2YLDA

Recombinant native cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound at 1.25 a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yldA00
2YL3A 3ZQVA 3HNKA 3NMJA 3QVYA 2YKZA 3QW0A 2YLIA 2XLEA 1GQAA 3C62A 4D4NA 4JEAA 1E83A 5B3IA 1S05A 4IAQA 4WGZA 5JRAA 1M6TA 1QQ3A 5AGFA 1APCA 4D4XA 4ER9A 3DE9A 3M15A 1EKYA 3IQ5A 4IB4A 1NBBA 3IQ6A 1YZCA 4CX9A 1YZAA 1MQVA 2XL8A 4CDYA 2YL1A 2YLGA 1YYJA 3FOPA 3M79A 1E86A 1LM3B 256BA 1A7VA 3ZWIA 1CPRA 4U9DA 2BC5A 1QPUA 3HNIA 3C63A 4JE9A 4NC3A 2XLMA 5JLIA 4EIYA 4L6RA 3HNLA 4CJGA 1CPQA 4JKVA 1YYXA 5JT4A 1RCPA 3NMIA 3QW1A 3HNJA 3U8PA 3ZTMA 1E84A 2YL0A 5JS5A 2YL7A 3NMKA 2CCYA 3TOLA 3QVZA 4JEBA 4N4WA 3DE8A 2XM0A 4CIPA 5JP7A 3VRCA 2J8WA 3FOOA 5JSLA 2XLWA 3TOMA 1BBHA 1CGNA 1E85A 4WGYA 3M4CA 2XLVA 2XL6A 2XLOA 4U9EA 3ZQYA 3L1MA 3M4BA 4N6HA 2XLDA 2J9BA 1CGOA 2XLHA 2QLAA 5JUAA 4ULVA 2XM4A 4IARA 3ZTZA 2YLDA 5JVEA 1JAFA 4CJOA 4CDAA 4CDVA
chains in the Genus database with same CATH superfamily
3NG1A 1PD0A 1YARO 3BEHA 3NMJA 1D1BA 3QVYA 5KYNA 3HLZA 4DBRA 4G7OF 2LFFA 3T4RA 2IBFA 4MVSA 4NQFA 4GYTA 3GODA 3LEVA 3C62A 3KYIA 4JEAA 2KYHA 1I5NA 1HW1A 4FWVA 5T1DB 3US6A 3RVYA 1FFHA 3LNMB 5BUOA 1M6TA 1QQ3A 3ASNC 3MLGA 4D4XA 1VK5A 2Y69C 5A69A 1TFOB 3EJNA 3UMHA 1YJGA 5L0CA 4C7OA 3V5YA 2LIGA 2R7VA 3M15A 1O87A 4E7SA 2GA0A 1EKYA 4MVMA 3G4ZA 2R7UA 1Q0GA 1NZEA 3EH1A 5GPGB 4PJMA 1TKNA 4K0DA 1NBBA 3IQ6A 3U2LA 2XXAA 4BJTA 2LFDA 2J0XA 1MQVA 3I5PA 2J46A 2M4EA 3G50A 2QE9A 1YYJA 2XRHA 2YLGA 4KNWA 4XLNF 2OQMA 2GWWA 3S9OA 2P1AA 2XS8A 1SZIA 2PP4A 2ETSA 4JW1A 3SNHA 2I8BA 4OIPF 3RQEA 4GQHA 2JPUA 2QY9A 3ABMC 3JYYA 3UGOA 1OCZC 3CSKA 2OOCA 2Q9CA 3NKDA 2DYSC 4OD5A 1K04A 1RKEB 3C7JA 2TMVP 2DB4A 1LKXA 1LI7A 3ASOC 1QPUA 2I15A 1ZHWA 1D1AA 4RBNA 1QLEC 2PX0A 2HJMA 5D92A 2B0HA 2XLMA 3RKOF 4ONSA 5KYWA 4Z9JA 4EIYA 4G7ZF 2LD6A 2J7PD 3HNLA 2OKUA 4BJ1A 5KYXA 4PJNA 2GAQA 4CJGA 3AG1C 3TULA 1OW6A 3S29A 4O6NA 3FMSA 2AP3A 2GDCA 2PFDA 1YYXA 3DAGA 2P61A 3EHMA 1NFNA 3GM2A 3QW1A 3VF0A 4DXWA 1M2VA 5CIVA 1EA8A 2FGYA 2J0WA 4JRZA 3VYWA 4N06A 3RH3A 2A6HF 2J7PA 1YVIA 4JCHA 5JS5A 1CGME 2XS1A 3EHNA 4XTKA 4JCZA 5DS6A 1T5OA 4JEBA 3TQOA 1ZHZA 1N1CA 2AU5A 2HZ8A 2MYSA 2NUTB 3W2WA 4CSAA 4MW3A 2M64A 1SYQA 2H8AA 2XM0A 2A0UA 2WZGA 3DM5A 3KL4A 3VRCA 2R7OA 2IXOA 3LUTB 3FVYA 2J9UA 3CEXA 2W4BA 1LVKA 1JMWA 3AOUA 3M4CA 1VTMP 3EFOA 3U8VA 1Z23A 3UMKA 4U5CE 4E0HA 2ZD9A 5T3TA 2IXNA 1EQ1A 1NSGB 1OR3A 2HS5A 4DRHB 3O39A 4ULWA 1TQGA 3W2VA 1NU7D 1OXKA 1ZYRF 2C03A 2XLHA 2QLAA 1MNEA 1TFKB 3B9QA 5DS4A 1R5ID 3L8JA 2XM4A 3UGPA 3NYLA 4QI0A 1D0YA 3EZIA 4JZAA 1KU2A 1LS1A 1Q0DA 4DRIB 5JVEA 1FMWA 4R32A 4LLEA 1JAFA 3LLKA 3S90A 5HV9A 3JYHA 4IRUA 4HFFB 1C17M 4DRJB 4LLCA 1DOWA 1MMNA 3EGXA 1E2XA 2H7BA 3C8GD 2Q00A 3J06A 4RD9A 2EIKC 3RVZA 3NRHA 1FAPB 1BDJB 2GFHA 2YL3A 3E70C 3HNKA 4XWJA 