2YLDA

Recombinant native cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound at 1.25 a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yldA00
2XLVA 1YZAA 4JEAA 1CGOA 2J8WA 2YLDA 3ZTMA 3ZTZA 5JUAA 4L6RA 4WGZA 3HNLA 4WGYA 3QVZA 3M79A 3ZQYA 2XLHA 3VRCA 1E83A 3HNJA 1YYJA 2CCYA 3M15A 3U8PA 1JAFA 4CIPA 3QW1A 3C63A 4CDYA 2QLAA 4N6HA 4CDVA 2XL6A 1CPRA 2YL1A 3ZWIA 4N4WA 4IARA 1EKYA 1E84A 3TOMA 3DE8A 4U9EA 4IB4A 5JP7A 1APCA 2YL0A 3QVYA 1E86A 2XM0A 3NMKA 5JLIA 3L1MA 1YZCA 2XLDA 3DE9A 4CX9A 4JKVA 3HNIA 4ER9A 1NBBA 4D4NA 3IQ6A 4IAQA 4CDAA 1CPQA 4EIYA 2XLOA 3NMIA 4CJGA 3TOLA 1QPUA 3NMJA 2XM4A 2J9BA 1CGNA 2XL8A 2BC5A 5JT4A 1MQVA 5JRAA 4D4XA 5JSLA 3C62A 5AGFA 1BBHA 1M6TA 4NC3A 2XLEA 3FOOA 1E85A 1A7VA 2XLWA 5JS5A 256BA 1QQ3A 1LM3B 4U9DA 1S05A 3HNKA 5JVEA 1YYXA 4CJOA 3QW0A 4JEBA 1GQAA 2XLMA 3IQ5A 2YLGA 2YL3A 4JE9A 2YL7A 2YKZA 3M4CA 1RCPA 3M4BA 3FOPA 5B3IA 2YLIA 3ZQVA 4ULVA
chains in the Genus database with same CATH superfamily
3SNHA 1VTMP 1M2OA 2XLVA 4IGGA 5DQZA 3ZC4A 1CGOA 2L81A 2OQMA 2Q9BA 4XQ1A 2R7TA 3ZIBA 2PP4A 3U5SA 1ZU4A 2AVKA 3FXHA 4C7OA 1FFTC 2D5RB 3K1HA 3C18A 1M2VB 1T6UA 3QVZA 4AL1A 5KYYA 3FDQA 4OIQF 4WABA 2VCCA 3O6XA 5CIVA 1D0ZA 2WL8A 4LACB 4H4KC 3U9JA 4EBBA 1A0BA 2R7RA 3PDMP 1ZVZA 1WN0A 1TFOB 1TWCA 1LI5A 1YAUO 1SZIA 3EZIA 3KH2A 3S29A 2JD3A 3C8GB 4CS9C 2P61A 2G62A 3MFNA 2WB7A 2XRHA 1N1CA 2PNOA 4N6HA 4DXWA 4YT8A 1FNTc 3MLGA 1CPRA 1XZQA 3VAYA 4DJ9A 3ZWIA 3UMIA 1WOLA 2HSQA 2QTVA 3US6A 3DMDA 1K04A 3K66A 2DYSC 4XLNF 2YHSA 3GORA 4MS2A 3NG1A 4X0RA 3X1OA 3TOMA 1ZU5A 3U8VA 4MNDA 3EFOB 4C3EA 5L0JA 2ZXWC 3AG1C 2AWYA 4DOZA 4OIOF 4ZLCA 5B1AC 3OA1A 4NY3A 2HSBA 2MYSA 3MBGA 4FWVA 4U5FE 2C04A 2P0NA 3G50A 2J9WA 3Q6MA 5KYNA 3V5ZA 1DOVA 2YL0A 3C7JA 3QVYA 1HE9A 3J06A 2PF4E 1R4TA 3LAYA 1WASA 1O3UA 2HUJA 5L0IA 1IZMA 1ST6A 1MNEA 2HZ8A 1FFHA 4YJWA 2Q3TA 4NTBA 2UUIA 2NSFA 2W4MA 3SXYA 4EBJA 4MQ9F 5KYXB 2PX0A 1NU9C 1UG7A 2LIGA 1IW7F 3MX3A 2VC9A 3EGXB 1SYQA 3EHNA 3DM9B 4R32A 4U5CE 4JCZA 3LESA 1C02A 1YLMA 4FAPB 1Y6DA 1OCOC 2CNWD 2KW3C 2X51A 3F46A 3JTLO 2RD9A 1CPQA 4CDAA 2NUTB 3GWLA 3GWNA 5COMA 4CJGA 4MVRA 4P9TA 2G3KA 4AE4B 2Q9CA 1QPUA 4I1MA 3AGUA 2O9XA 3BRJA 4JIOA 3U2MA 2XL8A 2BC5A 5JT4A 1A41A 1M57C 1NZEA 3B29A 3DJNB 1LVKA 2KYHA 3IEEA 5JRAA 3W8IA 1VYKA 2Y3GA 3QTHA 3UMKA 3UMHA 3FHDA 2P1AA 5JSLA 5B3SC 5DS6A 2ZXOA 1Q0DA 5AGFA 1BBHA 2NUPB 1ZZPA 4CBEA 3NYJA 2J46A 1YA7O 2W4BA 2WZLA 1ZHXA 4UDVA 1JR8A 5A6BA 4N6CA 1K40A 3S27A 4Q4ZF 2OEXA 4GYTA 1E85A 2L6FA 4G78A 2R7SA 2J7PD 2LK4A 4LDQA 4CSAA 4YT5A 1VLSA 4O6NA 1M2VA 2P6VA 1ORYA 1TR2A 1U89A 3AQCA 1T6QA 3B0PA 1QSPA 2WVOA 2PBEA 3DJUB 3DZAA 3KKBA 4XPXA 3N24A 3LNRA 1MNDA 1YYXA 1A7EA 2HMZA 1OKKA 2GA0A 2R7QA 2YLGA 5F5HA 4AK9A 3LEVA 5BQGA 3EG9B 3ASOC 5BQIA 2YKZA 3M4CA 3ABLC 1RCPA 3AOUA 4I3MA 1V4AA 3RVYA 