2L6FA

Nmr solution structure of fat domain of fak complexed with ld2 and ld4 motifs of paxillin
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
176
Chain Sequence
MANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPHSNLSELDRLLLELNAVQHNPPSSATRELDELMASLSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Focal adhesion kinase 1, linker1, Paxillin, linker2, Paxilli
publication title NMR Solution Structure of Fat Domain of Fak Complexed with Ld2 and Ld4 Motifs of Paxillin
rcsb
source organism Gallus gallus, unidentified
molecule tags Transferase,cell adhesion
total genus 62
structure length 176
sequence length 215
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2l6fA00
2KK1A 1WTYA 2HSBA 1OW6A 1WWPA 2Q00A 3AJMA 2L6HA 3GM3A 3L8JA 1KNYA 3C8GD 4EBKA 4XEFA 2L6GA 3B71A 4XEVA 3C18A 3U3FA 2L6FA 1PV3A 3RQEA 1JOGA 5F28E 1WOLA 3L8IA 2YWAA 1ZZPA 1K04A 4EBJA 3GM1A 2JX0A 1V4AA 2LK4A 1O3UA 3K7DA 4NQFA 3C8GB 1K05A 3MFNA 1K40A 1UFBA 4R32A 3O10A 4XEKA 1KTMA 2PBEA 1OW7A 3RQFA 1QVXA 3S9OA 3JZ0A 3U0CA 3BRJA 1OW8A 3C8GA 3JYYA 3TULA 3GM2A 3RQGA 2JPUA
chains in the Genus database with same CATH superfamily
1A41A 3EQLF 2YLDA 1NG1A 3L34A 2A0UA 4K7BA 1VTMP 1BDJB 3MLGA 3W8IA 3KH2A 1OCCC 2NG1A 5F5HA 3B71A 1NU9C 5BQIA 2CYDA 3ABKC 3GORA 1OXBA 1ZYRF 2A6EF 3EGXA 5D91A 4C3EA 4CS9C 4XPWA 4OIRF 1M2OA 2D5RB 3O55A 1NBBA 3E9VA 3RIPA 3DJNB 2M4EA 2EPLX 2IXMA 3JSEO 1GS9A 3EH2A 4C7OB 1JPNA 4CDYA 1RXQA 2FGYA 2XLMA 4JJFA 3NRHA 4JTDB 1CGME 2EPNA 2XLVA 1NZEA 2A69F 3O6XA 1FMVA 4IARA 5L0JA 3FXHA 3Q7GA 3JYYA 4A2NB 1NLXA 2J0XA 4O7GA 5DS4A 3W4YA 5E3AA 1LE4A 3FHDA 4O6NA 2EILC 1ZHXA 1M56C 1QSPA 1ZVZA 2A0BA 2QE9A 4O6YA 3SXYA 5EHHA 2LFDA 1I4ZA 2BC5A 1CGNA 1L7CA 1V54C 2CW0F 3C7JA 3JSZA 2YL7A 2TMVP 3TOMA 1A0BA 5HV9A 3OWTA 3H2UA 5KYYB 1SYQA 3Q7LA 2CGEA 2LIGA 3K1IA 5T3WA 4YT8A 4Z9HA 1T5OA 1YVIA 