5JP7A

Ferrous leu 16 val mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAVTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jp7A00
2YL7A 1GQAA 3TOLA 2YL3A 2XLHA 3HNIA 1E86A 3M4CA 3HNLA 3L1MA 3QVYA 5JS5A 3ZQVA 1CPRA 1CPQA 2J9BA 2XLVA 4CIPA 3ZTMA 3M15A 2XLDA 3NMIA 3VRCA 4D4XA 5AGFA 3ZWIA 1NBBA 4U9DA 5JP7A 3IQ5A 4JKVA 2XLMA 3M79A 4U9EA 1EKYA 3FOOA 4WGZA 4JEBA 2J8WA 2YLIA 2XLWA 3M4BA 1S05A 1E83A 2YL1A 4N6HA 5JLIA 1E85A 1CGNA 3C62A 3QW0A 4IARA 1JAFA 1QPUA 4ER9A 4L6RA 1E84A 4JEAA 2BC5A 3DE9A 4IB4A 4NC3A 5JVEA 2QLAA 2XL8A 3NMKA 4N4WA 2YL0A 2XM0A 2CCYA 3QVZA 3ZTZA 1YZAA 4CDYA 1APCA 1MQVA 5JRAA 256BA 3HNJA 5JT4A 2XL6A 2YKZA 3TOMA 4WGYA 1M6TA 1YYXA 3NMJA 5B3IA 2YLGA 4JE9A 3HNKA 4CDAA 4CDVA 5JUAA 2XLEA 1BBHA 1CGOA 1RCPA 4CJOA 1YYJA 3FOPA 2XM4A 3ZQYA 1QQ3A 1YZCA 3QW1A 5JSLA 1A7VA 4CJGA 2XLOA 4ULVA 1LM3B 3U8PA 4CX9A 3IQ6A 4D4NA 3DE8A 3C63A 4EIYA 2YLDA 4IAQA
chains in the Genus database with same CATH superfamily
4P9FA 3EGDB 3V5YA 2G3KA 3PHF2 4Z9IA 3LS1A 2B0JA 1ST6A 5COGA 1D1CA 2X0CA 2DB4A 4YT4A 3HTKC 1GQAA 3EH2A 3GEIA 3HKKA 3TOLA 2KYHA 2L6GA 3JZ0A 2HMZA 3RYLA 3U9MA 1E86A 1XZPA 3HNLA 1EA8A 3VAYA 4BEMJ 1Y4CA 2OJQA 2OEVA 3K6BA 4MTGA 1V55C 2R03A 3GM2A 3ZQVA 2XSEA 4R32A 1ZHZA 2B0HA 2OEXA 2P6VA 1D1AA 2EPLX 2VC9A 3PDMP 2HFIA 1D1BA 2Q9CA 2XLVA 1ZHWA 3BRJA 5FCLA 5TJ5E 2J9WA 4F4BA 4PK4A 2UUHA 2IBFA 3PMRA 4E18A 4OINF 3S28A 4DOZA 5L0HA 1VLSA 3T6GB 3NKEA 3SXYA 5DS4A 3NYLA 4CS7A 1OCCC 1JPJA 2Y3HA 3LNRA 5AGFA 1QLEC 2LP4A 3C8GB 1LS1A 2FGYA 2GWWA 1RKEB 2YWAA 4U9DA 4CS9C 3FXHA 4E0IA 1NU9C 3NG1A 2NUPB 1MMNA 3I5PA 2PFDA 3DKAA 4O7GA 1NG1A 2YZSA 1YA9A 4RBNA 2J9VA 3M4BA 3V5XA 1U0BB 4EHPA 4QI0A 3EG9A 1K05A 2OG2A 1V4AA 3C62A 1VTMP 2Y3DA 1WOLA 5L3QA 1V54C 2IXPA 3ASOC 1M2OA 1U89A 3X2QC 1LIHA 1TWGA 2IM8A 1R4TA 5KYYA 2EIKC 4XPYA 2ZXWC 4K7BA 4YN0B 2R02A 4DBRA 4KC9A 3DE9A 4YT8A 2LFFA 4CSAC 2I8BA 3E9VA 3KL4A 2A6EF 1NSGB 2A68F 5B1AC 2WZFA 3UGOA 1K40A 2EPKX 4CIHA 4LLEA 4UDVA 3R7CA 4MVZA 3POVA 2YRFA 4YT5A 3I5QA 1A7DA 3UMIA 3W2WA 3VM6A 4K0DA 1MMGA 1GM5A 3C8ZA 3A9CA 4EWCA 1FNTc 5B3SC 2TMVP 4WGYA 1SMYF 2YEVA 3E70C 2VCAA 1ZYRF 3K1IA 2HZ8A 2LIGA 4CDVA 3TULA 2GA0A 4LLCA 3TK0A 5JUAA 4JC7A 1FAPB 1YJGA 2DYSC 1LS4A 1T6QA 2J46A 2LSEA 2YHSA 3KYIA 4Z9HA 1LE4A 3DD7A 4QI2A 4J30B 3FVYA 1I4YA 3FOPA 1ORYA 4N6CA 5DVWA 4XEKA 2XM4A 2Q3TA 3NRHA 5E3AA 3AQBA 4U5FE 4DRHB 2R7SA 5E33A 3IHUA 3EG9B 2DYRC 3PCVA 3U3BA 1H7IA 2AVKA 2R7OA 2R7RA 5E3CA 3CZ6A 2R9RB 2WVNA 2GAQA 1Z5ZA 3SXMA 3ABKC 1YZCA 1QKRA 1FMVA 2Y3BA 4MNDA 4G7OF 2ZPAA 1T6IA 4I3MA 1OKKD 3LJBA 5KYYB 1MNDA 4MVQA 5KYXA 1YLMA 1VYIA 4PACA 4EBBA 4WJ0A 1J8MF 1PCXA 4RD9A 4ULWA 1PV3A 2UUIA 4DVZA 5EHHA 2P0NA 3IQ6A 4D4NA 5K0IA 3BEHA 3GEEA 4IGGA 3C63A 4PJNA 5JRAA 3EGXB 2EPNA 1ZW2A 4IAQA 3H2UA 4YL1A 1M2VA 4U5CE 2XXAA 3GEHA 2QUPA 