3O55A 5DQTA 3W2VA 3AGTA 1MMAA 3C8GA 3ZTZA 1OW7A 3K1HA 4J30B 3ASNC 4B6IA 2EPNA 1YAUO 3FDQA 2E87A 4ZLDA 2OEVA 256BA 2Y39A 4OD4A 3WG7C 2EIMC 4IB4A 4YT5A 3DAFA 2XLWA 4C7OA 2L6FA 3ZTMA 1V54C 5AC5A 4YT2A 3AG2C 2GDCA 1XWJA 1H9GA 2J9VA 3GM3A 1Y6DA 3I5QA 3NYLA 3RH3A 4XPXA 4JEAA 1QPUA 2QE9A 3C8GD 5TJ5E 3QVYA 2W4MA 4AE4B 3X1OA 2X51A 4PFOA 1UFBA 4XEFA 1NU7D 2B0JA 1E85A 1BBHA 4ZLCA 4QDLA 4OIOF 4BJ5A 1HE1A 1SR2A 3FOOA 1ZW2A 2LK4A 1RXQA 3C7JA 5B1AC 3QVZA 1RKEA 3GM2A 2BL2A 4JC7A 2J0WA 3MLGA 2DI3A 2GFHA 1YARO 3SEOA 1NFOA 3DJUB 5HSWA 4DRHB 2YL7A 2PX3A 1PCXA 2IXMA 3TOLA 1ORSC 4YT4A 5K0IA 5E3AA 4Q7CA 2A6EF 2A0BA 3RQEA 3U9JA 2YQYA 1RMVA 1A41A 3NMJA 3FAJA 4JTAB 1FR0A 5BQIA 5CIVA 4U9EA 2R25A 2PF4E 2B0HA 3AG1C 1F1MA 3HNLA 1O5HA 3JSEO 4A2NB 4Z9HA 1FMVA 3ZQVA 2H7VC 3C18A 4HFFB 3RF3A 2LD6A 4OIPF 1CPRA 1UG7A 1M2VA 4DBRA 2RD9A 3LS0A 1RKCA 1VMAA 3EG9B 2YZSA 1OCOC 3LLIA 5JP7A 3IQCA 5BQHA 1I4YA 4KBLA 1QVXA 1LI5A 1V74B 1RJ9A 2I15A 4JE9A 4JJFA 4JVSA 3W4YA 2L9JA 5L0JA 1ZW3A 3NYMA 4WGZA 1MNEA 4BJTA 3W8HA 5DS5A 1AVOB 2GWWA 1Z23A 3BEHA 3U8PA 1D1BA 2VC9A 1SYQA 3QMKA 4GEHA 2Q00A 1VB5A 4O7GA 3WHNA 1BDJB 1QLEC 4Q4ZF 3JYHA 1FFHA 4U5HA 1CPQA 1L7CA 2IXOA 4FESA 5BQGA 3B29A 4G78A 3AG4C 4JJGA 4P9FA 1E2XA 3JTLO 3T6BA 1TR2A 2IXNA 4XLPF 1OW6A 3AOUA 4MVRA 4F4BA 2VCCA 2YL0A 1WWPA 5A6JA 4CDVA 1HW2A 4O6NA 1C17M 2XS1A 2AWYA 3RIPA 3S0XA 1D1CA 3K1IC 4WABA 1IZMA 2UUIA 5JSLA 3NDBB 1VLTA 2YEVA 2ZXWC 4ONSA 3V5XA 3RYLA 4JEBA 4O79A 2HSBA 3LLKA 3V5YA 2W45A 1GGQA 5DQZA 1VTMP 1NG1A 3OEOA 5KYXB 3U5SA 1FTSA 4XQ1A 3ZQYA 2EPOA 3PCVA 4X0RA 4D4XA 4JW1A 4G7ZF 4OINF 1YZAA 1O87A 4K0DA 4NY3A 4YL0A 4D4NA 3E70C 3ABLC 2P61A 2NUTB 3TQOA 5F5HA 4O6YA 3E9VA 1HE9A 3B0UX 2ZD9A 1OKKA 4HEAJ 4J7TA 3S90A 3U0CA 2D4UA 2WVOA 3QZCA 4Z9JA 3K6BA 2M64A 3ITFA 4MVSA 3L8JA 4IARA 3F46A 1ZU5A 3DWWA 2AP3A 2QUPA 2C03A 3HKKA 3HTKC 4P9TA 5KYXA 1QSPA 4DRIB 1JR8A 1ZVZA 1T9KA 3K7DA 1PV3A 1O3UA 1ZYRF 4BPMA 2XRHA 1LVKA 2C04A 1T6IA 4XTKA 1YVIA 2XLMA 3ECSA 3RW0A 4EWCA 3UNGC 3B9QA 4O6MA 3S28A 1OKKD 1PD1A 1XZQA 1Z5ZA 4N6HA 3BRJA 3I4UA 1E86A 1H6GA 2XL4A 3R2PA 1S05A 4PK4A 4IAQA 4CS8A 3IPMO 4LLCA 2XXAA 3ABMC 4XEVA 4E7ZA 3M15A 3GANA 1LS4A 1GS9A 3AQCA 3JYYA 3LEVA 1G8XA 1ST6A 4JTDB 2EIKC 4NTFA 3W2WA 4CS9A 4CSAA 4DVYP 4DVZA 3M4BA 3EZHA 5E3CA 2DYSC 4MVOA 3ZSUA 3QW0A 3U2LA 2PBEA 4P6IC 4RBNA 1NLXA 4C7OB 1D0XA 1YYXA 3IQ6A 1NU9C 3FXHA 4DRJB 1LIHA 5EK0A 1SF8A 1T6UA 3IQTA 3MYFA 1KU2A 1U6HA 2YKZA 3LNRA 3UMIA 1GQAA 1FMWA 2KC3A 4PFPA 4QI0A 1ORJA 4KNWA 3SXMA 2R9RB 2VH3A 3C63A 3DXJF 4EBJA 5A6KA 1WATA 1ZHZA 3A9CA 1Z7Qc 4BJ1A 4FWVA 4MVUA 2OOCA 2LQGA 3C8GB 3DE9A 3QW1A 3UMHA 4MTFA 1C02A 