5JP7A

Ferrous leu 16 val mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSAVTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5jp7A00
5JP7A 5JVEA 4CX9A 4L6RA 4EIYA 2XM4A 1NBBA 4ER9A 3IQ5A 4ULVA 4U9EA 4D4NA 2YL1A 2YL7A 4IARA 1S05A 2XLWA 1E85A 1YYJA 2XLEA 2J8WA 3IQ6A 3DE8A 3NMKA 2XLMA 3TOLA 1YYXA 4N4WA 4D4XA 5JLIA 3QW1A 3M79A 3C63A 1YZCA 4JEAA 3QVYA 3M4BA 4CJOA 2XLHA 2YL0A 5JRAA 5B3IA 3QW0A 3TOMA 3M4CA 1EKYA 1CGNA 2BC5A 2XLOA 2YLIA 1QQ3A 3ZTMA 1QPUA 4CDVA 3HNLA 2YLGA 3ZQYA 3HNIA 4IAQA 3M15A 3ZTZA 4U9DA 1APCA 2XLDA 4NC3A 1CGOA 3ZQVA 1GQAA 2YL3A 3L1MA 2XL8A 2XM0A 1E86A 1MQVA 5JUAA 4WGYA 3VRCA 4JE9A 256BA 3ZWIA 1LM3B 2XLVA 3U8PA 4WGZA 3NMJA 1BBHA 3FOOA 3QVZA 3FOPA 4CJGA 2QLAA 2XL6A 5JS5A 2YLDA 1A7VA 4JKVA 5JT4A 4JEBA 1E83A 1CPQA 5AGFA 4CDAA 1JAFA 2YKZA 2CCYA 3C62A 1RCPA 1YZAA 4CDYA 1CPRA 4IB4A 4CIPA 5JSLA 1E84A 2J9BA 1M6TA 3HNJA 3DE9A 4N6HA 3HNKA 3NMIA
chains in the Genus database with same CATH superfamily
3WODF 4QDLA 2VCBA 1S7ZA 4AE4B 4XPYA 2VCCA 5D92A 4DVZA 2HS5A 1NLXA 2B0JA 1K40A 1ZU4A 3E70C 3L34A 3N2ZB 4IRUA 3VM6A 1EQ1A 1M2VB 1OQCA 1Q0DA 2XM4A 4A2NB 1RKEB 3DWWA 4H4KC 1NFOA 5L0FA 3PDMP 1LI5A 1VB5A 4OIQF 1ZHXA 4ULWA 4KI2A 2OCCC 2OOCA 5CI9A 4U5HA 2YL1A 1I5NA 4EWCA 2D4UA 2HSBA 3T9OA 1ST6A 2R7RA 4YJWA 1T9KA 3A11A 2IXOA 1LVKA 4JTCB 3UMHA 2HJ3A 1ZU5A 3ZSUA 1L3PA 3WG7C 2PF4E 2P0NA 1PV3A 4HEAJ 1QVXA 3EGXB 2YHSA 4N06A 4BJ5A 4YWQA 2XLMA 1MNEA 1T5OA 3TOLA 2J9UA 3T6JA 3T6BA 2UUIA 3KMIA 4YK5A 3GM2A 3RF3A 3B0UX 1FFTC 3DAGA 1HMOA 2M4EA 2WVOA 2PX3A 4LLEA 4O6NA 2R7TA 4JEAA 4U5EE 3QVYA 4K0DA 2ZD9A 2NUTB 2ZPAA 3G50A 3M4BA 3O10A 4AL1A 4MTOA 1WN0A 2EPNA 5E3CA 2L6FA 3RQFA 1Z63A 1H9GA 4R32A 2A1DD 2UUHA 3SXZA 4XEKA 3C8GB 3ZTMA 3GODA 1FNTc 3Q7GA 4G0HA 3IQTA 4DBQA 4YT5A 2W45A 3C18A 1FFHA 2CW0F 4JTAB 2NUPA 2YLGA 4EHPA 1WTYA 4IAQA 3DJUB 3DMDA 5JT4A 4O7GA 5KYYA 2R25A 1WOLA 2W4BA 1NG1A 1D1CA 1UFBA 2J45A 1APCA 2P61A 3DAFA 3N24A 3O6XA 4U9DA 3ZQVA 4AL0A 1GQAA 1AUEA 1VYIA 1NU7D 2DB4A 3T6GB 2XL8A 4JURI 3IQCA 2XXAB 1MQVA 4JJFA 2C03A 4MTFA 1TKNA 2BE5F 1OR3A 4I1OB 2A0BA 4JW1A 4MW8A 2G62A 1YVIA 256BA 1OW7A 4B6IA 3ZWIA 2V3CC 1XZQA 1Y4CA 3RQGA 1AEPA 4NTBA 4XPWA 3GEEA 5KYUA 1IZMA 1TWAA 2A6HF 2AWCA 2P7VA 3JYHA 1BDJB 3NMJA 3L8JA 3TD7A 4LERA 2EINC 3FOOA 1SZIA 3K1IA 3KYJA 3B0VC 3HLZA 1JPJA 3AGUA 3O39A 2XL6A 1OCCC 1SYQA 2L6GA 2XRHA 2IYLD 4JC7A 4MVQA 4DRIB 1VLSA 2H8AA 3L0IA 4K1OA 4IGGA 5KYWA 4JKVA 1BZ4A 1V4AA 2AP3A 2WB7A 4FWVA 2Q3TA 3GEIA 4MNDA 4MVMA 4YL3A 2AVKA 3S29A 4W8PA 1LS4A 1E83A 4W8KA 4MVSA 2JPUA 1MMGA 3SXMA 3X1OA 1JMWA 4MS2A 4C7OB 1OXKA 3AQCA 3N0TA 4J30B 1TWHA 4Q7CA 5B1BC 3U9MA 3FMSA 1HY5A 2CCYA 2FFHA 1VYKA 2X0CA 1ORYA 1D0XA 3PHF2 4PFOA 2IXMA 1LPEA 3VF0A 3L8IA 3S90A 1H7IA 3S9OA 1JRAA 1M2VA 4G7HF 3SP1A 3ZVRA 4BJTA 1NFNA 1NU9C 2OKUA 2VH3A 