1NZEA 3KPHA 4AE4B 1FTSA 4WABA 4DVYP 2J45A 1BR2A 2MWQA 2EPMX 4AX2A 1JPNA 3ZIBA 3CEXA 4EBKA 2PP4A 3HNIA 3K7DA 1Q0GA 3M4CA 3OEOA 3DWWA 4IRUA 2C04A 4G0HA 3GORA 4IAOA 4MTOA 3S9OA 3W4YA 5KYNA 4JZAA 2GDCA 2LFDA 4I1OB 1ZU5A 3LLKA 3K1HA 2Y39A 5JS5A 4MVSA 1S7ZA 1BR4A 2PF4E 2ASRA 3U3FA 3ZC4A 5L0GA 2NUPA 1CPQA 3R2PA 4U5HA 4J32B 5CIVA 2XLDA 3LAYA 3CSKA 2Q00A 3VRCA 1OCOC 4YT2A 1AUEA 1EQ1A 2LK4A 2NPUA 5A6BA 4DXWA 1NBBA 2R7QA 3ABMC 2J7PD 3B0VC 4OD5A 3TJ5A 1Y6DA 4YL3A 2KJGA 5KYXB 2KW3C 2CDQA 4CS8C 3DXJF 2XLWA 2R05A 3W2VA 1QSPA 2L6FA 3WG7C 1S05A 2EIMC 2QTVA 4A2NB 1HW2A 4HFKB 1ZW3A 2HJMA 2HS5A 1ZVZA 2VB6A 3B9QA 2XXAB 4U5DE 1M2VB 4MVMA 4DRIB 4ER9A 5AC4A 1BZ4A 2ETSA 1NFOA 1TKNA 3SZRA 1JR8A 3RW0A 5GPGB 4DRJB 2BE5F 4XLNF 2J9UA 1Q0KA 3C7JA 3EPVA 1I4ZA 5BUOA 4NC3A 1G4US 4OIOF 5E2QA 3B0UX 2V3CC 4MW3A 5JVEA 3JYYA 1L7CA 2JD3A 2XL8A 4NQFA 1JOGA 5A69A 4JTAB 3KH2A 3QVZA 1YZAA 2A0UA 1SZIA 2MHRA 2OJED 4O6YA 1APCA 3JRTA 3QTHA 1XWJA 4Q5SF 2H7VC 2IYLD 3ABLC 1MMAA 4IWBA 1PD1A 3CQZA 3SXZA 1WWPA 2AU5A 3S29A 2HUJA 2KQ9A 3M1CB 3U8VA 3VYWA 1ZHYA 4K1OA 3TOMA 2G3VA 2OOCA 1WGWA 3NMJA 2CGEA 2YQYA 3GWLA 5HV9A 2M64A 4NTFA 2W9YA 2NUTA 3UMKA 3Q6NA 3SP1A 4EBJA 5F28E 1W2WA 2J0XA 2L81A 1SF8A 2PNOA 4NTBA 1ZHXA 1I5NA 2EILC 3U2MA 3VF0A 1T6UA 1LI5A 2NSFA 2HV6A 3RQFA 1Z6AA 3L34A 3N2ZB 3X1OA 1R5ID 4BG0A 3LESA 3S90A 1VYKA 3H65A 4YL0A 3S27A 2WVOA 5A6AA 4JURI 4ZLCA 2R7VA 3DM9B 3EGXA 3CAXA 4E7ZA 3FDQA 4YJWA 5DS5A 3QZCA 4I44A 2A6HF 1LVKA 5D92A 4AE4A 1VOMA 1IZMA 3RVYA 3AJMA 3JCUQ 4BJ5A 1JMWA 2XRHA 3GWNA 4BJTA 2ZD9A 2LD6A 4YK5A 1JRAA 3DAFA 3TJ6A 3EZHA 5D91A 1OR3A 5L0CA 1HE9A 2Z15A 4BEJA 4EIYA 2J0WA 4MQ9F 4YWQA 4G7HF 3NYMA 1ZZPA 3V5ZA 4HEAJ 1BR1A 1WATA 4JCHA 5KYWB 1VLTA 2YL7A 1HMOA 1H9TA 1Q0MA 3AGTA 1MNEA 2HMQA 1IW7F 2XL4A 1D0ZA 3EZIA 2Y69C 2CNWD 3SYNA 2YL3A 4ANJA 2XLHA 4C3BA 2Q7RA 3UNGC 1Q0DA 1C17M 1WASA 2W4BA 5A6KA 3L1MA 4MVOA 2OQMA 3N0TA 4KI2A 1RKCA 1E2XA 2NUTB 3KYJA 2ZXOA 3OWTA 4MS2A 3C18A 3EQLF 1YVIA 1KTMA 1QZXA 1AEPA 1T01A 4FX5A 4LACB 1SYQA 1O5HA 1ORJA 1NLXA 4CIPA 3ZTMA 1K04A 5T3TA 1OR2A 3IQTA 4C3DA 1YAUO 1FFTC 3DJUB 4XPXA 1NU7D 3NMIA 3I4UA 4XEFA 2XS8A 1HMDA 2JX0A 2L6HA 4NTAA 3T6JA 5DLJA 2R7WA 1G4WR 4D4XA 3ZWIA 2M4EA 4H54A 4JVSA 3C8GD 3TQOA 4BJ1A 2A1DD 5JP7A 2NG1A 3LS0A 5COFA 2P1AA 3RVZA 3G4XA 4JKVA 2XLMA 3M79A 4GEHA 4U9EA 5CI8A 3FOOA 4WGZA 5EK0A 3UGPA 1EKYA 1TQGA 3MBGA 4J7TA 4U5GA 1NFNA 2OKUA 3MLGA 2QY9A 4AK9A 2IXOA 3KKBA 3NDBB 4XPWA 2MYSA 3UR3C 4U5BE 2YL1A 1YDIA 2A0BA 1B68A 1H6GA 3QW0A 3U5SA 2HV7A 3DMDA 4IARA 2NSGA 3Q7GA 2G62A 3GM3A 4Z9JA 3EHNA 1GGQA 1OKKA 1ZHTA 2AWYA 2I15A 3FAPB 3MYFA 1OXBA 3SEOA 1C03A 1E84A 2VCBA 3F46A 4Q7CA 1TWAA 3T9OA 2QLAA 2EINC 4N4WA 1HE1A 3FAJA 4AL0A 2CCYA 1ZU4A 3ZTZA 3ZVRA 4E0HA 4CDYA 1MQVA 5L0IA 3ITFA 4NY3A 4B6IA 4MW8A 1GS9A 1QVXA 2VH3A 