1Q0GA 1V74B 1YDIA 3DKAA 4BJ5A 3AG4C 5B3IA 4MVMA 4E17A 1ZHYA 2A0BA 4O7GA 2L9JA 2QUPA 3CAXA 1OW8A 1G4WR 3LNMB 4IRUA 4O6YA 3U9MA 2TMVP 3W8HA 5A6JA 4JTDB 4MTGA 1TQGA 2FGYA 2OKUA 3KYIA 4FX5A 4BPMA 1J8MF 2KGOA 2LQGA 4L6RA 4WGZA 3L8IA 4K7BA 3HNLA 3JRTA 3EFOA 4JZAA 1A7DA 3CEXA 1Z3IX 3EHMA 4LDKA 5TJ5E 2J9UA 4CSAC 1O87A 1G8XA 2KSFA 3EPVA 1R5ID 3ZQYA 2Y3HA 1KTMA 3RQEA 4PJNA 1L3PA 3W2VA 2NPUA 2DYRC 1TWHA 3HNJA 3IQTA 1YYJA 2ICWG 4CS8A 4NQFA 5AC4A 3M15A 5A6BD 4JVSA 3GANA 3NKEA 2A1DD 4CDYA 2PX3A 3ZVRA 2EPKX 3JSZA 1RKEB 3QZCA 2EPOA 4J7YA 4BJ5C 4PJLA 2IXNA 3RYLA 1ORJA 2H7VC 4NCQA 2AWCA 5A69A 2OJQA 2PFDA 1T6IA 1ZHZA 2R05A 1LPEA 1I5NA 4Z9HA 1Z6AA 1E84A 1OKKD 3OEOA 4YL1A 3K7DA 4U5BE 1TFKB 3DAFA 4BEMJ 2ZD9A 3C8GD 3SZRA 3PHF2 3ATPA 4XEFA 2Y39A 4B6IA 4XEVA 4DRHB 4DRJB 3ZSUA 1T9KA 5E33A 5L0FA 4AE4A 3GM2A 5E3AA 2NG1A 2OOCA 1ORSC 3RQGA 3M1CB 4XEKA 3NRHA 5A6AA 4KBLA 3IPMO 4PFOA 5L0HA 1G4US 1LIHA 3SP1A 2XM0A 2A6EF 3ASNC 3HTKC 2CNWA 3L1MA 5E2QA 3TK0A 4BG0A 3W2WA 1ZW3A 1YZCA 3EJNA 1U6HA 4OD5A 1PD0A 2NUPA 4XTKA 4QDLA 2XLDA 5IY5C 4G7OF 3PCVA 4Q5SF 4CX9A 2J45A 1O5HA 4PACA 2EIJC 3ZDLA 3N0TA 3AJMA 2R7WA 2CGEA 1WWPA 5COFA 4MVSA 4A4AA 3RKOF 1ZW2A 4PFPA 4MW3A 4OIPF 2Q00A 3JRMO 3NMIA 2Q7RA 1BR1A 1OXKA 4E18A 4DVYP 1NFOA 3NMJA 2DI3A 2XS8A 2R7OA 2XM4A 2AU5A 2J9BA 3DD7A 2GWWA 4MTOA 1RJ9B 4PR9A 4U5DE 2J7PA 5L0DA 4QI2A 2CYDA 3EG9A 4PK4A 3V7OA 3V5XA 4D4XA 5F28E 1Z7Qc 5EGYA 5EHHA 2FFHA 2I8BA 4DVZA 2QNLA 2ZXRA 3RF3A 1M6TA 2H7OA 2V26A 3O55A 4YK5A 5L0GA 2IYLD 2LCHA 1WGWA 2XXAB 2KNHA 3ZG1A 3SXZA 2XLWA 3S84A 4I1OB 5D92A 4PJMA 3DI5A 3IQCA 2ZPAA 2QY9A 3GODA 1QVXA 3HLZA 3K6BA 3RW0A 2A6HF 1Z63A 1EQ1A 2G3VA 2YRFA 3HNKA 4I44A 2EPNA 3H2VA 4HE8D 4CJOA 4JRZA 1D0YA 4JEBA 3OWTA 4LERA 2EPMX 4YN0B 1F1MA 5CI9A 2LFFA 2YL3A 3T6BA 1LS4A 2R7UA 3VYWA 1SF8A 4JC7A 5KYWB 1YVIA 3E9VA 2YL7A 2R03A 3EGDB 1RMVA 1T5OA 3M4BA 3LLIA 1EI7A 1RKEA 3DXJF 4ULVA 4DBQA 1HE1A 1JRAA 2D4UA 2VH3A 3EH1A 1AEPA 4QI0A 1NSGB 4E7SA 3ZTMA 2YLDA 1JMWA 3T4RA 1ZYRF 1OW7A 2VCBA 2Y3BA 3ZTZA 5JUAA 4JJFA 4C7OB 1MMGA 2DGJA 1GS9A 4HFFB 1JPJA 2WVNA 4WGYA 3R7CA 4BJ1A 3NYLA 3N2ZB 2ETSA 3UNGC 4E0HA 1EA8A 4JTAB 2XLHA 3AQBA 4BJ6A 3S0XA 3NDBB 4C3BA 2J9VA 2M4EA 3KYJA 2CCYA 1GM5A 1OCCC 3U8PA 1HW1A 4JTCB 4MVOA 5CI8A 1HW2A 1B68A 4CIPA 1OR2A 2WZFA 3C63A 3QW1A 3C8GA 2RSEB 3U2LA 2VCAA 5GPGB 3DWWA 4U5GA 2XL6A 4G7HF 1VYIA 1D1BA 1LE4A 4CS7A 2YL1A 3E70C 3SXKA 1H9GA 4N4WA 4IARA 4ZLDA 4JURI 1FMWA 1EKYA 1FMVA 1YJGA 1E2XA 1D1AA 1BDJB 2Y69C 1OR3A 2R02A 3MYFA 3ABMC 2H8AA 5A6KA 4MVZA 2L6HA 2XSEA 4KC9A 4IAOA 1TWGA 5EK0A 4U9EA 1QKRA 1T01A 1BR4A 4CIHA 1KU2A 2Y3DA 4IB4A 4NTFA 2E87A 1AUEA 5T3TA 2R7VA 1LKXA 3JYYA 3GEHA 3GEIA 3WG7C 1V54C 4OINF 4RBNA 3T6GB 5JLIA 3C8ZA 1WATA 3LUTB 1QZXA 4LLCA 3RVZA 1DOWA 1RKCA 3DE9A 4RD9A 3RIPA 5BUOA 5KYXA 2HMQA 1V55C 