5JP7A

Ferrous leu 16 val mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAVTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jp7A00
1MQVA 5JP7A 2XM0A 2YL0A 1YZAA 3HNJA 3M4CA 4CDAA 2YLGA 4EIYA 1E83A 2XLEA 4NC3A 2XM4A 4IB4A 1S05A 3ZQVA 256BA 3C62A 5JT4A 3VRCA 4D4NA 3M79A 3ZQYA 3QVZA 2J9BA 4U9DA 2XL6A 1NBBA 5JS5A 1YYJA 3M15A 4WGYA 3TOLA 2CCYA 4D4XA 4JEBA 2YLIA 2BC5A 5AGFA 4IARA 3FOOA 1APCA 1E86A 3HNKA 4CJGA 3HNIA 3NMIA 3C63A 2XL8A 3HNLA 4CIPA 4N4WA 2J8WA 3QVYA 1CGOA 2YLDA 1CPQA 3ZWIA 4ER9A 1EKYA 2QLAA 3U8PA 1BBHA 1YZCA 5JRAA 3FOPA 4ULVA 4JEAA 1JAFA 2YL7A 3ZTZA 3IQ5A 4N6HA 3IQ6A 3TOMA 5JVEA 4CDVA 2XLMA 4JE9A 1RCPA 3M4BA 4IAQA 4CDYA 4CJOA 1E85A 3DE8A 1GQAA 2XLVA 4CX9A 5JSLA 2XLWA 1YYXA 2YL3A 1E84A 3L1MA 4L6RA 3NMKA 3ZTMA 5B3IA 5JLIA 2YL1A 3DE9A 1CPRA 2XLHA 2YKZA 2XLOA 1LM3B 5JUAA 4JKVA 3NMJA 1QPUA 3QW1A 2XLDA 3QW0A 1QQ3A 1M6TA 1A7VA 4WGZA 1CGNA 4U9EA
chains in the Genus database with same CATH superfamily
1LE2A 1DOVA 4DBRA 4U5EE 1FNTc 1GS9A 4MVOA 3FAJA 3JTLO 3WODF 4U5GA 2L6HA 3DD7A 1PD0A 3IHUA 3F47A 4EIYA 1E83A 4LACB 3RH3A 4FWVA 3PHF2 1T6UA 1OW8A 2CDQA 2XM4A 4IB4A 4NTBA 4BJ5C 3GM1A 5A6BD 2DGJA 4AL0A 4JVSA 4MW3A 1OCCC 5KYWA 1OCRC 3QTHA 3M79A 3DAGA 4G7OF 4CBEA 5DQZA 1UFBA 4HE8D 2J7PD 4MTGA 2NUTA 3RQEA 2XL6A 1CGME 3W4YA 1NBBA 1XZPA 2ZXOA 1WWPA 5KYUB 1EI7A 2A6HF 3K1HA 4JCZA 4KNWA 1YJGA 5DS4A 3U0CA 2HV7A 4WGYA 3EQLF 5T3TA 3NYLA 4D4XA 5L3QA 2KQ9A 1ZW3A 4B6IA 2NPUA 1Y4CA 1JPJA 2YLIA 3S84A 2PX0A 4P9TA 4PJLA 1ORJA 2LIGA 4EHPA 2CW0F 3K6BA 5A6AA 1O87A 1Q0DA 2Q9AA 1AUEA 2Y3BA 3ASNC 3AGTA 4DRIB 4R32A 3OEOA 4C3DA 1T5OA 3EH2A 3HNKA 3CAXA 2RSEB 4ANJA 1K40A 2IXNA 2QTVA 1U6HA 3EGDB 4YL1A 2VCAA 4W8KA 2I15A 3ASOC 3R7CA 2DYSC 1T6IA 3LLKA 4J7TA 4KI2A 4CIPA 3PCVA 1OR2A 5EK0A 5T1DB 4JIOA 2YLDA 1CPQA 3VF0A 4QI2A 1OXBA 4O7GA 1JMWA 2LK4A 2QLAA 3S90A 3CSKA 2HSQA 3UR3C 4PFPA 2GAQA 1YZCA 2VASA 3FXHA 4E7SA 5COMA 5DS6A 2Y3DA 1JAFA 1OR3A 2HKVA 1HE9A 3AGUA 2YL7A 4K7BA 1T01A 2MYSA 4N6HA 3BEHA 1AVOB 3L8IA 2PFDA 4XEFA 5CI9A 5BQGA 2WVQA 1K05A 1V4AA 4JRZA 1LVKA 2IXPA 2Q4FA 3SNHA 1RXQA 2P6VA 3NYMA 4DRHB 2YVKA 2QUPA 3SXYA 4DOZA 4H4KC 3ZDLA 5T3WA 4DXWA 4AE4B 3GEIA 3T6GB 3AG1C 2L7AA 2KGOA 3QZCA 4XLPF 1U0BB 2A1DD 2XLWA 5COFA 2W9YA 4YT8A 1G5ZA 3O55A 2G3KA 1Q0FA 1R4TA 1K04A 2A6EF 1VOMA 1G4US 2KC3A 4L6RA 4JZAA 4DJ9A 3VYWA 2AVKA 2KK1A 3ZTMA 1F1MA 1LS4A 1LKXA 3LEOA 3VAYA 5B3IA 3KH2A 2EILC 1C03A 1JRAA 1CPRA 2A68F 1OKKD 3DI5A 3NRHA 1ZU4A 2YKZA 3HLZA 1LM3B 2L81A 1Z23A 1JOGA 4I1MA 3AG2C 3DWWA 4MVRA 5TJ5E 3CQZA 4HFFB 1TFOB 1VLTA 3EFOB 3QW1A 3DXJF 4LDKA 3UMIA 4O6YA 1KTMA 1L7CA 1ZHXA 1M56C 3C18A 2EIMC 2XLDA 2H7OA 1MMNA 1VMAA 2W45A 4LLEA 4XLNF 3LNMB 2R7QA 3ABKC 3FHDA 1A7VA 2VCBA 3LESA 4WGZA 4YL0A 1OW6A 1MMDA 3U3FA 2XM0A 2YL0A 3U9MA 4NCQA 1YZAA 5AC4A 1KU2A 4MQ9F 