3DZAA 4JTDB 3UMHA 3O39A 4EKWA 1KU2A 4PFPA 5JT4A 4DBQA 5COMA 2FAPB 2YKZA 4HFFB 1HW1A 2P7VA 4BJ5C 4BJ6A 4XWJA 1O3UA 1Z7Qc 1YYXA 2DGJA 2YLGA 1FMWA 2ICWG 3OA1A 2WL8A 4JE9A 4PR9A 1D0XA 4KBLA 3T6BA 2JPUA 4I1MA 4C3EA 1TFKB 4CDAA 1LI7A 3JSEO 4JTCB 4OD4A 4QDLA 5BQHA 1T5OA 1T9KA 2L7AA 2AP3A 2OU6A 3B0PA 4FESA 1OW7A 1M56C 3ECSA 3K1IC 1MMDA 1YYJA 2A69F 2R25A 3RQGA 5BQIA 5L0JA 5DQZA 3RKOF 4JRZA 4JCZA 3AG2C 2PBEA 3TD7A 3ZQYA 2KK1A 1RMVA 3DAGA 3HLZA 2X51A 3LUTB 1V74B 3US6A 5KYWA 2VASA 1QQ3A 3K33A 1N1CA 3IEEA 3JT1A 2J7PA 3EHMA 4GYTA 3DI5A 4CJGA 2XLOA 4RDAA 3HJCA 1LM3B 2KC3A 2D5RB 2LCHA 5DQTA 2Q4FA 3K66A 5L0FA 3LNMB 4A4AA 4MVRA 4LERA 4M63A 2RD9A 3AG4C 3SNHA 2ZXRA 4CX9A 4KNVA 2O9XA 5KYUB 3DE8A 4W8PA 5AC5A 2QNLA 1YARO 4JJFA 1H9GA 2VCCA 3G4ZA 3ZDLA 1PD0A 4MVUA 2Q9AA 1TWCA 3W8HA 3Q7LA 3MYIA 4C7OA 1VMAA 2QE9A 1LPEA 3L0IA 3L8IA 3FMSA 1G5ZA 4O6MA 1UG7A 3LEVA 1YA7O 4U5EE 5F5FA 5L3VA 4OIQF 2D4UA 3F47A 1OW6A 4BPMA 1RXQA 2P61A 5DS6A 4G78A 4X0RA 3QVYA 2H7OA 3RQEA 3AOUA 2L9JA 3RF3A 3S0XA 1OXKA 2F22A 2XS1A 1CPRA 2Q9BA 3JSZA 2DI3A 3ZSUA 1VB5A 5L0DA 2AWCA 2GFHA 4MTFA 4W8KA 5A6JA 3S84A 1UFBA 2J9BA 3WAQA 1Z63A 4E7SA 1KNYA 3ASNC 3M15A 1U6HA 3JYHA 4XEVA 3RIPA 3GM1A 4LDQA 3U0CA 2R7UA 3EH1A 3JTLO 4OIRF 2CYDA 4E17A 1WN0A 2WZGA 2R7XA 4ONSA 2W4MA 2IOQA 1O87A 1Q0FA 5HSWA 2KGOA 4JIOA 4DJ9A 1D0YA 3JRMO 2IXMA 1L3PA 4CS8A 1M57C 5T1DB 3IQ5A 3EFOA 2KSFA 2PX3A 2ZXPA 3MFNA 2J8WA 4JEBA 2YLIA 3U2LA 3B29A 4FAPB 1C02A 3IPMO 1BDJB 4KNWA 1E83A 4OIPF 4N6HA 4P6IC 4PFOA 5JLIA 1E85A 1CGNA 1CGME 4XLPF 2WZLA 1A41A 1JAFA 1QPUA 1LE2A 4PJMA 3LLIA 3NYJA 2YVKA 4H4KC 3RFYA 1G8XA 4BJ6C 3GODA 4C7OB 4L6RA 5FZTA 3B71A 2C03A 4JEAA 2BC5A 2LQGA 3LEOA 2EIJC 1RJ9A 1OCZC 4IB4A 4PJLA 3NKDA 4CS9A 4EUKB 5IY5C 1F1MA 2W45A 3G50A 2Y3GA 5T3WA 3T4RA 4CBEA 1Z23A 4LDRA 3EJNA 3NMKA 5CI9A 2CW0F 2WVQA 1AVOB 2YL0A 4JJGA 2XM0A 4XTKA 1A7EA 4LDKA 2EPOA 5F5HA 3EGDA 1DOVA 3AGUA 3O6XA 4PJJA 1FFHA 3IQCA 4GQHA 256BA 2H7BA 3HNJA 3Q6MA 4JW1A 4AL1A 2CNWA 2XL6A 1LKXA 2WB7A 3O55A 1XZQA 2FFHA 1TWHA 3N24A 4FWVA 1M6TA 3KMIA 4O79A 5B3IA 1A0BA 1OQCA 3AG3C 3ATPA 5A6BD 3HNKA 3O10A 3L8JA 3AQCA 4IJJA 2HSQA 2XLEA 1OCRC 2HSBA 4CSAA 2HKVA 1BBHA 3QMKA 1CGOA 3FHDA 1J8YF 3EFOB 1RCPA 4CJOA 5EGYA 3SXKA 4ZLDA 2BL2A 3MX3A 5B1BC 3DM5A 4Q4ZF 4G7ZF 5BQGA 2E87A 2KNHA 4O6NA 1TR2A 4P9TA 5KYUA 3U9JA 1OW8A 2HJ3A 3H2VA 2RSEB 2OCCC 2R7TA 1WTYA 4XQ1A 3V7OA 1TFOB 2IXNA 3WHNA 3WODF 3A11A 3W8IA 1FR0A 1DOWA 1Z3IX 3QW1A 3C8GA 5JSLA 1RKEA 3DJNB 1A7VA 1SR2A 3AG1C 4N06A 4ULVA 4HE8D 1EI7A 1HY5A 3RH3A 3U8PA 1RJ9B 3J06A 2PX0A 2H8AA 4J7YA 4NCQA 1ORSC 2V26A 3GANA 3ZG1A 2YLDA 1VK5A
chains in the Genus database with same CATH topology
