2YLDA

Recombinant native cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound at 1.25 a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2yldA00
5JS5A 3M79A 2XLHA 3FOPA 4N6HA 4JEBA 1LM3B 1EKYA 3L1MA 5JLIA 3ZQYA 5JUAA 3HNLA 3HNIA 5B3IA 2YL3A 4NC3A 3ZTMA 4CDVA 4L6RA 1E84A 2XLVA 3M15A 3ZTZA 4ER9A 3VRCA 2CCYA 3QW1A 1CGNA 2XL6A 3U8PA 2XLEA 4CJGA 1E86A 2J8WA 4WGZA 3QW0A 2XM0A 4CJOA 2QLAA 3TOMA 4EIYA 2XLOA 2YL0A 3ZWIA 4JE9A 3DE8A 4JEAA 3IQ6A 5AGFA 1JAFA 1APCA 5JVEA 4IARA 1CPQA 3TOLA 3QVZA 3C62A 3M4BA 1YZCA 3IQ5A 4U9EA 1RCPA 3NMKA 1QPUA 2XLMA 2YL7A 4D4NA 1E83A 2XLWA 4IB4A 4ULVA 1GQAA 1M6TA 3C63A 2XL8A 1QQ3A 4CIPA 4N4WA 1YYXA 2YLDA 3NMJA 1BBHA 1CPRA 1CGOA 4IAQA 4WGYA 4CDYA 3FOOA 4CDAA 3HNJA 256BA 4D4XA 1NBBA 3ZQVA 2XLDA 4CX9A 2YL1A 1E85A 2YLIA 5JT4A 2YKZA 1YZAA 5JP7A 1S05A 3HNKA 5JSLA 1YYJA 3QVYA 5JRAA 2J9BA 2BC5A 3DE9A 2XM4A 1A7VA 4U9DA 1MQVA 3M4CA 3NMIA 4JKVA 2YLGA
chains in the Genus database with same CATH superfamily
3AQCA 4E0IA 4CIHA 1A41A 3CQZA 4JURI 1ZHYA 3M79A 3ABKC 4JRZA 4PJMA 4OIRF 3EFOA 3KYIA 3RH3A 2ZXWC 4EBKA 1KNYA 2JPUA 4IRUA 4BJ5C 2A6EF 1ORYA 2G62A 2H7BA 2HUJA 2JX0A 3KYJA 4MW8A 3N24A 3U2MA 4YL1A 5JUAA 4ONSA 1WASA 5B3IA 4OINF 1T9KA 4DOZA 1D0YA 3DWWA 4NC3A 1Z23A 2YVKA 3H2VA 3A11A 1F1MA 1BDJB 1T6UA 2CW0F 4DBRA 2J7PD 4IGGA 4XEKA 4YJWA 1JMWA 1ZZPA 2XLVA 4RD9A 2Q9CA 1ZVZA 2AP3A 4MTFA 1RKCA 3IQTA 1T6IA 4CSAA 3VRCA 2J9VA 4CS8A 2CCYA 3SP1A 3LUTB 1I5NA 3V7OA 2ZXOA 4C3BA 2VCAA 1YJGA 3HKKA 3MYFA 2J0XA 3S90A 1PD0A 3AG3C 1JPNA 2F22A 1LS4A 1LIHA 1UFBA 1YAUO 2OEXA 3C7JA 3GWNA 4GYTA 2WZGA 4Z9IA 1QKRA 2BE5F 3QW0A 3T6GB 4A2NB 1Q0MA 2OOCA 3NYLA 1H7IA 3TOMA 2DYSC 3TQOA 2D5RB 4IJJA 1PD1A 1OR3A 4YL0A 1BR1A 1V55C 4XWJA 4BJ6A 2XXAA 1TR2A 1IW7F 3Q6NA 5CI8A 4JE9A 3FAPB 4QI2A 1CGME 4Q5SF 1ZU5A 3RQGA 2A0BA 4DXWA 5JVEA 4IARA 5A6BA 2B0HA 5L0IA 1CPQA 1VYKA 5L3VA 4I1MA 2L7AA 2LD6A 2VCCA 4CS7A 1OW6A 3G4XA 2KYHA 3W4YA 3C62A 1O3UA 1AVOB 3QVZA 1U6HA 4GQHA 1YZCA 3IQ5A 4JCZA 4PACA 4U9EA 5E2QA 1RCPA 3OA1A 4I44A 5BQHA 2EIKC 2I8BA 4O79A 2PP4A 5KYXB 2W9YA 1ZHWA 1D1CA 1J8YF 3QTHA 2XLWA 3X1OA 4N6CA 4Z9HA 1TWCA 1GQAA 2ETSA 2PF4E 4LDRA 1KTMA 3POVA 3C63A 3WODF 2KSFA 2XL8A 5EGYA 4FESA 4HEAJ 2OQMA 4YWQA 1QQ3A 1K40A 3OWTA 4MTOA 1EI7A 3DZAA 4N4WA 2J45A 3GANA 4FX5A 4DVYP 3ZG1A 3JRTA 3RYLA 1BBHA 4IAOA 5CIVA 5F5FA 3WAQA 2QE9A 3LLIA 1LS1A 4GEHA 4FAPB 1WATA 2Q9BA 1ORSC 3JYHA 4QDLA 3EGDA 3GM2A 4CSAC 1Z3IX 3HNJA 4CS8C 3U2LA 4D4XA 1OKKA 4PR9A 4CX9A 2LQGA 3AG1C 3KL4A 1G4WR 2R7QA 3AGTA 2VCBA 3K1HA 4BJ5A 1GS9A 3A9CA 1Q0GA 3JRMO 3EGXA 2AWCA 1E2XA 1DOVA 4IWBA 3NRHA 1LI7A 1Z6AA 5JP7A 2P6VA 2YRFA 2R7WA 3MLGA 3S28A 1IZMA 3JT1A 1TFOB 1VYIA 4KNWA 3T6JA 4AK9A 4BEJA 5B1BC 3I5PA 2R7OA 2HSQA 3DI5A 5EHHA 5JRAA 1RJ9B 2J9BA 1ZW2A 2PX3A 3L8IA 4YK5A 1YA7O 2X0CA 3J06A 2HMZA 