2Y69C 2UUHA 3TJ5A 4MVSA 4CDAA 3RFYA 2L6FA 1ZYRF 2VB6A 2YLGA 4EBKA 4BEJA 2R7TA 2BE5F 1D1AA 4NC3A 1NU7D 1RJ9B 3ZQVA 4JCHA 256BA 3ZIBA 1M2VA 1OXKA 4P6IC 1ORSC 3V7OA 2J9BA 3KL4A 1H9TA 1WASA 4XTKA 2WVNA 4U9DA 1T9KA 2XXAB 1YVIA 5JS5A 5E2QA 2B0HA 4BEMJ 2AWYA 1YYJA 5COGA 3CZ6A 1EA8A 3X1OA 2P61A 5BQHA 2QY9A 2R7SA 1Y6DA 3K33A 1E2XA 2J0WA 3TOLA 3EPVA 4IAOA 3N2ZB 4J32B 2H7VC 4JEBA 1TWAA 5KYXA 3EFOA 3SZRA 1NSGB 1D1BA 3ZVRA 2Q3TA 3EG9B 2XS8A 3EGXB 3C7JA 4BJTA 4BG0A 3ITFA 4F4BA 1BR4A 1LIHA 2CGEA 1NFNA 2HJMA 3G4ZA 3GWLA 3L0IA 2AP3A 5L0CA 3GEHA 4MVUA 1WGWA 4U5FE 4AX2A 5L0JA 3S0XA 4XWJA 2CNWA 2WZGA 1C02A 2XL8A 4N6CA 2PF4E 4CIHA 1HMDA 4N4WA 2J8WA 4C3BA 2L9JA 1L3PA 2OOCA 3H2VA 3ZWIA 4ER9A 5L0HA 2R7VA 1FR0A 2R9RB 4C7OB 3BRJA 4M63A 1ZHWA 3DJUB 3C8GA 2WVOA 3EJNA 3MYFA 4XPXA 3W2VA 2HSBA 4ULVA 4IWBA 3T6BA 1MNEA 3JCUQ 3SXKA 3C8ZA 2OEVA 1OQCA 1QVXA 1NLXA 1O3UA 3GM2A 3Q6NA 3SXZA 3ZTZA 3G50A 4G78A 4Q4ZF 3KKBA 3E9VA 2DI3A 3JSEO 1RKEA 4PJMA 1PV3A 2XLMA 4E0IA 2EPNA 5KYYB 3NYJA 1RCPA 1T6QA 4I44A 2X51A 3LS0A 3Q6MA 1BDJB 1VK5A 2B0JA 2IXOA 3H2UA 3H65A 3K66A 3L8JA 3U3BA 2J9WA 2IM8A 4A2NB 2OKUA 1WTYA 2ETSA 4YN0B 1NZEA 3TQOA 4G7ZF 3B0VC 4JURI 2XLVA 3U5SA 5JSLA 2GFHA 5EHHA 1KNYA 1YYXA 2PNOA 1LI5A 3LJBA 2X0CA 3LUTB 4MS2A 1ZHYA 4EKWA 4BJ6A 3B29A 5D91A 5DS5A 1A41A 4Z9JA 2EIJC 2PBEA 3OA1A 3FMSA 3ZG1A 3AJMA 1TWCA 2HMZA 3EHNA 2HV6A 1FTSA 2C03A 1IZMA 3L34A 4I1OB 5KYUA 1ORYA 3UMHA 5FCLA 5FZTA 2R25A 1Q0MA 2XLHA 3DMDA 3SXMA 2EPLX 3JSZA 3K7DA 3EH1A 3NMJA 4JKVA 4MVQA 3POVA 4PJNA 1A0BA 4O6NA 2AWCA 3NKDA 2XSEA 1FMVA 1SYQA 1LI7A 2QE9A 2NSGA 4JTCB 3QW0A 2M4EA 4N06A 5E33A 3B71A 4AL1A 1M6TA 1HMOA 1CGNA 3RIPA 4XEVA 1QZXA 2KNHA 2V26A 5JP7A 3WHNA 5K0IA 4A4AA 4Q5SF 1Q0GA 3GM3A 3M4CA 5HV9A 3EGDA 4NTAA 3UMKA 1R5ID 2Y3HA 4DVZA 2W4BA 2EINC 2F22A 1EQ1A 3V5ZA 1A7EA 5A6BA 4U5HA 4WJ0A 1TKNA 5F5FA 1Q0KA 2EPKX 2OQMA 2DB4A 3V5XA 2LQGA 4YT2A 3NDBB 1G4WR 3RW0A 3US6A 4K0DA 2VC9A 1SMYF 5A6KA 4CS9C 1YA9A 2J7PA 1FMWA 3C62A 5JT4A 3VRCA 2P7VA 4MVMA 4OIRF 4D4NA 2R7UA 2KJGA 1YARO 4IGGA 1D0ZA 4CS9A 3LNRA 2OJQA 4P9FA 1WOLA 4GEHA 4I3MA 5BQIA 2JX0A 2GDCA 3R2PA 3RVYA 3LEVA 3M15A 3Q7GA 3U8VA 4E17A 2PX3A 4LLCA 4LDQA 3B9QA 1NFOA 3AOUA 1G8XA 2MWQA 4RD9A 3TD7A 1VB5A 2CCYA 2H8AA 4QI0A 3AG4C 4EBJA 4GYTA 4EUKB 3S9OA 2BC5A 2G62A 3AQCA 1OCOC 4Q7CA 3WG7C 4IARA 4YWQA 2HFIA 4PK4A 4AE4A 1PCXA 3E70C 1A7DA 2HJ3A 1APCA 5B1AC 3JRTA 1SZIA 1NU9C 2BL2A 2LFFA 2LSEA 4IRUA 4PFOA 4YK5A 4CJGA 4EBBA 3Q7LA 3TJ6A 3NMIA 4HEAJ 4YL3A 2TMVP 2FAPB 2JD3A 3ABLC 1ZW2A 3C63A 5IY5C 3HNLA 4U5CE 3LS1A 3FAPB 4Z9IA 1D1CA 5CIVA 4MNDA 1HY5A 1LE4A 3MFNA 1BZ4A 2DYRC 1M2OA 3RQGA 3RQFA 2GA0A 2KSFA 3FOPA 2RD9A 1S7ZA 1VLSA 2Y39A 2Q00A 2NUTB 1QLEC 2R7OA 1WATA 3JYHA 3RF3A 4UDVA 3GEEA 5GPGB 3IQ5A 2M64A 1MMGA 2KYHA 4OIQF 2YWAA 1JPNA 1D0XA 4U9EA 