2YL7A 1GQAA 3TOLA 2YL3A 2XLHA 3HNIA 1E86A 3M4CA 3HNLA 3L1MA 3QVYA 5JS5A 3ZQVA 1CPRA 1CPQA 2J9BA 2XLVA 4CIPA 3ZTMA 3M15A 2XLDA 3NMIA 3VRCA 4D4XA 5AGFA 3ZWIA 1NBBA 4U9DA 5JP7A 3IQ5A 4JKVA 2XLMA 3M79A 4U9EA 1EKYA 3FOOA 4WGZA 4JEBA 2J8WA 2YLIA 2XLWA 3M4BA 1S05A 1E83A 2YL1A 4N6HA 5JLIA 1E85A 1CGNA 3C62A 3QW0A 4IARA 1JAFA 1QPUA 4ER9A 4L6RA 1E84A 4JEAA 2BC5A 3DE9A 4IB4A 4NC3A 5JVEA 2QLAA 2XL8A 3NMKA 4N4WA 2YL0A 2XM0A 2CCYA 3QVZA 3ZTZA 1YZAA 4CDYA 1APCA 1MQVA 5JRAA 256BA 3HNJA 5JT4A 2XL6A 2YKZA 3TOMA 4WGYA 1M6TA 1YYXA 3NMJA 5B3IA 2YLGA 4JE9A 3HNKA 4CDAA 4CDVA 5JUAA 2XLEA 1BBHA 1CGOA 1RCPA 4CJOA 1YYJA 3FOPA 2XM4A 3ZQYA 1QQ3A 1YZCA 3QW1A 5JSLA 1A7VA 4CJGA 2XLOA 4ULVA 1LM3B 3U8PA 4CX9A 3IQ6A 4D4NA 3DE8A 3C63A 4EIYA 2YLDA 4IAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YL7 A;  1GQA A;  3TOL A;  2YL3 A;  2XLH A;  3HNI A;  1E86 A;  3M4C A;  3HNL A;  3L1M A;  3QVY A;  5JS5 A;  3ZQV A;  1CPR A;  1CPQ A;  2J9B A;  2XLV A;  4CIP A;  3ZTM A;  3M15 A;  2XLD A;  3NMI A;  3VRC A;  4D4X A;  5AGF A;  3ZWI A;  1NBB A;  4U9D A;  5JP7 A;  3IQ5 A;  4JKV A;  2XLM A;  3M79 A;  4U9E A;  1EKY A;  3FOO A;  4WGZ A;  4JEB A;  2J8W A;  2YLI A;  2XLW A;  3M4B A;  1S05 A;  1E83 A;  2YL1 A;  4N6H A;  5JLI A;  1E85 A;  1CGN A;  3C62 A;  3QW0 A;  4IAR A;  1JAF A;  1QPU A;  4ER9 A;  4L6R A;  1E84 A;  4JEA A;  2BC5 A;  3DE9 A;  4IB4 A;  4NC3 A;  5JVE A;  2QLA A;  2XL8 A;  3NMK A;  4N4W A;  2YL0 A;  2XM0 A;  2CCY A;  3QVZ A;  3ZTZ A;  1YZA A;  4CDY A;  1APC A;  1MQV A;  5JRA A;  256B A;  3HNJ A;  5JT4 A;  2XL6 A;  2YKZ A;  3TOM A;  4WGY A;  1M6T A;  1YYX A;  3NMJ A;  5B3I A;  2YLG A;  4JE9 A;  3HNK A;  4CDA A;  4CDV A;  5JUA A;  2XLE A;  1BBH A;  1CGO A;  1RCP A;  4CJO A;  1YYJ A;  3FOP A;  2XM4 A;  3ZQY A;  1QQ3 A;  1YZC A;  3QW1 A;  5JSL A;  1A7V A;  4CJG A;  2XLO A;  4ULV A;  1LM3 B;  3U8P A;  4CX9 A;  3IQ6 A;  4D4N A;  3DE8 A;  3C63 A;  4EIY A;  2YLD A;  4IAQ A; 
#chains in the Genus database with same CATH topology
 4P9F A;  3EGD B;  3V5Y A;  2G3K A;  3PHF 2;  4Z9I A;  3LS1 A;  2B0J A;  1ST6 A;  5COG A;  1D1C A;  2X0C A;  2DB4 A;  4YT4 A;  3HTK C;  1GQA A;  3EH2 A;  3GEI A;  3HKK A;  3TOL A;  2KYH A;  2L6G A;  3JZ0 A;  2HMZ A;  3RYL A;  3U9M A;  1E86 A;  1XZP A;  3HNL A;  1EA8 A;  3VAY A;  4BEM J;  1Y4C A;  2OJQ A;  2OEV A;  3K6B A;  4MTG A;  1V55 C;  2R03 A;  3GM2 A;  3ZQV A;  2XSE A;  4R32 A;  1ZHZ A;  2B0H A;  2OEX A;  2P6V A;  1D1A A;  2EPL X;  2VC9 A;  3PDM P;  2HFI A;  1D1B A;  2Q9C A;  2XLV A;  1ZHW A;  3BRJ A;  5FCL A;  5TJ5 E;  2J9W A;  4F4B A;  4PK4 A;  2UUH A;  2IBF A;  3PMR A;  4E18 A;  4OIN F;  3S28 A;  4DOZ A;  5L0H A;  1VLS A;  3T6G B;  3NKE A;  3SXY A;  5DS4 A;  3NYL A;  4CS7 A;  1OCC C;  1JPJ A;  2Y3H A;  3LNR A;  5AGF A;  1QLE C;  2LP4 A;  3C8G B;  1LS1 A;  2FGY A;  2GWW A;  1RKE B;  2YWA A;  4U9D A;  4CS9 C;  3FXH A;  4E0I A;  1NU9 C;  3NG1 A;  