1BZ4A 5KYYB 4UDVA 2XM4A 3T6BA 3DMDA 4YN0B 1G4US 4JKVA 1M57C 5JS5A 2Y69C 3LS1A 3BRJA 2A1DD 3K66A 3F47A 2XLHA 3FOPA 2IBFA 4N6HA 4JEBA 5COMA 4U5FE 1LM3B 3NYMA 3VAYA 4EUKB 1MMAA 2EPLX 2VH3A 4I3MA 4LLCA 4JTCB 2L6FA 2ASRA 1ZHTA 2XRHA 3R7CA 3UGOA 4DVZA 5KYNA 1ZU4A 3ZQYA 1TWAA 2KC3A 5KYUA 3HNIA 1VOMA 3SNHA 3DM5A 4LDQA 3TJ5A 2G3VA 1M56C 3JTLO 2NUTB 3RVZA 4Q4ZF 3EG9B 2Y3DA 1RKEA 4JC7A 5K0IA 2H8AA 1WOLA 2DGJA 1FTSA 1VLTA 4ER9A 3OEOA 3RVYA 4DJ9A 1Q0DA 2W4BA 3LESA 2XL6A 1B68A 2OJQA 4E7SA 1E86A 2J8WA 3KPHA 2A68F 4AE4B 3U9MA 3NKEA 4C3DA 1T6QA 5D92A 3U3FA 2PBEA 2W45A 4EIYA 4JVSA 1KU2A 4E0HA 1U89A 2EILC 2NPUA 1OXBA 1NZEA 1BR2A 2MWQA 3IPMO 3RFYA 3NDBB 2XL4A 2OKUA 3JCUQ 4MS2A 4ANJA 2IXNA 2P1AA 5COGA 5AGFA 2EIJC 4PJNA 1WN0A 3O55A 1H9GA 4K7BA 4U5BE 5D91A 1FR0A 1APCA 1LE4A 1TFKB 1M2VB 2R9RB 4RBNA 1D1BA 4HFFB 5A6JA 3O39A 3IQCA 2PFDA 2W4MA 1YA9A 3DKAA 3Q6MA 3TOLA 1LVKA 2Z15A 3CZ6A 3KMIA 2EPMX 3PMRA 1O87A 3SXYA 2XLMA 1L3PA 1Q0KA 2OCCC 2G3KA 4CS9C 2ZD9A 2UUHA 3AQBA 3JYYA 4P9FA 2BL2A 2L81A 3FMSA 4O6NA 2L6GA 4U5CE 1H6GA 2AWYA 2A69F 2HJ3A 2LFDA 4HE8D 4B6IA 1LE2A 4BJ1A 3JSZA 1PV3A 2EPKX 2Y3GA 2QUPA 3AJMA 1T5OA 3GWLA 3ATPA 4MVRA 3SZRA 4N06A 4CIPA 3NG1A 3E70C 3NMJA 4NCQA 3UMIA 1NU9C 4XEFA 2QY9A 1XZPA 2P7VA 2YWAA 5DS6A 2R7VA 2FFHA 2C03A 1SYQA 2HZ8A 5E3AA 4CDYA 3UMHA 2ICWG 2KW3C 3FOOA 4CDAA 4OIQF 2FAPB 3CAXA 2I15A 2R05A 2CYDA 3C8GB 2GWWA 3B71A 4MVMA 2YL1A 3B29A 4C7OB 1J8MF 3R2PA 3LEOA 3EZIA 5JT4A 4E18A 4J32B 1XZQA 4LLEA 5FCLA 2HFIA 1C17M 1XWJA 1YZAA 3AOUA 1HMDA 3GM3A 4EHPA 5L3QA 1Y6DA 1YARO 2DYRC 3ZVRA 5E3CA 4MVUA 5KYWB 5JSLA 1S7ZA 1UG7A 3KH2A 3QVYA 2GFHA 3RKOF 2R7SA 3C8GD 1SMYF 4PK4A 2B0JA 3EFOB 1JR8A 1OCRC 2BC5A 2GDCA 2Q00A 5CI9A 4U9DA 2TMVP 2A6HF 1MQVA 2IM8A 3TK0A 3ZC4A 1I4YA 4G7HF 2ZPAA 4DRHB 2YL0A 2LFFA 2NUPA 2GAQA 1A7DA 1MNDA 2GA0A 2D4UA 1YLMA 1QLEC 1WWPA 4W8PA 4CBEA 3GEHA 4YT2A 5L0JA 4KI2A 1V4AA 2Y3HA 2R7RA 2IOQA 3F46A 4YT5A 5DS4A 5T3TA 2DB4A 3S27A 2WVQA 4U5HA 1FAPB 4MVSA 2Q7RA 2OEVA 3CSKA 2R7TA 4MTGA 5JLIA 3IEEA 4OIOF 5B3SC 3EH2A 1FMWA 4H54A 2P61A 3I5QA 2NSFA 4OD5A 3JSEO 4W8KA 1QSPA 4EBBA 2YL3A 4XLNF 1ZHZA 3RF3A 2J7PA 2J9WA 2ZXPA 2CGEA 3FXHA 4NTFA 1NFOA 1RXQA 3TJ6A 3X2QC 4K0DA 4L6RA 4P6IC 4CDVA 1VB5A 4E17A 3S84A 3SXKA 5L0GA 3O6XA 4Z9JA 1HE1A 2Q3TA 4RDAA 3T4RA 3ZIBA 2LK4A 3C8ZA 3DAGA 3V5XA 3ZTZA 4XPWA 3QMKA 1D1AA 2XXAB 3QW1A 3SEOA 1HW1A 2PNOA 2WZLA 4O6MA 3T9OA 4CS9A 1G5ZA 2NSGA 1OXKA 2IXOA 4FWVA 4LERA 4WGZA 3U8PA 3W2WA 2AU5A 4DBQA 3M1CB 3LAYA 3EQLF 3EHNA 2XM0A 3B0UX 4A4AA 2EINC 3LEVA 4JW1A 3EZHA 4YL3A 3U3BA 1JRAA 2XLOA 3RW0A 4P9TA 3TD7A 2EIMC 4U5DE 3U8VA 3K6BA 3ZWIA 3DE8A 1JOGA 4JEAA 2CNWD 4XPXA 2P0NA 3LNRA 2LSEA 1HW2A 2R02A 4NTBA 1FFHA 1QZXA 4XPYA 4DRJB 4MNDA 1L7CA 2MHRA 1Z5ZA 3ITFA 3L0IA 4ZLCA 4OD4A 4MVOA 4C3EA 2KGOA 1O5HA 4O7GA 1Q0FA 