3VM6A 1YLMA 2RSEB 2YLIA 4FX5A 3UMKA 2KW3C 2OCCC 2XM4A 4BG0A 1V55C 3DM9B 4MW3A 2IOQA 3GWLA 4MQ9F 2KGOA 3AQBA 4E0IA 1U0BB 2QLAA 1EQ1A 3H2VA 2W9YA 1YZCA 4AL0A 3EPVA 2WVNA 1I4ZA 3S9OA 2GA0A 5FZTA 4GQHA 3PDMP 3TJ5A 2Q9BA 2FGYA 2XLVA 4JURI 1OQCA 5KYUB 2AU5A 1VK5A 3AG3C 3PMRA 4H4KC 4LLEA 3RVZA 2OJQA 5AGFA 5JVEA 2A0UA 5KYNA 3IHUA 4LERA 5COMA 1Q0KA 1MMNA 4KI2A 1YJGA 1SZIA 2GAQA 5L0FA 4AX2A 2G3VA 2ZXOA 4NTBA 1LE4A 3LS1A 1VLSA 1FAPB 2J9BA 4C3DA 4EKWA 1L3PA 2YWAA 1VYKA 3HNJA 3TK0A 4DBQA 3EFOB 3EGDA 1TWCA 5IY5C 2LP4A 3GODA 2J7PD 2BE5F 2ZXRA 3PHF2 1BR4A 5GPGB 1T01A 2VCAA 1OR2A 2KQ9A 3H65A 5F5FA 2XXAB 2TMVP 4K1OA 4YN0B 4CJOA 2HS5A 4ER9A 1JPJA 3T4RA 2P0NA 4PJLA 5COGA 3KYIA 1M56C 3KKBA 2IM8A 4MVZA 3SNHA 3AJMA 5FCLA 2WZLA 1H9TA 2HJ3A 3MYIA 3DJNB 1R5ID 3C8ZA 1QQ3A 4CS9C 1M6TA 3N2ZB 4OIRF 1E84A 1RJ9B 4CSAC 1C03A 3A11A 3M4CA 5L0GA 1CGME 4MS2A 4J32B 4CBEA 3EFOA 5HV9A 1CGNA 3I5PA 3Q6MA 4E0HA 5B3SC 4OIQF 2HMZA 2KNHA 2LCHA 2WVQA 3POVA 2HUJA 4M63A 3KMIA 4LDRA 4MTGA 4U5BE 2R02A 2LFDA 3DE8A 3U3FA 4BEMJ 3RFYA 4NC3A 3U8VA 2QTVA 3GWNA 4CDAA 1HMOA 3F47A 2YHSA 3ZWIA 3EHMA 3RKOF 4IGGA 1LM3B 1Z3IX 2R03A 2XLDA 4JIOA 3VF0A 3EGXA 1NZEA 3OWTA 2XLHA 1MMDA 3O6XA 3G4XA 1U89A 2NUPA 4JCHA 1QKRA 2R05A 2Q7RA 5D91A 1Q0FA 4JCZA 3VRCA 4ANJA 4OD5A 2NSGA 3QTHA 1WTYA 1LE2A 3O10A 2BC5A 2Y3GA 4NQFA 1BR2A 4YK5A 3TOMA 3EG9A 4DOZA 4EHPA 5AC4A 3DZAA 5KYWB 4KC9A 5JT4A 4JRZA 4G0HA 4LDKA 3DM5A 1PD0A 2P1AA 2X0CA 3SXKA 3WODF 2WL8A 5L3VA 3N0TA 4CS8C 2XL6A 1WN0A 5JS5A 2AVKA 2FAPB 2XLEA 1A7DA 3MFNA 4E7SA 1DOVA 4CIPA 1V4AA 1Z63A 2YL1A 2HV7A 2VB6A 4U5DE 1J8YF 2EINC 4N06A 5L0HA 1EI7A 1OCRC 4PACA 5A6AA 2A6HF 4MW8A 1OXBA 3ZIBA 1YA7O 5DLJA 3LEOA 4DXWA 2J7PA 5L0DA 1T6QA 3B0PA 2R7RA 2Q3TA 3KH2A 3RVYA 3LJBA 1G4WR 1OCCC 4LDQA 1ZU4A 2WZGA 2CW0F 1LI7A 3AGUA 3MBGA 4FAPB 4UDVA 2J9WA 1ZHYA 2Y3DA 3KPHA 4Q5SF 3FOPA 4YJWA 1YDIA 4I44A 3JCUQ 2J9UA 2XSEA 3G4ZA 3K33A 2ASRA 4IWBA 4E17A 4LACB 3GEHA 3Q6NA 4PJJA 2XL8A 4BJ6C 5E33A 2VCBA 3DKAA 1JAFA 2XM0A 4IJJA 1G5ZA 2P6VA 2IBFA 1TKNA 3T6GB 1NFNA 4YL1A 2LIGA 3MX3A 4XEKA 5JRAA 1VYIA 1HY5A 2KJGA 1ZHTA 2OKUA 4PJNA 2OEXA 1EA8A 2CDQA 2MYSA 2P7VA 2Y3BA 3ABKC 2J8WA 1FNTc 1LS1A 4JTCB 1Y4CA 3CZ6A 1YA9A 3L1MA 3SYNA 4CDYA 4CJGA 4DJ9A 5L0CA 4BJ5C 1AUEA 5A6BD 4H54A 2DB4A 3RQFA 1YYJA 1JOGA 1M2OA 1Q0DA 2YVKA 1WOLA 2XS8A 4NCQA 5F28E 4U5CE 2Q4FA 4WGYA 1FFTC 2OQMA 1W2WA 1K40A 2EPKX 4N4WA 4EUKB 3J06A 4U5GA 1OR3A 2OG2A 4R32A 3ZG1A 1R4TA 1MQVA 3W8IA 5T1DB 4CS7A 4EIYA 3JSZA 3B71A 5JUAA 2R7XA 3S29A 3TD7A 2G62A 3HNKA 1TFOB 4MVQA 1APCA 2M4EA 3OA1A 2ZPAA 3EGDB 3KYJA 3X2QC 2Q9CA 3NKEA 2F22A 2R7WA 2O9XA 3T6JA 3SP1A 1IW7F 4EBBA 