3L8IA 4U5DE 4EKWA 3K1HA 2J9WA 2CNWA 3B9QA 3KYIA 4QI2A 5GPGB 1TWGA 1E85A 3QVZA 4EIYA 2OCCC 5A6BA 4BG0A 5CI9A 2I15A 4OIPF 4U5FE 4G78A 1SMYF 1T6IA 3SEOA 1JPJA 4AE4B 4K1OA 3MYIA 2KSFA 2IBFA 1VOMA 1ZHTA 5E2QA 2Z15A 2J46A 3AJMA 2DI3A 1T9KA 1R4TA 2R03A 4MVZA 4AL0A 1ORJA 4BJTA 2ZD9A 1JAFA 1ZU4A 1PV3A 1LIHA 2Q9CA 2ICWG 2W9YA 2H7BA 2XLEA 4RBNA 1WOLA 5T3TA 4DJ9A 2KJGA 3HTKC 2IM8A 1HMDA 4YN0B 3W2WA 256BA 4JCZA 4Q4ZF 3PDMP 3AQCA 5COFA 3VM6A 2R7UA 1ORYA 5L0IA 4PJNA 2E87A 4BJ6A 4NY3A 3ZQYA 1VYKA 1K40A 3POVA 3F46A 1GQAA 4DBQA 3UMKA 3RQFA 2NUTB 4AL1A 2PP4A 4PFOA 4U5HA 1N1CA 2Y69C 1WN0A 4B6IA 4W8PA 3U2MA 3RVYA 2EIJC 5A6BD 1BZ4A 2H7OA 1WWPA 2Q00A 2OG2A 3JT1A 4CBEA 4O79A 3A9CA 2XS8A 3WAQA 1G4WR 3QMKA 1NU7D 1YZAA 2R7XA 3V5ZA 3NMJA 2V3CC 5TJ5E 1TQGA 4P6IC 2AP3A 2YL1A 5L0FA 1HW2A 2C04A 3C8ZA 4XTKA 4EBJA 1E83A 1NFOA 2EPOA 2LK4A 1LI7A 2IOQA 2YL3A 3IQCA 3C8GB 1LKXA 2HFIA 2L81A 1OR2A 2I8BA 3NKEA 3X2QC 3S90A 5COMA 2HSQA 3H65A 4AK9A 1YA9A 5KYXB 2XS1A 4PJJA 4BEJA 3EHNA 3LESA 3K1IC 3U2LA 2P0NA 4IGGA 3EFOA 5DQTA 3NYJA 2ZXPA 1RJ9A 5B1AC 3SXKA 1XZPA 4DVZA 1VB5A 4WJ0A 1QLEC 2QUPA 1E86A 3SNHA 2P7VA 4MW3A 4NTBA 5L0DA 2J7PA 3EGDB 4CS8A 2VCBA 2X0CA 4LDQA 1QPUA 3RFYA 3S28A 2Q4FA 1M2VB 5JRAA 1PD1A 1TWCA 2ZXOA 4E18A 1NFNA 4MTOA 3GM1A 3M79A 1D0YA 3CAXA 4U9DA 2UUIA 3NYLA 2KW3C 3Q6NA 1A7EA 1UFBA 3ZQVA 3AQBA 3B0VC 1VLSA 3LJBA 1ZW2A 2G3KA 2R7QA 3RH3A 3EZHA 5JLIA 4CX9A 4E0HA 3S84A 2J45A 4YT5A 1JRAA 2AWCA 2HJ3A 3GANA 3NMIA 3U9MA 5KYWA 5KYUB 2VC9A 2WL8A 4QDLA 1Q0GA 1WTYA 3QTHA 2H8AA 4E0IA 1G5ZA 1HW1A 4CJGA 1MNEA 4IB4A 4MNDA 4BJ6C 4YWQA 2EPKX 4LDKA 4LLCA 4XEFA 3DXJF 3W8HA 1F1MA 1ZHZA 1M6TA 3FMSA 3JCUQ 4EWCA 3B0UX 1L3PA 3QVYA 3ZTMA 4YK5A 3QW0A 5FCLA 5BUOA 2XL6A 4CS7A 2J7PD 3Q6MA 4P9FA 3B29A 5D92A 2JX0A 4BJ5A 2IYLD 2MYSA 2J8WA 3LAYA 4NTAA 3WG7C 4EHPA 4C3DA 1AEPA 2AWYA 2BL2A 3ZSUA 4R32A 5JS5A 2QY9A 2AU5A 