4J7TA 4K1OA 1NSGB 1W2WA 2WVOA 5A6KA 1FMVA 2V26A 1MMNA 3FHDA 1YDIA 4HFKB 1E83A 2M64A 3VM6A 4JIOA 4XLPF 2RSEB 4I1OB 4BPMA 1WGWA 2YZSA 3I4UA 2IYLD 2OJED 4MVZA 3SYNA 4ULVA 1R5ID 2HJMA 2VC9A 3DD7A 1M6TA 2LP4A 1HE9A 3H2UA 5TJ5E 3C8GA 1V54C 1ZYRF 2YHSA 2X51A 2ZXRA 4C7OA 5KYXA 5HSWA 2M4EA 1G8XA 1OCOC 5BQIA 3EJNA 4AX2A 1YYXA 2YLDA 4JTDB 1OCCC 2A0UA 3MX3A 3VYWA 1LI5A 4E7ZA 1K05A 3DM9B 3EGXB 3PCVA 4IAQA 2EPNA 4G78A 4F4BA 4YT4A 5KYWA 4WGYA 4KC9A 4U5GA 3E9VA 3GODA 2HS5A 1D0ZA 2VASA 5AC4A 1TWGA 256BA 1NBBA 3ZQVA 2YEVA 4EBJA 1H9TA 2Q4FA 2WZFA 1LPEA 1WTYA 1EA8A 1OKKD 1OQCA 2MYSA 2XSEA 3LS0A 3JZ0A 2R03A 1K04A 1MMGA 2WB7A 3N0TA 1S05A 3NKDA 2NG1A 4XTKA 2J0WA 3WHNA 5DQTA 3GEIA 2OU6A 3H65A 3TULA 1YYJA 1PCXA 4NTAA 3HTKC 5DS5A 5F5HA 3L8JA 3HLZA 1OW7A 3DE9A 1EQ1A 3AG4C 3V5ZA 1QVXA 1MNEA 3HJCA 3S0XA 3M4CA 2DI3A 2R25A 2YLGA 3GM1A 2O9XA 3UGPA 5KYUB 4O6YA 3AGUA 1RJ9A 3UMKA 2L9JA 1HMOA 1OCZC 3QZCA 5KYYA 4MQ9F 2VB6A 1RKEB 4U5EE 1EKYA 3B0PA 3V5YA 1GM5A 1M2OA 1MMDA 3L1MA 1A0BA 3Q7LA 4NQFA 3US6A 3B0VC 1VLSA 2RD9A 2CNWA 3PHF2 3HNLA 2XS1A 2Y39A 5AC5A 3EH1A 5BUOA 3ZTMA 2QTVA 4ZLDA 3ASOC 4X0RA 3GORA 3SXZA 4PFOA 3S29A 3ABMC 3U0CA 1TKNA 2Y3BA 1VK5A 1NFNA 2HMQA 1SZIA 1E84A 4G7OF 1JPJA 3B9QA 1ZHXA 5L0FA 3M15A 5A69A 5A6AA 1D0XA 2KNHA 5DLJA 3C18A 2R7UA 2WL8A 3N2ZB 3DAFA 4XEVA 1CGNA 2CDQA 5B1AC 2HV6A 2JD3A 5F28E 2NUTA 2XLEA 3EG9A 3GEEA 3W2VA 3DJNB 4CJGA 4G7ZF 1YVIA 2HKVA 3UNGC 3W8HA 2KJGA 2J9UA 4YT8A 3LNMB 3L34A 4CJOA 2WVNA 3ZSUA 4BJTA 5T1DB 3IHUA 2QLAA 3CEXA 4JJFA 1NU7D 3LJBA 3ABLC 4M63A 4LDKA 3AG2C 3IQ6A 1SF8A 3K1IA 2V3CC 1JAFA 2E87A 4AE4A 4Q7CA 1C02A 4J7YA 4MW3A 4JTAB 5HV9A 1A7EA 2OG2A 5EK0A 2J46A 5L0HA 3WG7C 2LCHA 3U5SA 2HSBA 3ASNC 3M4BA 3Q7GA 3PDMP 2AVKA 2H7VC 3UR3C 2Q9AA 1ORJA 1Y4CA 3FVYA 3NMKA 4JZAA 1QPUA 4XQ1A 2YL7A 2H7OA 4D4NA 4KNVA 4AL1A 1LKXA 4NY3A 1M2VA 4AL0A 4JCHA 3VF0A 4IB4A 2IXPA 4ULWA 4H4KC 3NYJA 3O10A 1R4TA 2C04A 2QNLA 3LLKA 3MYIA 3RQEA 2L6HA 1AUEA 1HY5A 1SR2A 4WABA 3G50A 4EWCA 5E33A 3EPVA 2YQYA 4KBLA 4G0HA 5DVWA 1N1CA 5BQGA 3RQFA 4BJ6C 5IY5C 1ZW3A 4BG0A 1U0BB 3G4ZA 3MBGA 3EHMA 1T01A 5DQZA 1FNTc 3RIPA 5FZTA 4PJJA 1CPRA 2FGYA 5T3WA 3FDQA 1CGOA 4PFPA 1VMAA 3DXJF 2XS8A 2EPOA 2KQ9A 3K33A 4WJ0A 5A6BD 1NG1A 2IXMA 2KK1A 1OR2A 4MVQA 3DJUB 2XLDA 4JJGA 1VTMP 1E85A 2YLIA 5L0DA 1RMVA 1OW8A 4EKWA 4DRIB 1NLXA 3W8IA 3SXMA 1C03A 2YKZA 4PJLA 3ECSA 4R32A 2UUIA 3ZDLA 5L0CA 4QI0A 1TWHA 3U9JA 1GGQA 2NUPB 3MFNA 1DOWA 3HNKA 1V74B 5GPGB 1Z7Qc 1BR4A 4BEMJ 3BEHA 2PX0A 4LACB 3EGDB 3S9OA 1Z63A 1I4ZA 1AEPA 3FAJA 3K1IC 3KKBA 2LIGA 1A7VA 5COFA 4OIPF 2HV7A 4J30B 1TQGA 3NMIA 2R7XA 1FFTC 1ST6A 3K7DA
chains in the Genus database with same CATH topology