2R7VA 4JKVA 4YWQA 3EH1A 3EHNA 1K05A 2EILC 3US6A 2PP4A 4CX9A 3TJ6A 1A7VA 2YL3A 5L0IA 4A4AA 1K04A 1ORYA 2EPLX 3IQ5A 3T9OA 3G50A 2HV6A 3EQLF 3U3BA 1I5NA 4C3BA 1XZPA 5KYWA 1EKYA 3FMSA 3LUTB 3L0IA 3ASOC 2R7SA 1ZHXA 2R7UA 1JRAA 2PNOA 4G7OF 4XPWA 2HZ8A 4AE4A 3CSKA 5CI9A 2HJMA 1B68A 2CCYA 3Q7LA 3UR3C 1A7EA 2YRFA 2AWCA 3ATPA 4IRUA 1NSGB 2Z15A 3IEEA 4I1MA 5KYYA 3M79A 3NRHA 1G4US 3CEXA 2I8BA 1TQGA 1ZZPA 3CQZA 3L34A 3N24A 3DMDA 3ZVRA 3GORA 5D92A 3K1IA 4K7BA 1D0YA 4U9DA 4W8KA 3UGPA 5A69A 3FVYA 2A68F 4IAOA 5A6BA 1E83A 2G3KA 2PX0A 4XLNF 3RQGA 5KYUA 2DGJA 4ULVA 2KSFA 4E18A 3HNIA 3DI5A 2R7QA 1CGOA 4PR9A 1TWAA 4MVMA 2IYLD 3JRMO 4MNDA 1JMWA 1LPEA 1T5OA 4BEJA 4HFKB 2JX0A 4XPYA 1BR1A 4J7YA 5E2QA 5DVWA 3GEEA 2JPUA 2ZXPA 5T3WA 2HMQA 1Z6AA 3FHDA 1J8MF 1BZ4A 1S7ZA 1DOWA 2D5RB 2EIJC 2VASA 2QY9A 3HLZA 4KNVA 4L6RA 5CI8A 2NUTA 1TWHA 3U9MA 3VYWA 4AL1A 5EHHA 3EH2A 4XWJA 3NKDA 2CYDA 3TULA 3VAYA 3NMKA 3ZDLA 3SZRA 1D1AA 2L7AA 2XLOA 2Y69C 3GEIA 4W8PA 2YLDA 4I1OB 4RDAA 2MWQA 3KL4A 2WZFA 4AK9A 3WAQA 3UGOA 3V5ZA 3EJNA 3H2UA 4NTAA 4C3EA 1WGWA 4BJ6A 4MTOA 1VOMA 2NSFA 1M57C 3LAYA 1D0ZA 3S27A 2L6GA 3Q7GA 4YT8A 1MMGA 2DYRC 3HJCA 5B3IA 5EGYA 4EBKA 4Z9IA 3S84A 2HKVA 2KK1A 1KNYA 1QZXA 3JZ0A 1TWGA 1TFKB 4G7HF 3CAXA 1WASA 4PJMA 2R7TA 2PFDA 3EZIA 2J45A 2H8AA 4U5FE 5DS6A 1HW1A 1M2VB 3SXYA 3LNMB 3U2MA 1GM5A 4YL3A 1MNDA 2MHRA 5COFA 4HE8D 2IXPA 3R7CA 3NMIA 3SXZA 3V7OA 5L3QA 1NBBA 1OCZC 2V3CC 3FAPB 3ZC4A 3JT1A 2J0XA 2HFIA 4JZAA 4I3MA 1LKXA 2A69F 1HMDA 1OXKA 2NPUA 3M1CB 2EPMX 2CNWA 2H7BA 3NG1A 5JLIA 2FFHA 2A1DD 5B1BC 1SMYF 2L6HA 2Q9AA 3LESA 2ICWG 1Q0MA 2JD3A
chains in the Genus database with same CATH topology
1YZAA 4JKVA 1QQ3A 4D4NA 1M6TA 1E84A 3M4CA 4CX9A 1A7VA 2YL3A 1CGNA 1RCPA 3IQ5A 1EKYA 4IARA 3DE8A 2YLGA 3C62A 4NC3A 4CDAA 3ZTZA 3ZWIA 1LM3B 2XLDA 2CCYA 2XLMA 2XLHA 3M79A 3VRCA 256BA 4N6HA 1E86A 2BC5A 4IB4A 1S05A 4IAQA 4U9DA 3TOMA 2XLWA 3ZTMA 3M15A 5JT4A 1E83A 2XL6A 5JS5A 2XLEA 4ULVA 4JEAA 1QPUA 3M4BA 3QVYA 3HNIA 4CIPA 1E85A 2YL1A 1CGOA 1BBHA 3QW0A 1YYXA 3FOOA 3IQ6A 3QVZA 2YKZA 1GQAA 4L6RA 4D4XA 3C63A 2YL7A 3TOLA 3FOPA 3NMKA 3DE9A 3NMJA 2XLOA 4U9EA 2YLDA 2YLIA 2XL8A 3HNLA 2XM4A 1JAFA 3ZQVA 2XM0A 1CPRA 2QLAA 5JP7A 5JRAA 1YZCA 4JE9A 5B3IA 2XLVA 4WGZA 2J8WA 3U8PA 5JVEA 5AGFA 3L1MA 4CDYA 4CJGA 1YYJA 1CPQA 2J9BA 4WGYA 2YL0A 3HNJA 4N4WA 4CDVA 3NMIA 1MQVA 4EIYA 1NBBA 5JUAA 5JSLA 4JEBA 5JLIA 3HNKA 1APCA 4CJOA 4ER9A 3ZQYA 3QW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YZA A;  4JKV A;  1QQ3 A;  4D4N A;  1M6T A;  1E84 A;  3M4C A;  4CX9 A;  1A7V A;  2YL3 A;  1CGN A;  1RCP A;  3IQ5 A;  1EKY A;  4IAR A;  3DE8 