3HNLA 3JZ0A 4XLPF 3CEXA 1WATA 3BRJA 3K6BA 3U8VA 3G4ZA 1FFTC 5EGYA 4Q7CA 1BR1A 1D0ZA 3T4RA 3V5XA 2B0HA 2WVOA 3EPVA 2EINC 5E33A 3T9OA 1EA8A 2NPUA 2XXAA 3EGXB 2M64A 4J32B 2L6HA 3ZC4A 2YRFA 2R7VA 3G50A 3HLZA 2QNLA 1OCZC 2LSEA 3EH1A 3GEIA 4JJGA 4MVSA 1ZHYA 4DVYP 1SF8A 2F22A 1B68A 2HUJA 3HJCA 2VCAA 1IZMA 5F28E 2GWWA 2XLHA 1FR0A 3ZTZA 4JIOA 1HMOA 4J7TA 4U5EE 2IXNA 2XLOA 2Y3DA 3NKDA 5FZTA 3UGOA 2P1AA 1H9TA 1TWAA 1H9GA 1MMGA 1W2WA 1WGWA 3O39A 4YL1A 4MVMA 4CS8C 1YARO 3LNRA 3L0IA 4JRZA 4ONSA 3RW0A 2PX3A 4GQHA 1OW8A 4OD5A 2LCHA 1NSGB 3CQZA 3GEHA 4JEBA 3VRCA 1HE9A 1FNTc 2R7TA 3KL4A 3EHMA 4LERA 4G7OF 1J8MF 4IRUA 3DZAA 1TKNA 3LLKA 2NSGA 4MVOA 3K66A 2EPMX 4JURI 3UR3C 4CDVA 5KYNA 2QTVA 1J8YF 4E7SA 2R7SA 4DXWA 4UDVA 1RMVA 4JE9A 2WZFA 1K04A 3TD7A 3EG9A 3EZIA 4KC9A 1YZCA 3GWNA 1OKKD 2NUPA 3IQ5A 2G62A 4JCHA 1K05A 3DKAA 3LLIA 4NCQA 3DD7A 3B0PA 3TQOA 5BQGA 3GODA 3T6BA 3S9OA 3JYHA 1VYIA 4I3MA 1C02A 4ER9A 4JTAB 2W4MA 1V55C 4E17A 2FAPB 2A68F 1IW7F 3RQGA 3TJ5A 3ZVRA 2DYRC 5IY5C 2DYSC 3N0TA 3HNKA 4MVQA 4BJ5C 5HSWA 4H54A 2PFDA 1KNYA 1U0BB 4EBKA 1RKEA 1LM3B 2L6GA 3DM5A 3U8PA 1SR2A 3LNMB 4PACA 2ZXWC 2L6FA 1V74B 1Z6AA 2GDCA 1PD0A 2R7OA 5JT4A 3AGTA 2W4BA 3I5PA 2HV6A 1GM5A 4ULWA 1EQ1A 1BR2A 2W45A 5L0GA 1JR8A 4FX5A 4L6RA 3S0XA 3FDQA 3VF0A 1ORSC 3FVYA 1TFOB 4JKVA 3VAYA 5JP7A 3X1OA 1KTMA 3NYMA 1RKCA 3SYNA 2YKZA 1XWJA 2Y3BA 3LEVA 1OW7A 1JMWA 5AC5A 4CS9A 4JEAA 2YEVA 1R5ID 2CCYA 3UGPA 5DS5A 4J30B 2Q7RA 4DRIB 2G3VA 2C03A 4OIQF 3SXZA 1DOWA 2HSBA 2WVQA 3KYJA 3LS1A 1OW6A 3ASNC 1Q0FA 3U5SA 4F4BA 1A7DA 2R7RA 1D1AA 2P61A 5A69A 2YVKA 4CDAA 4BEMJ 3AG1C 4MVRA 4P9TA 3RQEA 2OOCA 1XZQA 2J9VA 2YLIA 4U5CE 1QZXA 1YYXA 3M15A 4PJMA 2OJED 1ZW3A 2XSEA 4I1OB 4PFPA 3U9JA 2J0WA 5E3CA 4CSAA 3EFOB 4ANJA 1YA7O 4N06A 3DJUB 3E70C 3KMIA 3U3BA 5DQZA 4OINF 3SXMA 4A4AA 1C17M 1D0XA 3U0CA 2Y3HA 4JC7A 4LLEA 1SZIA 4M63A 4AX2A 