2EIJC 3KL4A 1JPNA 2KSFA 5JSLA 4CS8A 2J9BA 1E84A 1QZXA 2XS1A 3AG2C 3TQOA 1YA9A 5B1AC 3US6A 3K7DA 5TJ5E 3B29A 3KYIA 2IM8A 3SNHA 3HNKA 3V5YA 3ZG1A 1T6IA 1XZPA 3MBGA 5JP7A 3B71A 3AGTA 4EIYA 5COFA 3EGXA 3EJNA 4MW3A 5BQGA 2ASRA 2I15A 3LLIA 4E7SA 4F4BA 2E87A 1NBBA 4JVSA 1E2XA 3WHNA 5HSWA 3LUTB 2GWWA 2LP4A 2Q00A 4D4NA 4Q5SF 1SR2A 4BJ1A 1Q0FA 3RVYA 3JSZA 2YL7A 1U6HA 4MQ9F 3AG1C 3S28A 1JR8A 3E9VA 4XLNF 3GM1A 3G4XA 4JCZA 5DQZA 1E85A 4CS9A 3EFOA 2XLEA 1V55C 3ZC4A 2J8WA 1ZHTA 3DE8A 1FMVA 1D1AA 2FAPB 4ANJA 1LE2A 1LIHA 2XL4A 1I4YA 4N4WA 1WASA 4O6MA 1OCRC 4WJ0A 4FAPB 3C63A 3MLGA 3FAJA 4U5BE 3CSKA 3V5ZA 3EG9B 5DS4A 4Q4ZF 3EZHA 2QNLA 4XEVA 3X2QC 4BJ5C 3NRHA 5JRAA 2Y39A 3QW0A 5L3VA 5KYNA 2J9VA 2HJMA 4G78A 3TOMA 4RDAA 4UDVA 3GWNA 1CGNA 2W4MA 3HTKC 1EA8A 2BC5A 3KH2A 3M1CB 1K04A 2XLOA 2Q9BA 3W4YA 1O3UA 5T1DB 3RQEA 5F5HA 4A4AA 1G4WR 4EBJA 3ASOC 2R03A 2J9WA 1C03A 4WABA 1YAUO 4CDVA 1YARO 3MYIA 4O6YA 3EGDB 4EKWA 1ZYRF 3ZQYA 2VC9A 2AWYA 2H7BA 1T6UA 3M15A 3AOUA 3LNRA 4JCHA 2OEXA 3HJCA 4MVUA 4Z9HA 4JIOA 1EI7A 1TWCA 3V7OA 2LFFA 1D1BA 1ZHYA 2R7OA 1CGOA 1NSGB 3ECSA 4NC3A 3GWLA 3SXYA 4YT4A 2YL3A 3H2UA 1M56C 3KKBA 2PX0A 3L1MA 3NYMA 1G5ZA 1U89A 2W9YA 4RBNA 1Z3IX 2LIGA 2ETSA 1GS9A 3EH2A 3RVZA 1JOGA 4BEMJ 1VOMA 1TQGA 2MYSA 4K7BA 5IY5C 4JE9A 1RXQA 2KJGA 4MVZA 3AJMA 1LM3B 3UNGC 3DXJF 1IW7F 1LS1A 4PJJA 3R2PA 3U8PA 3GM3A 5A6KA 4CSAA 3U5SA 3AQBA 2EPMX 1BBHA 4M63A 2J0XA 2CYDA 5T3WA 2HKVA 5L0CA 5L3QA 1TFOB 1Z6AA 3FOPA 2ZXPA 1OKKA 3VYWA 4C3DA 2CNWA 4C3BA 2OU6A 1A7VA 2X51A 3G4ZA 3JRMO 1GM5A 4J7YA 5AC4A 2AU5A 2ZXOA 3ASNC 3K1IC 5A6BA 2ZXWC 1HE1A 2VB6A 3EZIA 4IJJA 4PFPA 1CPQA 2L81A 3K33A 4IWBA 2G3VA 1TFKB 3EPVA 1Y6DA 3LS0A 3SXKA 1ORSC 1ORJA 4P9TA 1ZVZA 2A0UA 2TMVP 3C62A 3DI5A 1RCPA 1RJ9A 4XQ1A 1PD1A 2I8BA 2XS8A 4JJGA 4KBLA 4CDYA 1HW2A 5DVWA 1YA7O 4IB4A 2BL2A 5DQTA 4CIPA 2V26A 2R05A 3IPMO 3K6BA 3RH3A 1LKXA 3DKAA 4KC9A 2R7XA 3IHUA 1VTMP 2DYSC 5GPGB 1Z23A 4IAOA 3MX3A 1TR2A 2P6VA 1Q0MA 5D91A 4XPXA 3TJ6A 3C7JA 3CAXA 3BRJA 1LI7A 1PD0A 3A9CA 4YN0B 3TJ5A 1VMAA 4CS8C 2WL8A 3RYLA 2VASA 2J7PA 2R02A 5KYXB 1GGQA 3CQZA 4ZLCA 3JT1A 5EHHA 3W2WA 4BJ6A 4E0HA 4ER9A 1OR2A 4ULVA 4U9EA 4BEJA 3LS1A 5AC5A 4AE4A 4U5GA 4X0RA 3DZAA 4DBRA 1FAPB 1SMYF 3I5PA 1T6QA 1S05A 1RKEA 2XLWA 1YYJA 4OD5A 5BQIA 3S0XA 3S84A 2KNHA 4YT8A 3NMKA 4PJNA 4U5DE 3U2MA 1YYXA 2LD6A 3S27A 5BUOA 2OQMA 4D4XA 1OCZC 1OW8A 3FHDA 3U3FA 2EIMC 3RKOF 3RFYA 4AK9A 1W2WA 5JLIA 5L0DA 3M79A 3QW1A 1YZCA 5COGA 1MMNA 1Q0KA 3EHNA 4CS9C 2R7WA 2WVNA 4PACA 4O79A 1OXBA 2HZ8A 4CJOA 2PBEA 2YL0A 2KW3C 4KNVA 4E0IA 2L7AA 2NUPB 3LAYA 3M4CA 4J7TA 1EKYA 3I4UA 3W8HA 2HV7A 3HKKA 3GANA 5CIVA 2YLIA 4P6IC 1QQ3A 4AX2A 4DRJB 1QPUA 3C8GD 2NUTA 1C17M 2KK1A 1QSPA 1ZW2A 3OEOA 3QTHA 3K1HA 2NSGA 3ZDLA 4FX5A 2YEVA 2GAQA 3LESA 2IXNA 4JRZA 3OA1A 2Z15A 2J0WA 