1LI5A 1XZQA 3CZ6A 2YHSA 1Q0KA 4XQ1A 4DVZA 3V5XA 5B1BC 3C8GA 3RW0A 4IWBA 4KBLA 4O6MA 1JOGA 5BQGA 2NUPB 4YL0A 3K33A 1OQCA 3KMIA 1FFTC 3DAFA 4ER9A 2FAPB 1DOVA 5DQZA 4E7ZA 3LS0A 1A7EA 2DYRC 3GEHA 2G62A 1Q0FA 4P9TA 3LESA 1OCCC 5A6AA 1ZU4A 2A69F 3T6GB 1BR2A 1ZW2A 3FXHA 3PMRA 4O6YA 5L0GA 4HFKB 1G5ZA 1WATA 3O10A 3AG3C 2Y3BA 5IY5C 3GEIA 2L81A 4JTAB 2P6VA 3X2QC 1LPEA 5A6KA 2CYDA 2HSBA 4JIOA 3LLIA 5D91A 2PNOA 3FOPA 4CS7A 3ZIBA 3I4UA 4MS2A 2XSEA 1WTYA 2ZXOA 1G8XA 1E86A 2YEVA 3MYIA 1K40A 3HJCA 4M63A 1LM3B 4MQ9F 3B71A 1VMAA 1SF8A 4BJ5C 3S27A 2KW3C 1OW8A 2R25A 5K0IA 2AWYA 3DMDA 3NYMA 5DVWA 2EIMC 3C63A 1VLSA 2UUIA 4JE9A 3LJBA 1WWPA 4J30B 2Q7RA 1IZMA 1VYIA 5JLIA 5L3QA 4ZLDA 3A9CA 3DZAA 2A1DD 3ZC4A 4BEMJ 3ABLC 3JZ0A 1CPQA 2CNWD 2WVNA 4IJJA 2OEXA 1H6GA 5FCLA 1PD1A 4AX2A 3OA1A 1ZW3A 5COGA 1BR4A 2PF4E 3U8PA 3WAQA 3Q7LA 4XEVA 1MMAA 4ZLCA 3QZCA 1D0XA 3UMIA 5EGYA 2EILC 2ZPAA 1RMVA 4MVRA 1RJ9B 1O5HA 3L0IA 4UDVA 3F47A 5KYYB 1ZVZA 2CNWA 1V54C 3TOLA 3KPHA 2JD3A 2WVOA 4BG0A 1M56C 1RKEA 2W45A 3ABKC 1ST6A 1V55C 5E2QA 1Z7Qc 3V7OA 4G7HF 4C7OB 3BRJA 3RF3A 1ORJA 3EH2A 3AGUA 3O55A 2WL8A 4NY3A 4PFOA 4PK4A 4E18A 5JP7A 1B68A 2O9XA 2R7TA 3JCUQ 3TOMA 1ZHYA 4Z9HA 1TWGA 3AG2C 3NYJA 2XLVA 2R7QA 3QMKA 5T3WA 4FAPB 1BR1A 1HMOA 2R03A 2WB7A 1QZXA 3KYJA 4PACA 3UNGC 2ICWG 2J9WA 2Y3HA 4XPWA 5DS5A 2EIJC 1SR2A 1YA7O 3O6XA 1AVOB 3L1MA 3SEOA 4W8KA 2OG2A 5L0DA 4OIOF 1C02A 2MHRA 2XLDA 2J9BA 5TJ5E 4EWCA 1CGOA 2YWAA 3IEEA 1IW7F 1FMVA 3N24A 4ULVA 4IARA 4EBKA 3ZTZA 2YVKA 2CW0F 4LACB 4XEFA 3TK0A 4BEJA 2Z15A 1RKCA 4AE4B 1HMDA 2W4MA 2QTVA 2IXPA 3LS1A 4FX5A 3DWWA 4CDAA 4CDVA 1T9KA 5EHHA 2HV7A 3SXZA 2Y39A 3GEEA 4BJ6C 5AC5A 4PJLA 1SMYF 3EQLF 1GM5A 4XPXA 3T6BA 2HV6A 2VH3A 2YKZA 4C3BA 4YN0B 2IXMA 4KI2A 2W9YA 2OCCC 1XZPA 2XLEA 1GQAA 2YLIA 1AUEA 2HJ3A 3KKBA 3T9OA 1AEPA 1MNDA 4BJ5A 1VYKA 2ASRA 2EPNA 2P0NA 4G78A 3FAJA 4MNDA 2YQYA 5E33A 4IAQA 4EKWA 2HUJA 4DBQA 4WGZA 5JRAA 5AGFA 1F1MA 1APCA 5F28E 4F4BA 2NSGA 4P6IC 4YT8A 5L0IA 1U6HA 2KSFA 3JSZA 3K66A 2H7VC 5EK0A 3GORA 2VCBA 3DE9A 4QDLA 4JURI 1A7DA 1U89A 4MTOA 4IB4A 4QI2A 2VASA 2LSEA 4CS8C 4G0HA 3EZHA 5COFA 1OXBA 2L6GA 1H9GA 4AK9A 1H9TA 3SXMA 3AQBA 1OR2A 4DVYP 4YK5A 4YL3A 2DGJA 3ZSUA 3H2UA 1QVXA 2A68F 1HE1A 3R2PA 4MVQA 1KNYA 3TJ6A 2NUPA 4OIQF 2ZXRA 3U3BA 3DI5A 1Z5ZA 2X0CA 2VCAA 3U2MA 3DJUB 2OU6A 2NPUA 1FTSA 3DJNB 2Y3GA 3W8IA 5A6BD 1ORSC 3MBGA 256BA 4C3EA 1A7VA 2BL2A 1CPRA 2WVQA 4KC9A 2HFIA 4U9DA 2BC5A 3ZWIA 1UFBA 1NFOA 2WZLA 3HNIA 3ITFA 1W2WA 2HSQA 5KYUB 3JT1A 3FDQA 4MTFA 1C03A 1ZU5A 2NSFA 2V26A 4L6RA 1WASA 3R7CA 4AL1A 1YAUO 1G4WR 5A6BA 4LERA 5DLJA 1WOLA 4NCQA 3K7DA 4NTBA 4JKVA 4H54A 4MVOA 4I1MA 5JT4A 3EPVA 1RCPA 3DXJF 3HNJA 2R05A 3AGTA 2KQ9A 2B0JA 3RYLA 2D5RB 2YL0A 5F5FA 3L8IA 4P9FA 1ZHTA 2L6HA 1T01A 2CCYA 3NMKA 3QTHA 4NTFA 3QVZA 4H4KC 