3EGXA 1H9TA 2HKVA 1RXQA 3HJCA 2GDCA 2HV6A 1U0BB 1NG1A 1FR0A 3S28A 4ER9A 1VLTA 3IQ6A 1HY5A 2BE5F 3A11A 4KNVA 2HV7A 4IAQA 3ECSA 4JW1A 4ANJA 3WODF 2WZGA 2YVKA 4EIYA 2J0XA 4EUKB 2W45A 5KYUB 2HFIA 4YL3A 2NUTA 4KNWA 1VOMA 1LI7A 4E0IA 2WVQA 2BL2A 3JZ0A 1FTSA 5T1DB 1CGNA 1Y4CA 2B0JA 3WHNA 4CS8C 4G7ZF 4MTFA 3F47A 1MQVA 3GEEA 1KNYA 1LE2A 2EIMC 1G5ZA 3O39A 5KYWA 4XLPF 3EGDA 3CSKA 2LFDA 3C62A 2LSEA 2R9RB 5COGA 4EKWA 4ONSA 4LLEA 2YQYA 3AG3C 2V3CC 3G4ZA 1CGME 3RQFA 1Z23A 2XLEA 1M56C 3I5QA 1OQCA 2YEVA 4XPWA 2KQ9A 256BA 4GEHA 1K05A 3EZHA 4AX2A 1QQ3A 2M64A 1LM3B 1D0XA 1S05A 1ZHTA 3K33A 3T9OA 4BEJA 4XPYA 3K1IA 3LS1A 1GQAA 1TKNA 3KMIA 3S9OA 1I4ZA 1VB5A 2YWAA 4IJJA 2OU6A 2AP3A 4JE9A 4XWJA 3RFYA 5HSWA 2LP4A 3U3FA 3ABKC 3I4UA 4MW8A 5B1BC 3FOPA 5E3CA 5F5FA 1S7ZA 3MYIA 2YLIA 3Q7GA 2CDQA 2IOQA 3NYMA 4EBKA 2KK1A 2C03A 2YZSA 3T6JA 4P6IC 1YZAA 1Q0FA 2A0UA 2H7BA 2J8WA 4JEAA 2R7XA 4PJJA 1MMAA 2HJMA 4Z9IA 2Q9AA 2Q4FA 2JPUA 3ITFA 3NKDA 3B0UX 1OCRC 3M79A 1YA9A 4ULWA 4MVQA 1OXBA 3TD7A 3VRCA 5DQTA 4EHPA 4YT4A 2IM8A 1D1CA 1Q0KA 3H2UA 4K0DA 1E83A 3K1IC 2A68F 3PMRA 3JSEO 3B71A 4YL0A 4MVUA 5FCLA 3W4YA 5DS5A 5DVWA 3LS0A 4WJ0A 3QMKA 5D91A 4YT2A 1JAFA 2NSGA 5HV9A 2L6GA 2QLAA 1OW6A 2OJED 4HEAJ 3VF0A 2VASA 1C03A 4CDVA 1JOGA 4J30B 3LLKA 1WTYA 3UGOA 2GFHA 1Z5ZA 3LEOA 2IXOA 2Z15A 1MMNA 3DAGA 2QE9A 4DRIB 4OD4A 3IHUA 3FAJA 4AL0A 3HKKA 4Z9JA 1BZ4A 3U3BA 3JYHA 2OEVA 3SEOA 3TULA 1VK5A 3JCUQ 4H54A 4W8PA 1TWAA 3DE8A 3AG2C 3L0IA 5KYYB 2R25A 2L7AA 3Q7LA 5KYUA 2GAQA 4M63A 5DS4A 3FMSA 2B0HA 4Q7CA 1W2WA 3RH3A 3EQLF 5JP7A 1APCA 2MWQA 5L0CA 4RDAA 2HS5A 2OCCC 3WAQA 2EPLX 2OG2A 4U5HA 4W8KA 1E86A 1Q0MA 3JT1A 3UR3C 3L34A 1MMDA 1C17M 3CQZA 3NMKA 4KI2A 1SR2A 3R2PA 3GM3A 4O6MA 5DLJA 1NFNA 4J7TA 2KJGA 4F4BA 1NU7D 3I5PA 3UGPA 1L7CA 4G0HA 3TQOA 4DBRA 2XL4A 1SMYF 1OCZC 3S90A 4JKVA 2LD6A 3G4XA 2FAPB 1HMOA 3BEHA 1NBBA 1XWJA 3GM1A 3HNIA 4JCHA 3SYNA 4D4NA 4A2NB 5AC5A 2W9YA 2EILC 3KL4A 4OIRF 3CZ6A 1XZPA 2XLOA 3AGTA 3DM5A 2I15A 2EINC 4FESA 3TOLA 2IXMA 5L3QA 2P7VA 2KC3A 3VM6A 4EWCA 1HMDA 4BJ6C 3O10A 2EIKC 2ASRA 2CW0F 3LJBA 4GQHA 3B0VC 3TJ5A 3FAPB 2VB6A 5FZTA 1AVOB 3V5YA 3ZQVA 3POVA 1BR2A 1JPNA 1LS1A 1RJ9A 2X0CA 4NTAA 2DB4A 4O79A 4NC3A 4K1OA 1I4YA 1J8YF 2ZXPA 1VMAA 4N06A 4J32B 2J0WA 3EH2A 3FOOA 4U5EE 1GGQA 5L3VA 2MHRA 1A7VA 1YARO 3B9QA 1UFBA 5JS5A 2XXAA 2IBFA 2A69F 1H7IA 4IWBA 5T3WA 4YWQA 5BQHA 2UUHA 5K0IA 4U9DA 4LDRA 1PD1A 4E7ZA 5JVEA 2IXPA 1H6GA 2JX0A 3KPHA 3QW0A 4P9FA 3U0CA 4C3DA 2XLMA 3IQ5A 3FVYA 2XS1A 4JJGA 3SXMA 4CS9A 1QLEC 3TJ6A 1FAPB 3Q6NA 1PV3A 3L8JA 1PCXA 4HFKB 3X2QC 2F22A 3H65A 1NLXA 4BJTA 3A9CA 2HJ3A 1ZHWA
chains in the Genus database with same CATH topology