A;  2YLG A;  3C62 A;  4NC3 A;  4CDA A;  3ZTZ A;  3ZWI A;  1LM3 B;  2XLD A;  2CCY A;  2XLM A;  2XLH A;  3M79 A;  3VRC A;  256B A;  4N6H A;  1E86 A;  2BC5 A;  4IB4 A;  1S05 A;  4IAQ A;  4U9D A;  3TOM A;  2XLW A;  3ZTM A;  3M15 A;  5JT4 A;  1E83 A;  2XL6 A;  5JS5 A;  2XLE A;  4ULV A;  4JEA A;  1QPU A;  3M4B A;  3QVY A;  3HNI A;  4CIP A;  1E85 A;  2YL1 A;  1CGO A;  1BBH A;  3QW0 A;  1YYX A;  3FOO A;  3IQ6 A;  3QVZ A;  2YKZ A;  1GQA A;  4L6R A;  4D4X A;  3C63 A;  2YL7 A;  3TOL A;  3FOP A;  3NMK A;  3DE9 A;  3NMJ A;  2XLO A;  4U9E A;  2YLD A;  2YLI A;  2XL8 A;  3HNL A;  2XM4 A;  1JAF A;  3ZQV A;  2XM0 A;  1CPR A;  2QLA A;  5JP7 A;  5JRA A;  1YZC A;  4JE9 A;  5B3I A;  2XLV A;  4WGZ A;  2J8W A;  3U8P A;  5JVE A;  5AGF A;  3L1M A;  4CDY A;  4CJG A;  1YYJ A;  1CPQ A;  2J9B A;  4WGY A;  2YL0 A;  3HNJ A;  4N4W A;  4CDV A;  3NMI A;  1MQV A;  4EIY A;  1NBB A;  5JUA A;  5JSL A;  4JEB A;  5JLI A;  3HNK A;  1APC A;  4CJO A;  4ER9 A;  3ZQY A;  3QW1 A; 
#chains in the Genus database with same CATH topology
 5DS4 A;  1RKE B;  3DD7 A;  1H7I A;  3O39 A;  4CIH A;  2OJE D;  3GM1 A;  3B0V C;  1A0B A;  5KYY B;  2V26 A;  3NYJ A;  1JPN A;  2HSQ A;  4N6C A;  4ULW A;  2W4B A;  1Q0G A;  2CGE A;  1N1C A;  3L8I A;  2OU6 A;  2L81 A;  1RCP A;  1ZHW A;  5T3T A;  2LSE A;  3DAG A;  2UUH A;  2H7O A;  2QNL A;  5BUO A;  2ETS A;  2CNW D;  1AEP A;  2WB7 A;  2NG1 A;  2R7O A;  1OW8 A;  3EGX B;  1KTM A;  2Y3H A;  4RD9 A;  4U5E E;  2J46 A;  2KYH A;  3JRT A;  2NUP B;  3K66 A;  4GYT A;  2LFF A;  4QI2 A;  4WJ0 A;  2YLG A;  3C62 A;  3O55 A;  5DQT A;  3W2V A;  3AGT A;  1MMA A;  3C8G A;  3ZTZ A;  1OW7 A;  3K1H A;  4J30 B;  3ASN C;  4B6I A;  2EPN A;  1YAU O;  3FDQ A;  2E87 A;  4ZLD A;  2OEV A;  256B A;  2Y39 A;  4OD4 A;  3WG7 C;  2EIM C;  4IB4 A;  4YT5 A;  3DAF A;  2XLW A;  4C7O A;  2L6F A;  3ZTM A;  1V54 C;  5AC5 A;  4YT2 A;  3AG2 C;  2GDC A;  1XWJ A;  1H9G A;  2J9V A;  3GM3 A;  1Y6D A;  3I5Q A;  3NYL A;  3RH3 A;  4XPX A;  4JEA A;  1QPU A;  2QE9 A;  3C8G D;  5TJ5 E;  3QVY A;  2W4M A;  4AE4 B;  3X1O A;  2X51 A;  4PFO A;  1UFB A;  4XEF A;  1NU7 D;  2B0J A;  1E85 A;  1BBH A;  4ZLC A;  4QDL A;  4OIO F;  4BJ5 A;  1HE1 A;  1SR2 A;  3FOO A;  1ZW2 A;  2LK4 A;  1RXQ A;  3C7J A;  5B1A C;  3QVZ A;  1RKE A;  3GM2 A;  2BL2 A;  4JC7 A;  2J0W A;  3MLG A;  2DI3 A;  2GFH A;  1YAR O;  3SEO A;  1NFO A;  3DJU B;  5HSW A;  4DRH B;  2YL7 A;  2PX3 A;  1PCX A;  2IXM A;  3TOL A;  1ORS C;  4YT4 A;  5K0I A;  5E3A A;  4Q7C A;  2A6E F;  2A0B A;  3RQE A;  3U9J A;  2YQY A;  1RMV A;  1A41 A;  3NMJ A;  3FAJ A;  4JTA B;  1FR0 A;  5BQI A;  