1Z5ZA 3TOMA 4OD4A 3ZSUA 4OINF 1RMVA 2YRFA 5JVEA 3SP1A 4E0HA 2OU6A 2R7WA 3T6JA 3PDMP 1I4ZA 3RVZA 1FFTC 4JC7A 1ZHTA 1VYIA 3M4BA 1VYKA 4W8PA 4KNVA 4IAQA 4U5BE 1IW7F 1V54C 2R02A 2UUIA 3I5PA 3K1IA 4CDYA 4CJOA 5A69A 1E85A 3DE8A 5DVWA 3FDQA 1D0YA 1YA7O 2A0BA 3GWNA 2V3CC 3O6XA 3G4XA 4JTAB 3TULA 4FESA 4MTFA 2WZFA 2P0NA 2IOQA 5F28E 4CS8A 4MTOA 3S28A 2IBFA 4LDRA 1RJ9A 4CX9A 4OIPF 3M1CB 5L0FA 2P1AA 2OG2A 2LD6A 4BJ1A 5L0DA 2C04A 2IYLD 4YJWA 1FFHA 3NMKA 3ZC4A 3A11A 1J8MF 2WB7A 3I5QA 4GQHA 2XXAA 1OKKA 3MYIA 2G3VA 3DE9A 3PMRA 1BR1A 4KC9A 2XL4A 4H54A 3X2QC 4J30B 3W8IA 4BJ5A 1H6GA 2FGYA 3F46A 3AQBA 2XLOA 1FAPB 1GGQA 3IPMO 3N24A 4NTFA 2XRHA 4JTDB 4JJFA 2HUJA 2CYDA 1PD1A 3DZAA 3OWTA 5AC5A 2AU5A 4O79A 4DBQA 2J9UA 3EG9A 4HFKB 3UGPA 2ZXRA 3EGXA 3O10A 1MMAA 4LERA 5L0GA 2LP4A 1SR2A 1QSPA 2A0UA 4BJ6C 1HE1A 1ZU5A 1MQVA 3DM5A 3JRMO 4PACA 4XQ1A 4Z9HA 3IQTA 2D5RB 3SEOA 5DQTA 3HNJA 2HZ8A 3KYJA 3ATPA 1WN0A 1J8YF 1Z6AA 2GWWA 1TWHA 3UGOA 2XLEA 2R7XA 4C3EA 4G7HF 5B1BC 1S05A 4J7YA 1GM5A 4U5DE 4C7OA 4ZLCA 4XEKA 2I8BA 3GODA 3ECSA 2O9XA 1O5HA 2Q9CA 3JT1A 1TQGA 3KPHA 3QVZA 3ZQYA 4DRJB 2XS1A 2ASRA 1BR2A 2YZSA 4ULWA 3O39A 4EWCA 2E87A 1Z7Qc 4ZLDA 3JYYA 3EZIA 3N0TA 3I4UA 4JJGA 5E3CA 1MNDA 3LLIA 4WABA 4DVYP 1M57C 3UNGC 5B3SC 2LCHA 1SF8A 2VCCA 3NG1A 5HSWA 3GORA 4K1OA 3V5YA 3DAFA 5E3AA 4IJJA 5KYYA 2OCCC 2R7RA 2NUPB 3EHMA 1TR2A 2HMQA 5AGFA 2IXMA 1Z3IX 1YLMA 1ZVZA 3FOOA 2OJED 2OEXA 3A9CA 1LS1A 2EPMX 2J9VA 2KW3C 3IQCA 1OW7A 4PR9A 4CS8C 1YAUO 1E86A 1NG1A 4ONSA 5D92A 2J45A 1QKRA 1V55C 3HNIA 3QMKA 1UG7A 2H7BA 4JW1A 4O6MA 1RKCA 2YQYA 2J46A 4KBLA 4RBNA 4XPWA 4AK9A 2MHRA 4FAPB 2CNWD 3QVYA 4G0HA 1CGOA 4BPMA 1AEPA 3ABMC 5EGYA 3MBGA 5F5HA 3W8HA 2EIKC 3U8PA 1EKYA 2WL8A 3B0UX 2NSFA 1BBHA 2WZLA 3GANA 1XZQA 2R03A 1M2VB 1Z63A 2QNLA 1XWJA 2HS5A 5JRAA 4FX5A 4PJJA 4JEAA 3C8GD 4MVZA 3TK0A 3VM6A 3NKEA 3T4RA 3U2LA 3HTKC 4XPYA 2J0XA 2D4UA 2NG1A 3MLGA 4RDAA 3IQ6A 5L0IA 1LPEA 3KMIA 3DKAA 2Q7RA 1W2WA 1ZHZA 2Q9BA 2Z15A 3JZ0A 3DM9B 4CDVA 1I5NA 1TFKB 2W4MA 2YEVA 4OIOF 2ZXWC 3U2MA 1H7IA 2A69F 3EZHA 4JE9A 5KYXB 1HW1A 5CI8A 3RYLA 2NUPA 4E18A 1GQAA 4NY3A 2VH3A 3RKOF 5A6JA 3T9OA 3J06A 2L6GA 4E7ZA 2FFHA 4CSAC 1HW2A 2YL3A 5KYWB 2Y3GA 1E84A 1C17M 1OCZC 3L1MA 3SYNA 2YHSA 1YDIA 2EPOA 4CSAA 3U9JA 1VTMP 3CEXA 1H9GA 3MX3A 1U89A 5L3VA 3B0PA 4X0RA 4MW8A 3S29A 3WAQA 1I4YA 2JPUA 2PP4A 4NQFA 2YL1A 5JLIA 3W2WA 2LFDA 3C8GB 3S27A 3HKKA 4QDLA 3AG3C 2R05A 5KYNA 1ZZPA 5JUAA 1B68A 1DOWA 3K1IC 2ZD9A 2ZPAA 1QPUA 2ZXPA 1ST6A 3HJCA 4YT4A 3LAYA 5DLJA 1N1CA 4OD5A 3KYIA 4CS7A 3IEEA 3DJNB 1QQ3A 1V74B 4YT5A 5BUOA 3FVYA 2ICWG 1JR8A 1RKEB 1TWGA
chains in the Genus database with same CATH topology