2NUP B;  1MMN A;  3I5P A;  2PFD A;  3DKA A;  4O7G A;  1NG1 A;  2YZS A;  1YA9 A;  4RBN A;  2J9V A;  3M4B A;  3V5X A;  1U0B B;  4EHP A;  4QI0 A;  3EG9 A;  1K05 A;  2OG2 A;  1V4A A;  3C62 A;  1VTM P;  2Y3D A;  1WOL A;  5L3Q A;  1V54 C;  2IXP A;  3ASO C;  1M2O A;  1U89 A;  3X2Q C;  1LIH A;  1TWG A;  2IM8 A;  1R4T A;  5KYY A;  2EIK C;  4XPY A;  2ZXW C;  4K7B A;  4YN0 B;  2R02 A;  4DBR A;  4KC9 A;  3DE9 A;  4YT8 A;  2LFF A;  4CSA C;  2I8B A;  3E9V A;  3KL4 A;  2A6E F;  1NSG B;  2A68 F;  5B1A C;  2WZF A;  3UGO A;  1K40 A;  2EPK X;  4CIH A;  4LLE A;  4UDV A;  3R7C A;  4MVZ A;  3POV A;  2YRF A;  4YT5 A;  3I5Q A;  1A7D A;  3UMI A;  3W2W A;  3VM6 A;  4K0D A;  1MMG A;  1GM5 A;  3C8Z A;  3A9C A;  4EWC A;  1FNT c;  5B3S C;  2TMV P;  4WGY A;  1SMY F;  2YEV A;  3E70 C;  2VCA A;  1ZYR F;  3K1I A;  2HZ8 A;  2LIG A;  4CDV A;  3TUL A;  2GA0 A;  4LLC A;  3TK0 A;  5JUA A;  4JC7 A;  1FAP B;  1YJG A;  2DYS C;  1LS4 A;  1T6Q A;  2J46 A;  2LSE A;  2YHS A;  3KYI A;  4Z9H A;  1LE4 A;  3DD7 A;  4QI2 A;  4J30 B;  3FVY A;  1I4Y A;  3FOP A;  1ORY A;  4N6C A;  5DVW A;  4XEK A;  2XM4 A;  2Q3T A;  3NRH A;  5E3A A;  3AQB A;  4U5F E;  4DRH B;  2R7S A;  5E33 A;  3IHU A;  3EG9 B;  2DYR C;  3PCV A;  3U3B A;  1H7I A;  2AVK A;  2R7O A;  2R7R A;  5E3C A;  3CZ6 A;  2R9R B;  2WVN A;  2GAQ A;  1Z5Z A;  3SXM A;  3ABK C;  1YZC A;  1QKR A;  1FMV A;  2Y3B A;  4MND A;  4G7O F;  2ZPA A;  1T6I A;  4I3M A;  1OKK D;  3LJB A;  5KYY B;  1MND A;  4MVQ A;  5KYX A;  1YLM A;  1VYI A;  4PAC A;  4EBB A;  4WJ0 A;  1J8M F;  1PCX A;  4RD9 A;  4ULW A;  1PV3 A;  2UUI A;  4DVZ A;  5EHH A;  2P0N A;  3IQ6 A;  4D4N A;  5K0I A;  3BEH A;  3GEE A;  4IGG A;  3C63 A;  4PJN A;  5JRA A;  3EGX B;  2EPN A;  1ZW2 A;  4IAQ A;  3H2U A;  4YL1 A;  1M2V A;  4U5C E;  2XXA A;  3GEH A;  2QUP A;  1NZE A;  3KPH A;  4AE4 B;  1FTS A;  4WAB A;  4DVY P;  2J45 A;  1BR2 A;  2MWQ A;  2EPM X;  4AX2 A;  1JPN A;  3ZIB A;  3CEX A;  4EBK A;  2PP4 A;  3HNI A;  3K7D A;  1Q0G A;  3M4C A;  3OEO A;  3DWW A;  4IRU A;  2C04 A;  4G0H A;  3GOR A;  4IAO A;  4MTO A;  3S9O A;  3W4Y A;  5KYN A;  4JZA A;  2GDC A;  2LFD A;  4I1O B;  1ZU5 A;  3LLK A;  3K1H A;  2Y39 A;  5JS5 A;  4MVS A;  1S7Z A;  1BR4 A;  2PF4 E;  2ASR A;  3U3F A;  3ZC4 A;  5L0G A;  2NUP A;  1CPQ A;  3R2P A;  4U5H A;  4J32 B;  5CIV A;  2XLD A;  3LAY A;  3CSK A;  2Q00 A;  3VRC A;  1OCO C;  4YT2 A;  1AUE A;  1EQ1 A;  2LK4 A;  2NPU A;  5A6B A;  4DXW A;  1NBB A;  2R7Q A;  3ABM C;  2J7P D;  3B0V C;  4OD5 A;  3TJ5 A;  1Y6D A;  4YL3 A;  2KJG A;  5KYX B;  2KW3 C;  2CDQ A;  4CS8 C;  3DXJ F;  2XLW A;  2R05 A;  3W2V A;  1QSP A;  2L6F A;  3WG7 C;  1S05 A;  2EIM C;  2QTV A;  4A2N B;  1HW2 A;  4HFK B;  1ZW3 A;  2HJM A;  2HS5 A;  1ZVZ A;  2VB6 A;  3B9Q A;  2XXA B;  4U5D E;  