5BQHA 2C04A 1CGME 4CIHA 2GFHA 3C8GA 1WGWA 2QY9A 3ZTZA 5F28E 1G4US 1BR2A 1RKCA 1FTSA 1UG7A 4MTGA 1PCXA 2XLDA 2PNOA 3CZ6A 1A7DA 4RD9A 4NY3A 1AVOB 2Y3DA 4PJLA 1O87A 4YL1A 2Y3HA 1KNYA 3EHMA 4I44A 1K05A 2P1AA 2A68F 5JUAA 2H7VC 4WGYA 3VRCA 2OJQA 2CDQA 1L7CA 2OG2A 4QI0A 4JTDB 5L0JA 1V74B 4OD4A 1BR1A 2HSQA 3J06A 1BR4A 2Y3BA 2O9XA 3OWTA 1KTMA 3U9JA 3NDBB 2CGEA 2XXAA 4WGZA 3PCVA 2MWQA 3CEXA 2KC3A 3K66A 1G8XA 3SYNA 3TK0A 3JRTA 3QVZA 1B68A 5F5FA 4KNWA 5B3SC 5JS5A 2YLDA 2EPOA 4OIRF 3QZCA 4CS7A 4HE8D 1HE9A 4N6CA 3AG4C 4CSAC 3GEHA 3NYJA 2OJED 5A6JA 3EH1A 3F47A 3UMKA 5A69A 4XWJA 1H9TA 1MNDA 2LCHA 2B0HA 2GDCA 2J46A 5EGYA 1H6GA 4NTFA 1Q0GA 1YJGA 4LLCA 4Z9IA 2IBFA 1JAFA 2YKZA 2YWAA 4Z9JA 2HMQA 1Z5ZA 2Q9AA 3QMKA 2R7VA 1DOVA 1YZAA 4XTKA 4BPMA 1M57C 1V54C 1OKKD 1T01A 5KYXA 4C7OA 1CPRA 2CNWD 1ZW3A 3NG1A 4XEFA 1O5HA 1MMAA 4E7ZA 3HNJA 3AG3C 2ICWG 3DE9A 2QTVA 4N6HA 5A6BD 3RW0A 3U2LA 4PJMA 2IOQA 3MYFA 2OEVA 2FGYA 2A69F 4EBKA 5JVEA 3W2VA 1M2OA 1NZEA 3VAYA 3EQLF 4CX9A 4L6RA 3JSEO 3FVYA 4I3MA 4G7ZF 3DM5A 3T4RA 3I5QA 2YZSA 1R5ID 2NG1A 4DXWA 1ZZPA 3B9QA 2R7QA 2EPLX 2HMZA 4HFKB 4JZAA 5E3AA 2HUJA 2M64A 3EFOB 3IQ5A 3LJBA 3NKDA 3TULA 2NPUA 1N1CA 2ZXRA 4HFFB 4BG0A 1FR0A 4G7OF 4U5FE 2Y69C 4IARA 2Q4FA 4BJ6C 1ZHWA 3MFNA 4I1MA 3WAQA 3IQ6A 3IEEA 4GQHA 4MVOA 2NSFA 4C3EA 2EIKC 3O55A 2J7PD 3V5XA 5T3TA 4H54A 3RIPA 3H65A 2Q7RA 4DJ9A 2WZLA 4J32B 5E2QA 4YT2A 2MHRA 4LDKA 3UR3C 3JCUQ 2G3KA 1J8MF 5HV9A 3ABMC 1QKRA 3JZ0A 1A7EA 2XLHA 1VLTA 5E33A 4E18A 5B3IA 1YLMA 1XWJA 3ZIBA 4XLPF 1YDIA 3UGPA 4GEHA 3LNMB 2R9RB 3BEHA 5DS6A 2RSEB 3H2VA 4CBEA 5L0HA 3DD7A 3EG9A 3F46A 2F22A 3HNLA 2DI3A 1C02A 1ZHZA 1D0YA 2WZFA 2Y3GA 4QI2A 1J8YF 4E17A 5EK0A 1FMWA 3HNIA 4NCQA 2RD9A 2HV6A 1F1MA 3Q6MA 3KPHA 4ZLDA 2LQGA 2R7SA 4FESA 3C8ZA 4LACB 3EGDA 1Z7Qc 1DOWA 3ABLC 1LE4A 2YRFA 3ATPA 4GYTA 5FZTA 1WWPA 3UMIA 3ITFA 3JYYA 4EBBA 2A6EF 4PR9A 2XM0A 1E86A 2YVKA 3U0CA 3GORA 3FDQA 2XSEA 3NYLA 5COMA 3Q7LA 5FCLA 2L6HA 1I4ZA 4EUKB 1U0BB 3DM9B 3UGOA 2JD3A 1TWGA 2QE9A 2XLVA 1A41A 3B0PA 4OIOF 3Q6NA 3U8VA 5KYYB 4OIPF 4MVRA 3ABKC 3FAPB 1D0ZA 5DS5A 2D5RB 2PFDA 2LFDA 4CJGA 3SZRA 3LLKA 4OINF 3SEOA 2QLAA 2KYHA 5L0GA 1RMVA 2JX0A 5CI8A 2HFIA 2IXPA 2L9JA 1SF8A 2WZGA 4JEBA 2GA0A 1RJ9B 1MMDA 4YL0A 1HMDA 2Q9CA 5K0IA 5KYUB 3R7CA 5AGFA 1A0BA 4LDRA 3W8IA 4NTAA 2WVQA 4CDAA 2H7OA 4U5CE 4ONSA 4NQFA 4PK4A 2KQ9A 2LSEA 3JTLO 1R4TA 1OCOC 1OW6A 2PP4A 4LDQA 2KGOA 1KU2A 2QUPA 3U3BA 5KYWB 2EILC 3FXHA 2YQYA 1VK5A 3LEVA 4DOZA 1HW1A 4P9FA 5A6AA 2EPKX 1M6TA 1WATA 2VCAA 1QLEC 3PMRA 4DRHB 5DLJA 4DVYP 3LEOA 3DJNB 3POVA 2LK4A 2R7UA 2DGJA 3NKEA 2DYRC 3NMIA 5L0IA
chains in the Genus database with same CATH topology