4BJ6A 4BPMA 1WGWA 4PR9A 1LIHA 2HKVA 2L9JA 3LNRA 4B6IA 4A2NB 2JX0A 1LE2A 2IOQA 2L6FA 3DKAA 5COMA 3SYNA 1PCXA 1Z3IX 3EGDB 4CIPA 2FFHA 1NLXA 2VCCA 3HKKA 3N0TA 4J7TA 4PFPA 4YT5A 2R02A 2J8WA 3FOOA 5JSLA 2XLWA 4IGGA 4N6CA 3G4XA 3U9JA 3FHDA 2EPKX 3WHNA 1CGNA 1E85A 4Z9IA 4U5GA 3U3FA 3IPMO 2KNHA 4I1OB 1Z63A 2XLOA 3EG9B 3AG4C 5CI8A 3GM1A 3MFNA 3B0VC 2LP4A 4HEAJ 3I5QA 5HSWA 1LE4A 1RJ9A 5A6JA 4LDQA 4JJGA 5KYYA 1FNTc 3PHF2 1S7ZA 1UG7A 3PDMP 4YJWA 4CS8A 3K6BA 5BQHA 3T6JA 1FR0A 1D0ZA 1EI7A 4OINF 1OW7A 4C3DA 4I3MA 4WABA 2D4UA 5BQIA 3POVA 1VB5A 3LAYA 3WG7C 4YWQA 4CIHA 5CI9A 2G3KA 4YT2A 1R4TA 3W4YA 4YT4A 5DQTA 1TWHA 5B3SC 1T6IA 2Q4FA 2XXAB 4Q4ZF 1HW2A 3K1IC 2MWQA 3ZQVA 3B0UX 3VAYA 4Q5SF 2R9RB 3ZVRA 2LCHA 3IQCA 3QW0A 3S84A 4JC7A 2AVKA 4LDRA 2LQGA 1I4YA 4CS9C 1T6UA 1YA9A 2F22A 2KK1A 1HE9A 2G3VA 1BZ4A 3HTKC 4MTGA 4D4NA 1JRAA 1T6QA 1E83A 2HMQA 5B3IA 3A11A 1S05A 4HE8D 3U0CA 1L3PA 2PBEA 1TR2A 3L34A 1QKRA 3JRMO 1YLMA 3TJ5A 3LEOA 2NG1A 2NUTA 4AE4A 3VM6A 4YL1A 2EPMX 1VLTA 2ZXPA 4EBJA 3IQTA 1QSPA 5B1AC 4KNVA 3GWLA 3OEOA 2Q9BA 1MMGA 2J45A 3IQ5A 4O79A 2RD9A 5AC4A 2KC3A 4PJJA 4AL0A 1U0BB 1TWAA 1D1CA 1YZCA 2VB6A 1YZAA 3H65A 3W8HA 4CX9A 1NG1A 3PCVA 4FESA 1J8MF 2XL8A 3NKEA 4W8PA 5L0JA 5KYWB 2VC9A 1KTMA 3Q7GA 4CDYA 4OIRF 3Q6NA 2YL1A 5KYXB 3KH2A 3S0XA 2R7XA 1MMDA 4U5DE 4JJFA 2XL4A 4EBBA 2L7AA 2YRFA 3ATPA 3UR3C 4DJ9A 3M79A 3C18A 2PX3A 3ZG1A 3RFYA 1M2VB 4XLPF 1M57C 2IM8A 3C8ZA 1LS4A 3RQFA 2X51A 2YZSA 1H7IA 1NU9C 2LK4A 2HMZA 2Q9AA 3B0PA 2CDQA 2P7VA 3JTLO 3SXKA 4U5FE 1GGQA 2UUHA 4E17A 4NTAA 3S28A 5E3AA 3SP1A 4U5HA 2KJGA 4U5BE 1ZZPA 4WJ0A 2QUPA 3GANA 2RSEB 4E0IA 4XEKA 4NC3A 2EPOA 3H2VA 1L7CA 2EINC 2BE5F 4JTCB 1M2OA 4MW8A 1JPNA 4RDAA 1J8YF 2H7OA 2AWCA 3DM9B 3EFOB 2V3CC 3JSEO 1Q0MA 3K1HA 3NMIA 4U5EE 3ZDLA 4OD4A 1Y4CA 3SZRA 4I44A 4X0RA 4IAOA 3WODF 2R7WA 3ZTMA 1RXQA 4LDKA 1OKKD 1E84A 1JPJA 2IYLD 2R7RA 3X1OA 3Q6MA 2YL7A 4JTDB 4K1OA 2WZFA 2OJQA 3RQGA 1YDIA 3NDBB 1XWJA 4J32B 2E87A 3RIPA 3K1IA 4N4WA 4DOZA 4GEHA 1V4AA 1VOMA 2CGEA 3DE8A 5L3VA 1K05A 2DI3A 1OKKA 5KYUA 1ZHXA 2R7SA 2KGOA 1WN0A 3B29A 1A0BA 4CS9A 1BBHA 3EGXB 3OWTA 3V5ZA 4WGYA 1Z6AA 1GS9A 2XL6A 4JVSA 4EHPA 3CQZA 3ECSA 2OEVA 3DD7A 2A6EF 4U9EA 4EUKB 4ANJA 4O7GA 1A41A 1OCOC 3AQCA 3CAXA 3MX3A 3ZQYA 4MVZA 2C04A 3M4BA 1G4US 3MYFA 4N6HA 2A0BA 3U5SA 3U9MA 3C8GB 1OCRC 3JRTA 3FAPB 5E3CA 4A4AA 1PV3A 3GWNA 4Q7CA 3N2ZB 4MVUA 5JUAA 1HY5A 2Y3DA 5FZTA 1I4ZA 1JR8A 2YLDA 1Y6DA 2OJED 4J7YA 5L0FA 5L0HA 3EGDA 2J9VA 4CJOA 1V74B 2EPLX 2Q3TA 3SXYA 2QNLA 4K7BA 1O3UA 1ORYA 3M1CB 3TD7A 3IHUA 4CBEA 4XPYA 1TWCA 2ZXWC 3E9VA 3AJMA 3GM3A 5F5HA 3EG9A 3F46A 4CSAC
chains in the Genus database with same CATH topology