1G4US 3N2ZB 4MW8A 1EKYA 5COGA 4YL3A 3AGUA 3ZG1A 3AG2C 3MYFA 3DAGA 4OIOF 3TK0A 3HNIA 4CIHA 1QKRA 3IQ6A 2P6VA 4J7YA 4X0RA 5L0CA 2OEXA 2KC3A 3MX3A 2WB7A 4Z9IA 1RCPA 3LUTB 5CIVA 4G7ZF 4KI2A 1LPEA 3HKKA 1KU2A 5CI8A 4ZLDA 1VMAA 2Q9AA 2YZSA 2GFHA 4NC3A 3M4BA 3PMRA 3ABMC 1YDIA 4WABA 1H6GA 3DE8A 1FMWA 1ZHWA 5KYWB 4XEKA 4DRJB 2HKVA 4ULVA 4YT4A 2KQ9A 2VCCA 5B3IA 2A1DD 1U89A 2NSFA 3RYLA 3FOPA 4C7OA 2A6HF 1Z3IX 4HFFB 2XL4A 3IQTA 5A6KA 4MS2A 2OJQA 2R05A 1AUEA 2J9BA 3IHUA 4KBLA 2ZXRA 4U5GA 4WGZA 3KKBA 3TJ6A 5JUAA 2FFHA 4IJJA 4XEVA 3F47A 1T6QA 2VASA 1S7ZA 2Y39A 3U3FA 1EI7A 2XM0A 1OKKA 4GEHA 4LDRA 3L1MA 5JVEA 1FFHA 4MVUA 2HS5A 4HE8D 3WODF 1YLMA 1MNDA 4DBRA 3K7DA 1T01A 2ETSA 4IWBA 3GEEA 2WZGA 3VYWA 5L0HA 5KYYA 3O10A 2D4UA 3AG3C 2XXAB 2ZPAA 1MMAA 4DRHB 1AVOB 2DB4A 2XL8A 3NG1A 3QW1A 1MMDA 1A7VA 3MBGA 3OEOA 4U5BE 4CJOA 2X51A 3TULA 1MMNA 4PK4A 2JD3A 3DM9B 4RDAA 1BR4A 3UMIA 4O6MA 2HJMA 4IAQA 4CSAC 3CSKA 1CPQA 4EBBA 1Z63A 1QQ3A 4AE4A 2LFFA 2Q3TA 3SZRA 5AC4A 1S05A 1Z7Qc 5L3VA 1YYJA 1Q0DA 3PCVA 2R9RB 3DMDA 4PR9A 5B3SC 4LACB 3V5YA 1DOVA 2KGOA 1OXKA 1C03A 4BJ1A 1V4AA 4QI0A 3G4XA 5F5FA 4NQFA 2CDQA 2J9UA 1YJGA 2EIMC 2L9JA 2Y3GA 1Q0KA 4MQ9F 3ATPA 4XQ1A 4D4XA 1Y4CA 2HV7A 2QLAA 3JRTA 4EUKB 2O9XA 1TR2A 2IXPA 2RD9A 3R2PA 2H7VC 4N4WA 4YL0A 3SP1A 2RSEB 4MTFA 3GM2A 1Z23A 2HMQA 3LS0A 3RKOF 3HNJA 3ZDLA 2KK1A 4ZLCA 2V26A 2KYHA 5DS6A 3GM3A 2HMZA 2KNHA 3OA1A 2NUTA 4KNVA 1GGQA 1CGOA 1OR3A 2GA0A 3EG9B 1H7IA 2PX0A 3IPMO 4XPYA 1O87A 3C18A 4XPXA 4FESA 3M1CB 2LP4A 1LS4A 2NUPB 2VB6A 3TOLA 1U6HA 5AGFA 1E2XA 1G8XA 2WZLA 1HY5A 2DGJA 3ASOC 4RD9A 3US6A 4DOZA 1ZZPA 4YT2A 2OQMA 1M57C 1O3UA 4NTFA 4XLNF 2XLWA 1MQVA 3DWWA 3N24A 1LI5A 4JVSA 1I4YA 3FOOA 4Q5SF 3UNGC 2CNWD 2BE5F 2OU6A 3AG4C 4D4NA 3I4UA 2B0JA 3KPHA 3H2VA 1RKEB 4N6HA 3JTLO 3C63A 3CZ6A 5DVWA 3C8GA 1UG7A 3FAJA 5A6JA 4G7HF 1Z5ZA 4E7ZA 2YQYA 4I44A 1Q0MA 