5JS5A 3M79A 2XLHA 3FOPA 4N6HA 4JEBA 1LM3B 1EKYA 3L1MA 5JLIA 3ZQYA 5JUAA 3HNLA 3HNIA 5B3IA 2YL3A 4NC3A 3ZTMA 4CDVA 4L6RA 1E84A 2XLVA 3M15A 3ZTZA 4ER9A 3VRCA 2CCYA 3QW1A 1CGNA 2XL6A 3U8PA 2XLEA 4CJGA 1E86A 2J8WA 4WGZA 3QW0A 2XM0A 4CJOA 2QLAA 3TOMA 4EIYA 2XLOA 2YL0A 3ZWIA 4JE9A 3DE8A 4JEAA 3IQ6A 5AGFA 1JAFA 1APCA 5JVEA 4IARA 1CPQA 3TOLA 3QVZA 3C62A 3M4BA 1YZCA 3IQ5A 4U9EA 1RCPA 3NMKA 1QPUA 2XLMA 2YL7A 4D4NA 1E83A 2XLWA 4IB4A 4ULVA 1GQAA 1M6TA 3C63A 2XL8A 1QQ3A 4CIPA 4N4WA 1YYXA 2YLDA 3NMJA 1BBHA 1CPRA 1CGOA 4IAQA 4WGYA 4CDYA 3FOOA 4CDAA 3HNJA 256BA 4D4XA 1NBBA 3ZQVA 2XLDA 4CX9A 2YL1A 1E85A 2YLIA 5JT4A 2YKZA 1YZAA 5JP7A 1S05A 3HNKA 5JSLA 1YYJA 3QVYA 5JRAA 2J9BA 2BC5A 3DE9A 2XM4A 1A7VA 4U9DA 1MQVA 3M4CA 3NMIA 4JKVA 2YLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JS5 A;  3M79 A;  2XLH A;  3FOP A;  4N6H A;  4JEB A;  1LM3 B;  1EKY A;  3L1M A;  5JLI A;  3ZQY A;  5JUA A;  3HNL A;  3HNI A;  5B3I A;  2YL3 A;  4NC3 A;  3ZTM A;  4CDV A;  4L6R A;  1E84 A;  2XLV A;  3M15 A;  3ZTZ A;  4ER9 A;  3VRC A;  2CCY A;  3QW1 A;  1CGN A;  2XL6 A;  3U8P A;  2XLE A;  4CJG A;  1E86 A;  2J8W A;  4WGZ A;  3QW0 A;  2XM0 A;  4CJO A;  2QLA A;  3TOM A;  4EIY A;  2XLO A;  2YL0 A;  3ZWI A;  4JE9 A;  3DE8 A;  4JEA A;  3IQ6 A;  5AGF A;  1JAF A;  1APC A;  5JVE A;  4IAR A;  1CPQ A;  3TOL A;  3QVZ A;  3C62 A;  3M4B A;  1YZC A;  3IQ5 A;  4U9E A;  1RCP A;  3NMK A;  1QPU A;  2XLM A;  2YL7 A;  4D4N A;  1E83 A;  2XLW A;  4IB4 A;  4ULV A;  1GQA A;  1M6T A;  3C63 A;  2XL8 A;  1QQ3 A;  4CIP A;  4N4W A;  1YYX A;  2YLD A;  3NMJ A;  1BBH A;  1CPR A;  1CGO A;  4IAQ A;  4WGY A;  4CDY A;  3FOO A;  4CDA A;  3HNJ A;  256B A;  4D4X A;  1NBB A;  3ZQV A;  2XLD A;  4CX9 A;  2YL1 A;  1E85 A;  2YLI A;  5JT4 A;  2YKZ A;  1YZA A;  5JP7 A;  1S05 A;  3HNK A;  5JSL A;  1YYJ A;  3QVY A;  5JRA A;  2J9B A;  2BC5 A;  3DE9 A;  2XM4 A;  1A7V A;  4U9D A;  1MQV A;  3M4C A;  3NMI A;  4JKV A;  2YLG A; 
#chains in the Genus database with same CATH topology
 3AQC A;  4E0I A;  4CIH A;  1A41 A;  3CQZ A;  4JUR I;  1ZHY A;  3M79 A;  3ABK C;  4JRZ A;  4PJM A;  4OIR F;  3EFO A;  3KYI A;  3RH3 A;  2ZXW C;  4EBK A;  1KNY A;  2JPU A;  4IRU A;  4BJ5 C;  2A6E F;  1ORY A;  2G62 A;  2H7B A;  2HUJ A;  2JX0 A;  3KYJ A;  4MW8 A;  3N24 A;  3U2M A;  4YL1 A;  5JUA A;  4ONS A;  1WAS A;  5B3I A;  4OIN F;  1T9K A;  4DOZ A;  1D0Y A;  3DWW A;  4NC3 A;  1Z23 A;  2YVK A;  3H2V A;  3A11 A;  1F1M A;  1BDJ B;  1T6U A;  2CW0 F;  4DBR A;  2J7P D;  4IGG A;  4XEK A;  4YJW A;  1JMW A;  1ZZP A;  2XLV A;  4RD9 A;  2Q9C A;  1ZVZ A;  2AP3 A;  4MTF A;  1RKC A;  3IQT A;  1T6I A;  4CSA A;  3VRC A;  2J9V A;  4CS8 A;  2CCY A;  3SP1 A;  3LUT B;  1I5N A;  3V7O A;  2ZXO A;  4C3B A;  2VCA A;  1YJG A;  3HKK A;  3MYF A;  2J0X A;  3S90 A;  1PD0 A;  3AG3 C;  1JPN A;  2F22 A;  1LS4 A;  1LIH A;  1UFB A;  1YAU O;  2OEX A;  3C7J A;  3GWN A;  4GYT A;  2WZG