2YL3A 3ZQVA 3HNKA 3NMJA 3QVYA 2YKZA 3QW0A 2YLIA 2XLEA 1GQAA 3C62A 4D4NA 4JEAA 1E83A 5B3IA 1S05A 4IAQA 4WGZA 5JRAA 1M6TA 1QQ3A 5AGFA 1APCA 4D4XA 4ER9A 3DE9A 3M15A 1EKYA 3IQ5A 4IB4A 1NBBA 3IQ6A 1YZCA 4CX9A 1YZAA 1MQVA 2XL8A 4CDYA 2YL1A 2YLGA 1YYJA 3FOPA 3M79A 1E86A 1LM3B 256BA 1A7VA 3ZWIA 1CPRA 4U9DA 2BC5A 1QPUA 3HNIA 3C63A 4JE9A 4NC3A 2XLMA 5JLIA 4EIYA 4L6RA 3HNLA 4CJGA 1CPQA 4JKVA 1YYXA 5JT4A 1RCPA 3NMIA 3QW1A 3HNJA 3U8PA 3ZTMA 1E84A 2YL0A 5JS5A 2YL7A 3NMKA 2CCYA 3TOLA 3QVZA 4JEBA 4N4WA 3DE8A 2XM0A 4CIPA 5JP7A 3VRCA 2J8WA 3FOOA 5JSLA 2XLWA 3TOMA 1BBHA 1CGNA 1E85A 4WGYA 3M4CA 2XLVA 2XL6A 2XLOA 4U9EA 3ZQYA 3L1MA 3M4BA 4N6HA 2XLDA 2J9BA 1CGOA 2XLHA 2QLAA 5JUAA 4ULVA 2XM4A 4IARA 3ZTZA 2YLDA 5JVEA 1JAFA 4CJOA 4CDAA 4CDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YL3 A;  3ZQV A;  3HNK A;  3NMJ A;  3QVY A;  2YKZ A;  3QW0 A;  2YLI A;  2XLE A;  1GQA A;  3C62 A;  4D4N A;  4JEA A;  1E83 A;  5B3I A;  1S05 A;  4IAQ A;  4WGZ A;  5JRA A;  1M6T A;  1QQ3 A;  5AGF A;  1APC A;  4D4X A;  4ER9 A;  3DE9 A;  3M15 A;  1EKY A;  3IQ5 A;  4IB4 A;  1NBB A;  3IQ6 A;  1YZC A;  4CX9 A;  1YZA A;  1MQV A;  2XL8 A;  4CDY A;  2YL1 A;  2YLG A;  1YYJ A;  3FOP A;  3M79 A;  1E86 A;  1LM3 B;  256B A;  1A7V A;  3ZWI A;  1CPR A;  4U9D A;  2BC5 A;  1QPU A;  3HNI A;  3C63 A;  4JE9 A;  4NC3 A;  2XLM A;  5JLI A;  4EIY A;  4L6R A;  3HNL A;  4CJG A;  1CPQ A;  4JKV A;  1YYX A;  5JT4 A;  1RCP A;  3NMI A;  3QW1 A;  3HNJ A;  3U8P A;  3ZTM A;  1E84 A;  2YL0 A;  5JS5 A;  2YL7 A;  3NMK A;  2CCY A;  3TOL A;  3QVZ A;  4JEB A;  4N4W A;  3DE8 A;  2XM0 A;  4CIP A;  5JP7 A;  3VRC A;  2J8W A;  3FOO A;  5JSL A;  2XLW A;  3TOM A;  1BBH A;  1CGN A;  1E85 A;  4WGY A;  3M4C A;  2XLV A;  2XL6 A;  2XLO A;  4U9E A;  3ZQY A;  3L1M A;  3M4B A;  4N6H A;  2XLD A;  2J9B A;  1CGO A;  2XLH A;  2QLA A;  5JUA A;  4ULV A;  2XM4 A;  4IAR A;  3ZTZ A;  2YLD A;  5JVE A;  1JAF A;  4CJO A;  4CDA A;  4CDV A; 
#chains in the Genus database with same CATH topology
 3NG1 A;  1PD0 A;  1YAR O;  3BEH A;  3NMJ A;  1D1B A;  3QVY A;  5KYN A;  3HLZ A;  4DBR A;  4G7O F;  2LFF A;  3T4R A;  2IBF A;  4MVS A;  4NQF A;  4GYT A;  3GOD A;  3LEV A;  3C62 A;  3KYI A;  4JEA A;  2KYH A;  1I5N A;  1HW1 A;  4FWV A;  5T1D B;  3US6 A;  3RVY A;  1FFH A;  3LNM B;  5BUO A;  1M6T A;  1QQ3 A;  3ASN C;  3MLG A;  4D4X A;  1VK5 A;  2Y69 C;  5A69 A;  1TFO B;  3EJN A;  3UMH A;  1YJG A;  5L0C A;  4C7O A;  3V5Y A;  2LIG A;  2R7V A;  3M15 A;  1O87 A;  4E7S A;  2GA0 A;  1EKY A;  4MVM A;  3G4Z A;  2R7U A;  1Q0G A;  1NZE A;  3EH1 A;  5GPG B;  4PJM A;  1TKN A;  4K0D A;  1NBB A;  3IQ6 A;  3U2L A;  2XXA A;  4BJT A;  2LFD A;  2J0X A;  1MQV A;  3I5P A;  2J46 A;  2M4E A;  3G50 A;  2QE9 A;  1YYJ A;  2XRH A;  2YLG A;  4KNW A;  4XLN F;  2OQM A;  2GWW A;  3S9O A;  2P1A A;  2XS8 A;  1SZI A;  2PP4 A;  2ETS A;  4JW1 A;  3SNH A;  2I8B A;  4OIP F;  3RQE A;  4GQH