2XLVA 1YZAA 4JEAA 1CGOA 2J8WA 2YLDA 3ZTMA 3ZTZA 5JUAA 4L6RA 4WGZA 3HNLA 4WGYA 3QVZA 3M79A 3ZQYA 2XLHA 3VRCA 1E83A 3HNJA 1YYJA 2CCYA 3M15A 3U8PA 1JAFA 4CIPA 3QW1A 3C63A 4CDYA 2QLAA 4N6HA 4CDVA 2XL6A 1CPRA 2YL1A 3ZWIA 4N4WA 4IARA 1EKYA 1E84A 3TOMA 3DE8A 4U9EA 4IB4A 5JP7A 1APCA 2YL0A 3QVYA 1E86A 2XM0A 3NMKA 5JLIA 3L1MA 1YZCA 2XLDA 3DE9A 4CX9A 4JKVA 3HNIA 4ER9A 1NBBA 4D4NA 3IQ6A 4IAQA 4CDAA 1CPQA 4EIYA 2XLOA 3NMIA 4CJGA 3TOLA 1QPUA 3NMJA 2XM4A 2J9BA 1CGNA 2XL8A 2BC5A 5JT4A 1MQVA 5JRAA 4D4XA 5JSLA 3C62A 5AGFA 1BBHA 1M6TA 4NC3A 2XLEA 3FOOA 1E85A 1A7VA 2XLWA 5JS5A 256BA 1QQ3A 1LM3B 4U9DA 1S05A 3HNKA 5JVEA 1YYXA 4CJOA 3QW0A 4JEBA 1GQAA 2XLMA 3IQ5A 2YLGA 2YL3A 4JE9A 2YL7A 2YKZA 3M4CA 1RCPA 3M4BA 3FOPA 5B3IA 2YLIA 3ZQVA 4ULVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLV A;  1YZA A;  4JEA A;  1CGO A;  2J8W A;  2YLD A;  3ZTM A;  3ZTZ A;  5JUA A;  4L6R A;  4WGZ A;  3HNL A;  4WGY A;  3QVZ A;  3M79 A;  3ZQY A;  2XLH A;  3VRC A;  1E83 A;  3HNJ A;  1YYJ A;  2CCY A;  3M15 A;  3U8P A;  1JAF A;  4CIP A;  3QW1 A;  3C63 A;  4CDY A;  2QLA A;  4N6H A;  4CDV A;  2XL6 A;  1CPR A;  2YL1 A;  3ZWI A;  4N4W A;  4IAR A;  1EKY A;  1E84 A;  3TOM A;  3DE8 A;  4U9E A;  4IB4 A;  5JP7 A;  1APC A;  2YL0 A;  3QVY A;  1E86 A;  2XM0 A;  3NMK A;  5JLI A;  3L1M A;  1YZC A;  2XLD A;  3DE9 A;  4CX9 A;  4JKV A;  3HNI A;  4ER9 A;  1NBB A;  4D4N A;  3IQ6 A;  4IAQ A;  4CDA A;  1CPQ A;  4EIY A;  2XLO A;  3NMI A;  4CJG A;  3TOL A;  1QPU A;  3NMJ A;  2XM4 A;  2J9B A;  1CGN A;  2XL8 A;  2BC5 A;  5JT4 A;  1MQV A;  5JRA A;  4D4X A;  5JSL A;  3C62 A;  5AGF A;  1BBH A;  1M6T A;  4NC3 A;  2XLE A;  3FOO A;  1E85 A;  1A7V A;  2XLW A;  5JS5 A;  256B A;  1QQ3 A;  1LM3 B;  4U9D A;  1S05 A;  3HNK A;  5JVE A;  1YYX A;  4CJO A;  3QW0 A;  4JEB A;  1GQA A;  2XLM A;  3IQ5 A;  2YLG A;  2YL3 A;  4JE9 A;  2YL7 A;  2YKZ A;  3M4C A;  1RCP A;  3M4B A;  3FOP A;  5B3I A;  2YLI A;  3ZQV A;  4ULV A; 
#chains in the Genus database with same CATH topology
 3SNH A;  1VTM P;  1M2O A;  2XLV A;  4IGG A;  5DQZ A;  3ZC4 A;  1CGO A;  2L81 A;  2OQM A;  2Q9B A;  4XQ1 A;  2R7T A;  3ZIB A;  2PP4 A;  3U5S A;  1ZU4 A;  2AVK A;  3FXH A;  4C7O A;  1FFT C;  2D5R B;  3K1H A;  3C18 A;  1M2V B;  1T6U A;  3QVZ A;  4AL1 A;  5KYY A;  3FDQ A;  4OIQ F;  4WAB A;  2VCC A;  3O6X A;  5CIV A;  1D0Z A;  2WL8 A;  4LAC B;  4H4K C;  3U9J A;  4EBB A;  1A0B A;  2R7R A;  3PDM P;  1ZVZ A;  1WN0 A;  1TFO B;  1TWC A;  1LI5 A;  1YAU O;  1SZI A;  3EZI A;  3KH2 A;  3S29 A;  2JD3 A;  3C8G B;  4CS9 C;  2P61 A;  2G62 A;  3MFN A;  2WB7 A;  2XRH A;  1N1C A;  2PNO A;  4N6H A;  4DXW A;  4YT8 A;  1FNT c;  3MLG A;  1CPR A;  1XZQ A;  3VAY A;  4DJ9 A;  3ZWI A;  3UMI A;  1WOL A;  2HSQ A;  2QTV A;  3US6 A;  3DMD A;  1K04 A;  3K66 A;  2DYS C;  4XLN F;  2YHS A;  3GOR A;  4MS2 A;  3NG1 A;  4X0R A;  3X1O A;  3TOM A;  1ZU5 A;  3U8V A;  4MND A;  3EFO B;  4C3E