2YLDA

Recombinant native cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound at 1.25 a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
molecule tags Electron transport
source organism Achromobacter xylosoxidans
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yldA00
2XLWA 2XM4A 4EIYA 3IQ5A 3M4BA 1YYXA 2XM0A 2XLMA 3HNJA 1CPQA 4N4WA 256BA 3ZTZA 1CGNA 1YZAA 3NMIA 3M4CA 3L1MA 3FOOA 3M79A 5JUAA 1APCA 2J9BA 2XL8A 3TOLA 4JEBA 2XLDA 3FOPA 4CDAA 4CJGA 2YLGA 3C62A 3VRCA 3ZQYA 1E85A 4ER9A 2YL3A 2BC5A 2XLEA 1E86A 1QQ3A 2XL6A 4L6RA 4IARA 2YKZA 1NBBA 3QVZA 3IQ6A 2XLHA 2YL1A 4NC3A 5JSLA 4U9EA 2CCYA 3DE8A 5AGFA 3ZWIA 1MQVA 3QW1A 4WGYA 1RCPA 4WGZA 4N6HA 5JLIA 2YL0A 1E84A 3TOMA 2QLAA 3HNIA 1LM3B 4D4NA 1CGOA 2YL7A 1CPRA 2J8WA 4CDYA 1M6TA 3M15A 3U8PA 4IAQA 1EKYA 1S05A 3QVYA 2XLVA 4JEAA 5B3IA 4D4XA 5JRAA 4CJOA 4CX9A 4CIPA 3HNLA 3NMJA 4ULVA 5JVEA 3ZTMA 3C63A 1A7VA 1GQAA 1YZCA 5JS5A 2YLIA 1JAFA 2YLDA 4IB4A 4JE9A 3ZQVA 3NMKA 5JT4A 1BBHA 4JKVA 4CDVA 5JP7A 3QW0A 3DE9A 1YYJA 4U9DA 3HNKA 2XLOA 1E83A 1QPUA
chains in the Genus database with same CATH superfamily
5L0IA 3GWNA 3EH2A 2NUPA 4C7OB 2WVOA 2Y3BA 1Y6DA 4CS8A 3Q6MA 3LLIA 2QUPA 5L0DA 1BR4A 4CS8C 3J06A 1EQ1A 4KI2A 4EWCA 2X51A 2XLMA 3S0XA 4Q4ZF 3IHUA 3HNJA 2ETSA 1B68A 1VYKA 4W8KA 1XZPA 1SR2A 4DBQA 1TQGA 2R7OA 3MYIA 2AWYA 3ZTZA 2XS1A 1OR3A 3EG9B 4BPMA 4CBEA 4E0IA 2L7AA 5IY5C 3L1MA 2RSEB 3LEOA 5A6JA 3C18A 1NSGB 1PV3A 2I8BA 2LFDA 3GM1A 4NQFA 3ZC4A 1ZHWA 2J9WA 4MQ9F 4C3DA 2J9BA 3JCUQ 4JJFA 2XXAA 4XLPF 4NTFA 3DAFA 1LVKA 2LP4A 4MW8A 1HMDA 1WN0A 2VC9A 3AOUA 3IPMO 1TR2A 1OKKA 3LAYA 4PJNA 1H6GA 4WJ0A 4CJGA 2YLGA 1NFNA 2J7PA 1JR8A 4JTAB 1ZYRF 3GODA 2H7VC 3C62A 4YN0B 4B6IA 2PX0A 4G0HA 1E85A 5E2QA 1DOVA 1I4YA 4U5GA 1E86A 4J7TA 2M4EA 3U9JA 1QQ3A 4BG0A 2VCCA 3FHDA 4FWVA 1QZXA 3N24A 3BEHA 3SP1A 4E17A 2H8AA 2IM8A 5E3CA 2HMZA 5F28E 2R05A 3PDMP 3Q7GA 3TULA 1OQCA 4LERA 4MW3A 2KNHA 4HEAJ 5BQGA 3V5YA 3T6BA 4P9FA 5F5FA 5T1DB 2EIJC 2BE5F 2FAPB 4U5BE 2NUTB 1H9TA 1BZ4A 1VYIA 1OCCC 2DI3A 4WABA 1RCPA 3UR3C 4P9TA 1YAUO 1LE4A 1C03A 2HV6A 3X1OA 4H54A 1K04A 3Q6NA 2YL0A 5KYWA 3KPHA 1HE9A 3ABMC 2HUJA 2GAQA 3U5SA 1U89A 1OCRC 3K6BA 4ZLDA 2EPMX 3IEEA 1M56C 4U5EE 2EILC 2KSFA 1A0BA 2AP3A 2OKUA 3GORA 3DM5A 2R7XA 1W2WA 2Q4FA 2L9JA 2O9XA 3S29A 3LNMB 2UUHA 2V26A 2XS8A 1XZQA 3AQCA 5GPGB 3R7CA 3UGOA 2XXAB 2YQYA 3EFOB 2TMVP 1H7IA 1M6TA 4OIQF 3WAQA 1TWGA 4XEVA 4IAQA 1UFBA 3HTKC 5T3WA 2W4MA 2X0CA 3QVYA 4JC7A 1A7DA 4JEAA 4I1MA 2NG1A 1VLSA 5JRAA 1QSPA 4XPWA 1G8XA 3HJCA 1LPEA 3RF3A 3RFYA 1YARO 4CX9A 1LE2A 3N2ZB 3N0TA 4EUKB 5KYYA 4MVSA 3I5PA 4R32A 3EFOA 3HNLA 3NYMA 2C03A 3C63A 1K40A 1Q0GA 3MYFA 4FAPB 1OCOC 1V54C 4ULWA 2CNWA 4J32B 2CGEA 4Q7CA 5KYUB 2OCCC 1UG7A 2Q3TA 2YLIA 4FX5A 3SXMA 4RDAA 3POVA 4IB4A 5DS4A 3QTHA 3RKOF 3PCVA 4CS7A 1L7CA 