A;  2JPU A;  2QY9 A;  3ABM C;  3JYY A;  3UGO A;  1OCZ C;  3CSK A;  2OOC A;  2Q9C A;  3NKD A;  2DYS C;  4OD5 A;  1K04 A;  1RKE B;  3C7J A;  2TMV P;  2DB4 A;  1LKX A;  1LI7 A;  3ASO C;  1QPU A;  2I15 A;  1ZHW A;  1D1A A;  4RBN A;  1QLE C;  2PX0 A;  2HJM A;  5D92 A;  2B0H A;  2XLM A;  3RKO F;  4ONS A;  5KYW A;  4Z9J A;  4EIY A;  4G7Z F;  2LD6 A;  2J7P D;  3HNL A;  2OKU A;  4BJ1 A;  5KYX A;  4PJN A;  2GAQ A;  4CJG A;  3AG1 C;  3TUL A;  1OW6 A;  3S29 A;  4O6N A;  3FMS A;  2AP3 A;  2GDC A;  2PFD A;  1YYX A;  3DAG A;  2P61 A;  3EHM A;  1NFN A;  3GM2 A;  3QW1 A;  3VF0 A;  4DXW A;  1M2V A;  5CIV A;  1EA8 A;  2FGY A;  2J0W A;  4JRZ A;  3VYW A;  4N06 A;  3RH3 A;  2A6H F;  2J7P A;  1YVI A;  4JCH A;  5JS5 A;  1CGM E;  2XS1 A;  3EHN A;  4XTK A;  4JCZ A;  5DS6 A;  1T5O A;  4JEB A;  3TQO A;  1ZHZ A;  1N1C A;  2AU5 A;  2HZ8 A;  2MYS A;  2NUT B;  3W2W A;  4CSA A;  4MW3 A;  2M64 A;  1SYQ A;  2H8A A;  2XM0 A;  2A0U A;  2WZG A;  3DM5 A;  3KL4 A;  3VRC A;  2R7O A;  2IXO A;  3LUT B;  3FVY A;  2J9U A;  3CEX A;  2W4B A;  1LVK A;  1JMW A;  3AOU A;  3M4C A;  1VTM P;  3EFO A;  3U8V A;  1Z23 A;  3UMK A;  4U5C E;  4E0H A;  2ZD9 A;  5T3T A;  2IXN A;  1EQ1 A;  1NSG B;  1OR3 A;  2HS5 A;  4DRH B;  3O39 A;  4ULW A;  1TQG A;  3W2V A;  1NU7 D;  1OXK A;  1ZYR F;  2C03 A;  2XLH A;  2QLA A;  1MNE A;  1TFK B;  3B9Q A;  5DS4 A;  1R5I D;  3L8J A;  2XM4 A;  3UGP A;  3NYL A;  4QI0 A;  1D0Y A;  3EZI A;  4JZA A;  1KU2 A;  1LS1 A;  1Q0D A;  4DRI B;  5JVE A;  1FMW A;  4R32 A;  4LLE A;  1JAF A;  3LLK A;  3S90 A;  5HV9 A;  3JYH A;  4IRU A;  4HFF B;  1C17 M;  4DRJ B;  4LLC A;  1DOW A;  1MMN A;  3EGX A;  1E2X A;  2H7B A;  3C8G D;  2Q00 A;  3J06 A;  4RD9 A;  2EIK C;  3RVZ A;  3NRH A;  1FAP B;  1BDJ B;  2GFH A;  2YL3 A;  3E70 C;  3HNK A;  4XWJ A;  1LI5 A;  1XZQ A;  3CZ6 A;  2YHS A;  1Q0K A;  4XQ1 A;  4DVZ A;  3V5X A;  5B1B C;  3C8G A;  3RW0 A;  4IWB A;  4KBL A;  4O6M A;  1JOG A;  5BQG A;  2NUP B;  4YL0 A;  3K33 A;  1OQC A;  3KMI A;  1FFT C;  3DAF A;  4ER9 A;  2FAP B;  1DOV A;  5DQZ A;  4E7Z A;  3LS0 A;  1A7E A;  2DYR C;  3GEH A;  2G62 A;  1Q0F A;  4P9T A;  3LES A;  1OCC C;  5A6A A;  1ZU4 A;  2A69 F;  3T6G B;  1BR2 A;  1ZW2 A;  3FXH A;  3PMR A;  4O6Y A;  5L0G A;  4HFK B;  1G5Z A;  1WAT A;  3O10 A;  3AG3 C;  2Y3B A;  5IY5 C;  3GEI A;  2L81 A;  4JTA B;  2P6V A;  3X2Q C;  1LPE A;  5A6K A;  2CYD A;  2HSB A;  4JIO A;  3LLI A;  5D91 A;  2PNO A;  3FOP A;  4CS7 A;  3ZIB A;  3I4U A;  4MS2 A;  2XSE A;  1WTY A;  2ZXO A;  1G8X A;  1E86 A;  2YEV A;  3MYI A;  1K40 A;  3HJC A;  4M63 A;  1LM3 B;  4MQ9 F;  3B71 A;  1VMA A;  1SF8 A;  4BJ5 C;  3S27 A;  2KW3 C;  1OW8 A;  2R25 A;  5K0I A;  2AWY A;  3DMD A;  3NYM A;  5DVW A;  2EIM C;  3C63 A;  1VLS A;  2UUI A;  4JE9 A;  3LJB A;  1WWP