5CIV A;  4U9E A;  2R25 A;  2PF4 E;  2B0H A;  3AG1 C;  1F1M A;  3HNL A;  1O5H A;  3JSE O;  4A2N B;  4Z9H A;  1FMV A;  3ZQV A;  2H7V C;  3C18 A;  4HFF B;  3RF3 A;  2LD6 A;  4OIP F;  1CPR A;  1UG7 A;  1M2V A;  4DBR A;  2RD9 A;  3LS0 A;  1RKC A;  1VMA A;  3EG9 B;  2YZS A;  1OCO C;  3LLI A;  5JP7 A;  3IQC A;  5BQH A;  1I4Y A;  4KBL A;  1QVX A;  1LI5 A;  1V74 B;  1RJ9 A;  2I15 A;  4JE9 A;  4JJF A;  4JVS A;  3W4Y A;  2L9J A;  5L0J A;  1ZW3 A;  3NYM A;  4WGZ A;  1MNE A;  4BJT A;  3W8H A;  5DS5 A;  1AVO B;  2GWW A;  1Z23 A;  3BEH A;  3U8P A;  1D1B A;  2VC9 A;  1SYQ A;  3QMK A;  4GEH A;  2Q00 A;  1VB5 A;  4O7G A;  3WHN A;  1BDJ B;  1QLE C;  4Q4Z F;  3JYH A;  1FFH A;  4U5H A;  1CPQ A;  1L7C A;  2IXO A;  4FES A;  5BQG A;  3B29 A;  4G78 A;  3AG4 C;  4JJG A;  4P9F A;  1E2X A;  3JTL O;  3T6B A;  1TR2 A;  2IXN A;  4XLP F;  1OW6 A;  3AOU A;  4MVR A;  4F4B A;  2VCC A;  2YL0 A;  1WWP A;  5A6J A;  4CDV A;  1HW2 A;  4O6N A;  1C17 M;  2XS1 A;  2AWY A;  3RIP A;  3S0X A;  1D1C A;  3K1I C;  4WAB A;  1IZM A;  2UUI A;  5JSL A;  3NDB B;  1VLT A;  2YEV A;  2ZXW C;  4ONS A;  3V5X A;  3RYL A;  4JEB A;  4O79 A;  2HSB A;  3LLK A;  3V5Y A;  2W45 A;  1GGQ A;  5DQZ A;  1VTM P;  1NG1 A;  3OEO A;  5KYX B;  3U5S A;  1FTS A;  4XQ1 A;  3ZQY A;  2EPO A;  3PCV A;  4X0R A;  4D4X A;  4JW1 A;  4G7Z F;  4OIN F;  1YZA A;  1O87 A;  4K0D A;  4NY3 A;  4YL0 A;  4D4N A;  3E70 C;  3ABL C;  2P61 A;  2NUT B;  3TQO A;  5F5H A;  4O6Y A;  3E9V A;  1HE9 A;  3B0U X;  2ZD9 A;  1OKK A;  4HEA J;  4J7T A;  3S90 A;  3U0C A;  2D4U A;  2WVO A;  3QZC A;  4Z9J A;  3K6B A;  2M64 A;  3ITF A;  4MVS A;  3L8J A;  4IAR A;  3F46 A;  1ZU5 A;  3DWW A;  2AP3 A;  2QUP A;  2C03 A;  3HKK A;  3HTK C;  4P9T A;  5KYX A;  1QSP A;  4DRI B;  1JR8 A;  1ZVZ A;  1T9K A;  3K7D A;  1PV3 A;  1O3U A;  1ZYR F;  4BPM A;  2XRH A;  1LVK A;  2C04 A;  1T6I A;  4XTK A;  1YVI A;  2XLM A;  3ECS A;  3RW0 A;  4EWC A;  3UNG C;  3B9Q A;  4O6M A;  3S28 A;  1OKK D;  1PD1 A;  1XZQ A;  1Z5Z A;  4N6H A;  3BRJ A;  3I4U A;  1E86 A;  1H6G A;  2XL4 A;  3R2P A;  1S05 A;  4PK4 A;  4IAQ A;  4CS8 A;  3IPM O;  4LLC A;  2XXA A;  3ABM C;  4XEV A;  4E7Z A;  3M15 A;  3GAN A;  1LS4 A;  1GS9 A;  3AQC A;  3JYY A;  3LEV A;  1G8X A;  1ST6 A;  4JTD B;  2EIK C;  4NTF A;  3W2W A;  4CS9 A;  4CSA A;  4DVY P;  4DVZ A;  3M4B A;  3EZH A;  5E3C A;  2DYS C;  4MVO A;  3ZSU A;  3QW0 A;  3U2L A;  2PBE A;  4P6I C;  4RBN A;  1NLX A;  4C7O B;  1D0X A;  1YYX A;  3IQ6 A;  1NU9 C;  3FXH A;  4DRJ B;  1LIH A;  5EK0 A;  1SF8 A;  1T6U A;  3IQT A;  3MYF A;  1KU2 A;  1U6H A;  2YKZ A;  3LNR A;  3UMI A;  1GQA