1MQVA 5JP7A 2XM0A 2YL0A 1YZAA 3HNJA 3M4CA 4CDAA 2YLGA 4EIYA 1E83A 2XLEA 4NC3A 2XM4A 4IB4A 1S05A 3ZQVA 256BA 3C62A 5JT4A 3VRCA 4D4NA 3M79A 3ZQYA 3QVZA 2J9BA 4U9DA 2XL6A 1NBBA 5JS5A 1YYJA 3M15A 4WGYA 3TOLA 2CCYA 4D4XA 4JEBA 2YLIA 2BC5A 5AGFA 4IARA 3FOOA 1APCA 1E86A 3HNKA 4CJGA 3HNIA 3NMIA 3C63A 2XL8A 3HNLA 4CIPA 4N4WA 2J8WA 3QVYA 1CGOA 2YLDA 1CPQA 3ZWIA 4ER9A 1EKYA 2QLAA 3U8PA 1BBHA 1YZCA 5JRAA 3FOPA 4ULVA 4JEAA 1JAFA 2YL7A 3ZTZA 3IQ5A 4N6HA 3IQ6A 3TOMA 5JVEA 4CDVA 2XLMA 4JE9A 1RCPA 3M4BA 4IAQA 4CDYA 4CJOA 1E85A 3DE8A 1GQAA 2XLVA 4CX9A 5JSLA 2XLWA 1YYXA 2YL3A 1E84A 3L1MA 4L6RA 3NMKA 3ZTMA 5B3IA 5JLIA 2YL1A 3DE9A 1CPRA 2XLHA 2YKZA 2XLOA 1LM3B 5JUAA 4JKVA 3NMJA 1QPUA 3QW1A 2XLDA 3QW0A 1QQ3A 1M6TA 1A7VA 4WGZA 1CGNA 4U9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MQV A;  5JP7 A;  2XM0 A;  2YL0 A;  1YZA A;  3HNJ A;  3M4C A;  4CDA A;  2YLG A;  4EIY A;  1E83 A;  2XLE A;  4NC3 A;  2XM4 A;  4IB4 A;  1S05 A;  3ZQV A;  256B A;  3C62 A;  5JT4 A;  3VRC A;  4D4N A;  3M79 A;  3ZQY A;  3QVZ A;  2J9B A;  4U9D A;  2XL6 A;  1NBB A;  5JS5 A;  1YYJ A;  3M15 A;  4WGY A;  3TOL A;  2CCY A;  4D4X A;  4JEB A;  2YLI A;  2BC5 A;  5AGF A;  4IAR A;  3FOO A;  1APC A;  1E86 A;  3HNK A;  4CJG A;  3HNI A;  3NMI A;  3C63 A;  2XL8 A;  3HNL A;  4CIP A;  4N4W A;  2J8W A;  3QVY A;  1CGO A;  2YLD A;  1CPQ A;  3ZWI A;  4ER9 A;  1EKY A;  2QLA A;  3U8P A;  1BBH A;  1YZC A;  5JRA A;  3FOP A;  4ULV A;  4JEA A;  1JAF A;  2YL7 A;  3ZTZ A;  3IQ5 A;  4N6H A;  3IQ6 A;  3TOM A;  5JVE A;  4CDV A;  2XLM A;  4JE9 A;  1RCP A;  3M4B A;  4IAQ A;  4CDY A;  4CJO A;  1E85 A;  3DE8 A;  1GQA A;  2XLV A;  4CX9 A;  5JSL A;  2XLW A;  1YYX A;  2YL3 A;  1E84 A;  3L1M A;  4L6R A;  3NMK A;  3ZTM A;  5B3I A;  5JLI A;  2YL1 A;  3DE9 A;  1CPR A;  2XLH A;  2YKZ A;  2XLO A;  1LM3 B;  5JUA A;  4JKV A;  3NMJ A;  1QPU A;  3QW1 A;  2XLD A;  3QW0 A;  1QQ3 A;  1M6T A;  1A7V A;  4WGZ A;  1CGN A;  4U9E A; 
#chains in the Genus database with same CATH topology
 1LE2 A;  1DOV A;  4DBR A;  4U5E E;  1FNT c;  1GS9 A;  4MVO A;  3FAJ A;  3JTL O;  3WOD F;  4U5G A;  2L6H A;  3DD7 A;  1PD0 A;  3IHU A;  3F47 A;  4EIY A;  1E83 A;  4LAC B;  3RH3 A;  4FWV A;  3PHF 2;  1T6U A;  1OW8 A;  2CDQ A;  2XM4 A;  4IB4 A;  4NTB A;  4BJ5 C;  3GM1 A;  5A6B D;  2DGJ A;  4AL0 A;  4JVS A;  4MW3 A;  1OCC C;  5KYW A;  1OCR C;  3QTH A;  3M79 A;  3DAG A;  4G7O F;  4CBE A;  5DQZ A;  1UFB A;  4HE8 D;  2J7P D;  4MTG A;  2NUT A;  3RQE A;  2XL6 A;  1CGM E;  3W4Y A;  1NBB A;  1XZP A;  2ZXO A;  1WWP A;  5KYU B;  1EI7 A;  2A6H F;  3K1H A;  4JCZ A;  4KNW A;  1YJG A;  5DS4 A;  3U0C A;  2HV7 A;  4WGY A;  3EQL F;  5T3T A;  3NYL A;  4D4X A;  5L3Q A;  2KQ9 A;  1ZW3 A;  4B6I A;  2NPU A;  1Y4C A;  1JPJ A;  2YLI A;  3S84 A;  2PX0 A;  4P9T A;  4PJL A;  1ORJ A;  2LIG A;  4EHP A;  2CW0 F;  3K6B A;  5A6A A;  1O87 A;  1Q0D A;  2Q9A A;  1AUE A;  2Y3B A;  3ASN C;  