A;  4Z9I A;  1QKR A;  2BE5 F;  3QW0 A;  3T6G B;  4A2N B;  1Q0M A;  2OOC A;  3NYL A;  1H7I A;  3TOM A;  2DYS C;  3TQO A;  2D5R B;  4IJJ A;  1PD1 A;  1OR3 A;  4YL0 A;  1BR1 A;  1V55 C;  4XWJ A;  4BJ6 A;  2XXA A;  1TR2 A;  1IW7 F;  3Q6N A;  5CI8 A;  4JE9 A;  3FAP B;  4QI2 A;  1CGM E;  4Q5S F;  1ZU5 A;  3RQG A;  2A0B A;  4DXW A;  5JVE A;  4IAR A;  5A6B A;  2B0H A;  5L0I A;  1CPQ A;  1VYK A;  5L3V A;  4I1M A;  2L7A A;  2LD6 A;  2VCC A;  4CS7 A;  1OW6 A;  3G4X A;  2KYH A;  3W4Y A;  3C62 A;  1O3U A;  1AVO B;  3QVZ A;  1U6H A;  4GQH A;  1YZC A;  3IQ5 A;  4JCZ A;  4PAC A;  4U9E A;  5E2Q A;  1RCP A;  3OA1 A;  4I44 A;  5BQH A;  2EIK C;  2I8B A;  4O79 A;  2PP4 A;  5KYX B;  2W9Y A;  1ZHW A;  1D1C A;  1J8Y F;  3QTH A;  2XLW A;  3X1O A;  4N6C A;  4Z9H A;  1TWC A;  1GQA A;  2ETS A;  2PF4 E;  4LDR A;  1KTM A;  3POV A;  3C63 A;  3WOD F;  2KSF A;  2XL8 A;  5EGY A;  4FES A;  4HEA J;  2OQM A;  4YWQ A;  1QQ3 A;  1K40 A;  3OWT A;  4MTO A;  1EI7 A;  3DZA A;  4N4W A;  2J45 A;  3GAN A;  4FX5 A;  4DVY P;  3ZG1 A;  3JRT A;  3RYL A;  1BBH A;  4IAO A;  5CIV A;  5F5F A;  3WAQ A;  2QE9 A;  3LLI A;  1LS1 A;  4GEH A;  4FAP B;  1WAT A;  2Q9B A;  1ORS C;  3JYH A;  4QDL A;  3EGD A;  3GM2 A;  4CSA C;  1Z3I X;  3HNJ A;  4CS8 C;  3U2L A;  4D4X A;  1OKK A;  4PR9 A;  4CX9 A;  2LQG A;  3AG1 C;  3KL4 A;  1G4W R;  2R7Q A;  3AGT A;  2VCB A;  3K1H A;  4BJ5 A;  1GS9 A;  3A9C A;  1Q0G A;  3JRM O;  3EGX A;  2AWC A;  1E2X A;  1DOV A;  4IWB A;  3NRH A;  1LI7 A;  1Z6A A;  5JP7 A;  2P6V A;  2YRF A;  2R7W A;  3MLG A;  3S28 A;  1IZM A;  3JT1 A;  1TFO B;  1VYI A;  4KNW A;  3T6J A;  4AK9 A;  4BEJ A;  5B1B C;  3I5P A;  2R7O A;  2HSQ A;  3DI5 A;  5EHH A;  5JRA A;  1RJ9 B;  2J9B A;  1ZW2 A;  2PX3 A;  3L8I A;  4YK5 A;  1YA7 O;  2X0C A;  3J06 A;  2HMZ A;  1BZ4 A;  5KYY B;  4UDV A;  2XM4 A;  3T6B A;  3DMD A;  4YN0 B;  1G4U S;  4JKV A;  1M57 C;  5JS5 A;  2Y69 C;  3LS1 A;  3BRJ A;  2A1D D;  3K66 A;  3F47 A;  2XLH A;  3FOP A;  2IBF A;  4N6H A;  4JEB A;  5COM A;  4U5F E;  1LM3 B;  3NYM A;  3VAY A;  4EUK B;  1MMA A;  2EPL X;  2VH3 A;  4I3M A;  4LLC A;  4JTC B;  2L6F A;  2ASR A;  1ZHT A;  2XRH A;  3R7C A;  3UGO A;  4DVZ A;  5KYN A;  1ZU4 A;  3ZQY A;  1TWA A;  2KC3 A;  5KYU A;  3HNI A;  1VOM A;  3SNH A;  3DM5 A;  4LDQ A;  3TJ5 A;  2G3V A;  1M56 C;  3JTL O;  2NUT B;  3RVZ A;  4Q4Z F;  3EG9 B;  2Y3D A;  1RKE A;  4JC7 A;  5K0I A;  2H8A A;  1WOL A;  2DGJ A;  1FTS A;  1VLT A;  4ER9 A;  3OEO A;  3RVY A;  4DJ9 A;  1Q0D A;  2W4B A;  3LES A;  2XL6 A;  1B68 A;  2OJQ A;  4E7S A;  1E86 A;  2J8W A;  3KPH A;  2A68 F;  4AE4 B;  3U9M A;  3NKE A;  4C3D A;  1T6Q A;  5D92 A;  3U3F A;  2PBE A;  2W45 A;  4EIY A;  4JVS A;  1KU2 A;  4E0H A;  1U89 A;  2EIL C;  2NPU A;  1OXB A;  1NZE A;  1BR2 A;  2MWQ A;  3IPM O;  3RFY A;  3NDB B;  2XL4 A;  2OKU A;  3JCU Q;  4MS2 A;  4ANJ A;  2IXN A;  2P1A A;  5COG A;  5AGF A;  2EIJ C;  4PJN A;  1WN0 A;  3O55 A;  1H9G A;  4K7B A;  4U5B E;  5D91 A;  1FR0 A;  1APC A;  1LE4 A;  1TFK B;  1M2V B;  2R9R B;  4RBN A;  1D1B A;  4HFF B;  5A6J A;  3O39 A;  3IQC A;  2PFD A;  2W4M A;  1YA9 A;  3DKA A;  3Q6M A;  3TOL A;  1LVK A;  2Z15 A;  3CZ6 A;  3KMI A;  2EPM X;  3PMR A;  1O87 A;  3SXY A;  2XLM A;  1L3P A;  1Q0K A;  2OCC C;  2G3K A;  4CS9 C;  2ZD9 A;  2UUH A;  3AQB A;  3JYY A;  4P9F A;  2BL2 A;  2L81 A;  3FMS A;  4O6N A;  2L6G A;  4U5C E;  1H6G A;  2AWY A;  2A69 F;  2HJ3 A;  2LFD A;  4HE8 D;  4B6I A;  1LE2 A;  4BJ1 A;  3JSZ A;  1PV3 A;  2EPK X;  2Y3G A;  2QUP A;  3AJM A;  1T5O A;  3GWL A;  3ATP A;  4MVR A;  3SZR A;  4N06 A;  4CIP A;  3NG1 A;  3E70 C;  3NMJ A;  4NCQ A;  3UMI A;  1NU9 C;  4XEF A;  2QY9 A;  1XZP A;  2P7V A;  2YWA A;  5DS6 A;  2R7V A;  2FFH A;  2C03 A;  1SYQ A;  2HZ8 A;  5E3A A;  4CDY A;  3UMH A;  2ICW G;  2KW3 C;  3FOO A;  4CDA A;  4OIQ F;  2FAP B;  3CAX A;  2I15 A;  2R05 A;  2CYD A;  3C8G B;  2GWW A;  3B71 A;  4MVM A;  2YL1 A;  3B29 A;  4C7O B;  1J8M F;  3R2P A;  3LEO A;  3EZI A;  5JT4 A;  4E18 A;  4J32 B;  1XZQ A;  4LLE A;  5FCL A;  2HFI A;  1C17 M;  1XWJ A;  1YZA A;  3AOU A;  1HMD A;  3GM3 A;  4EHP A;  5L3Q A;  1Y6D A;  1YAR O;  2DYR C;  3ZVR A;  5E3C A;  4MVU A;  5KYW B;  5JSL A;  1S7Z A;  1UG7 A;  3KH2 A;  3QVY A;  2GFH A;  3RKO F;  2R7S A;  3C8G D;  1SMY F;  4PK4 A;  2B0J A;  3EFO B;  1JR8 A;  1OCR C;  2BC5 A;  2GDC A;  2Q00 A;  5CI9 A;  4U9D A;  2TMV P;  2A6H F;  1MQV A;  2IM8 A;  3TK0 A;  3ZC4 A;  1I4Y A;  4G7H F;  2ZPA A;  4DRH B;  2YL0 A;  2LFF A;  2NUP A;  2GAQ A;  1A7D A;  1MND A;  2GA0 A;  2D4U A;  1YLM A;  1QLE C;  1WWP A;  4W8P A;  4CBE A;  3GEH A;  4YT2 A;  5L0J A;  4KI2 A;  1V4A A;  2Y3H A;  2R7R A;  2IOQ A;  3F46 A;  4YT5 A;  5DS4 A;  5T3T A;  2DB4 A;  3S27 A;  2WVQ A;  4U5H A;  1FAP B;  4MVS A;  2Q7R A;  2OEV A;  3CSK A;  2R7T A;  4MTG A;  5JLI A;  3IEE A;  4OIO F;  5B3S C;  3EH2 A;  1FMW A;  4H54 A;  2P61 A;  3I5Q A;  2NSF A;  4OD5 A;  3JSE O;  4W8K A;  1QSP A;  4EBB A;  2YL3 A;  4XLN F;  1ZHZ A;  3RF3 A;  2J7P A;  2J9W A;  2ZXP A;  2CGE A;  3FXH A;  4NTF A;  1NFO A;  1RXQ A;  3TJ6 A;  3X2Q C;  4K0D A;  4L6R A;  4P6I C;  4CDV A;  1VB5 A;  4E17 A;  3S84 A;  3SXK A;  5L0G A;  3O6X A;  4Z9J A;  1HE1 A;  2Q3T A;  4RDA A;  3T4R A;  3ZIB A;  2LK4 A;  3C8Z A;  3DAG A;  3V5X A;  3ZTZ A;  4XPW A;  3QMK A;  1D1A A;  2XXA B;  3QW1 A;  3SEO A;  1HW1 A;  2PNO A;  2WZL A;  4O6M A;  3T9O A;  4CS9 A;  1G5Z A;  2NSG A;  1OXK A;  2IXO A;  4FWV A;  4LER A;  4WGZ A;  3U8P A;  3W2W A;  2AU5 A;  4DBQ A;  3M1C B;  3LAY A;  3EQL F;  3EHN A;  2XM0 A;  3B0U X;  4A4A A;  2EIN C;  