A;  5L0J A;  2ZXW C;  3AG1 C;  2AWY A;  4DOZ A;  4OIO F;  4ZLC A;  5B1A C;  3OA1 A;  4NY3 A;  2HSB A;  2MYS A;  3MBG A;  4FWV A;  4U5F E;  2C04 A;  2P0N A;  3G50 A;  2J9W A;  3Q6M A;  5KYN A;  3V5Z A;  1DOV A;  2YL0 A;  3C7J A;  3QVY A;  1HE9 A;  3J06 A;  2PF4 E;  1R4T A;  3LAY A;  1WAS A;  1O3U A;  2HUJ A;  5L0I A;  1IZM A;  1ST6 A;  1MNE A;  2HZ8 A;  1FFH A;  4YJW A;  2Q3T A;  4NTB A;  2UUI A;  2NSF A;  2W4M A;  3SXY A;  4EBJ A;  4MQ9 F;  5KYX B;  2PX0 A;  1NU9 C;  1UG7 A;  2LIG A;  1IW7 F;  3MX3 A;  2VC9 A;  3EGX B;  1SYQ A;  3EHN A;  3DM9 B;  4R32 A;  4U5C E;  4JCZ A;  3LES A;  1C02 A;  1YLM A;  4FAP B;  1Y6D A;  1OCO C;  2CNW D;  2KW3 C;  2X51 A;  3F46 A;  3JTL O;  2RD9 A;  1CPQ A;  4CDA A;  2NUT B;  3GWL A;  3GWN A;  5COM A;  4CJG A;  4MVR A;  4P9T A;  2G3K A;  4AE4 B;  2Q9C A;  1QPU A;  4I1M A;  3AGU A;  2O9X A;  3BRJ A;  4JIO A;  3U2M A;  2XL8 A;  2BC5 A;  5JT4 A;  1A41 A;  1M57 C;  1NZE A;  3B29 A;  3DJN B;  1LVK A;  2KYH A;  3IEE A;  5JRA A;  3W8I A;  1VYK A;  2Y3G A;  3QTH A;  3UMK A;  3UMH A;  3FHD A;  2P1A A;  5JSL A;  5B3S C;  5DS6 A;  2ZXO A;  1Q0D A;  5AGF A;  1BBH A;  2NUP B;  1ZZP A;  4CBE A;  3NYJ A;  2J46 A;  1YA7 O;  2W4B A;  2WZL A;  1ZHX A;  4UDV A;  1JR8 A;  5A6B A;  4N6C A;  1K40 A;  3S27 A;  4Q4Z F;  2OEX A;  4GYT A;  1E85 A;  2L6F A;  4G78 A;  2R7S A;  2J7P D;  2LK4 A;  4LDQ A;  4CSA A;  4YT5 A;  1VLS A;  4O6N A;  1M2V A;  2P6V A;  1ORY A;  1TR2 A;  1U89 A;  3AQC A;  1T6Q A;  3B0P A;  1QSP A;  2WVO A;  2PBE A;  3DJU B;  3DZA A;  3KKB A;  4XPX A;  3N24 A;  3LNR A;  1MND A;  1YYX A;  1A7E A;  2HMZ A;  1OKK A;  2GA0 A;  2R7Q A;  2YLG A;  5F5H A;  4AK9 A;  3LEV A;  5BQG A;  3EG9 B;  3ASO C;  5BQI A;  2YKZ A;  3M4C A;  3ABL C;  1RCP A;  3AOU A;  4I3M A;  1V4A A;  3RVY A;  1Q0G A;  1V74 B;  1YDI A;  3DKA A;  4BJ5 A;  3AG4 C;  5B3I A;  4MVM A;  4E17 A;  1ZHY A;  2A0B A;  4O7G A;  2L9J A;  2QUP A;  3CAX A;  1OW8 A;  1G4W R;  3LNM B;  4IRU A;  4O6Y A;  3U9M A;  2TMV P;  3W8H A;  5A6J A;  4JTD B;  4MTG A;  1TQG A;  2FGY A;  2OKU A;  3KYI A;  4FX5 A;  4BPM A;  1J8M F;  2KGO A;  2LQG A;  4L6R A;  4WGZ A;  3L8I A;  4K7B A;  3HNL A;  3JRT A;  3EFO A;  4JZA A;  1A7D A;  3CEX A;  1Z3I X;  3EHM A;  4LDK A;  5TJ5 E;  2J9U A;  4CSA C;  1O87 A;  1G8X A;  2KSF A;  3EPV A;  1R5I D;  3ZQY A;  2Y3H A;  1KTM A;  3RQE A;  4PJN A;  1L3P A;  3W2V A;  2NPU A;  2DYR C;  1TWH A;  3HNJ A;  3IQT A;  1YYJ A;  2ICW G;  4CS8 A;  4NQF A;  5AC4 A;  3M15 A;  5A6B D;  4JVS A;  3GAN A;  3NKE A;  2A1D D;  4CDY A;  2PX3 A;  3ZVR A;  2EPK X;  3JSZ A;  1RKE B;  3QZC A;  2EPO A;  4J7Y A;  4BJ5 C;  4PJL A;  2IXN A;  3RYL A;  1ORJ A;  2H7V C;  4NCQ A;  2AWC A;  5A69 A;  2OJQ A;  2PFD A;  1T6I A;  1ZHZ A;  2R05 A;  1LPE A;  1I5N A;  