1M2V B;  4MVM A;  4DRI B;  4ER9 A;  5AC4 A;  1BZ4 A;  2ETS A;  1NFO A;  1TKN A;  3SZR A;  1JR8 A;  3RW0 A;  5GPG B;  4DRJ B;  2BE5 F;  4XLN F;  2J9U A;  1Q0K A;  3C7J A;  3EPV A;  1I4Z A;  5BUO A;  4NC3 A;  1G4U S;  4OIO F;  5E2Q A;  3B0U X;  2V3C C;  4MW3 A;  5JVE A;  3JYY A;  1L7C A;  2JD3 A;  2XL8 A;  4NQF A;  1JOG A;  5A69 A;  4JTA B;  3KH2 A;  3QVZ A;  1YZA A;  2A0U A;  1SZI A;  2MHR A;  2OJE D;  4O6Y A;  1APC A;  3JRT A;  3QTH A;  1XWJ A;  4Q5S F;  2H7V C;  2IYL D;  3ABL C;  1MMA A;  4IWB A;  1PD1 A;  3CQZ A;  3SXZ A;  1WWP A;  2AU5 A;  3S29 A;  2HUJ A;  2KQ9 A;  3M1C B;  3U8V A;  3VYW A;  1ZHY A;  4K1O A;  3TOM A;  2G3V A;  2OOC A;  1WGW A;  3NMJ A;  2CGE A;  2YQY A;  3GWL A;  5HV9 A;  2M64 A;  4NTF A;  2W9Y A;  2NUT A;  3UMK A;  3Q6N A;  3SP1 A;  4EBJ A;  5F28 E;  1W2W A;  2J0X A;  2L81 A;  1SF8 A;  2PNO A;  4NTB A;  1ZHX A;  1I5N A;  2EIL C;  3U2M A;  3VF0 A;  1T6U A;  1LI5 A;  2NSF A;  2HV6 A;  3RQF A;  1Z6A A;  3L34 A;  3N2Z B;  3X1O A;  1R5I D;  4BG0 A;  3LES A;  3S90 A;  1VYK A;  3H65 A;  4YL0 A;  3S27 A;  2WVO A;  5A6A A;  4JUR I;  4ZLC A;  2R7V A;  3DM9 B;  3EGX A;  3CAX A;  4E7Z A;  3FDQ A;  4YJW A;  5DS5 A;  3QZC A;  4I44 A;  2A6H F;  1LVK A;  5D92 A;  4AE4 A;  1VOM A;  1IZM A;  3RVY A;  3AJM A;  3JCU Q;  4BJ5 A;  1JMW A;  2XRH A;  3GWN A;  4BJT A;  2ZD9 A;  2LD6 A;  4YK5 A;  1JRA A;  3DAF A;  3TJ6 A;  3EZH A;  5D91 A;  1OR3 A;  5L0C A;  1HE9 A;  2Z15 A;  4BEJ A;  4EIY A;  2J0W A;  4MQ9 F;  4YWQ A;  4G7H F;  3NYM A;  1ZZP A;  3V5Z A;  4HEA J;  1BR1 A;  1WAT A;  4JCH A;  5KYW B;  1VLT A;  2YL7 A;  1HMO A;  1H9T A;  1Q0M A;  3AGT A;  1MNE A;  2HMQ A;  1IW7 F;  2XL4 A;  1D0Z A;  3EZI A;  2Y69 C;  2CNW D;  3SYN A;  2YL3 A;  4ANJ A;  2XLH A;  4C3B A;  2Q7R A;  3UNG C;  1Q0D A;  1C17 M;  1WAS A;  2W4B A;  5A6K A;  3L1M A;  4MVO A;  2OQM A;  3N0T A;  4KI2 A;  1RKC A;  1E2X A;  2NUT B;  3KYJ A;  2ZXO A;  3OWT A;  4MS2 A;  3C18 A;  3EQL F;  1YVI A;  1KTM A;  1QZX A;  1AEP A;  1T01 A;  4FX5 A;  4LAC B;  1SYQ A;  1O5H A;  1ORJ A;  1NLX A;  4CIP A;  3ZTM A;  1K04 A;  5T3T A;  1OR2 A;  3IQT A;  4C3D A;  1YAU O;  1FFT C;  3DJU B;  4XPX A;  1NU7 D;  3NMI A;  3I4U A;  4XEF A;  2XS8 A;  1HMD A;  2JX0 A;  2L6H A;  4NTA A;  3T6J A;  5DLJ A;  2R7W A;  1G4W R;  4D4X A;  3ZWI A;  2M4E A;  4H54 A;  4JVS A;  3C8G D;  3TQO A;  4BJ1 A;  2A1D D;  5JP7 A;  2NG1 A;  3LS0 A;  5COF A;  2P1A A;  3RVZ A;  3G4X A;  4JKV A;  2XLM A;  3M79 A;  4GEH A;  4U9E A;  5CI8 A;  3FOO A;  4WGZ A;  5EK0 A;  3UGP A;  1EKY A;  1TQG A;  3MBG A;  4J7T A;  4U5G A;  1NFN A;  2OKU A;  3MLG A;  2QY9 A;  4AK9 A;  2IXO A;  3KKB A;  3NDB B;  4XPW A;  2MYS A;  3UR3 C;  4U5B E;  2YL1 A;  1YDI A;  2A0B A;  1B68 A;  1H6G A;  3QW0 A;  3U5S A;  2HV7 A;  3DMD