3EHMA 2A1DD 3G4XA 1DOWA 5COMA 2A0BA 2G62A 3ATPA 5JP7A 1M2VB 1NU7D 2L81A 3C8GD 4MVUA 2NUTA 4G7HF 3DJUB 4U9DA 2VH3A 3HNKA 5AC4A 3SXKA 4QI2A 3OWTA 4M63A 1QPUA 1HMOA 1ZU4A 4EBKA 1MMDA 3JYHA 1FTSA 3MX3A 5BQIA 3ABLC 4G7OF 2XLWA 2GDCA 3OA1A 2LIGA 4JRZA 1XWJA 4YL0A 2HSBA 1YYXA 1ZHTA 4AE4B 1GS9A 2R25A 2VB6A 4LDRA 1MMGA 4KBLA 3U0CA 3JYYA 3EHNA 1O87A 3FXHA 3JSEO 2IOQA 1ZVZA 1LS4A 1J8MF 2L6HA 3R2PA 256BA 1WATA 2WVQA 1Z6AA 5E3AA 3LS0A 3EH1A 3NMIA 4Z9JA 3C8GB 1D1BA 2KC3A 4K1OA 1EI7A 1VLTA 4YK5A 4AL1A 2E87A 5EGYA 3UMKA 3RH3A 1N1CA 1APCA 2DYRC 4DBRA 3U8VA 1NFOA 3EGXB 3K7DA 3AG1C 2WVNA 3ITFA 1Z7Qc 3W4YA 5DQTA 3E70C 4HFFB 1TKNA 3SZRA 2R7RA 2XLDA 2ZXOA 5DLJA 1OCZC 3NYLA 3FVYA 3CZ6A 5CI9A 1SZIA 2Y3DA 3SYNA 4BJ5C 3FDQA 1ST6A 1FMWA 2R7WA 3VRCA 3E9VA 3H2UA 3RYLA 4ER9A 2KJGA 4JURI 4N6CA 2OEVA 3EGXA 4Z9IA 2CDQA 1M2OA 1AVOB 2YEVA 4IGGA 5CI8A 3SXZA 4CS9A 4NCQA 4CS9C 1QVXA 4JIOA 2J9VA 4KNVA 1PCXA 2LQGA 4L6RA 1Z3IX 2MWQA 2YKZA 3CSKA 2YVKA 4DXWA 1NBBA 5KYXA 1OR2A 1WASA 4EBBA 3CAXA 4OD5A 4E7SA 5B1BC 2OQMA 4NC3A 1MNDA 2OOCA 4XPYA 5HV9A 5KYUA 4EBJA 3FMSA 2Q9CA 2NSGA 4YT8A 5L0JA 2CCYA 2DB4A 5AGFA 2WL8A 1ZHYA 3AGUA 2LD6A 2Q9AA 5D91A 3S27A 4WGZA 4N6HA 4BJ6C 5JLIA 5KYXB 2ASRA 1Z5ZA 2EIKC 4NTBA 2EPOA 3TOMA 4E18A 2QLAA 3QZCA 3KMIA 2HSQA 4EKWA 2P6VA 4XQ1A 1RKCA 1WGWA 4O7GA 3ZVRA 1ORSC 3JSZA 3MFNA 1TWHA 2MYSA 2QTVA 2YL7A 3U2MA 3G50A 1KNYA 5FCLA 3HLZA 2AWCA 3LNRA 1T6IA 1TWCA 3PMRA 5L0FA 2ZXRA 1ZZPA 4HE8D 1IW7F 2EPLX 3ZDLA 4PK4A 3H65A 3EG9A 1ORJA 2YRFA 5EK0A 2LCHA 4FESA 2OEXA 3WG7C 2G3KA 4DJ9A 3U3BA 3TK0A 5A6BA 4JZAA 3U9MA 1YVIA 2HJMA 2Y3HA 3RVZA 5FZTA 3G4ZA 3KH2A 3LEVA 3WHNA 3EZIA 1G4WR 4Q5SF 5JVEA 3K66A 1RJ9A 5TJ5E 4IJJA 3RQFA 4A4AA 2GWWA 1T6UA 3T6JA 3W2WA 4JCZA 4DRHB 2Y3GA 3CQZA 1JAFA 1OKKD 3DI5A 4JE9A 3B0UX 4X0RA 3FAPB 3NMKA 5JT4A 1F1MA 3DM9B 1BBHA 4HFKB 5KYWB 4CDVA 1GM5A 4IRUA 1T6QA 3T9OA 2V3CC 4XLNF 3DE9A 2PBEA 1YYJA 3C7JA 5D92A 2P61A 3JTLO 4PFPA 5BQHA 2J0WA 2R9RB 3H2VA 2CYDA 2PNOA 3ABKC 3IQ5A 3M4BA 1M2VA 5A6AA 3JRMO 1EA8A 3KYJA 4KC9A 2GA0A 3C8GA 4PACA 4LLCA 3QMKA 2KQ9A 3LUTB 4OIRF 3UGPA 1D0XA 1TFOB 2Y69C 3AJMA 2R7UA 2W9YA 3EJNA 3MLGA 4JW1A 3GEIA 1RJ9B 1CGNA 5AC5A 1YZAA 3UMHA 3V7OA 5EHHA 4OINF 4JTCB 1OXKA 1HW2A 2KGOA 3FAJA 4YL1A 3VYWA 5A6KA 2HFIA 3RQEA 3UNGC 2IXNA 3ECSA 1Q0FA 3M79A 4LDKA 5JUAA 4DOZA 1SYQA 2G3VA 3I5QA 2XL8A 1Q0DA 2DYSC 4G7ZF 1LIHA 2OJED 1AEPA 2OJQA 4NTAA 1JOGA 1A41A 3EQLF 3VF0A 2P7VA 4G78A 2FGYA 4C3BA 4DRJB 2D4UA 1R4TA 4CDAA 2R02A 2A0UA 4BJTA 4PJLA 4MTGA 1MMAA 2H7BA 2KW3C 2P1AA 4LLEA 4O6MA 1SMYF 4YT4A 1G5ZA 4LDQA 3GEEA 2BL2A 1NU9C 5B1AC 3S28A 4C7OA 2EPNA 2D5RB 2EINC 2KK1A 1JRAA 4MNDA 4CSAC 1D1AA 1SF8A 4MTFA 4IARA 2P0NA 3BRJA 3RW0A 2CNWD 4I1OB 5B3SC 1FAPB 1V4AA 2YL1A 1Q0KA 4XTKA 4U5DE 3US6A 4MVQA 4A2NB 2HS5A 1CGME 4OD4A 1E2XA 3LJBA 3AGTA 3DE8A 2IBFA 