A;  4J30 B;  2Q7R A;  1IZM A;  1VYI A;  5JLI A;  5L3Q A;  4ZLD A;  3A9C A;  3DZA A;  2A1D D;  3ZC4 A;  4BEM J;  3ABL C;  3JZ0 A;  1CPQ A;  2CNW D;  2WVN A;  4IJJ A;  2OEX A;  1H6G A;  5FCL A;  1PD1 A;  4AX2 A;  3OA1 A;  1ZW3 A;  5COG A;  1BR4 A;  2PF4 E;  3U8P A;  3WAQ A;  3Q7L A;  4XEV A;  1MMA A;  4ZLC A;  3QZC A;  1D0X A;  3UMI A;  5EGY A;  2EIL C;  2ZPA A;  1RMV A;  4MVR A;  1RJ9 B;  1O5H A;  3L0I A;  4UDV A;  3F47 A;  5KYY B;  1ZVZ A;  2CNW A;  1V54 C;  3TOL A;  3KPH A;  2JD3 A;  2WVO A;  4BG0 A;  1M56 C;  1RKE A;  2W45 A;  3ABK C;  1ST6 A;  1V55 C;  5E2Q A;  1Z7Q c;  3V7O A;  4G7H F;  4C7O B;  3BRJ A;  3RF3 A;  1ORJ A;  3EH2 A;  3AGU A;  3O55 A;  2WL8 A;  4NY3 A;  4PFO A;  4PK4 A;  4E18 A;  5JP7 A;  1B68 A;  2O9X A;  2R7T A;  3JCU Q;  3TOM A;  1ZHY A;  4Z9H A;  1TWG A;  3AG2 C;  3NYJ A;  2XLV A;  2R7Q A;  3QMK A;  5T3W A;  4FAP B;  1BR1 A;  1HMO A;  2R03 A;  2WB7 A;  1QZX A;  3KYJ A;  4PAC A;  3UNG C;  2ICW G;  2J9W A;  2Y3H A;  4XPW A;  5DS5 A;  2EIJ C;  1SR2 A;  1YA7 O;  3O6X A;  1AVO B;  3L1M A;  3SEO A;  4W8K A;  2OG2 A;  5L0D A;  4OIO F;  1C02 A;  2MHR A;  2XLD A;  2J9B A;  5TJ5 E;  4EWC A;  1CGO A;  2YWA A;  3IEE A;  1IW7 F;  1FMV A;  3N24 A;  4ULV A;  4IAR A;  4EBK A;  3ZTZ A;  2YVK A;  2CW0 F;  4LAC B;  4XEF A;  3TK0 A;  4BEJ A;  2Z15 A;  1RKC A;  4AE4 B;  1HMD A;  2W4M A;  2QTV A;  2IXP A;  3LS1 A;  4FX5 A;  3DWW A;  4CDA A;  4CDV A;  1T9K A;  5EHH A;  2HV7 A;  3SXZ A;  2Y39 A;  3GEE A;  4BJ6 C;  5AC5 A;  4PJL A;  1SMY F;  3EQL F;  1GM5 A;  4XPX A;  3T6B A;  2HV6 A;  2VH3 A;  2YKZ A;  4C3B A;  4YN0 B;  2IXM A;  4KI2 A;  2W9Y A;  2OCC C;  1XZP A;  2XLE A;  1GQA A;  2YLI A;  1AUE A;  2HJ3 A;  3KKB A;  3T9O A;  1AEP A;  1MND A;  4BJ5 A;  1VYK A;  2ASR A;  2EPN A;  2P0N A;  4G78 A;  3FAJ A;  4MND A;  2YQY A;  5E33 A;  4IAQ A;  4EKW A;  2HUJ A;  4DBQ A;  4WGZ A;  5JRA A;  5AGF A;  1F1M A;  1APC A;  5F28 E;  4F4B A;  2NSG A;  4P6I C;  4YT8 A;  5L0I A;  1U6H A;  2KSF A;  3JSZ A;  3K66 A;  2H7V C;  5EK0 A;  3GOR A;  2VCB A;  3DE9 A;  4QDL A;  4JUR I;  1A7D A;  1U89 A;  4MTO A;  4IB4 A;  4QI2 A;  2VAS A;  2LSE A;  4CS8 C;  4G0H A;  3EZH A;  5COF A;  1OXB A;  2L6G A;  1H9G A;  4AK9 A;  1H9T A;  3SXM A;  3AQB A;  1OR2 A;  4DVY P;  4YK5 A;  4YL3 A;  2DGJ A;  3ZSU A;  3H2U A;  1QVX A;  2A68 F;  1HE1 A;  3R2P A;  4MVQ A;  1KNY A;  3TJ6 A;  2NUP A;  4OIQ F;  2ZXR A;  3U3B A;  3DI5 A;  1Z5Z A;  2X0C A;  2VCA A;  3U2M A;  3DJU B;  2OU6 A;  2NPU A;  1FTS A;  3DJN B;  2Y3G A;  3W8I A;  5A6B D;  1ORS C;  3MBG A;  256B A;  4C3E A;  1A7V A;  2BL2 A;  1CPR A;  2WVQ A;  4KC9 A;  2HFI A;  4U9D A;  2BC5 A;  3ZWI A;  1UFB A;  1NFO A;  2WZL A;  3HNI A;  3ITF A;  1W2W A;  2HSQ A;  5KYU B;  3JT1 A;  3FDQ A;  4MTF A;  1C03 A;  