3AGT A;  4DRI B;  4R32 A;  3OEO A;  4C3D A;  1T5O A;  3EH2 A;  3HNK A;  3CAX A;  2RSE B;  4ANJ A;  1K40 A;  2IXN A;  2QTV A;  1U6H A;  3EGD B;  4YL1 A;  2VCA A;  4W8K A;  2I15 A;  3ASO C;  3R7C A;  2DYS C;  1T6I A;  3LLK A;  4J7T A;  4KI2 A;  4CIP A;  3PCV A;  1OR2 A;  5EK0 A;  5T1D B;  4JIO A;  2YLD A;  1CPQ A;  3VF0 A;  4QI2 A;  1OXB A;  4O7G A;  1JMW A;  2LK4 A;  2QLA A;  3S90 A;  3CSK A;  2HSQ A;  3UR3 C;  4PFP A;  2GAQ A;  1YZC A;  2VAS A;  3FXH A;  4E7S A;  5COM A;  5DS6 A;  2Y3D A;  1JAF A;  1OR3 A;  2HKV A;  1HE9 A;  3AGU A;  2YL7 A;  4K7B A;  1T01 A;  2MYS A;  4N6H A;  3BEH A;  1AVO B;  3L8I A;  2PFD A;  4XEF A;  5CI9 A;  5BQG A;  2WVQ A;  1K05 A;  1V4A A;  4JRZ A;  1LVK A;  2IXP A;  2Q4F A;  3SNH A;  1RXQ A;  2P6V A;  3NYM A;  4DRH B;  2YVK A;  2QUP A;  3SXY A;  4DOZ A;  4H4K C;  3ZDL A;  5T3W A;  4DXW A;  4AE4 B;  3GEI A;  3T6G B;  3AG1 C;  2L7A A;  2KGO A;  3QZC A;  4XLP F;  1U0B B;  2A1D D;  2XLW A;  5COF A;  2W9Y A;  4YT8 A;  1G5Z A;  3O55 A;  2G3K A;  1Q0F A;  1R4T A;  1K04 A;  2A6E F;  1VOM A;  1G4U S;  2KC3 A;  4L6R A;  4JZA A;  4DJ9 A;  3VYW A;  2AVK A;  2KK1 A;  3ZTM A;  1F1M A;  1LS4 A;  1LKX A;  3LEO A;  3VAY A;  5B3I A;  3KH2 A;  2EIL C;  1C03 A;  1JRA A;  1CPR A;  2A68 F;  1OKK D;  3DI5 A;  3NRH A;  1ZU4 A;  2YKZ A;  3HLZ A;  1LM3 B;  2L81 A;  1Z23 A;  1JOG A;  4I1M A;  3AG2 C;  3DWW A;  4MVR A;  5TJ5 E;  3CQZ A;  4HFF B;  1TFO B;  1VLT A;  3EFO B;  3QW1 A;  3DXJ F;  4LDK A;  3UMI A;  4O6Y A;  1KTM A;  1L7C A;  1ZHX A;  1M56 C;  3C18 A;  2EIM C;  2XLD A;  2H7O A;  1MMN A;  1VMA A;  2W45 A;  4LLE A;  4XLN F;  3LNM B;  2R7Q A;  3ABK C;  3FHD A;  1A7V A;  2VCB A;  3LES A;  4WGZ A;  4YL0 A;  1OW6 A;  1MMD A;  3U3F A;  2XM0 A;  2YL0 A;  3U9M A;  4NCQ A;  1YZA A;  5AC4 A;  1KU2 A;  4MQ9 F;  2Y69 C;  2UUH A;  3TJ5 A;  4MVS A;  4CDA A;  3RFY A;  2L6F A;  1ZYR F;  2VB6 A;  2YLG A;  4EBK A;  4BEJ A;  2R7T A;  2BE5 F;  1D1A A;  4NC3 A;  1NU7 D;  1RJ9 B;  3ZQV A;  4JCH A;  256B A;  3ZIB A;  1M2V A;  1OXK A;  4P6I C;  1ORS C;  3V7O A;  2J9B A;  3KL4 A;  1H9T A;  1WAS A;  4XTK A;  2WVN A;  4U9D A;  1T9K A;  2XXA B;  1YVI A;  5JS5 A;  5E2Q A;  2B0H A;  4BEM J;  2AWY A;  1YYJ A;  5COG A;  3CZ6 A;  1EA8 A;  3X1O A;  2P61 A;  5BQH A;  2QY9 A;  2R7S A;  1Y6D A;  3K33 A;  1E2X A;  2J0W A;  3TOL A;  3EPV A;  4IAO A;  3N2Z B;  4J32 B;  2H7V C;  4JEB A;  1TWA A;  5KYX A;  3EFO A;  3SZR A;  1NSG B;  1D1B A;  3ZVR A;  2Q3T A;  3EG9 B;  2XS8 A;  3EGX B;  3C7J A;  4BJT A;  4BG0 A;  3ITF A;  4F4B A;  1BR4 A;  1LIH A;  2CGE A;  1NFN A;  2HJM A;  3G4Z A;  3GWL A;  3L0I A;  2AP3 A;  5L0C A;  3GEH A;  4MVU A;  1WGW A;  4U5F E;  4AX2 A;  5L0J A;  3S0X A;  4XWJ A;  2CNW A;  2WZG A;  1C02 A;  2XL8 A;  4N6C A;  2PF4 E;  