A;  1FMW A;  2KC3 A;  4PFP A;  4QI0 A;  1ORJ A;  4KNW A;  3SXM A;  2R9R B;  2VH3 A;  3C63 A;  3DXJ F;  4EBJ A;  5A6K A;  1WAT A;  1ZHZ A;  3A9C A;  1Z7Q c;  4BJ1 A;  4FWV A;  4MVU A;  2OOC A;  2LQG A;  3C8G B;  3DE9 A;  3QW1 A;  3UMH A;  4MTF A;  1C02 A;  3VM6 A;  1YLM A;  2RSE B;  2YLI A;  4FX5 A;  3UMK A;  2KW3 C;  2OCC C;  2XM4 A;  4BG0 A;  1V55 C;  3DM9 B;  4MW3 A;  2IOQ A;  3GWL A;  4MQ9 F;  2KGO A;  3AQB A;  4E0I A;  1U0B B;  2QLA A;  1EQ1 A;  3H2V A;  2W9Y A;  1YZC A;  4AL0 A;  3EPV A;  2WVN A;  1I4Z A;  3S9O A;  2GA0 A;  5FZT A;  4GQH A;  3PDM P;  3TJ5 A;  2Q9B A;  2FGY A;  2XLV A;  4JUR I;  1OQC A;  5KYU B;  2AU5 A;  1VK5 A;  3AG3 C;  3PMR A;  4H4K C;  4LLE A;  3RVZ A;  2OJQ A;  5AGF A;  5JVE A;  2A0U A;  5KYN A;  3IHU A;  4LER A;  5COM A;  1Q0K A;  1MMN A;  4KI2 A;  1YJG A;  1SZI A;  2GAQ A;  5L0F A;  4AX2 A;  2G3V A;  2ZXO A;  4NTB A;  1LE4 A;  3LS1 A;  1VLS A;  1FAP B;  2J9B A;  4C3D A;  4EKW A;  1L3P A;  2YWA A;  1VYK A;  3HNJ A;  3TK0 A;  4DBQ A;  3EFO B;  3EGD A;  1TWC A;  5IY5 C;  2LP4 A;  3GOD A;  2J7P D;  2BE5 F;  2ZXR A;  3PHF 2;  1BR4 A;  5GPG B;  1T01 A;  2VCA A;  1OR2 A;  2KQ9 A;  3H65 A;  5F5F A;  2XXA B;  2TMV P;  4K1O A;  4YN0 B;  4CJO A;  2HS5 A;  4ER9 A;  1JPJ A;  3T4R A;  2P0N A;  4PJL A;  5COG A;  3KYI A;  1M56 C;  3KKB A;  2IM8 A;  4MVZ A;  3SNH A;  3AJM A;  5FCL A;  2WZL A;  1H9T A;  2HJ3 A;  3MYI A;  3DJN B;  1R5I D;  3C8Z A;  1QQ3 A;  4CS9 C;  1M6T A;  3N2Z B;  4OIR F;  1E84 A;  1RJ9 B;  4CSA C;  1C03 A;  3A11 A;  3M4C A;  5L0G A;  1CGM E;  4MS2 A;  4J32 B;  4CBE A;  3EFO A;  5HV9 A;  1CGN A;  3I5P A;  3Q6M A;  4E0H A;  5B3S C;  4OIQ F;  2HMZ A;  2KNH A;  2LCH A;  2WVQ A;  3POV A;  2HUJ A;  4M63 A;  3KMI A;  4LDR A;  4MTG A;  4U5B E;  2R02 A;  2LFD A;  3DE8 A;  3U3F A;  4BEM J;  3RFY A;  4NC3 A;  3U8V A;  2QTV A;  3GWN A;  4CDA A;  1HMO A;  3F47 A;  2YHS A;  3ZWI A;  3EHM A;  3RKO F;  4IGG A;  1LM3 B;  1Z3I X;  2R03 A;  2XLD A;  4JIO A;  3VF0 A;  3EGX A;  1NZE A;  3OWT A;  2XLH A;  1MMD A;  3O6X A;  3G4X A;  1U89 A;  2NUP A;  4JCH A;  1QKR A;  2R05 A;  2Q7R A;  5D91 A;  1Q0F A;  4JCZ A;  3VRC A;  4ANJ A;  4OD5 A;  2NSG A;  3QTH A;  1WTY A;  1LE2 A;  3O10 A;  2BC5 A;  2Y3G A;  4NQF A;  1BR2 A;  4YK5 A;  3TOM A;  3EG9 A;  4DOZ A;  4EHP A;  5AC4 A;  3DZA A;  5KYW B;  4KC9 A;  5JT4 A;  4JRZ A;  4G0H A;  4LDK A;  3DM5 A;  1PD0 A;  2P1A A;  2X0C A;  3SXK A;  3WOD F;  2WL8 A;  5L3V A;  3N0T A;  4CS8 C;  2XL6 A;  1WN0 A;  5JS5 A;  2AVK A;  2FAP B;  2XLE A;  1A7D A;  3MFN A;  4E7S A;  1DOV A;  4CIP A;  1V4A A;  1Z63 A;  2YL1 A;  2HV7 