3KL4A 3QW1A 3S9OA 3B29A 2DGJA 2Q00A 1RXQA 4XWJA 3Q7LA 2Z15A 2HKVA 2ZXWC 2LFFA 2NPUA 3RIPA 2F22A 2EPKX 2J9UA 3NKEA 4MVZA 2AVKA 1LM3B 2HJ3A 2PF4E 2W4BA 3LLKA 4U5HA 4YL3A 3WODF 3ZG1A 3AG2C 5L0CA 1LI7A 1CPRA 3PHF2 4CDYA 1BR1A 2Y39A 4JCHA 1Z63A 4J30B 4RD9A 4DVZA 3U8PA 1ZHZA 3SNHA 1M57C 3K1IC 4J7YA 3L0IA 3NYJA 1U0BB 3LESA 1O5HA 4CJOA 3EGDA 1C02A 1LI5A 1Y4CA 2HZ8A 4PR9A 3GM3A 2VASA 5COGA 4P6IC 3W8HA 1K05A 2WZGA 3GWLA 4EHPA 2YZSA 5T3TA 2B0HA 4BEMJ 2HMQA 1NZEA 3ZTMA 2PP4A 3NKDA 2L6GA 3L34A 2MHRA 3CEXA 3LS1A 2IXPA 1FMVA 1V74B 2ZD9A 2WZFA 3ASOC 4PJMA 4O79A 1Z23A 5JS5A 3S90A 1YJGA 3OEOA 5L0HA 2YLDA 3SEOA 3DMDA 4ZLCA 1A7EA 3ZWIA 2IYLD 1YA9A 1D1CA 1FNTc 1ZHXA 1IZMA 1NLXA 4YT5A 2B0JA 3A11A 3QW0A 4LACB 3SXYA 3VAYA 5DQZA 5L0GA 3B0PA 3O39A 1R5ID 2AU5A 3DD7A 3T4RA 1ZU5A 2J7PD 2L6FA 4UDVA 2XL4A 2QNLA 4ONSA 4QDLA 2XM4A 3K1HA 4EIYA 4XPXA 3AG3C 1WWPA 2R03A 1FFTC 2XM0A 4RBNA 3ZIBA 2I15A 4GQHA 4BJ6A 4MVOA 3EGDB 4ANJA 2IXOA 1GGQA 3JZ0A 2EIMC 1CPQA 3JRTA 4N4WA 1I5NA 5BUOA 3B0VC 3W8IA 2J0XA 3NG1A 5DVWA 3TJ6A 4E7ZA 2RD9A 3M4CA 4XEFA 5E33A 1D0ZA 1L3PA 2ZPAA 3MBGA 2A68F 1WOLA 1JPNA 3O6XA 3L8IA 2JX0A 3FOOA 3L8JA 3T6GB 4AE4A 4AX2A 3DJNB 4CIHA 1U6HA 1VB5A 1VK5A 1Q0MA 5F5HA 3TOLA 2WZLA 3I4UA 5CIVA 1TFKB 4OIOF 1KTMA 1FFHA 4MVMA 4C3EA 4JEBA 4U5CE 3KYIA 3FOPA 2KYHA 2YWAA 1PD1A 3AG4C 1BR2A 3U2LA 3V5XA 3F46A 3UMIA 2JD3A 2W45A 3K1IA 5A69A 5DS5A 3A9CA 5A6BD 3ZQYA 1RMVA 3RQGA 5DS6A 2YL3A 1PD0A 1ORYA 4YJWA 2Q7RA 3S84A 2BC5A 3EZHA 1JPJA 2XLEA 3B71A 4QI0A 1AUEA 3ZSUA 2JPUA 4O6NA 2XL6A 2OG2A 3NRHA 2Q9BA 3V5ZA 3NDBB 3HKKA 1KU2A 1C17M 1RKEB 2IXMA 3TQOA 2FFHA 2LK4A 3QVZA 3IQ6A 3IQTA 2CW0F 2XLHA 1OXBA 2M64A 1S7ZA 2H7OA 5L3QA 2XRHA 3IQCA 2R7VA 3TJ5A 2UUIA 4N06A 4IAOA 4XEKA 5JSLA 4PFOA 4U9EA 2A6EF 4I44A 2ICWG 3K33A 1T9KA 1MQVA 1QKRA 4JVSA 2PX3A 1OW8A 2A69F 4WGYA 1LS1A 2J46A 1VOMA 3O55A 3TD7A 1YLMA 4YWQA 5HSWA 5KYNA 1RKEA 1YDIA 1E84A 4MTOA 4GYTA 3GM2A 4MS2A 3HNIA 4MVRA 1H9GA 4U5FE 3DXJF 1I4ZA 1VMAA 4D4NA 1CGOA 2XSEA 3F47A 4KNWA 3VM6A 2J8WA 1WTYA 2GFHA 1MMNA 4K0DA 1VTMP 4YT2A 2NSFA 3M15A 3DKAA 1O3UA 2A6HF 1EKYA 2HV7A 1S05A 3M1CB 4NY3A 2XLVA 5B3IA 2WB7A 4O6YA 4D4XA 4OIPF 1BDJB 2LSEA 1MNEA 3DZAA 5COFA 4DRIB 1G4US 1V55C 5KYYB 1FR0A 4PJJA 4AK9A 4BJ5A 4CIPA 2PFDA 2QE9A 3JT1A 4Z9HA 1HY5A 2ZXPA 4E0HA 5K0IA 1YA7O 3NMJA 4ULVA 3U3FA 4BEJA 1J8YF 4K7BA 3GANA 2VCBA 4W8PA 1T01A 1HE1A 1A7VA 3ASNC 4JTDB 2OU6A 3X2QC 4GEHA 4AL0A 1ZW2A 2J45A 4DVYP 1GQAA 1YZCA 1TWAA 3RVYA 3O10A 2R7SA 3C8ZA 1OW6A 4JJGA 2NUPB 1QLEC 2R7TA 1LKXA 3GEHA 4F4BA 1ZW3A 4BJ1A 1NG1A 1D0YA 2YHSA 3AQBA 3DWWA 3ZQVA 1JMWA 3EPVA 3KKBA 4JKVA 1T5OA 1OW7A 2QY9A 4CSAA 3DAGA 5L3VA 4H4KC 2R7QA 3W2VA 2VCAA 2C04A 2XLOA 4IWBA 1E83A 3B9QA 1HW1A 4I3MA
chains in the Genus database with same CATH topology