3LEV A;  4JW1 A;  3EZH A;  4YL3 A;  3U3B A;  1JRA A;  2XLO A;  3RW0 A;  4P9T A;  3TD7 A;  2EIM C;  4U5D E;  3U8V A;  3K6B A;  3ZWI A;  3DE8 A;  1JOG A;  4JEA A;  2CNW D;  4XPX A;  2P0N A;  3LNR A;  2LSE A;  1HW2 A;  2R02 A;  4NTB A;  1FFH A;  1QZX A;  4XPY A;  4DRJ B;  4MND A;  1L7C A;  2MHR A;  1Z5Z A;  3ITF A;  3L0I A;  4ZLC A;  4OD4 A;  4MVO A;  4C3E A;  2KGO A;  1O5H A;  4O7G A;  1Q0F A;  4J7T A;  4K1O A;  1NSG B;  1W2W A;  2WVO A;  5A6K A;  1FMV A;  2V26 A;  1MMN A;  3FHD A;  1YDI A;  4HFK B;  1E83 A;  2M64 A;  3VM6 A;  4JIO A;  4XLP F;  2RSE B;  4I1O B;  4BPM A;  1WGW A;  2YZS A;  3I4U A;  2IYL D;  2OJE D;  4MVZ A;  3SYN A;  4ULV A;  1R5I D;  2HJM A;  2VC9 A;  3DD7 A;  1M6T A;  2LP4 A;  1HE9 A;  3H2U A;  5TJ5 E;  3C8G A;  1V54 C;  1ZYR F;  2YHS A;  2X51 A;  2ZXR A;  4C7O A;  5KYX A;  5HSW A;  2M4E A;  1G8X A;  1OCO C;  5BQI A;  3EJN A;  4AX2 A;  1YYX A;  2YLD A;  4JTD B;  1OCC C;  2A0U A;  3MX3 A;  3VYW A;  1LI5 A;  4E7Z A;  1K05 A;  3DM9 B;  3EGX B;  3PCV A;  4IAQ A;  2EPN A;  4G78 A;  4F4B A;  4YT4 A;  5KYW A;  4WGY A;  4KC9 A;  4U5G A;  3E9V A;  3GOD A;  2HS5 A;  1D0Z A;  2VAS A;  5AC4 A;  1TWG A;  256B A;  1NBB A;  3ZQV A;  2YEV A;  4EBJ A;  1H9T A;  2Q4F A;  2WZF A;  1LPE A;  1WTY A;  1EA8 A;  1OKK D;  1OQC A;  2MYS A;  2XSE A;  3LS0 A;  3JZ0 A;  2R03 A;  1K04 A;  1MMG A;  2WB7 A;  3N0T A;  1S05 A;  3NKD A;  2NG1 A;  4XTK A;  2J0W A;  3WHN A;  5DQT A;  3GEI A;  2OU6 A;  3H65 A;  3TUL A;  1YYJ A;  1PCX A;  4NTA A;  3HTK C;  5DS5 A;  5F5H A;  3L8J A;  3HLZ A;  1OW7 A;  3DE9 A;  1EQ1 A;  3AG4 C;  3V5Z A;  1QVX A;  1MNE A;  3HJC A;  3S0X A;  3M4C A;  2DI3 A;  2R25 A;  2YLG A;  3GM1 A;  2O9X A;  3UGP A;  5KYU B;  4O6Y A;  3AGU A;  1RJ9 A;  3UMK A;  2L9J A;  1HMO A;  1OCZ C;  3QZC A;  5KYY A;  4MQ9 F;  2VB6 A;  1RKE B;  4U5E E;  1EKY A;  3B0P A;  3V5Y A;  1GM5 A;  1M2O A;  1MMD A;  3L1M A;  1A0B A;  3Q7L A;  4NQF A;  3US6 A;  3B0V C;  1VLS A;  2RD9 A;  2CNW A;  3PHF 2;  3HNL A;  2XS1 A;  2Y39 A;  5AC5 A;  3EH1 A;  5BUO A;  3ZTM A;  2QTV A;  4ZLD A;  3ASO C;  4X0R A;  3GOR A;  3SXZ A;  4PFO A;  3S29 A;  3ABM C;  3U0C A;  1TKN A;  2Y3B A;  1VK5 A;  1NFN A;  2HMQ A;  1SZI A;  1E84 A;  4G7O F;  1JPJ A;  3B9Q A;  1ZHX A;  5L0F A;  3M15 A;  5A69 A;  5A6A A;  1D0X A;  2KNH A;  5DLJ A;  3C18 A;  2R7U A;  2WL8 A;  3N2Z B;  3DAF A;  4XEV A;  1CGN A;  2CDQ A;  5B1A C;  2HV6 A;  2JD3 A;  5F28 E;  2NUT A;  2XLE A;  3EG9 A;  3GEE A;  3W2V A;  3DJN B;  4CJG A;  4G7Z F;  1YVI A;  2HKV A;  3UNG C;  3W8H A;  2KJG A;  2J9U A;  4YT8 A;  3LNM B;  3L34 A;  4CJO A;  2WVN A;  3ZSU A;  4BJT A;  5T1D B;  3IHU A;  2QLA A;  3CEX A;  4JJF A;  1NU7 D;  3LJB A;  3ABL C;  4M63 A;  4LDK A;  3AG2 C;  3IQ6 A;  1SF8 A;  3K1I A;  2V3C C;  1JAF A;  2E87 A;  4AE4 A;  4Q7C A;  1C02 A;  4J7Y A;  4MW3 A;  4JTA B;  5HV9 A;  1A7E A;  2OG2 A;  5EK0 A;  2J46 A;  5L0H A;  3WG7 C;  2LCH A;  3U5S A;  2HSB A;  3ASN C;  3M4B A;  3Q7G A;  3PDM P;  2AVK A;  2H7V C;  3UR3 C;  2Q9A A;  1ORJ A;  1Y4C A;  3FVY A;  3NMK A;  4JZA A;  1QPU A;  4XQ1 A;  2YL7 A;  2H7O A;  4D4N A;  4KNV A;  4AL1 A;  1LKX A;  4NY3 A;  1M2V A;  4AL0 A;  4JCH A;  3VF0 A;  4IB4 A;  2IXP A;  4ULW A;  4H4K C;  3NYJ A;  3O10 A;  1R4T A;  2C04 A;  2QNL A;  3LLK A;  3MYI A;  3RQE A;  2L6H A;  1AUE A;  1HY5 A;  1SR2 A;  4WAB A;  3G50 A;  4EWC A;  5E33 A;  3EPV A;  2YQY A;  4KBL A;  4G0H A;  5DVW A;  1N1C A;  5BQG A;  3RQF A;  4BJ6 C;  5IY5 C;  1ZW3 A;  4BG0 A;  1U0B B;  3G4Z A;  3MBG A;  3EHM A;  1T01 A;  5DQZ A;  1FNT c;  3RIP A;  5FZT A;  4PJJ A;  1CPR A;  2FGY A;  5T3W A;  3FDQ A;  1CGO A;  4PFP A;  1VMA A;  3DXJ F;  2XS8 A;  2EPO A;  2KQ9 A;  3K33 A;  4WJ0 A;  5A6B D;  1NG1 A;  2IXM A;  2KK1 A;  1OR2 A;  4MVQ A;  3DJU B;  2XLD A;  4JJG A;  1VTM P;  1E85 A;  2YLI A;  5L0D A;  1RMV A;  1OW8 A;  4EKW A;  4DRI B;  1NLX A;  3W8I A;  3SXM A;  1C03 A;  2YKZ A;  4PJL A;  3ECS A;  4R32 A;  2UUI A;  3ZDL A;  5L0C A;  4QI0 A;  1TWH A;  3U9J A;  1GGQ A;  2NUP B;  3MFN A;  1DOW A;  3HNK A;  1V74 B;  5GPG B;  1Z7Q c;  1BR4 A;  4BEM J;  3BEH A;  2PX0 A;  4LAC B;  3EGD B;  3S9O A;  1Z63 A;  1I4Z A;  1AEP A;  3FAJ A;  3K1I C;  3KKB A;  2LIG A;  1A7V A;  5COF A;  4OIP F;  2HV7 A;  4J30 B;  1TQG A;  3NMI A;  2R7X A;  1FFT C;  1ST6 A;  3K7D A; 
#chains in the Genus database with same CATH homology
 5JS5 A;  3M79 A;  2XLH A;  3FOP A;  4N6H A;  4JEB A;  1LM3 B;  1EKY A;  3L1M A;  5JLI A;  3ZQY A;  5JUA A;  3HNL A;  3HNI A;  5B3I A;  2YL3 A;  4NC3 A;  3ZTM A;  4CDV A;  4L6R A;  1E84 A;  2XLV A;  3M15 A;  3ZTZ A;  4ER9 A;  3VRC A;  2CCY A;  3QW1 A;  1CGN A;  2XL6 A;  3U8P A;  2XLE A;  4CJG A;  1E86 A;  2J8W A;  4WGZ A;  3QW0 A;  2XM0 A;  4CJO A;  2QLA A;  3TOM A;  4EIY A;  2XLO A;  2YL0 A;  3ZWI A;  4JE9 A;  3DE8 A;  4JEA A;  3IQ6 A;  5AGF A;  1JAF A;  1APC A;  5JVE A;  4IAR A;  1CPQ A;  3TOL A;  3QVZ A;  3C62 A;  3M4B A;  1YZC A;  3IQ5 A;  4U9E A;  1RCP A;  3NMK A;  1QPU A;  2XLM A;  2YL7 A;  4D4N A;  1E83 A;  2XLW A;  4IB4 A;  4ULV A;  1GQA A;  1M6T A;  3C63 A;  2XL8 A;  1QQ3 A;  4CIP A;  4N4W A;  1YYX A;  2YLD A;  3NMJ A;  1BBH A;  1CPR A;  1CGO A;  4IAQ A;  4WGY A;  4CDY A;  3FOO A;  4CDA A;  3HNJ A;  256B A;  4D4X A;  1NBB A;  3ZQV A;  2XLD A;  4CX9 A;  2YL1 A;  1E85 A;  2YLI A;  5JT4 A;  2YKZ A;  1YZA A;  5JP7 A;  1S05 A;  3HNK A;  5JSL A;  1YYJ A;  3QVY A;  5JRA A;  2J9B A;  2BC5 A;  3DE9 A;  2XM4 A;  1A7V A;  4U9D A;  1MQV A;  3M4C A;  3NMI A;  4JKV A;  2YLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...