5JP7A 5JVEA 4CX9A 4L6RA 4EIYA 2XM4A 1NBBA 4ER9A 3IQ5A 4ULVA 4U9EA 4D4NA 2YL1A 2YL7A 4IARA 1S05A 2XLWA 1E85A 1YYJA 2XLEA 2J8WA 3IQ6A 3DE8A 3NMKA 2XLMA 3TOLA 1YYXA 4N4WA 4D4XA 5JLIA 3QW1A 3M79A 3C63A 1YZCA 4JEAA 3QVYA 3M4BA 4CJOA 2XLHA 2YL0A 5JRAA 5B3IA 3QW0A 3TOMA 3M4CA 1EKYA 1CGNA 2BC5A 2XLOA 2YLIA 1QQ3A 3ZTMA 1QPUA 4CDVA 3HNLA 2YLGA 3ZQYA 3HNIA 4IAQA 3M15A 3ZTZA 4U9DA 1APCA 2XLDA 4NC3A 1CGOA 3ZQVA 1GQAA 2YL3A 3L1MA 2XL8A 2XM0A 1E86A 1MQVA 5JUAA 4WGYA 3VRCA 4JE9A 256BA 3ZWIA 1LM3B 2XLVA 3U8PA 4WGZA 3NMJA 1BBHA 3FOOA 3QVZA 3FOPA 4CJGA 2QLAA 2XL6A 5JS5A 2YLDA 1A7VA 4JKVA 5JT4A 4JEBA 1E83A 1CPQA 5AGFA 4CDAA 1JAFA 2YKZA 2CCYA 3C62A 1RCPA 1YZAA 4CDYA 1CPRA 4IB4A 4CIPA 5JSLA 1E84A 2J9BA 1M6TA 3HNJA 3DE9A 4N6HA 3HNKA 3NMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JP7 A;  5JVE A;  4CX9 A;  4L6R A;  4EIY A;  2XM4 A;  1NBB A;  4ER9 A;  3IQ5 A;  4ULV A;  4U9E A;  4D4N A;  2YL1 A;  2YL7 A;  4IAR A;  1S05 A;  2XLW A;  1E85 A;  1YYJ A;  2XLE A;  2J8W A;  3IQ6 A;  3DE8 A;  3NMK A;  2XLM A;  3TOL A;  1YYX A;  4N4W A;  4D4X A;  5JLI A;  3QW1 A;  3M79 A;  3C63 A;  1YZC A;  4JEA A;  3QVY A;  3M4B A;  4CJO A;  2XLH A;  2YL0 A;  5JRA A;  5B3I A;  3QW0 A;  3TOM A;  3M4C A;  1EKY A;  1CGN A;  2BC5 A;  2XLO A;  2YLI A;  1QQ3 A;  3ZTM A;  1QPU A;  4CDV A;  3HNL A;  2YLG A;  3ZQY A;  3HNI A;  4IAQ A;  3M15 A;  3ZTZ A;  4U9D A;  1APC A;  2XLD A;  4NC3 A;  1CGO A;  3ZQV A;  1GQA A;  2YL3 A;  3L1M A;  2XL8 A;  2XM0 A;  1E86 A;  1MQV A;  5JUA A;  4WGY A;  3VRC A;  4JE9 A;  256B A;  3ZWI A;  1LM3 B;  2XLV A;  3U8P A;  4WGZ A;  3NMJ A;  1BBH A;  3FOO A;  3QVZ A;  3FOP A;  4CJG A;  2QLA A;  2XL6 A;  5JS5 A;  2YLD A;  1A7V A;  4JKV A;  5JT4 A;  4JEB A;  1E83 A;  1CPQ A;  5AGF A;  4CDA A;  1JAF A;  2YKZ A;  2CCY A;  3C62 A;  1RCP A;  1YZA A;  4CDY A;  1CPR A;  4IB4 A;  4CIP A;  5JSL A;  1E84 A;  2J9B A;  1M6T A;  3HNJ A;  3DE9 A;  4N6H A;  3HNK A;  3NMI A; 
#chains in the Genus database with same CATH topology
 3WOD F;  4QDL A;  2VCB A;  1S7Z A;  4AE4 B;  4XPY A;  2VCC A;  5D92 A;  4DVZ A;  2HS5 A;  1NLX A;  2B0J A;  1K40 A;  1ZU4 A;  3E70 C;  3L34 A;  3N2Z B;  4IRU A;  3VM6 A;  1EQ1 A;  1M2V B;  1OQC A;  1Q0D A;  2XM4 A;  4A2N B;  1RKE B;  3DWW A;  4H4K C;  1NFO A;  5L0F A;  3PDM P;  1LI5 A;  1VB5 A;  4OIQ F;  1ZHX A;  4ULW A;  4KI2 A;  2OCC C;  2OOC A;  5CI9 A;  4U5H A;  2YL1 A;  1I5N A;  4EWC A;  2D4U A;  2HSB A;  3T9O A;  1ST6 A;  2R7R A;  4YJW A;  1T9K A;  3A11 A;  2IXO A;  1LVK A;  4JTC B;  3UMH A;  2HJ3 A;  1ZU5 A;  3ZSU A;  1L3P A;  3WG7 C;  2PF4 E;  2P0N A;  1PV3 A;  4HEA J;  1QVX A;  3EGX B;  2YHS A;  4N06 A;  4BJ5 A;  4YWQ A;  2XLM A;  1MNE A;  1T5O A;  3TOL A;  2J9U A;  3T6J A;  3T6B A;  2UUI A;  3KMI A;  4YK5 A;  3GM2 A;  3RF3 A;  3B0U X;  1FFT C;  3DAG A;  1HMO A;  2M4E A;  2WVO A;  2PX3 A;  4LLE A;  4O6N A;  2R7T A;  4JEA A;  4U5E E;  3QVY A;  