4CIH A;  1HMD A;  4N4W A;  2J8W A;  4C3B A;  2L9J A;  1L3P A;  2OOC A;  3H2V A;  3ZWI A;  4ER9 A;  5L0H A;  2R7V A;  1FR0 A;  2R9R B;  4C7O B;  3BRJ A;  4M63 A;  1ZHW A;  3DJU B;  3C8G A;  2WVO A;  3EJN A;  3MYF A;  4XPX A;  3W2V A;  2HSB A;  4ULV A;  4IWB A;  3T6B A;  1MNE A;  3JCU Q;  3SXK A;  3C8Z A;  2OEV A;  1OQC A;  1QVX A;  1NLX A;  1O3U A;  3GM2 A;  3Q6N A;  3SXZ A;  3ZTZ A;  3G50 A;  4G78 A;  4Q4Z F;  3KKB A;  3E9V A;  2DI3 A;  3JSE O;  1RKE A;  4PJM A;  1PV3 A;  2XLM A;  4E0I A;  2EPN A;  5KYY B;  3NYJ A;  1RCP A;  1T6Q A;  4I44 A;  2X51 A;  3LS0 A;  3Q6M A;  1BDJ B;  1VK5 A;  2B0J A;  2IXO A;  3H2U A;  3H65 A;  3K66 A;  3L8J A;  3U3B A;  2J9W A;  2IM8 A;  4A2N B;  2OKU A;  1WTY A;  2ETS A;  4YN0 B;  1NZE A;  3TQO A;  4G7Z F;  3B0V C;  4JUR I;  2XLV A;  3U5S A;  5JSL A;  2GFH A;  5EHH A;  1KNY A;  1YYX A;  2PNO A;  1LI5 A;  3LJB A;  2X0C A;  3LUT B;  4MS2 A;  1ZHY A;  4EKW A;  4BJ6 A;  3B29 A;  5D91 A;  5DS5 A;  1A41 A;  4Z9J A;  2EIJ C;  2PBE A;  3OA1 A;  3FMS A;  3ZG1 A;  3AJM A;  1TWC A;  2HMZ A;  3EHN A;  2HV6 A;  1FTS A;  2C03 A;  1IZM A;  3L34 A;  4I1O B;  5KYU A;  1ORY A;  3UMH A;  5FCL A;  5FZT A;  2R25 A;  1Q0M A;  2XLH A;  3DMD A;  3SXM A;  2EPL X;  3JSZ A;  3K7D A;  3EH1 A;  3NMJ A;  4JKV A;  4MVQ A;  3POV A;  4PJN A;  1A0B A;  4O6N A;  2AWC A;  3NKD A;  2XSE A;  1FMV A;  1SYQ A;  1LI7 A;  2QE9 A;  2NSG A;  4JTC B;  3QW0 A;  2M4E A;  4N06 A;  5E33 A;  3B71 A;  4AL1 A;  1M6T A;  1HMO A;  1CGN A;  3RIP A;  4XEV A;  1QZX A;  2KNH A;  2V26 A;  5JP7 A;  3WHN A;  5K0I A;  4A4A A;  4Q5S F;  1Q0G A;  3GM3 A;  3M4C A;  5HV9 A;  3EGD A;  4NTA A;  3UMK A;  1R5I D;  2Y3H A;  4DVZ A;  2W4B A;  2EIN C;  2F22 A;  1EQ1 A;  3V5Z A;  1A7E A;  5A6B A;  4U5H A;  4WJ0 A;  1TKN A;  5F5F A;  1Q0K A;  2EPK X;  2OQM A;  2DB4 A;  3V5X A;  2LQG A;  4YT2 A;  3NDB B;  1G4W R;  3RW0 A;  3US6 A;  4K0D A;  2VC9 A;  1SMY F;  5A6K A;  4CS9 C;  1YA9 A;  2J7P A;  1FMW A;  3C62 A;  5JT4 A;  3VRC A;  2P7V A;  4MVM A;  4OIR F;  4D4N A;  2R7U A;  2KJG A;  1YAR O;  4IGG A;  1D0Z A;  4CS9 A;  3LNR A;  2OJQ A;  4P9F A;  1WOL A;  4GEH A;  4I3M A;  5BQI A;  2JX0 A;  2GDC A;  3R2P A;  3RVY A;  3LEV A;  3M15 A;  3Q7G A;  3U8V A;  4E17 A;  2PX3 A;  4LLC A;  4LDQ A;  3B9Q A;  1NFO A;  3AOU A;  1G8X A;  2MWQ A;  4RD9 A;  3TD7 A;  1VB5 A;  2CCY A;  2H8A A;  4QI0 A;  3AG4 C;  4EBJ A;  4GYT A;  4EUK B;  3S9O A;  2BC5 A;  2G62 A;  3AQC A;  1OCO C;  4Q7C A;  3WG7 C;  4IAR A;  4YWQ A;  2HFI A;  4PK4 A;  4AE4 A;  1PCX A;  3E70 C;  1A7D A;  2HJ3 A;  1APC A;  5B1A C;  3JRT A;  1SZI A;  1NU9 C;  2BL2 A;  2LFF A;  2LSE A;  4IRU A;  4PFO A;  4YK5 A;  4CJG A;  4EBB A;  3Q7L A;  3TJ6 A;  3NMI A;  4HEA J;  4YL3 A;  2TMV P;  2FAP B;  2JD3 A;  3ABL C;  1ZW2 