A;  4IAR A;  2NSG A;  3Q7G A;  2G62 A;  3GM3 A;  4Z9J A;  3EHN A;  1GGQ A;  1OKK A;  1ZHT A;  2AWY A;  2I15 A;  3FAP B;  3MYF A;  1OXB A;  3SEO A;  1C03 A;  1E84 A;  2VCB A;  3F46 A;  4Q7C A;  1TWA A;  3T9O A;  2QLA A;  2EIN C;  4N4W A;  1HE1 A;  3FAJ A;  4AL0 A;  2CCY A;  1ZU4 A;  3ZTZ A;  3ZVR A;  4E0H A;  4CDY A;  1MQV A;  5L0I A;  3ITF A;  4NY3 A;  4B6I A;  4MW8 A;  1GS9 A;  1QVX A;  2VH3 A;  3DZA A;  4JTD B;  3UMH A;  3O39 A;  4EKW A;  1KU2 A;  4PFP A;  5JT4 A;  4DBQ A;  5COM A;  2FAP B;  2YKZ A;  4HFF B;  1HW1 A;  2P7V A;  4BJ5 C;  4BJ6 A;  4XWJ A;  1O3U A;  1Z7Q c;  1YYX A;  2DGJ A;  2YLG A;  1FMW A;  2ICW G;  3OA1 A;  2WL8 A;  4JE9 A;  4PR9 A;  1D0X A;  4KBL A;  3T6B A;  2JPU A;  4I1M A;  4C3E A;  1TFK B;  4CDA A;  1LI7 A;  3JSE O;  4JTC B;  4OD4 A;  4QDL A;  5BQH A;  1T5O A;  1T9K A;  2L7A A;  2AP3 A;  2OU6 A;  3B0P A;  4FES A;  1OW7 A;  1M56 C;  3ECS A;  3K1I C;  1MMD A;  1YYJ A;  2A69 F;  2R25 A;  3RQG A;  5BQI A;  5L0J A;  5DQZ A;  3RKO F;  4JRZ A;  4JCZ A;  3AG2 C;  2PBE A;  3TD7 A;  3ZQY A;  2KK1 A;  1RMV A;  3DAG A;  3HLZ A;  2X51 A;  3LUT B;  1V74 B;  3US6 A;  5KYW A;  2VAS A;  1QQ3 A;  3K33 A;  1N1C A;  3IEE A;  3JT1 A;  2J7P A;  3EHM A;  4GYT A;  3DI5 A;  4CJG A;  2XLO A;  4RDA A;  3HJC A;  1LM3 B;  2KC3 A;  2D5R B;  2LCH A;  5DQT A;  2Q4F A;  3K66 A;  5L0F A;  3LNM B;  4A4A A;  4MVR A;  4LER A;  4M63 A;  2RD9 A;  3AG4 C;  3SNH A;  2ZXR A;  4CX9 A;  4KNV A;  2O9X A;  5KYU B;  3DE8 A;  4W8P A;  5AC5 A;  2QNL A;  1YAR O;  4JJF A;  1H9G A;  2VCC A;  3G4Z A;  3ZDL A;  1PD0 A;  4MVU A;  2Q9A A;  1TWC A;  3W8H A;  3Q7L A;  3MYI A;  4C7O A;  1VMA A;  2QE9 A;  1LPE A;  3L0I A;  3L8I A;  3FMS A;  1G5Z A;  4O6M A;  1UG7 A;  3LEV A;  1YA7 O;  4U5E E;  5F5F A;  5L3V A;  4OIQ F;  2D4U A;  3F47 A;  1OW6 A;  4BPM A;  1RXQ A;  2P61 A;  5DS6 A;  4G78 A;  4X0R A;  3QVY A;  2H7O A;  3RQE A;  3AOU A;  2L9J A;  3RF3 A;  3S0X A;  1OXK A;  2F22 A;  2XS1 A;  1CPR A;  2Q9B A;  3JSZ A;  2DI3 A;  3ZSU A;  1VB5 A;  5L0D A;  2AWC A;  2GFH A;  4MTF A;  4W8K A;  5A6J A;  3S84 A;  1UFB A;  2J9B A;  3WAQ A;  1Z63 A;  4E7S A;  1KNY A;  3ASN C;  3M15 A;  1U6H A;  3JYH A;  4XEV A;  3RIP A;  3GM1 A;  4LDQ A;  3U0C A;  2R7U A;  3EH1 A;  3JTL O;  4OIR F;  2CYD A;  4E17 A;  1WN0 A;  2WZG A;  2R7X A;  4ONS A;  2W4M A;  2IOQ A;  1O87 A;  1Q0F A;  5HSW A;  2KGO A;  4JIO A;  4DJ9 A;  1D0Y A;  3JRM O;  2IXM A;  1L3P A;  4CS8 A;  1M57 C;  5T1D B;  3IQ5 A;  3EFO A;  2KSF A;  2PX3 A;  2ZXP A;  3MFN A;  2J8W A;  4JEB A;  2YLI A;  3U2L A;  3B29 A;  4FAP B;  1C02 A;  3IPM O;  1BDJ B;  4KNW A;  1E83 A;  4OIP F;  4N6H A;  4P6I C;  4PFO A;  5JLI A;  1E85 A;  1CGN A;  1CGM E;  4XLP F;  2WZL A;  1A41 A;  1JAF A;  1QPU A;  1LE2 A;  4PJM A;  3LLI