4K0D A;  2ZD9 A;  2NUT B;  2ZPA A;  3G50 A;  3M4B A;  3O10 A;  4AL1 A;  4MTO A;  1WN0 A;  2EPN A;  5E3C A;  2L6F A;  3RQF A;  1Z63 A;  1H9G A;  4R32 A;  2A1D D;  2UUH A;  3SXZ A;  4XEK A;  3C8G B;  3ZTM A;  3GOD A;  1FNT c;  3Q7G A;  4G0H A;  3IQT A;  4DBQ A;  4YT5 A;  2W45 A;  3C18 A;  1FFH A;  2CW0 F;  4JTA B;  2NUP A;  2YLG A;  4EHP A;  1WTY A;  4IAQ A;  3DJU B;  3DMD A;  5JT4 A;  4O7G A;  5KYY A;  2R25 A;  1WOL A;  2W4B A;  1NG1 A;  1D1C A;  1UFB A;  2J45 A;  1APC A;  2P61 A;  3DAF A;  3N24 A;  3O6X A;  4U9D A;  3ZQV A;  4AL0 A;  1GQA A;  1AUE A;  1VYI A;  1NU7 D;  2DB4 A;  3T6G B;  2XL8 A;  4JUR I;  3IQC A;  2XXA B;  1MQV A;  4JJF A;  2C03 A;  4MTF A;  1TKN A;  2BE5 F;  1OR3 A;  4I1O B;  2A0B A;  4JW1 A;  4MW8 A;  2G62 A;  1YVI A;  256B A;  1OW7 A;  4B6I A;  3ZWI A;  2V3C C;  1XZQ A;  1Y4C A;  3RQG A;  1AEP A;  4NTB A;  4XPW A;  3GEE A;  5KYU A;  1IZM A;  1TWA A;  2A6H F;  2AWC A;  2P7V A;  3JYH A;  1BDJ B;  3NMJ A;  3L8J A;  3TD7 A;  4LER A;  2EIN C;  3FOO A;  1SZI A;  3K1I A;  3KYJ A;  3B0V C;  3HLZ A;  1JPJ A;  3AGU A;  3O39 A;  2XL6 A;  1OCC C;  1SYQ A;  2L6G A;  2XRH A;  2IYL D;  4JC7 A;  4MVQ A;  4DRI B;  1VLS A;  2H8A A;  3L0I A;  4K1O A;  4IGG A;  5KYW A;  4JKV A;  1BZ4 A;  1V4A A;  2AP3 A;  2WB7 A;  4FWV A;  2Q3T A;  3GEI A;  4MND A;  4MVM A;  4YL3 A;  2AVK A;  3S29 A;  4W8P A;  1LS4 A;  1E83 A;  4W8K A;  4MVS A;  2JPU A;  1MMG A;  3SXM A;  3X1O A;  1JMW A;  4MS2 A;  4C7O B;  1OXK A;  3AQC A;  3N0T A;  4J30 B;  1TWH A;  4Q7C A;  5B1B C;  3U9M A;  3FMS A;  1HY5 A;  2CCY A;  2FFH A;  1VYK A;  2X0C A;  1ORY A;  1D0X A;  3PHF 2;  4PFO A;  2IXM A;  1LPE A;  3VF0 A;  3L8I A;  3S90 A;  1H7I A;  3S9O A;  1JRA A;  1M2V A;  4G7H F;  3SP1 A;  3ZVR A;  4BJT A;  1NFN A;  1NU9 C;  2OKU A;  2VH3 A;  2EIJ C;  3KL4 A;  1JPN A;  2KSF A;  5JSL A;  4CS8 A;  2J9B A;  1E84 A;  1QZX A;  2XS1 A;  3AG2 C;  3TQO A;  1YA9 A;  5B1A C;  3US6 A;  3K7D A;  5TJ5 E;  3B29 A;  3KYI A;  2IM8 A;  3SNH A;  3HNK A;  3V5Y A;  3ZG1 A;  1T6I A;  1XZP A;  3MBG A;  5JP7 A;  3B71 A;  3AGT A;  4EIY A;  5COF A;  3EGX A;  3EJN A;  4MW3 A;  5BQG A;  2ASR A;  2I15 A;  3LLI A;  4E7S A;  4F4B A;  2E87 A;  1NBB A;  4JVS A;  1E2X A;  3WHN A;  5HSW A;  3LUT B;  2GWW A;  2LP4 A;  2Q00 A;  4D4N A;  4Q5S F;  1SR2 A;  4BJ1 A;  1Q0F A;  3RVY A;  3JSZ A;  2YL7 A;  1U6H A;  4MQ9 F;  3AG1 C;  3S28 A;  1JR8 A;  3E9V A;  4XLN F;  3GM1 A;  3G4X A;  4JCZ A;  5DQZ A;  1E85 A;  4CS9 A;  3EFO A;  2XLE A;  1V55 C;  3ZC4 A;  2J8W A;  1ZHT A;  3DE8 A;  1FMV A;  1D1A A;  2FAP B;  4ANJ A;  1LE2 A;  1LIH A;  2XL4 A;  1I4Y A;  4N4W A;  1WAS A;  4O6M A;  1OCR C;  4WJ0 A;  4FAP B;  3C63 A;  3MLG A;  3FAJ A;  4U5B E;  3CSK A;  3V5Z A;  3EG9 B;  5DS4 A;  4Q4Z F;  3EZH A;  