A;  2VB6 A;  4U5D E;  1J8Y F;  2EIN C;  4N06 A;  5L0H A;  1EI7 A;  1OCR C;  4PAC A;  5A6A A;  2A6H F;  4MW8 A;  1OXB A;  3ZIB A;  1YA7 O;  5DLJ A;  3LEO A;  4DXW A;  2J7P A;  5L0D A;  1T6Q A;  3B0P A;  2R7R A;  2Q3T A;  3KH2 A;  3RVY A;  3LJB A;  1G4W R;  1OCC C;  4LDQ A;  1ZU4 A;  2WZG A;  2CW0 F;  1LI7 A;  3AGU A;  3MBG A;  4FAP B;  4UDV A;  2J9W A;  1ZHY A;  2Y3D A;  3KPH A;  4Q5S F;  3FOP A;  4YJW A;  1YDI A;  4I44 A;  3JCU Q;  2J9U A;  2XSE A;  3G4Z A;  3K33 A;  2ASR A;  4IWB A;  4E17 A;  4LAC B;  3GEH A;  3Q6N A;  4PJJ A;  2XL8 A;  4BJ6 C;  5E33 A;  2VCB A;  3DKA A;  1JAF A;  2XM0 A;  4IJJ A;  1G5Z A;  2P6V A;  2IBF A;  1TKN A;  3T6G B;  1NFN A;  4YL1 A;  2LIG A;  3MX3 A;  4XEK A;  5JRA A;  1VYI A;  1HY5 A;  2KJG A;  1ZHT A;  2OKU A;  4PJN A;  2OEX A;  1EA8 A;  2CDQ A;  2MYS A;  2P7V A;  2Y3B A;  3ABK C;  2J8W A;  1FNT c;  1LS1 A;  4JTC B;  1Y4C A;  3CZ6 A;  1YA9 A;  3L1M A;  3SYN A;  4CDY A;  4CJG A;  4DJ9 A;  5L0C A;  4BJ5 C;  1AUE A;  5A6B D;  4H54 A;  2DB4 A;  3RQF A;  1YYJ A;  1JOG A;  1M2O A;  1Q0D A;  2YVK A;  1WOL A;  2XS8 A;  4NCQ A;  5F28 E;  4U5C E;  2Q4F A;  4WGY A;  1FFT C;  2OQM A;  1W2W A;  1K40 A;  2EPK X;  4N4W A;  4EUK B;  3J06 A;  4U5G A;  1OR3 A;  2OG2 A;  4R32 A;  3ZG1 A;  1R4T A;  1MQV A;  3W8I A;  5T1D B;  4CS7 A;  4EIY A;  3JSZ A;  3B71 A;  5JUA A;  2R7X A;  3S29 A;  3TD7 A;  2G62 A;  3HNK A;  1TFO B;  4MVQ A;  1APC A;  2M4E A;  3OA1 A;  2ZPA A;  3EGD B;  3KYJ A;  3X2Q C;  2Q9C A;  3NKE A;  2F22 A;  2R7W A;  2O9X A;  3T6J A;  3SP1 A;  1IW7 F;  4EBB A;  2R7V A;  4JKV A;  4YWQ A;  3EH1 A;  3EHN A;  1K05 A;  2EIL C;  3US6 A;  2PP4 A;  4CX9 A;  3TJ6 A;  1A7V A;  2YL3 A;  5L0I A;  4A4A A;  1K04 A;  1ORY A;  2EPL X;  3IQ5 A;  3T9O A;  3G50 A;  2HV6 A;  3EQL F;  3U3B A;  1I5N A;  4C3B A;  1XZP A;  5KYW A;  1EKY A;  3FMS A;  3LUT B;  3L0I A;  3ASO C;  2R7S A;  1ZHX A;  2R7U A;  1JRA A;  2PNO A;  4G7O F;  4XPW A;  2HZ8 A;  4AE4 A;  3CSK A;  5CI9 A;  2HJM A;  1B68 A;  2CCY A;  3Q7L A;  3UR3 C;  1A7E A;  2YRF A;  2AWC A;  3ATP A;  4IRU A;  1NSG B;  2Z15 A;  3IEE A;  4I1M A;  5KYY A;  3M79 A;  3NRH A;  1G4U S;  3CEX A;  2I8B A;  1TQG A;  1ZZP A;  3CQZ A;  3L34 A;  3N24 A;  3DMD A;  3ZVR A;  3GOR A;  5D92 A;  3K1I A;  4K7B A;  1D0Y A;  4U9D A;  4W8K A;  3UGP A;  5A69 A;  3FVY A;  2A68 F;  4IAO A;  5A6B A;  1E83 A;  2G3K A;  2PX0 A;  4XLN F;  3RQG A;  5KYU A;  2DGJ A;  4ULV A;  2KSF A;  4E18 A;  3HNI A;  3DI5 A;  2R7Q A;  1CGO A;  4PR9 A;  1TWA A;  4MVM A;  2IYL D;  3JRM O;  4MND A;  1JMW A;  1LPE A;  1T5O A;  4BEJ A;  4HFK B;  2JX0 A;  