4Z9H A;  1Z6A A;  1E84 A;  1OKK D;  3OEO A;  4YL1 A;  3K7D A;  4U5B E;  1TFK B;  3DAF A;  4BEM J;  2ZD9 A;  3C8G D;  3SZR A;  3PHF 2;  3ATP A;  4XEF A;  2Y39 A;  4B6I A;  4XEV A;  4DRH B;  4DRJ B;  3ZSU A;  1T9K A;  5E33 A;  5L0F A;  4AE4 A;  3GM2 A;  5E3A A;  2NG1 A;  2OOC A;  1ORS C;  3RQG A;  3M1C B;  4XEK A;  3NRH A;  5A6A A;  4KBL A;  3IPM O;  4PFO A;  5L0H A;  1G4U S;  1LIH A;  3SP1 A;  2XM0 A;  2A6E F;  3ASN C;  3HTK C;  2CNW A;  3L1M A;  5E2Q A;  3TK0 A;  4BG0 A;  3W2W A;  1ZW3 A;  1YZC A;  3EJN A;  1U6H A;  4OD5 A;  1PD0 A;  2NUP A;  4XTK A;  4QDL A;  2XLD A;  5IY5 C;  4G7O F;  3PCV A;  4Q5S F;  4CX9 A;  2J45 A;  1O5H A;  4PAC A;  2EIJ C;  3ZDL A;  3N0T A;  3AJM A;  2R7W A;  2CGE A;  1WWP A;  5COF A;  4MVS A;  4A4A A;  3RKO F;  1ZW2 A;  4PFP A;  4MW3 A;  4OIP F;  2Q00 A;  3JRM O;  3NMI A;  2Q7R A;  1BR1 A;  1OXK A;  4E18 A;  4DVY P;  1NFO A;  3NMJ A;  2DI3 A;  2XS8 A;  2R7O A;  2XM4 A;  2AU5 A;  2J9B A;  3DD7 A;  2GWW A;  4MTO A;  1RJ9 B;  4PR9 A;  4U5D E;  2J7P A;  5L0D A;  4QI2 A;  2CYD A;  3EG9 A;  4PK4 A;  3V7O A;  3V5X A;  4D4X A;  5F28 E;  1Z7Q c;  5EGY A;  5EHH A;  2FFH A;  2I8B A;  4DVZ A;  2QNL A;  2ZXR A;  3RF3 A;  1M6T A;  2H7O A;  2V26 A;  3O55 A;  4YK5 A;  5L0G A;  2IYL D;  2LCH A;  1WGW A;  2XXA B;  2KNH A;  3ZG1 A;  3SXZ A;  2XLW A;  3S84 A;  4I1O B;  5D92 A;  4PJM A;  3DI5 A;  3IQC A;  2ZPA A;  2QY9 A;  3GOD A;  1QVX A;  3HLZ A;  3K6B A;  3RW0 A;  2A6H F;  1Z63 A;  1EQ1 A;  2G3V A;  2YRF A;  3HNK A;  4I44 A;  2EPN A;  3H2V A;  4HE8 D;  4CJO A;  4JRZ A;  1D0Y A;  4JEB A;  3OWT A;  4LER A;  2EPM X;  4YN0 B;  1F1M A;  5CI9 A;  2LFF A;  2YL3 A;  3T6B A;  1LS4 A;  2R7U A;  3VYW A;  1SF8 A;  4JC7 A;  5KYW B;  1YVI A;  3E9V A;  2YL7 A;  2R03 A;  3EGD B;  1RMV A;  1T5O A;  3M4B A;  3LLI A;  1EI7 A;  1RKE A;  3DXJ F;  4ULV A;  4DBQ A;  1HE1 A;  1JRA A;  2D4U A;  2VH3 A;  3EH1 A;  1AEP A;  4QI0 A;  1NSG B;  4E7S A;  3ZTM A;  2YLD A;  1JMW A;  3T4R A;  1ZYR F;  1OW7 A;  2VCB A;  2Y3B A;  3ZTZ A;  5JUA A;  4JJF A;  4C7O B;  1MMG A;  2DGJ A;  1GS9 A;  4HFF B;  1JPJ A;  2WVN A;  4WGY A;  3R7C A;  4BJ1 A;  3NYL A;  3N2Z B;  2ETS A;  3UNG C;  4E0H A;  1EA8 A;  4JTA B;  2XLH A;  3AQB A;  4BJ6 A;  3S0X A;  3NDB B;  4C3B A;  2J9V A;  2M4E A;  3KYJ A;  2CCY A;  1GM5 A;  1OCC C;  3U8P A;  1HW1 A;  4JTC B;  4MVO A;  5CI8 A;  1HW2 A;  1B68 A;  4CIP A;  1OR2 A;  2WZF A;  3C63 A;  3QW1 A;  3C8G A;  2RSE B;  3U2L A;  2VCA A;  5GPG B;  3DWW A;  4U5G A;  2XL6 A;  4G7H F;  1VYI A;  1D1B A;  1LE4 A;  4CS7 A;  2YL1 A;  3E70 C;  3SXK A;  1H9G A;  4N4W A;  4IAR A;  4ZLD A;  4JUR I;  1FMW A;  1EKY A;  1FMV A;  1YJG A;  1E2X A;  1D1A A;  1BDJ B;  2Y69 C;  1OR3 A;  2R02 A;  3MYF A;  3ABM C;  2H8A A;  5A6K A;  4MVZ A;  