2XLWA 2XM4A 4EIYA 3IQ5A 3M4BA 1YYXA 2XM0A 2XLMA 3HNJA 1CPQA 4N4WA 256BA 3ZTZA 1CGNA 1YZAA 3NMIA 3M4CA 3L1MA 3FOOA 3M79A 5JUAA 1APCA 2J9BA 2XL8A 3TOLA 4JEBA 2XLDA 3FOPA 4CDAA 4CJGA 2YLGA 3C62A 3VRCA 3ZQYA 1E85A 4ER9A 2YL3A 2BC5A 2XLEA 1E86A 1QQ3A 2XL6A 4L6RA 4IARA 2YKZA 1NBBA 3QVZA 3IQ6A 2XLHA 2YL1A 4NC3A 5JSLA 4U9EA 2CCYA 3DE8A 5AGFA 3ZWIA 1MQVA 3QW1A 4WGYA 1RCPA 4WGZA 4N6HA 5JLIA 2YL0A 1E84A 3TOMA 2QLAA 3HNIA 1LM3B 4D4NA 1CGOA 2YL7A 1CPRA 2J8WA 4CDYA 1M6TA 3M15A 3U8PA 4IAQA 1EKYA 1S05A 3QVYA 2XLVA 4JEAA 5B3IA 4D4XA 5JRAA 4CJOA 4CX9A 4CIPA 3HNLA 3NMJA 4ULVA 5JVEA 3ZTMA 3C63A 1A7VA 1GQAA 1YZCA 5JS5A 2YLIA 1JAFA 2YLDA 4IB4A 4JE9A 3ZQVA 3NMKA 5JT4A 1BBHA 4JKVA 4CDVA 5JP7A 3QW0A 3DE9A 1YYJA 4U9DA 3HNKA 2XLOA 1E83A 1QPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLW A;  2XM4 A;  4EIY A;  3IQ5 A;  3M4B A;  1YYX A;  2XM0 A;  2XLM A;  3HNJ A;  1CPQ A;  4N4W A;  256B A;  3ZTZ A;  1CGN A;  1YZA A;  3NMI A;  3M4C A;  3L1M A;  3FOO A;  3M79 A;  5JUA A;  1APC A;  2J9B A;  2XL8 A;  3TOL A;  4JEB A;  2XLD A;  3FOP A;  4CDA A;  4CJG A;  2YLG A;  3C62 A;  3VRC A;  3ZQY A;  1E85 A;  4ER9 A;  2YL3 A;  2BC5 A;  2XLE A;  1E86 A;  1QQ3 A;  2XL6 A;  4L6R A;  4IAR A;  2YKZ A;  1NBB A;  3QVZ A;  3IQ6 A;  2XLH A;  2YL1 A;  4NC3 A;  5JSL A;  4U9E A;  2CCY A;  3DE8 A;  5AGF A;  3ZWI A;  1MQV A;  3QW1 A;  4WGY A;  1RCP A;  4WGZ A;  4N6H A;  5JLI A;  2YL0 A;  1E84 A;  3TOM A;  2QLA A;  3HNI A;  1LM3 B;  4D4N A;  1CGO A;  2YL7 A;  1CPR A;  2J8W A;  4CDY A;  1M6T A;  3M15 A;  3U8P A;  4IAQ A;  1EKY A;  1S05 A;  3QVY A;  2XLV A;  4JEA A;  5B3I A;  4D4X A;  5JRA A;  4CJO A;  4CX9 A;  4CIP A;  3HNL A;  3NMJ A;  4ULV A;  5JVE A;  3ZTM A;  3C63 A;  1A7V A;  1GQA A;  1YZC A;  5JS5 A;  2YLI A;  1JAF A;  2YLD A;  4IB4 A;  4JE9 A;  3ZQV A;  3NMK A;  5JT4 A;  1BBH A;  4JKV A;  4CDV A;  5JP7 A;  3QW0 A;  3DE9 A;  1YYJ A;  4U9D A;  3HNK A;  2XLO A;  1E83 A;  1QPU A; 
#chains in the Genus database with same CATH topology
 5L0I A;  3GWN A;  3EH2 A;  2NUP A;  4C7O B;  2WVO A;  2Y3B A;  1Y6D A;  4CS8 A;  3Q6M A;  3LLI A;  2QUP A;  5L0D A;  1BR4 A;  4CS8 C;  3J06 A;  1EQ1 A;  4KI2 A;  4EWC A;  2X51 A;  2XLM A;  3S0X A;  4Q4Z F;  3IHU A;  3HNJ A;  2ETS A;  1B68 A;  1VYK A;  4W8K A;  1XZP A;  1SR2 A;  4DBQ A;  1TQG A;  2R7O A;  3MYI A;  2AWY A;  3ZTZ A;  2XS1 A;  1OR3 A;  3EG9 B;  4BPM A;  4CBE A;  4E0I A;  2L7A A;  5IY5 C;  3L1M A;  2RSE B;  3LEO A;  5A6J A;  3C18 A;  1NSG B;  1PV3 A;  2I8B A;  2LFD A;  3GM1 A;  4NQF A;  3ZC4 A;  1ZHW A;  2J9W A;  4MQ9 F;  4C3D A;  2J9B A;  3JCU Q;  4JJF A;  2XXA A;  4XLP F;  4NTF A;  3DAF A;  1LVK A;  2LP4 A;  4MW8 A;  1HMD A;  1WN0 A;  2VC9 A;  3AOU A;  3IPM O;  1TR2 A;  1OKK A;  3LAY A;  4PJN A;  1H6G A;  4WJ0 A;  4CJG A;  2YLG A;  1NFN A;  2J7P A;  1JR8 A;  4JTA B;  