1ZU5 A;  2NSF A;  2V26 A;  4L6R A;  1WAS A;  3R7C A;  4AL1 A;  1YAU O;  1G4W R;  5A6B A;  4LER A;  5DLJ A;  1WOL A;  4NCQ A;  3K7D A;  4NTB A;  4JKV A;  4H54 A;  4MVO A;  4I1M A;  5JT4 A;  3EPV A;  1RCP A;  3DXJ F;  3HNJ A;  2R05 A;  3AGT A;  2KQ9 A;  2B0J A;  3RYL A;  2D5R B;  2YL0 A;  5F5F A;  3L8I A;  4P9F A;  1ZHT A;  2L6H A;  1T01 A;  2CCY A;  3NMK A;  3QTH A;  4NTF A;  3QVZ A;  4H4K C;  4BJ6 A;  4BPM A;  1WGW A;  4PR9 A;  1LIH A;  2HKV A;  2L9J A;  3LNR A;  4B6I A;  4A2N B;  2JX0 A;  1LE2 A;  2IOQ A;  2L6F A;  3DKA A;  5COM A;  3SYN A;  1PCX A;  1Z3I X;  3EGD B;  4CIP A;  2FFH A;  1NLX A;  2VCC A;  3HKK A;  3N0T A;  4J7T A;  4PFP A;  4YT5 A;  2R02 A;  2J8W A;  3FOO A;  5JSL A;  2XLW A;  4IGG A;  4N6C A;  3G4X A;  3U9J A;  3FHD A;  2EPK X;  3WHN A;  1CGN A;  1E85 A;  4Z9I A;  4U5G A;  3U3F A;  3IPM O;  2KNH A;  4I1O B;  1Z63 A;  2XLO A;  3EG9 B;  3AG4 C;  5CI8 A;  3GM1 A;  3MFN A;  3B0V C;  2LP4 A;  4HEA J;  3I5Q A;  5HSW A;  1LE4 A;  1RJ9 A;  5A6J A;  4LDQ A;  4JJG A;  5KYY A;  1FNT c;  3PHF 2;  1S7Z A;  1UG7 A;  3PDM P;  4YJW A;  4CS8 A;  3K6B A;  5BQH A;  3T6J A;  1FR0 A;  1D0Z A;  1EI7 A;  4OIN F;  1OW7 A;  4C3D A;  4I3M A;  4WAB A;  2D4U A;  5BQI A;  3POV A;  1VB5 A;  3LAY A;  3WG7 C;  4YWQ A;  4CIH A;  5CI9 A;  2G3K A;  4YT2 A;  1R4T A;  3W4Y A;  4YT4 A;  5DQT A;  1TWH A;  5B3S C;  1T6I A;  2Q4F A;  2XXA B;  4Q4Z F;  1HW2 A;  3K1I C;  2MWQ A;  3ZQV A;  3B0U X;  3VAY A;  4Q5S F;  2R9R B;  3ZVR A;  2LCH A;  3IQC A;  3QW0 A;  3S84 A;  4JC7 A;  2AVK A;  4LDR A;  2LQG A;  1I4Y A;  4CS9 C;  1T6U A;  1YA9 A;  2F22 A;  2KK1 A;  1HE9 A;  2G3V A;  1BZ4 A;  3HTK C;  4MTG A;  4D4N A;  1JRA A;  1T6Q A;  1E83 A;  2HMQ A;  5B3I A;  3A11 A;  1S05 A;  4HE8 D;  3U0C A;  1L3P A;  2PBE A;  1TR2 A;  3L34 A;  1QKR A;  3JRM O;  1YLM A;  3TJ5 A;  3LEO A;  2NG1 A;  2NUT A;  4AE4 A;  3VM6 A;  4YL1 A;  2EPM X;  1VLT A;  2ZXP A;  4EBJ A;  3IQT A;  1QSP A;  5B1A C;  4KNV A;  3GWL A;  3OEO A;  2Q9B A;  1MMG A;  2J45 A;  3IQ5 A;  4O79 A;  2RD9 A;  5AC4 A;  2KC3 A;  4PJJ A;  4AL0 A;  1U0B B;  1TWA A;  1D1C A;  1YZC A;  2VB6 A;  1YZA A;  3H65 A;  3W8H A;  4CX9 A;  1NG1 A;  3PCV A;  4FES A;  1J8M F;  2XL8 A;  3NKE A;  4W8P A;  5L0J A;  5KYW B;  2VC9 A;  1KTM A;  3Q7G A;  4CDY A;  4OIR F;  3Q6N A;  2YL1 A;  5KYX B;  3KH2 A;  3S0X A;  2R7X A;  1MMD A;  4U5D E;  4JJF A;  2XL4 A;  4EBB A;  2L7A A;  2YRF A;  3ATP A;  3UR3 C;  4DJ9 A;  3M79 A;  3C18 A;  2PX3 A;  3ZG1 A;  3RFY A;  1M2V B;  4XLP F;  1M57 C;  2IM8 A;  3C8Z A;  1LS4 A;  3RQF A;  2X51 A;  2YZS A;  1H7I A;  1NU9 C;  2LK4 A;  2HMZ A;  2Q9A A;  3B0P A;  2CDQ A;  2P7V A;  3JTL O;  3SXK A;  4U5F E;  1GGQ A;  2UUH A;  4E17 A;  4NTA A;  3S28 A;  5E3A A;  3SP1 A;  4U5H A;  2KJG A;  4U5B