2L6H A;  2XSE A;  4KC9 A;  4IAO A;  1TWG A;  5EK0 A;  4U9E A;  1QKR A;  1T01 A;  1BR4 A;  4CIH A;  1KU2 A;  2Y3D A;  4IB4 A;  4NTF A;  2E87 A;  1AUE A;  5T3T A;  2R7V A;  1LKX A;  3JYY A;  3GEH A;  3GEI A;  3WG7 C;  1V54 C;  4OIN F;  4RBN A;  3T6G B;  5JLI A;  3C8Z A;  1WAT A;  3LUT B;  1QZX A;  4LLC A;  3RVZ A;  1DOW A;  1RKC A;  3DE9 A;  4RD9 A;  3RIP A;  5BUO A;  5KYX A;  2HMQ A;  1V55 C;  3EGX A;  1H9T A;  2HKV A;  1RXQ A;  3HJC A;  2GDC A;  2HV6 A;  1U0B B;  1NG1 A;  1FR0 A;  3S28 A;  4ER9 A;  1VLT A;  3IQ6 A;  1HY5 A;  2BE5 F;  3A11 A;  4KNV A;  2HV7 A;  4IAQ A;  3ECS A;  4JW1 A;  4ANJ A;  3WOD F;  2WZG A;  2YVK A;  4EIY A;  2J0X A;  4EUK B;  2W45 A;  5KYU B;  2HFI A;  4YL3 A;  2NUT A;  4KNW A;  1VOM A;  1LI7 A;  4E0I A;  2WVQ A;  2BL2 A;  3JZ0 A;  1FTS A;  5T1D B;  1CGN A;  1Y4C A;  2B0J A;  3WHN A;  4CS8 C;  4G7Z F;  4MTF A;  3F47 A;  1MQV A;  3GEE A;  1KNY A;  1LE2 A;  2EIM C;  1G5Z A;  3O39 A;  5KYW A;  4XLP F;  3EGD A;  3CSK A;  2LFD A;  3C62 A;  2LSE A;  2R9R B;  5COG A;  4EKW A;  4ONS A;  4LLE A;  2YQY A;  3AG3 C;  2V3C C;  3G4Z A;  1CGM E;  3RQF A;  1Z23 A;  2XLE A;  1M56 C;  3I5Q A;  1OQC A;  2YEV A;  4XPW A;  2KQ9 A;  256B A;  4GEH A;  1K05 A;  3EZH A;  4AX2 A;  1QQ3 A;  2M64 A;  1LM3 B;  1D0X A;  1S05 A;  1ZHT A;  3K33 A;  3T9O A;  4BEJ A;  4XPY A;  3K1I A;  3LS1 A;  1GQA A;  1TKN A;  3KMI A;  3S9O A;  1I4Z A;  1VB5 A;  2YWA A;  4IJJ A;  2OU6 A;  2AP3 A;  4JE9 A;  4XWJ A;  3RFY A;  5HSW A;  2LP4 A;  3U3F A;  3ABK C;  3I4U A;  4MW8 A;  5B1B C;  3FOP A;  5E3C A;  5F5F A;  1S7Z A;  3MYI A;  2YLI A;  3Q7G A;  2CDQ A;  2IOQ A;  3NYM A;  4EBK A;  2KK1 A;  2C03 A;  2YZS A;  3T6J A;  4P6I C;  1YZA A;  1Q0F A;  2A0U A;  2H7B A;  2J8W A;  4JEA A;  2R7X A;  4PJJ A;  1MMA A;  2HJM A;  4Z9I A;  2Q9A A;  2Q4F A;  2JPU A;  3ITF A;  3NKD A;  3B0U X;  1OCR C;  3M79 A;  1YA9 A;  4ULW A;  4MVQ A;  1OXB A;  3TD7 A;  3VRC A;  5DQT A;  4EHP A;  4YT4 A;  2IM8 A;  1D1C A;  1Q0K A;  3H2U A;  4K0D A;  1E83 A;  3K1I C;  2A68 F;  3PMR A;  3JSE O;  3B71 A;  4YL0 A;  4MVU A;  5FCL A;  3W4Y A;  5DS5 A;  5DVW A;  3LS0 A;  4WJ0 A;  3QMK A;  5D91 A;  4YT2 A;  1JAF A;  2NSG A;  5HV9 A;  2L6G A;  2QLA A;  1OW6 A;  2OJE D;  4HEA J;  3VF0 A;  2VAS A;  1C03 A;  4CDV A;  1JOG A;  4J30 B;  3LLK A;  1WTY A;  3UGO A;  2GFH A;  1Z5Z A;  3LEO A;  2IXO A;  2Z15 A;  1MMN A;  3DAG A;  2QE9 A;  4DRI B;  4OD4 A;  3IHU A;  3FAJ A;  4AL0 A;  3HKK A;  4Z9J A;  1BZ4 A;  3U3B A;  3JYH A;  2OEV A;  3SEO A;  3TUL A;  1VK5 A;  3JCU Q;  4H54 A;  4W8P A;  1TWA A;  3DE8 A;  3AG2 C;  3L0I A;  5KYY B;  2R25 A;  2L7A A;  3Q7L A;  5KYU A;  2GAQ A;  4M63 A;  5DS4 A;  3FMS A;  2B0H A;  4Q7C A;  1W2W A;  3RH3 A;  3EQL F;  5JP7 A;  1APC A;  2MWQ A;  5L0C A;  4RDA