4XPY A;  1BR1 A;  4J7Y A;  5E2Q A;  5DVW A;  3GEE A;  2JPU A;  2ZXP A;  5T3W A;  2HMQ A;  1Z6A A;  3FHD A;  1J8M F;  1BZ4 A;  1S7Z A;  1DOW A;  2D5R B;  2EIJ C;  2VAS A;  2QY9 A;  3HLZ A;  4KNV A;  4L6R A;  5CI8 A;  2NUT A;  1TWH A;  3U9M A;  3VYW A;  4AL1 A;  5EHH A;  3EH2 A;  4XWJ A;  3NKD A;  2CYD A;  3TUL A;  3VAY A;  3NMK A;  3ZDL A;  3SZR A;  1D1A A;  2L7A A;  2XLO A;  2Y69 C;  3GEI A;  4W8P A;  2YLD A;  4I1O B;  4RDA A;  2MWQ A;  3KL4 A;  2WZF A;  4AK9 A;  3WAQ A;  3UGO A;  3V5Z A;  3EJN A;  3H2U A;  4NTA A;  4C3E A;  1WGW A;  4BJ6 A;  4MTO A;  1VOM A;  2NSF A;  1M57 C;  3LAY A;  1D0Z A;  3S27 A;  2L6G A;  3Q7G A;  4YT8 A;  1MMG A;  2DYR C;  3HJC A;  5B3I A;  5EGY A;  4EBK A;  4Z9I A;  3S84 A;  2HKV A;  2KK1 A;  1KNY A;  1QZX A;  3JZ0 A;  1TWG A;  1TFK B;  4G7H F;  3CAX A;  1WAS A;  4PJM A;  2R7T A;  2PFD A;  3EZI A;  2J45 A;  2H8A A;  4U5F E;  5DS6 A;  1HW1 A;  1M2V B;  3SXY A;  3LNM B;  3U2M A;  1GM5 A;  4YL3 A;  1MND A;  2MHR A;  5COF A;  4HE8 D;  2IXP A;  3R7C A;  3NMI A;  3SXZ A;  3V7O A;  5L3Q A;  1NBB A;  1OCZ C;  2V3C C;  3FAP B;  3ZC4 A;  3JT1 A;  2J0X A;  2HFI A;  4JZA A;  4I3M A;  1LKX A;  2A69 F;  1HMD A;  1OXK A;  2NPU A;  3M1C B;  2EPM X;  2CNW A;  2H7B A;  3NG1 A;  5JLI A;  2FFH A;  2A1D D;  5B1B C;  1SMY F;  2L6H A;  2Q9A A;  3LES A;  2ICW G;  1Q0M A;  2JD3 A; 
#chains in the Genus database with same CATH homology
 1YZA A;  4JKV A;  1QQ3 A;  4D4N A;  1M6T A;  1E84 A;  3M4C A;  4CX9 A;  1A7V A;  2YL3 A;  1CGN A;  1RCP A;  3IQ5 A;  1EKY A;  4IAR A;  3DE8 A;  2YLG A;  3C62 A;  4NC3 A;  4CDA A;  3ZTZ A;  3ZWI A;  1LM3 B;  2XLD A;  2CCY A;  2XLM A;  2XLH A;  3M79 A;  3VRC A;  256B A;  4N6H A;  1E86 A;  2BC5 A;  4IB4 A;  1S05 A;  4IAQ A;  4U9D A;  3TOM A;  2XLW A;  3ZTM A;  3M15 A;  5JT4 A;  1E83 A;  2XL6 A;  5JS5 A;  2XLE A;  4ULV A;  4JEA A;  1QPU A;  3M4B A;  3QVY A;  3HNI A;  4CIP A;  1E85 A;  2YL1 A;  1CGO A;  1BBH A;  3QW0 A;  1YYX A;  3FOO A;  3IQ6 A;  3QVZ A;  2YKZ A;  1GQA A;  4L6R A;  4D4X A;  3C63 A;  2YL7 A;  3TOL A;  3FOP A;  3NMK A;  3DE9 A;  3NMJ A;  2XLO A;  4U9E A;  2YLD A;  2YLI A;  2XL8 A;  3HNL A;  2XM4 A;  1JAF A;  3ZQV A;  2XM0 A;  1CPR A;  2QLA A;  5JP7 A;  5JRA A;  1YZC A;  4JE9 A;  5B3I A;  2XLV A;  4WGZ A;  2J8W A;  3U8P A;  5JVE A;  5AGF A;  3L1M A;  4CDY A;  4CJG A;  1YYJ A;  1CPQ A;  2J9B A;  4WGY A;  2YL0 A;  3HNJ A;  4N4W A;  4CDV A;  3NMI A;  1MQV A;  4EIY A;  1NBB A;  5JUA A;  5JSL A;  4JEB A;  5JLI A;  3HNK A;  1APC A;  4CJO A;  4ER9 A;  3ZQY A;  3QW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...