E;  1ZZP A;  4WJ0 A;  2QUP A;  3GAN A;  2RSE B;  4E0I A;  4XEK A;  4NC3 A;  2EPO A;  3H2V A;  1L7C A;  2EIN C;  2BE5 F;  4JTC B;  1M2O A;  4MW8 A;  1JPN A;  4RDA A;  1J8Y F;  2H7O A;  2AWC A;  3DM9 B;  3EFO B;  2V3C C;  3JSE O;  1Q0M A;  3K1H A;  3NMI A;  4U5E E;  3ZDL A;  4OD4 A;  1Y4C A;  3SZR A;  4I44 A;  4X0R A;  4IAO A;  3WOD F;  2R7W A;  3ZTM A;  1RXQ A;  4LDK A;  1OKK D;  1E84 A;  1JPJ A;  2IYL D;  2R7R A;  3X1O A;  3Q6M A;  2YL7 A;  4JTD B;  4K1O A;  2WZF A;  2OJQ A;  3RQG A;  1YDI A;  3NDB B;  1XWJ A;  4J32 B;  2E87 A;  3RIP A;  3K1I A;  4N4W A;  4DOZ A;  4GEH A;  1V4A A;  1VOM A;  2CGE A;  3DE8 A;  5L3V A;  1K05 A;  2DI3 A;  1OKK A;  5KYU A;  1ZHX A;  2R7S A;  2KGO A;  1WN0 A;  3B29 A;  1A0B A;  4CS9 A;  1BBH A;  3EGX B;  3OWT A;  3V5Z A;  4WGY A;  1Z6A A;  1GS9 A;  2XL6 A;  4JVS A;  4EHP A;  3CQZ A;  3ECS A;  2OEV A;  3DD7 A;  2A6E F;  4U9E A;  4EUK B;  4ANJ A;  4O7G A;  1A41 A;  1OCO C;  3AQC A;  3CAX A;  3MX3 A;  3ZQY A;  4MVZ A;  2C04 A;  3M4B A;  1G4U S;  3MYF A;  4N6H A;  2A0B A;  3U5S A;  3U9M A;  3C8G B;  1OCR C;  3JRT A;  3FAP B;  5E3C A;  4A4A A;  1PV3 A;  3GWN A;  4Q7C A;  3N2Z B;  4MVU A;  5JUA A;  1HY5 A;  2Y3D A;  5FZT A;  1I4Z A;  1JR8 A;  2YLD A;  1Y6D A;  2OJE D;  4J7Y A;  5L0F A;  5L0H A;  3EGD A;  2J9V A;  4CJO A;  1V74 B;  2EPL X;  2Q3T A;  3SXY A;  2QNL A;  4K7B A;  1O3U A;  1ORY A;  3M1C B;  3TD7 A;  3IHU A;  4CBE A;  4XPY A;  1TWC A;  2ZXW C;  3E9V A;  3AJM A;  3GM3 A;  5F5H A;  3EG9 A;  3F46 A;  4CSA C; 
#chains in the Genus database with same CATH homology
 2YL3 A;  3ZQV A;  3HNK A;  3NMJ A;  3QVY A;  2YKZ A;  3QW0 A;  2YLI A;  2XLE A;  1GQA A;  3C62 A;  4D4N A;  4JEA A;  1E83 A;  5B3I A;  1S05 A;  4IAQ A;  4WGZ A;  5JRA A;  1M6T A;  1QQ3 A;  5AGF A;  1APC A;  4D4X A;  4ER9 A;  3DE9 A;  3M15 A;  1EKY A;  3IQ5 A;  4IB4 A;  1NBB A;  3IQ6 A;  1YZC A;  4CX9 A;  1YZA A;  1MQV A;  2XL8 A;  4CDY A;  2YL1 A;  2YLG A;  1YYJ A;  3FOP A;  3M79 A;  1E86 A;  1LM3 B;  256B A;  1A7V A;  3ZWI A;  1CPR A;  4U9D A;  2BC5 A;  1QPU A;  3HNI A;  3C63 A;  4JE9 A;  4NC3 A;  2XLM A;  5JLI A;  4EIY A;  4L6R A;  3HNL A;  4CJG A;  1CPQ A;  4JKV A;  1YYX A;  5JT4 A;  1RCP A;  3NMI A;  3QW1 A;  3HNJ A;  3U8P A;  3ZTM A;  1E84 A;  2YL0 A;  5JS5 A;  2YL7 A;  3NMK A;  2CCY A;  3TOL A;  3QVZ A;  4JEB A;  4N4W A;  3DE8 A;  2XM0 A;  4CIP A;  5JP7 A;  3VRC A;  2J8W A;  3FOO A;  5JSL A;  2XLW A;  3TOM A;  1BBH A;  1CGN A;  1E85 A;  4WGY A;  3M4C A;  2XLV A;  2XL6 A;  2XLO A;  4U9E A;  3ZQY A;  3L1M A;  3M4B A;  4N6H A;  2XLD A;  2J9B A;  1CGO A;  2XLH A;  2QLA A;  5JUA A;  4ULV A;  2XM4 A;  4IAR A;  3ZTZ A;  2YLD A;  5JVE A;  1JAF A;  4CJO A;  4CDA A;  4CDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...