A;  3C63 A;  5IY5 C;  3HNL A;  4U5C E;  3LS1 A;  3FAP B;  4Z9I A;  1D1C A;  5CIV A;  4MND A;  1HY5 A;  1LE4 A;  3MFN A;  1BZ4 A;  2DYR C;  1M2O A;  3RQG A;  3RQF A;  2GA0 A;  2KSF A;  3FOP A;  2RD9 A;  1S7Z A;  1VLS A;  2Y39 A;  2Q00 A;  2NUT B;  1QLE C;  2R7O A;  1WAT A;  3JYH A;  3RF3 A;  4UDV A;  3GEE A;  5GPG B;  3IQ5 A;  2M64 A;  1MMG A;  2KYH A;  4OIQ F;  2YWA A;  1JPN A;  1D0X A;  4U9E A;  1Z5Z A;  3TOM A;  4OD4 A;  3ZSU A;  4OIN F;  1RMV A;  2YRF A;  5JVE A;  3SP1 A;  4E0H A;  2OU6 A;  2R7W A;  3T6J A;  3PDM P;  1I4Z A;  3RVZ A;  1FFT C;  4JC7 A;  1ZHT A;  1VYI A;  3M4B A;  1VYK A;  4W8P A;  4KNV A;  4IAQ A;  4U5B E;  1IW7 F;  1V54 C;  2R02 A;  2UUI A;  3I5P A;  3K1I A;  4CDY A;  4CJO A;  5A69 A;  1E85 A;  3DE8 A;  5DVW A;  3FDQ A;  1D0Y A;  1YA7 O;  2A0B A;  3GWN A;  2V3C C;  3O6X A;  3G4X A;  4JTA B;  3TUL A;  4FES A;  4MTF A;  2WZF A;  2P0N A;  2IOQ A;  5F28 E;  4CS8 A;  4MTO A;  3S28 A;  2IBF A;  4LDR A;  1RJ9 A;  4CX9 A;  4OIP F;  3M1C B;  5L0F A;  2P1A A;  2OG2 A;  2LD6 A;  4BJ1 A;  5L0D A;  2C04 A;  2IYL D;  4YJW A;  1FFH A;  3NMK A;  3ZC4 A;  3A11 A;  1J8M F;  2WB7 A;  3I5Q A;  4GQH A;  2XXA A;  1OKK A;  3MYI A;  2G3V A;  3DE9 A;  3PMR A;  1BR1 A;  4KC9 A;  2XL4 A;  4H54 A;  3X2Q C;  4J30 B;  3W8I A;  4BJ5 A;  1H6G A;  2FGY A;  3F46 A;  3AQB A;  2XLO A;  1FAP B;  1GGQ A;  3IPM O;  3N24 A;  4NTF A;  2XRH A;  4JTD B;  4JJF A;  2HUJ A;  2CYD A;  1PD1 A;  3DZA A;  3OWT A;  5AC5 A;  2AU5 A;  4O79 A;  4DBQ A;  2J9U A;  3EG9 A;  4HFK B;  3UGP A;  2ZXR A;  3EGX A;  3O10 A;  1MMA A;  4LER A;  5L0G A;  2LP4 A;  1SR2 A;  1QSP A;  2A0U A;  4BJ6 C;  1HE1 A;  1ZU5 A;  1MQV A;  3DM5 A;  3JRM O;  4PAC A;  4XQ1 A;  4Z9H A;  3IQT A;  2D5R B;  3SEO A;  5DQT A;  3HNJ A;  2HZ8 A;  3KYJ A;  3ATP A;  1WN0 A;  1J8Y F;  1Z6A A;  2GWW A;  1TWH A;  3UGO A;  2XLE A;  2R7X A;  4C3E A;  4G7H F;  5B1B C;  1S05 A;  4J7Y A;  1GM5 A;  4U5D E;  4C7O A;  4ZLC A;  4XEK A;  2I8B A;  3GOD A;  3ECS A;  2O9X A;  1O5H A;  2Q9C A;  3JT1 A;  1TQG A;  3KPH A;  3QVZ A;  3ZQY A;  4DRJ B;  2XS1 A;  2ASR A;  1BR2 A;  2YZS A;  4ULW A;  3O39 A;  4EWC A;  2E87 A;  1Z7Q c;  4ZLD A;  3JYY A;  3EZI A;  3N0T A;  3I4U A;  4JJG A;  5E3C A;  1MND A;  3LLI A;  4WAB A;  4DVY P;  1M57 C;  3UNG C;  5B3S C;  2LCH A;  1SF8 A;  2VCC A;  3NG1 A;  5HSW A;  3GOR A;  4K1O A;  3V5Y A;  3DAF A;  5E3A A;  4IJJ A;  5KYY A;  2OCC C;  2R7R A;  2NUP B;  3EHM A;  1TR2 A;  2HMQ A;  5AGF A;  2IXM A;  1Z3I X;  1YLM A;  1ZVZ A;  3FOO A;  2OJE D;  2OEX A;  3A9C A;  1LS1 A;  2EPM X;  2J9V A;  2KW3 C;  3IQC A;  1OW7 A;  4PR9 A;  4CS8 C;  1YAU O;  1E86 A;  1NG1 A;  4ONS A;  5D92 A;  2J45 A;  1QKR A;  1V55 C;  3HNI A;  3QMK A;  1UG7 A;  2H7B A;  4JW1 A;  4O6M A;  1RKC A;  2YQY