1ZYR F;  3GOD A;  2H7V C;  3C62 A;  4YN0 B;  4B6I A;  2PX0 A;  4G0H A;  1E85 A;  5E2Q A;  1DOV A;  1I4Y A;  4U5G A;  1E86 A;  4J7T A;  2M4E A;  3U9J A;  1QQ3 A;  4BG0 A;  2VCC A;  3FHD A;  4FWV A;  1QZX A;  3N24 A;  3BEH A;  3SP1 A;  4E17 A;  2H8A A;  2IM8 A;  5E3C A;  2HMZ A;  5F28 E;  2R05 A;  3PDM P;  3Q7G A;  3TUL A;  1OQC A;  4LER A;  4MW3 A;  2KNH A;  4HEA J;  5BQG A;  3V5Y A;  3T6B A;  4P9F A;  5F5F A;  5T1D B;  2EIJ C;  2BE5 F;  2FAP B;  4U5B E;  2NUT B;  1H9T A;  1BZ4 A;  1VYI A;  1OCC C;  2DI3 A;  4WAB A;  1RCP A;  3UR3 C;  4P9T A;  1YAU O;  1LE4 A;  1C03 A;  2HV6 A;  3X1O A;  4H54 A;  1K04 A;  3Q6N A;  2YL0 A;  5KYW A;  3KPH A;  1HE9 A;  3ABM C;  2HUJ A;  2GAQ A;  3U5S A;  1U89 A;  1OCR C;  3K6B A;  4ZLD A;  2EPM X;  3IEE A;  1M56 C;  4U5E E;  2EIL C;  2KSF A;  1A0B A;  2AP3 A;  2OKU A;  3GOR A;  3DM5 A;  2R7X A;  1W2W A;  2Q4F A;  2L9J A;  2O9X A;  3S29 A;  3LNM B;  2UUH A;  2V26 A;  2XS8 A;  1XZQ A;  3AQC A;  5GPG B;  3R7C A;  3UGO A;  2XXA B;  2YQY A;  3EFO B;  2TMV P;  1H7I A;  1M6T A;  4OIQ F;  3WAQ A;  1TWG A;  4XEV A;  4IAQ A;  1UFB A;  3HTK C;  5T3W A;  2W4M A;  2X0C A;  3QVY A;  4JC7 A;  1A7D A;  4JEA A;  4I1M A;  2NG1 A;  1VLS A;  5JRA A;  1QSP A;  4XPW A;  1G8X A;  3HJC A;  1LPE A;  3RF3 A;  3RFY A;  1YAR O;  4CX9 A;  1LE2 A;  3N2Z B;  3N0T A;  4EUK B;  5KYY A;  4MVS A;  3I5P A;  4R32 A;  3EFO A;  3HNL A;  3NYM A;  2C03 A;  3C63 A;  1K40 A;  1Q0G A;  3MYF A;  4FAP B;  1OCO C;  1V54 C;  4ULW A;  2CNW A;  4J32 B;  2CGE A;  4Q7C A;  5KYU B;  2OCC C;  1UG7 A;  2Q3T A;  2YLI A;  4FX5 A;  3SXM A;  4RDA A;  3POV A;  4IB4 A;  5DS4 A;  3QTH A;  3RKO F;  3PCV A;  4CS7 A;  1L7C A;  3EHM A;  2A1D D;  3G4X A;  1DOW A;  5COM A;  2A0B A;  2G62 A;  3ATP A;  5JP7 A;  1M2V B;  1NU7 D;  2L81 A;  3C8G D;  4MVU A;  2NUT A;  4G7H F;  3DJU B;  4U9D A;  2VH3 A;  3HNK A;  5AC4 A;  3SXK A;  4QI2 A;  3OWT A;  4M63 A;  1QPU A;  1HMO A;  1ZU4 A;  4EBK A;  1MMD A;  3JYH A;  1FTS A;  3MX3 A;  5BQI A;  3ABL C;  4G7O F;  2XLW A;  2GDC A;  3OA1 A;  2LIG A;  4JRZ A;  1XWJ A;  4YL0 A;  2HSB A;  1YYX A;  1ZHT A;  4AE4 B;  1GS9 A;  2R25 A;  2VB6 A;  4LDR A;  1MMG A;  4KBL A;  3U0C A;  3JYY A;  3EHN A;  1O87 A;  3FXH A;  3JSE O;  2IOQ A;  1ZVZ A;  1LS4 A;  1J8M F;  2L6H A;  3R2P A;  256B A;  1WAT A;  2WVQ A;  1Z6A A;  5E3A A;  3LS0 A;  3EH1 A;  3NMI A;  4Z9J A;  3C8G B;  1D1B A;  2KC3 A;  4K1O A;  1EI7 A;  1VLT A;  4YK5 A;  4AL1 A;  2E87 A;  5EGY A;  3UMK A;  3RH3 A;  1N1C A;  1APC A;  2DYR C;  4DBR A;  3U8V A;  1NFO A;  3EGX B;  3K7D A;  3AG1 C;  2WVN A;  3ITF A;  1Z7Q c;  3W4Y A;  5DQT A;  3E70 C;  4HFF B;  1TKN A;  3SZR A;  2R7R A;  2XLD A;  2ZXO A;  5DLJ A;  1OCZ C;  3NYL A;  3FVY A;  3CZ6 A;  5CI9 A;  1SZI A;  2Y3D A;  3SYN A;  4BJ5 C;  3FDQ A;  1ST6 A;  1FMW A;  2R7W A;  3VRC A;  3E9V A;  3H2U A;  3RYL A;  4ER9 A;  2KJG A;  4JUR I;  4N6C A;  2OEV A;  3EGX A;  4Z9I A;  2CDQ A;  1M2O A;  1AVO B;  2YEV A;  4IGG A;  5CI8 A;  3SXZ A;  4CS9 A;  4NCQ A;  4CS9 C;  1QVX A;  4JIO A;  2J9V A;  4KNV A;  1PCX A;  2LQG A;  4L6R A;  1Z3I X;  2MWQ A;  2YKZ A;  3CSK A;  2YVK A;  4DXW A;  1NBB A;  5KYX A;  1OR2 A;  1WAS A;  4EBB A;  3CAX A;  4OD5 A;  4E7S A;  5B1B C;  2OQM A;  4NC3 A;  1MND A;  2OOC A;  4XPY A;  5HV9 A;  5KYU A;  4EBJ A;  3FMS A;  2Q9C A;  2NSG A;  4YT8 A;  5L0J A;  2CCY A;  2DB4 A;  5AGF A;  2WL8 A;  1ZHY A;  3AGU A;  2LD6 A;  2Q9A A;  5D91 A;  3S27 A;  4WGZ A;  4N6H A;  4BJ6 C;  5JLI A;  5KYX B;  2ASR A;  1Z5Z A;  2EIK C;  4NTB A;  2EPO A;  3TOM A;  4E18 A;  2QLA A;  3QZC A;  3KMI A;  2HSQ A;  4EKW A;  2P6V A;  4XQ1 A;  1RKC A;  1WGW A;  4O7G A;  3ZVR A;  1ORS C;  3JSZ A;  3MFN A;  1TWH A;  2MYS A;  2QTV A;  2YL7 A;  3U2M A;  3G50 A;  1KNY A;  5FCL A;  3HLZ A;  2AWC A;  3LNR A;  1T6I A;  1TWC A;  3PMR A;  5L0F A;  2ZXR A;  1ZZP A;  4HE8 D;  1IW7 F;  2EPL X;  3ZDL A;  4PK4 A;  3H65 A;  3EG9 A;  1ORJ A;  2YRF A;  5EK0 A;  2LCH A;  4FES A;  2OEX A;  3WG7 C;  2G3K A;  4DJ9 A;  3U3B A;  3TK0 A;  5A6B A;  4JZA A;  3U9M A;  1YVI A;  2HJM A;  2Y3H A;  3RVZ A;  5FZT A;  3G4Z A;  3KH2 A;  3LEV A;  3WHN A;  3EZI A;  1G4W R;  4Q5S F;  5JVE A;  3K66 A;  1RJ9 A;  5TJ5 E;  4IJJ A;  3RQF A;  4A4A A;  2GWW A;  1T6U A;  3T6J A;  3W2W A;  4JCZ A;  4DRH B;  2Y3G A;  3CQZ A;  1JAF A;  1OKK D;  3DI5 A;  4JE9 A;  3B0U X;  4X0R A;  3FAP B;  3NMK A;  5JT4 A;  1F1M A;  3DM9 B;  1BBH A;  4HFK B;  5KYW B;  4CDV A;  1GM5 A;  4IRU A;  1T6Q A;  3T9O A;  2V3C C;  4XLN F;  3DE9 A;  2PBE A;  1YYJ A;  3C7J A;  5D92 A;  2P61 A;  3JTL O;  4PFP A;  5BQH A;  2J0W A;  2R9R B;  3H2V A;  2CYD A;  2PNO A;  3ABK C;  3IQ5 A;  3M4B A;  1M2V A;  5A6A A;  3JRM O;  1EA8 A;  3KYJ A;  4KC9 A;  2GA0 A;  3C8G A;  4PAC A;  4LLC A;  3QMK A;  2KQ9 A;  3LUT B;  4OIR F;  3UGP A;  1D0X A;  1TFO B;  2Y69 C;  3AJM A;  2R7U A;  2W9Y A;  3EJN A;  3MLG A;  4JW1 A;  3GEI A;  1RJ9 B;  1CGN A;  5AC5 A;  1YZA A;  3UMH A;  3V7O A;  5EHH A;  4OIN F;  4JTC B;  1OXK A;  1HW2 A;  2KGO A;  3FAJ A;  4YL1 A;  3VYW A;  5A6K A;  2HFI A;  3RQE A;  3UNG C;  2IXN A;  3ECS A;  1Q0F A;  3M79 A;  4LDK A;  5JUA A;  4DOZ A;  1SYQ A;  2G3V A;  3I5Q A;  2XL8 A;  1Q0D A;  2DYS C;  4G7Z F;  1LIH A;  2OJE D;  1AEP A;  2OJQ A;  4NTA A;  1JOG A;  1A41 A;  3EQL F;  3VF0 A;  2P7V A;  4G78 A;  2FGY A;  4C3B A;  4DRJ B;  2D4U A;  1R4T A;  4CDA A;  2R02 A;  2A0U A;  4BJT A;  4PJL A;  4MTG A;  1MMA A;  2H7B A;  2KW3 C;  2P1A A;  4LLE A;  4O6M A;  1SMY F;  4YT4 A;  1G5Z A;  4LDQ A;  3GEE A;  2BL2 A;  1NU9 C;  5B1A C;  3S28 A;  4C7O A;  2EPN A;  2D5R B;  2EIN