A;  3NYJ A;  2YVK A;  4H4K C;  3RFY A;  1G8X A;  4BJ6 C;  3GOD A;  4C7O B;  4L6R A;  5FZT A;  3B71 A;  2C03 A;  4JEA A;  2BC5 A;  2LQG A;  3LEO A;  2EIJ C;  1RJ9 A;  1OCZ C;  4IB4 A;  4PJL A;  3NKD A;  4CS9 A;  4EUK B;  5IY5 C;  1F1M A;  2W45 A;  3G50 A;  2Y3G A;  5T3W A;  3T4R A;  4CBE A;  1Z23 A;  4LDR A;  3EJN A;  3NMK A;  5CI9 A;  2CW0 F;  2WVQ A;  1AVO B;  2YL0 A;  4JJG A;  2XM0 A;  4XTK A;  1A7E A;  4LDK A;  2EPO A;  5F5H A;  3EGD A;  1DOV A;  3AGU A;  3O6X A;  4PJJ A;  1FFH A;  3IQC A;  4GQH A;  256B A;  2H7B A;  3HNJ A;  3Q6M A;  4JW1 A;  4AL1 A;  2CNW A;  2XL6 A;  1LKX A;  2WB7 A;  3O55 A;  1XZQ A;  2FFH A;  1TWH A;  3N24 A;  4FWV A;  1M6T A;  3KMI A;  4O79 A;  5B3I A;  1A0B A;  1OQC A;  3AG3 C;  3ATP A;  5A6B D;  3HNK A;  3O10 A;  3L8J A;  3AQC A;  4IJJ A;  2HSQ A;  2XLE A;  1OCR C;  2HSB A;  4CSA A;  2HKV A;  1BBH A;  3QMK A;  1CGO A;  3FHD A;  1J8Y F;  3EFO B;  1RCP A;  4CJO A;  5EGY A;  3SXK A;  4ZLD A;  2BL2 A;  3MX3 A;  5B1B C;  3DM5 A;  4Q4Z F;  4G7Z F;  5BQG A;  2E87 A;  2KNH A;  4O6N A;  1TR2 A;  4P9T A;  5KYU A;  3U9J A;  1OW8 A;  2HJ3 A;  3H2V A;  2RSE B;  2OCC C;  2R7T A;  1WTY A;  4XQ1 A;  3V7O A;  1TFO B;  2IXN A;  3WHN A;  3WOD F;  3A11 A;  3W8I A;  1FR0 A;  1DOW A;  1Z3I X;  3QW1 A;  3C8G A;  5JSL A;  1RKE A;  3DJN B;  1A7V A;  1SR2 A;  3AG1 C;  4N06 A;  4ULV A;  4HE8 D;  1EI7 A;  1HY5 A;  3RH3 A;  3U8P A;  1RJ9 B;  3J06 A;  2PX0 A;  2H8A A;  4J7Y A;  4NCQ A;  1ORS C;  2V26 A;  3GAN A;  3ZG1 A;  2YLD A;  1VK5 A; 
#chains in the Genus database with same CATH homology
 2YL7 A;  1GQA A;  3TOL A;  2YL3 A;  2XLH A;  3HNI A;  1E86 A;  3M4C A;  3HNL A;  3L1M A;  3QVY A;  5JS5 A;  3ZQV A;  1CPR A;  1CPQ A;  2J9B A;  2XLV A;  4CIP A;  3ZTM A;  3M15 A;  2XLD A;  3NMI A;  3VRC A;  4D4X A;  5AGF A;  3ZWI A;  1NBB A;  4U9D A;  5JP7 A;  3IQ5 A;  4JKV A;  2XLM A;  3M79 A;  4U9E A;  1EKY A;  3FOO A;  4WGZ A;  4JEB A;  2J8W A;  2YLI A;  2XLW A;  3M4B A;  1S05 A;  1E83 A;  2YL1 A;  4N6H A;  5JLI A;  1E85 A;  1CGN A;  3C62 A;  3QW0 A;  4IAR A;  1JAF A;  1QPU A;  4ER9 A;  4L6R A;  1E84 A;  4JEA A;  2BC5 A;  3DE9 A;  4IB4 A;  4NC3 A;  5JVE A;  2QLA A;  2XL8 A;  3NMK A;  4N4W A;  2YL0 A;  2XM0 A;  2CCY A;  3QVZ A;  3ZTZ A;  1YZA A;  4CDY A;  1APC A;  1MQV A;  5JRA A;  256B A;  3HNJ A;  5JT4 A;  2XL6 A;  2YKZ A;  3TOM A;  4WGY A;  1M6T A;  1YYX A;  3NMJ A;  5B3I A;  2YLG A;  4JE9 A;  3HNK A;  4CDA A;  4CDV A;  5JUA A;  2XLE A;  1BBH A;  1CGO A;  1RCP A;  4CJO A;  1YYJ A;  3FOP A;  2XM4 A;  3ZQY A;  1QQ3 A;  1YZC A;  3QW1 A;  5JSL A;  1A7V A;  4CJG A;  2XLO A;  4ULV A;  1LM3 B;  3U8P A;  4CX9 A;  3IQ6 A;  4D4N A;  3DE8 A;  3C63 A;  4EIY A;  2YLD A;  4IAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...