A;  2J46 A;  4KBL A;  4RBN A;  4XPW A;  4AK9 A;  2MHR A;  4FAP B;  2CNW D;  3QVY A;  4G0H A;  1CGO A;  4BPM A;  1AEP A;  3ABM C;  5EGY A;  3MBG A;  5F5H A;  3W8H A;  2EIK C;  3U8P A;  1EKY A;  2WL8 A;  3B0U X;  2NSF A;  1BBH A;  2WZL A;  3GAN A;  1XZQ A;  2R03 A;  1M2V B;  1Z63 A;  2QNL A;  1XWJ A;  2HS5 A;  5JRA A;  4FX5 A;  4PJJ A;  4JEA A;  3C8G D;  4MVZ A;  3TK0 A;  3VM6 A;  3NKE A;  3T4R A;  3U2L A;  3HTK C;  4XPY A;  2J0X A;  2D4U A;  2NG1 A;  3MLG A;  4RDA A;  3IQ6 A;  5L0I A;  1LPE A;  3KMI A;  3DKA A;  2Q7R A;  1W2W A;  1ZHZ A;  2Q9B A;  2Z15 A;  3JZ0 A;  3DM9 B;  4CDV A;  1I5N A;  1TFK B;  2W4M A;  2YEV A;  4OIO F;  2ZXW C;  3U2M A;  1H7I A;  2A69 F;  3EZH A;  4JE9 A;  5KYX B;  1HW1 A;  5CI8 A;  3RYL A;  2NUP A;  4E18 A;  1GQA A;  4NY3 A;  2VH3 A;  3RKO F;  5A6J A;  3T9O A;  3J06 A;  2L6G A;  4E7Z A;  2FFH A;  4CSA C;  1HW2 A;  2YL3 A;  5KYW B;  2Y3G A;  1E84 A;  1C17 M;  1OCZ C;  3L1M A;  3SYN A;  2YHS A;  1YDI A;  2EPO A;  4CSA A;  3U9J A;  1VTM P;  3CEX A;  1H9G A;  3MX3 A;  1U89 A;  5L3V A;  3B0P A;  4X0R A;  4MW8 A;  3S29 A;  3WAQ A;  1I4Y A;  2JPU A;  2PP4 A;  4NQF A;  2YL1 A;  5JLI A;  3W2W A;  2LFD A;  3C8G B;  3S27 A;  3HKK A;  4QDL A;  3AG3 C;  2R05 A;  5KYN A;  1ZZP A;  5JUA A;  1B68 A;  1DOW A;  3K1I C;  2ZD9 A;  2ZPA A;  1QPU A;  2ZXP A;  1ST6 A;  3HJC A;  4YT4 A;  3LAY A;  5DLJ A;  1N1C A;  4OD5 A;  3KYI A;  4CS7 A;  3IEE A;  3DJN B;  1QQ3 A;  1V74 B;  4YT5 A;  5BUO A;  3FVY A;  2ICW G;  1JR8 A;  1RKE B;  1TWG A; 
#chains in the Genus database with same CATH homology
 1MQV A;  5JP7 A;  2XM0 A;  2YL0 A;  1YZA A;  3HNJ A;  3M4C A;  4CDA A;  2YLG A;  4EIY A;  1E83 A;  2XLE A;  4NC3 A;  2XM4 A;  4IB4 A;  1S05 A;  3ZQV A;  256B A;  3C62 A;  5JT4 A;  3VRC A;  4D4N A;  3M79 A;  3ZQY A;  3QVZ A;  2J9B A;  4U9D A;  2XL6 A;  1NBB A;  5JS5 A;  1YYJ A;  3M15 A;  4WGY A;  3TOL A;  2CCY A;  4D4X A;  4JEB A;  2YLI A;  2BC5 A;  5AGF A;  4IAR A;  3FOO A;  1APC A;  1E86 A;  3HNK A;  4CJG A;  3HNI A;  3NMI A;  3C63 A;  2XL8 A;  3HNL A;  4CIP A;  4N4W A;  2J8W A;  3QVY A;  1CGO A;  2YLD A;  1CPQ A;  3ZWI A;  4ER9 A;  1EKY A;  2QLA A;  3U8P A;  1BBH A;  1YZC A;  5JRA A;  3FOP A;  4ULV A;  4JEA A;  1JAF A;  2YL7 A;  3ZTZ A;  3IQ5 A;  4N6H A;  3IQ6 A;  3TOM A;  5JVE A;  4CDV A;  2XLM A;  4JE9 A;  1RCP A;  3M4B A;  4IAQ A;  4CDY A;  4CJO A;  1E85 A;  3DE8 A;  1GQA A;  2XLV A;  4CX9 A;  5JSL A;  2XLW A;  1YYX A;  2YL3 A;  1E84 A;  3L1M A;  4L6R A;  3NMK A;  3ZTM A;  5B3I A;  5JLI A;  2YL1 A;  3DE9 A;  1CPR A;  2XLH A;  2YKZ A;  2XLO A;  1LM3 B;  5JUA A;  4JKV A;  3NMJ A;  1QPU A;  3QW1 A;  2XLD A;  3QW0 A;  1QQ3 A;  1M6T A;  1A7V A;  4WGZ A;  1CGN A;  4U9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...