C;  2KK1 A;  1JRA A;  4MND A;  4CSA C;  1D1A A;  1SF8 A;  4MTF A;  4IAR A;  2P0N A;  3BRJ A;  3RW0 A;  2CNW D;  4I1O B;  5B3S C;  1FAP B;  1V4A A;  2YL1 A;  1Q0K A;  4XTK A;  4U5D E;  3US6 A;  4MVQ A;  4A2N B;  2HS5 A;  1CGM E;  4OD4 A;  1E2X A;  3LJB A;  3AGT A;  3DE8 A;  2IBF A;  3KL4 A;  3QW1 A;  3S9O A;  3B29 A;  2DGJ A;  2Q00 A;  1RXQ A;  4XWJ A;  3Q7L A;  2Z15 A;  2HKV A;  2ZXW C;  2LFF A;  2NPU A;  3RIP A;  2F22 A;  2EPK X;  2J9U A;  3NKE A;  4MVZ A;  2AVK A;  1LM3 B;  2HJ3 A;  2PF4 E;  2W4B A;  3LLK A;  4U5H A;  4YL3 A;  3WOD F;  3ZG1 A;  3AG2 C;  5L0C A;  1LI7 A;  1CPR A;  3PHF 2;  4CDY A;  1BR1 A;  2Y39 A;  4JCH A;  1Z63 A;  4J30 B;  4RD9 A;  4DVZ A;  3U8P A;  1ZHZ A;  3SNH A;  1M57 C;  3K1I C;  4J7Y A;  3L0I A;  3NYJ A;  1U0B B;  3LES A;  1O5H A;  4CJO A;  3EGD A;  1C02 A;  1LI5 A;  1Y4C A;  2HZ8 A;  4PR9 A;  3GM3 A;  2VAS A;  5COG A;  4P6I C;  3W8H A;  1K05 A;  2WZG A;  3GWL A;  4EHP A;  2YZS A;  5T3T A;  2B0H A;  4BEM J;  2HMQ A;  1NZE A;  3ZTM A;  2PP4 A;  3NKD A;  2L6G A;  3L34 A;  2MHR A;  3CEX A;  3LS1 A;  2IXP A;  1FMV A;  1V74 B;  2ZD9 A;  2WZF A;  3ASO C;  4PJM A;  4O79 A;  1Z23 A;  5JS5 A;  3S90 A;  1YJG A;  3OEO A;  5L0H A;  2YLD A;  3SEO A;  3DMD A;  4ZLC A;  1A7E A;  3ZWI A;  2IYL D;  1YA9 A;  1D1C A;  1FNT c;  1ZHX A;  1IZM A;  1NLX A;  4YT5 A;  2B0J A;  3A11 A;  3QW0 A;  4LAC B;  3SXY A;  3VAY A;  5DQZ A;  5L0G A;  3B0P A;  3O39 A;  1R5I D;  2AU5 A;  3DD7 A;  3T4R A;  1ZU5 A;  2J7P D;  2L6F A;  4UDV A;  2XL4 A;  2QNL A;  4ONS A;  4QDL A;  2XM4 A;  3K1H A;  4EIY A;  4XPX A;  3AG3 C;  1WWP A;  2R03 A;  1FFT C;  2XM0 A;  4RBN A;  3ZIB A;  2I15 A;  4GQH A;  4BJ6 A;  4MVO A;  3EGD B;  4ANJ A;  2IXO A;  1GGQ A;  3JZ0 A;  2EIM C;  1CPQ A;  3JRT A;  4N4W A;  1I5N A;  5BUO A;  3B0V C;  3W8I A;  2J0X A;  3NG1 A;  5DVW A;  3TJ6 A;  4E7Z A;  2RD9 A;  3M4C A;  4XEF A;  5E33 A;  1D0Z A;  1L3P A;  2ZPA A;  3MBG A;  2A68 F;  1WOL A;  1JPN A;  3O6X A;  3L8I A;  2JX0 A;  3FOO A;  3L8J A;  3T6G B;  4AE4 A;  4AX2 A;  3DJN B;  4CIH A;  1U6H A;  1VB5 A;  1VK5 A;  1Q0M A;  5F5H A;  3TOL A;  2WZL A;  3I4U A;  5CIV A;  1TFK B;  4OIO F;  1KTM A;  1FFH A;  4MVM A;  4C3E A;  4JEB A;  4U5C E;  3KYI A;  3FOP A;  2KYH A;  2YWA A;  1PD1 A;  3AG4 C;  1BR2 A;  3U2L A;  3V5X A;  3F46 A;  3UMI A;  2JD3 A;  2W45 A;  3K1I A;  5A69 A;  5DS5 A;  3A9C A;  5A6B D;  3ZQY A;  1RMV A;  3RQG A;  5DS6 A;  2YL3 A;  1PD0 A;  1ORY A;  4YJW A;  2Q7R A;  3S84 A;  2BC5 A;  3EZH A;  1JPJ A;  2XLE A;  3B71 A;  4QI0 A;  1AUE A;  3ZSU A;  2JPU A;  4O6N A;  2XL6 A;  2OG2 A;  3NRH A;  2Q9B A;  3V5Z A;  3NDB B;  3HKK A;  1KU2 A;  1C17 M;  1RKE B;  2IXM A;  3TQO A;  2FFH A;  2LK4 A;  3QVZ A;  3IQ6 A;  3IQT A;  2CW0 F;  2XLH A;  1OXB A;  2M64 A;  1S7Z A;  2H7O