2QNL A;  4XEV A;  3X2Q C;  4BJ5 C;  3NRH A;  5JRA A;  2Y39 A;  3QW0 A;  5L3V A;  5KYN A;  2J9V A;  2HJM A;  4G78 A;  3TOM A;  4RDA A;  4UDV A;  3GWN A;  1CGN A;  2W4M A;  3HTK C;  1EA8 A;  2BC5 A;  3KH2 A;  3M1C B;  1K04 A;  2XLO A;  2Q9B A;  3W4Y A;  1O3U A;  5T1D B;  3RQE A;  5F5H A;  4A4A A;  1G4W R;  4EBJ A;  3ASO C;  2R03 A;  2J9W A;  1C03 A;  4WAB A;  1YAU O;  4CDV A;  1YAR O;  3MYI A;  4O6Y A;  3EGD B;  4EKW A;  1ZYR F;  3ZQY A;  2VC9 A;  2AWY A;  2H7B A;  1T6U A;  3M15 A;  3AOU A;  3LNR A;  4JCH A;  2OEX A;  3HJC A;  4MVU A;  4Z9H A;  4JIO A;  1EI7 A;  1TWC A;  3V7O A;  2LFF A;  1D1B A;  1ZHY A;  2R7O A;  1CGO A;  1NSG B;  3ECS A;  4NC3 A;  3GWL A;  3SXY A;  4YT4 A;  2YL3 A;  3H2U A;  1M56 C;  3KKB A;  2PX0 A;  3L1M A;  3NYM A;  1G5Z A;  1U89 A;  2W9Y A;  4RBN A;  1Z3I X;  2LIG A;  2ETS A;  1GS9 A;  3EH2 A;  3RVZ A;  1JOG A;  4BEM J;  1VOM A;  1TQG A;  2MYS A;  4K7B A;  5IY5 C;  4JE9 A;  1RXQ A;  2KJG A;  4MVZ A;  3AJM A;  1LM3 B;  3UNG C;  3DXJ F;  1IW7 F;  1LS1 A;  4PJJ A;  3R2P A;  3U8P A;  3GM3 A;  5A6K A;  4CSA A;  3U5S A;  3AQB A;  2EPM X;  1BBH A;  4M63 A;  2J0X A;  2CYD A;  5T3W A;  2HKV A;  5L0C A;  5L3Q A;  1TFO B;  1Z6A A;  3FOP A;  2ZXP A;  1OKK A;  3VYW A;  4C3D A;  2CNW A;  4C3B A;  2OU6 A;  1A7V A;  2X51 A;  3G4Z A;  3JRM O;  1GM5 A;  4J7Y A;  5AC4 A;  2AU5 A;  2ZXO A;  3ASN C;  3K1I C;  5A6B A;  2ZXW C;  1HE1 A;  2VB6 A;  3EZI A;  4IJJ A;  4PFP A;  1CPQ A;  2L81 A;  3K33 A;  4IWB A;  2G3V A;  1TFK B;  3EPV A;  1Y6D A;  3LS0 A;  3SXK A;  1ORS C;  1ORJ A;  4P9T A;  1ZVZ A;  2A0U A;  2TMV P;  3C62 A;  3DI5 A;  1RCP A;  1RJ9 A;  4XQ1 A;  1PD1 A;  2I8B A;  2XS8 A;  4JJG A;  4KBL A;  4CDY A;  1HW2 A;  5DVW A;  1YA7 O;  4IB4 A;  2BL2 A;  5DQT A;  4CIP A;  2V26 A;  2R05 A;  3IPM O;  3K6B A;  3RH3 A;  1LKX A;  3DKA A;  4KC9 A;  2R7X A;  3IHU A;  1VTM P;  2DYS C;  5GPG B;  1Z23 A;  4IAO A;  3MX3 A;  1TR2 A;  2P6V A;  1Q0M A;  5D91 A;  4XPX A;  3TJ6 A;  3C7J A;  3CAX A;  3BRJ A;  1LI7 A;  1PD0 A;  3A9C A;  4YN0 B;  3TJ5 A;  1VMA A;  4CS8 C;  2WL8 A;  3RYL A;  2VAS A;  2J7P A;  2R02 A;  5KYX B;  1GGQ A;  3CQZ A;  4ZLC A;  3JT1 A;  5EHH A;  3W2W A;  4BJ6 A;  4E0H A;  4ER9 A;  1OR2 A;  4ULV A;  4U9E A;  4BEJ A;  3LS1 A;  5AC5 A;  4AE4 A;  4U5G A;  4X0R A;  3DZA A;  4DBR A;  1FAP B;  1SMY F;  3I5P A;  1T6Q A;  1S05 A;  1RKE A;  2XLW A;  1YYJ A;  4OD5 A;  5BQI A;  3S0X A;  3S84 A;  2KNH A;  4YT8 A;  3NMK A;  4PJN A;  4U5D E;  3U2M A;  1YYX A;  2LD6 A;  3S27 A;  5BUO A;  2OQM A;  4D4X A;  1OCZ C;  1OW8 A;  3FHD A;  3U3F A;  2EIM C;  3RKO F;  3RFY A;  4AK9 A;  1W2W A;  5JLI A;  5L0D A;  3M79 A;  3QW1 A;  1YZC A;  5COG A;  1MMN A;  1Q0K A;  3EHN A;  4CS9 C;  2R7W A;  2WVN A;  4PAC A;  4O79 A;  1OXB A;  2HZ8 