A;  2HS5 A;  2OCC C;  3WAQ A;  2EPL X;  2OG2 A;  4U5H A;  4W8K A;  1E86 A;  1Q0M A;  3JT1 A;  3UR3 C;  3L34 A;  1MMD A;  1C17 M;  3CQZ A;  3NMK A;  4KI2 A;  1SR2 A;  3R2P A;  3GM3 A;  4O6M A;  5DLJ A;  1NFN A;  4J7T A;  2KJG A;  4F4B A;  1NU7 D;  3I5P A;  3UGP A;  1L7C A;  4G0H A;  3TQO A;  4DBR A;  2XL4 A;  1SMY F;  1OCZ C;  3S90 A;  4JKV A;  2LD6 A;  3G4X A;  2FAP B;  1HMO A;  3BEH A;  1NBB A;  1XWJ A;  3GM1 A;  3HNI A;  4JCH A;  3SYN A;  4D4N A;  4A2N B;  5AC5 A;  2W9Y A;  2EIL C;  3KL4 A;  4OIR F;  3CZ6 A;  1XZP A;  2XLO A;  3AGT A;  3DM5 A;  2I15 A;  2EIN C;  4FES A;  3TOL A;  2IXM A;  5L3Q A;  2P7V A;  2KC3 A;  3VM6 A;  4EWC A;  1HMD A;  4BJ6 C;  3O10 A;  2EIK C;  2ASR A;  2CW0 F;  3LJB A;  4GQH A;  3B0V C;  3TJ5 A;  3FAP B;  2VB6 A;  5FZT A;  1AVO B;  3V5Y A;  3ZQV A;  3POV A;  1BR2 A;  1JPN A;  1LS1 A;  1RJ9 A;  2X0C A;  4NTA A;  2DB4 A;  4O79 A;  4NC3 A;  4K1O A;  1I4Y A;  1J8Y F;  2ZXP A;  1VMA A;  4N06 A;  4J32 B;  2J0W A;  3EH2 A;  3FOO A;  4U5E E;  1GGQ A;  5L3V A;  2MHR A;  1A7V A;  1YAR O;  3B9Q A;  1UFB A;  5JS5 A;  2XXA A;  2IBF A;  2A69 F;  1H7I A;  4IWB A;  5T3W A;  4YWQ A;  5BQH A;  2UUH A;  5K0I A;  4U9D A;  4LDR A;  1PD1 A;  4E7Z A;  5JVE A;  2IXP A;  1H6G A;  2JX0 A;  3KPH A;  3QW0 A;  4P9F A;  3U0C A;  4C3D A;  2XLM A;  3IQ5 A;  3FVY A;  2XS1 A;  4JJG A;  3SXM A;  4CS9 A;  1QLE C;  3TJ6 A;  1FAP B;  3Q6N A;  1PV3 A;  3L8J A;  1PCX A;  4HFK B;  3X2Q C;  2F22 A;  3H65 A;  1NLX A;  4BJT A;  3A9C A;  2HJ3 A;  1ZHW A; 
#chains in the Genus database with same CATH homology
 2XLV A;  1YZA A;  4JEA A;  1CGO A;  2J8W A;  2YLD A;  3ZTM A;  3ZTZ A;  5JUA A;  4L6R A;  4WGZ A;  3HNL A;  4WGY A;  3QVZ A;  3M79 A;  3ZQY A;  2XLH A;  3VRC A;  1E83 A;  3HNJ A;  1YYJ A;  2CCY A;  3M15 A;  3U8P A;  1JAF A;  4CIP A;  3QW1 A;  3C63 A;  4CDY A;  2QLA A;  4N6H A;  4CDV A;  2XL6 A;  1CPR A;  2YL1 A;  3ZWI A;  4N4W A;  4IAR A;  1EKY A;  1E84 A;  3TOM A;  3DE8 A;  4U9E A;  4IB4 A;  5JP7 A;  1APC A;  2YL0 A;  3QVY A;  1E86 A;  2XM0 A;  3NMK A;  5JLI A;  3L1M A;  1YZC A;  2XLD A;  3DE9 A;  4CX9 A;  4JKV A;  3HNI A;  4ER9 A;  1NBB A;  4D4N A;  3IQ6 A;  4IAQ A;  4CDA A;  1CPQ A;  4EIY A;  2XLO A;  3NMI A;  4CJG A;  3TOL A;  1QPU A;  3NMJ A;  2XM4 A;  2J9B A;  1CGN A;  2XL8 A;  2BC5 A;  5JT4 A;  1MQV A;  5JRA A;  4D4X A;  5JSL A;  3C62 A;  5AGF A;  1BBH A;  1M6T A;  4NC3 A;  2XLE A;  3FOO A;  1E85 A;  1A7V A;  2XLW A;  5JS5 A;  256B A;  1QQ3 A;  1LM3 B;  4U9D A;  1S05 A;  3HNK A;  5JVE A;  1YYX A;  4CJO A;  3QW0 A;  4JEB A;  1GQA A;  2XLM A;  3IQ5 A;  2YLG A;  2YL3 A;  4JE9 A;  2YL7 A;  2YKZ A;  3M4C A;  1RCP A;  3M4B A;  3FOP A;  5B3I A;  2YLI A;  3ZQV A;  4ULV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...