A;  5L3Q A;  2XRH A;  3IQC A;  2R7V A;  3TJ5 A;  2UUI A;  4N06 A;  4IAO A;  4XEK A;  5JSL A;  4PFO A;  4U9E A;  2A6E F;  4I44 A;  2ICW G;  3K33 A;  1T9K A;  1MQV A;  1QKR A;  4JVS A;  2PX3 A;  1OW8 A;  2A69 F;  4WGY A;  1LS1 A;  2J46 A;  1VOM A;  3O55 A;  3TD7 A;  1YLM A;  4YWQ A;  5HSW A;  5KYN A;  1RKE A;  1YDI A;  1E84 A;  4MTO A;  4GYT A;  3GM2 A;  4MS2 A;  3HNI A;  4MVR A;  1H9G A;  4U5F E;  3DXJ F;  1I4Z A;  1VMA A;  4D4N A;  1CGO A;  2XSE A;  3F47 A;  4KNW A;  3VM6 A;  2J8W A;  1WTY A;  2GFH A;  1MMN A;  4K0D A;  1VTM P;  4YT2 A;  2NSF A;  3M15 A;  3DKA A;  1O3U A;  2A6H F;  1EKY A;  2HV7 A;  1S05 A;  3M1C B;  4NY3 A;  2XLV A;  5B3I A;  2WB7 A;  4O6Y A;  4D4X A;  4OIP F;  1BDJ B;  2LSE A;  1MNE A;  3DZA A;  5COF A;  4DRI B;  1G4U S;  1V55 C;  5KYY B;  1FR0 A;  4PJJ A;  4AK9 A;  4BJ5 A;  4CIP A;  2PFD A;  2QE9 A;  3JT1 A;  4Z9H A;  1HY5 A;  2ZXP A;  4E0H A;  5K0I A;  1YA7 O;  3NMJ A;  4ULV A;  3U3F A;  4BEJ A;  1J8Y F;  4K7B A;  3GAN A;  2VCB A;  4W8P A;  1T01 A;  1HE1 A;  1A7V A;  3ASN C;  4JTD B;  2OU6 A;  3X2Q C;  4GEH A;  4AL0 A;  1ZW2 A;  2J45 A;  4DVY P;  1GQA A;  1YZC A;  1TWA A;  3RVY A;  3O10 A;  2R7S A;  3C8Z A;  1OW6 A;  4JJG A;  2NUP B;  1QLE C;  2R7T A;  1LKX A;  3GEH A;  4F4B A;  1ZW3 A;  4BJ1 A;  1NG1 A;  1D0Y A;  2YHS A;  3AQB A;  3DWW A;  3ZQV A;  1JMW A;  3EPV A;  3KKB A;  4JKV A;  1T5O A;  1OW7 A;  2QY9 A;  4CSA A;  3DAG A;  5L3V A;  4H4K C;  2R7Q A;  3W2V A;  2VCA A;  2C04 A;  2XLO A;  4IWB A;  1E83 A;  3B9Q A;  1HW1 A;  4I3M A; 
#chains in the Genus database with same CATH homology
 2XLW A;  2XM4 A;  4EIY A;  3IQ5 A;  3M4B A;  1YYX A;  2XM0 A;  2XLM A;  3HNJ A;  1CPQ A;  4N4W A;  256B A;  3ZTZ A;  1CGN A;  1YZA A;  3NMI A;  3M4C A;  3L1M A;  3FOO A;  3M79 A;  5JUA A;  1APC A;  2J9B A;  2XL8 A;  3TOL A;  4JEB A;  2XLD A;  3FOP A;  4CDA A;  4CJG A;  2YLG A;  3C62 A;  3VRC A;  3ZQY A;  1E85 A;  4ER9 A;  2YL3 A;  2BC5 A;  2XLE A;  1E86 A;  1QQ3 A;  2XL6 A;  4L6R A;  4IAR A;  2YKZ A;  1NBB A;  3QVZ A;  3IQ6 A;  2XLH A;  2YL1 A;  4NC3 A;  5JSL A;  4U9E A;  2CCY A;  3DE8 A;  5AGF A;  3ZWI A;  1MQV A;  3QW1 A;  4WGY A;  1RCP A;  4WGZ A;  4N6H A;  5JLI A;  2YL0 A;  1E84 A;  3TOM A;  2QLA A;  3HNI A;  1LM3 B;  4D4N A;  1CGO A;  2YL7 A;  1CPR A;  2J8W A;  4CDY A;  1M6T A;  3M15 A;  3U8P A;  4IAQ A;  1EKY A;  1S05 A;  3QVY A;  2XLV A;  4JEA A;  5B3I A;  4D4X A;  5JRA A;  4CJO A;  4CX9 A;  4CIP A;  3HNL A;  3NMJ A;  4ULV A;  5JVE A;  3ZTM A;  3C63 A;  1A7V A;  1GQA A;  1YZC A;  5JS5 A;  2YLI A;  1JAF A;  2YLD A;  4IB4 A;  4JE9 A;  3ZQV A;  3NMK A;  5JT4 A;  1BBH A;  4JKV A;  4CDV A;  5JP7 A;  3QW0 A;  3DE9 A;  1YYJ A;  4U9D A;  3HNK A;  2XLO A;  1E83 A;  1QPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...