A;  4CJO A;  2PBE A;  2YL0 A;  2KW3 C;  4KNV A;  4E0I A;  2L7A A;  2NUP B;  3LAY A;  3M4C A;  4J7T A;  1EKY A;  3I4U A;  3W8H A;  2HV7 A;  3HKK A;  3GAN A;  5CIV A;  2YLI A;  4P6I C;  1QQ3 A;  4AX2 A;  4DRJ B;  1QPU A;  3C8G D;  2NUT A;  1C17 M;  2KK1 A;  1QSP A;  1ZW2 A;  3OEO A;  3QTH A;  3K1H A;  2NSG A;  3ZDL A;  4FX5 A;  2YEV A;  2GAQ A;  3LES A;  2IXN A;  4JRZ A;  3OA1 A;  2Z15 A;  2J0W A;  5BQH A;  2C04 A;  1CGM E;  4CIH A;  2GFH A;  3C8G A;  1WGW A;  2QY9 A;  3ZTZ A;  5F28 E;  1G4U S;  1BR2 A;  1RKC A;  1FTS A;  1UG7 A;  4MTG A;  1PCX A;  2XLD A;  2PNO A;  3CZ6 A;  1A7D A;  4RD9 A;  4NY3 A;  1AVO B;  2Y3D A;  4PJL A;  1O87 A;  4YL1 A;  2Y3H A;  1KNY A;  3EHM A;  4I44 A;  1K05 A;  2P1A A;  2A68 F;  5JUA A;  2H7V C;  4WGY A;  3VRC A;  2OJQ A;  2CDQ A;  1L7C A;  2OG2 A;  4QI0 A;  4JTD B;  5L0J A;  1V74 B;  4OD4 A;  1BR1 A;  2HSQ A;  3J06 A;  1BR4 A;  2Y3B A;  2O9X A;  3OWT A;  1KTM A;  3U9J A;  3NDB B;  2CGE A;  2XXA A;  4WGZ A;  3PCV A;  2MWQ A;  3CEX A;  2KC3 A;  3K66 A;  1G8X A;  3SYN A;  3TK0 A;  3JRT A;  3QVZ A;  1B68 A;  5F5F A;  4KNW A;  5B3S C;  5JS5 A;  2YLD A;  2EPO A;  4OIR F;  3QZC A;  4CS7 A;  4HE8 D;  1HE9 A;  4N6C A;  3AG4 C;  4CSA C;  3GEH A;  3NYJ A;  2OJE D;  5A6J A;  3EH1 A;  3F47 A;  3UMK A;  5A69 A;  4XWJ A;  1H9T A;  1MND A;  2LCH A;  2B0H A;  2GDC A;  2J46 A;  5EGY A;  1H6G A;  4NTF A;  1Q0G A;  1YJG A;  4LLC A;  4Z9I A;  2IBF A;  1JAF A;  2YKZ A;  2YWA A;  4Z9J A;  2HMQ A;  1Z5Z A;  2Q9A A;  3QMK A;  2R7V A;  1DOV A;  1YZA A;  4XTK A;  4BPM A;  1M57 C;  1V54 C;  1OKK D;  1T01 A;  5KYX A;  4C7O A;  1CPR A;  2CNW D;  1ZW3 A;  3NG1 A;  4XEF A;  1O5H A;  1MMA A;  4E7Z A;  3HNJ A;  3AG3 C;  2ICW G;  3DE9 A;  2QTV A;  4N6H A;  5A6B D;  3RW0 A;  3U2L A;  4PJM A;  2IOQ A;  3MYF A;  2OEV A;  2FGY A;  2A69 F;  4EBK A;  5JVE A;  3W2V A;  1M2O A;  1NZE A;  3VAY A;  3EQL F;  4CX9 A;  4L6R A;  3JSE O;  3FVY A;  4I3M A;  4G7Z F;  3DM5 A;  3T4R A;  3I5Q A;  2YZS A;  1R5I D;  2NG1 A;  4DXW A;  1ZZP A;  3B9Q A;  2R7Q A;  2EPL X;  2HMZ A;  4HFK B;  4JZA A;  5E3A A;  2HUJ A;  2M64 A;  3EFO B;  3IQ5 A;  3LJB A;  3NKD A;  3TUL A;  2NPU A;  1N1C A;  2ZXR A;  4HFF B;  4BG0 A;  1FR0 A;  4G7O F;  4U5F E;  2Y69 C;  4IAR A;  2Q4F A;  4BJ6 C;  1ZHW A;  3MFN A;  4I1M A;  3WAQ A;  3IQ6 A;  3IEE A;  4GQH A;  4MVO A;  2NSF A;  4C3E A;  2EIK C;  3O55 A;  2J7P D;  3V5X A;  5T3T A;  4H54 A;  3RIP A;  3H65 A;  2Q7R A;  4DJ9 A;  2WZL A;  4J32 B;  5E2Q A;  4YT2 A;  2MHR A;  4LDK A;  3UR3 C;  3JCU Q;  2G3K A;  1J8M F;  5HV9 A;  3ABM C;  1QKR A;  3JZ0 A;  1A7E A;  2XLH A;  1VLT A;  5E33 A;  4E18 A;  5B3I A;  1YLM A;  1XWJ A;  3ZIB A;  4XLP F;  1YDI A;  3UGP A;  4GEH A;  3LNM B;  2R9R B;  3BEH A;  5DS6 A;  2RSE B;  3H2V A;  4CBE A;  5L0H A;  3DD7 A;  3EG9 A;  3F46 A;  2F22 A;  3HNL A;  2DI3 A;  1C02 A;  1ZHZ A;  1D0Y A;  2WZF A;  2Y3G A;  4QI2 A;  1J8Y F;  4E17 A;  5EK0 A;  1FMW A;  3HNI A;  4NCQ A;  2RD9 A;  2HV6 A;  1F1M A;  3Q6M A;  3KPH A;  4ZLD A;  2LQG A;  2R7S A;  4FES A;  3C8Z A;  4LAC B;  3EGD A;  1Z7Q c;  1DOW A;  3ABL C;  1LE4 A;  2YRF A;  3ATP A;  4GYT A;  5FZT A;  1WWP A;  3UMI A;  3ITF A;  3JYY A;  4EBB A;  2A6E F;  4PR9 A;  2XM0 A;  1E86 A;  2YVK A;  3U0C A;  3GOR A;  3FDQ A;  2XSE A;  3NYL A;  5COM A;  3Q7L A;  5FCL A;  2L6H A;  1I4Z A;  4EUK B;  1U0B B;  3DM9 B;  3UGO A;  2JD3 A;  1TWG A;  2QE9 A;  2XLV A;  1A41 A;  3B0P A;  4OIO F;  3Q6N A;  3U8V A;  5KYY B;  4OIP F;  4MVR A;  3ABK C;  3FAP B;  1D0Z A;  5DS5 A;  2D5R B;  2PFD A;  2LFD A;  4CJG A;  3SZR A;  3LLK A;  4OIN F;  3SEO A;  2QLA A;  2KYH A;  5L0G A;  1RMV A;  2JX0 A;  5CI8 A;  2HFI A;  2IXP A;  2L9J A;  1SF8 A;  2WZG A;  4JEB A;  2GA0 A;  1RJ9 B;  1MMD A;  4YL0 A;  1HMD A;  2Q9C A;  5K0I A;  5KYU B;  3R7C A;  5AGF A;  1A0B A;  4LDR A;  3W8I A;  4NTA A;  2WVQ A;  4CDA A;  2H7O A;  4U5C E;  4ONS A;  4NQF A;  4PK4 A;  2KQ9 A;  2LSE A;  3JTL O;  1R4T A;  1OCO C;  1OW6 A;  2PP4 A;  4LDQ A;  2KGO A;  1KU2 A;  2QUP A;  3U3B A;  5KYW B;  2EIL C;  3FXH A;  2YQY A;  1VK5 A;  3LEV A;  4DOZ A;  1HW1 A;  4P9F A;  5A6A A;  2EPK X;  1M6T A;  1WAT A;  2VCA A;  1QLE C;  3PMR A;  4DRH B;  5DLJ A;  4DVY P;  3LEO A;  3DJN B;  3POV A;  2LK4 A;  2R7U A;  2DGJ A;  3NKE A;  2DYR C;  3NMI A;  5L0I A; 
#chains in the Genus database with same CATH homology
 5JP7 A;  5JVE A;  4CX9 A;  4L6R A;  4EIY A;  2XM4 A;  1NBB A;  4ER9 A;  3IQ5 A;  4ULV A;  4U9E A;  4D4N A;  2YL1 A;  2YL7 A;  4IAR A;  1S05 A;  2XLW A;  1E85 A;  1YYJ A;  2XLE A;  2J8W A;  3IQ6 A;  3DE8 A;  3NMK A;  2XLM A;  3TOL A;  1YYX A;  4N4W A;  4D4X A;  5JLI A;  3QW1 A;  3M79 A;  3C63 A;  1YZC A;  4JEA A;  3QVY A;  3M4B A;  4CJO A;  2XLH A;  2YL0 A;  5JRA A;  5B3I A;  3QW0 A;  3TOM A;  3M4C A;  1EKY A;  1CGN A;  2BC5 A;  2XLO A;  2YLI A;  1QQ3 A;  3ZTM A;  1QPU A;  4CDV A;  3HNL A;  2YLG A;  3ZQY A;  3HNI A;  4IAQ A;  3M15 A;  3ZTZ A;  4U9D A;  1APC A;  2XLD A;  4NC3 A;  1CGO A;  3ZQV A;  1GQA A;  2YL3 A;  3L1M A;  2XL8 A;  2XM0 A;  1E86 A;  1MQV A;  5JUA A;  4WGY A;  3VRC A;  4JE9 A;  256B A;  3ZWI A;  1LM3 B;  2XLV A;  3U8P A;  4WGZ A;  3NMJ A;  1BBH A;  3FOO A;  3QVZ A;  3FOP A;  4CJG A;  2QLA A;  2XL6 A;  5JS5 A;  2YLD A;  1A7V A;  4JKV A;  5JT4 A;  4JEB A;  1E83 A;  1CPQ A;  5AGF A;  4CDA A;  1JAF A;  2YKZ A;  2CCY A;  3C62 A;  1RCP A;  1YZA A;  4CDY A;  1CPR A;  4IB4 A;  4CIP A;  5JSL A;  1E84 A;  2J9B A;  1M6T A;  3HNJ A;  3DE9 A;  4N6H A;  3HNK A;  3NMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...