1D1BA 3ABLC 5A6AA 5KYXA 3L8JA 1FTSA 3T6JA 3S29A 5T1DB 1OCRC 1TFKB 2GAQA 3LEOA 4I1MA 2PF4E 5DLJA 2R02A 3V7OA 1LE2A 2LQGA 2LD6A 4JZAA 1O5HA 5L3QA 4JW1A 3ITFA 1Y6DA 2YHSA 1I5NA 2YL0A 2YWAA 3JRMO 4U9EA 4JTCB 3EGDA 3A11A 3J06A 4OD4A 1OCOC 2R7WA 2L7AA 5JSLA 3UMHA 4HEAJ 1M2VA 3EJNA 3FAPB 2EIKC 2XRHA 3M4CA 1RJ9B 1VLTA 2VH3A 4HFKB 3PHF2 1E84A 3NDBB 4XWJA 3ZIBA 4N6CA 1FAPB 1PCXA 4Z9JA 2UUHA 2R25A 3AOUA 2OKUA 1VK5A 1CPRA 3T6GB 2AVKA 4IAOA 1HE1A 2ASRA 4YJWA 3S27A 4GYTA 4K0DA 3C8GD 2MWQA 5BQHA 1APCA 1OQCA 4WGYA 3RF3A 2IXOA 3GWLA 3WHNA 4FWVA 1D1CA 2MHRA 4MTGA 5KYUA 3K33A 5EK0A 5B1BC 1JOGA 3ZWIA 4FAPB 4W8KA 4C3BA 4CIPA 3DAFA 2WVNA 3BEHA 3W2VA 2XLDA 3ECSA 3IEEA 1TWHA 3I5QA 3R7CA 3RVZA 1T6UA 1ZU5A 4PJLA 3MFNA 2PNOA 3DE9A 1ST6A 2OEVA 2PBEA 1YAUO 1WASA 3QZCA 1LVKA 3DI5A 1QVXA 3NMKA 4G0HA 4H4KC 5K0IA 2Q9BA 2XM4A 3C62A 4BPMA 1BBHA 1LS1A 2HZ8A 4KNWA 2YLGA 2JPUA
chains in the Genus database with same CATH topology
2KK1A 1WTYA 2HSBA 1OW6A 1WWPA 2Q00A 3AJMA 2L6HA 3GM3A 3L8JA 1KNYA 3C8GD 4EBKA 4XEFA 2L6GA 3B71A 4XEVA 3C18A 3U3FA 2L6FA 1PV3A 3RQEA 1JOGA 5F28E 1WOLA 3L8IA 2YWAA 1ZZPA 1K04A 4EBJA 3GM1A 2JX0A 1V4AA 2LK4A 1O3UA 3K7DA 4NQFA 3C8GB 1K05A 3MFNA 1K40A 1UFBA 4R32A 3O10A 4XEKA 1KTMA 2PBEA 1OW7A 3RQFA 1QVXA 3S9OA 3JZ0A 3U0CA 3BRJA 1OW8A 3C8GA 3JYYA 3TULA 3GM2A 3RQGA 2JPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KK1 A;  1WTY A;  2HSB A;  1OW6 A;  1WWP A;  2Q00 A;  3AJM A;  2L6H A;  3GM3 A;  3L8J A;  1KNY A;  3C8G D;  4EBK A;  4XEF A;  2L6G A;  3B71 A;  4XEV A;  3C18 A;  3U3F A;  2L6F A;  1PV3 A;  3RQE A;  1JOG A;  5F28 E;  1WOL A;  3L8I A;  2YWA A;  1ZZP A;  1K04 A;  4EBJ A;  3GM1 A;  2JX0 A;  1V4A A;  2LK4 A;  1O3U A;  3K7D A;  4NQF A;  3C8G B;  1K05 A;  3MFN A;  1K40 A;  1UFB A;  4R32 A;  3O10 A;  4XEK A;  1KTM A;  2PBE A;  1OW7 A;  3RQF A;  1QVX A;  3S9O A;  3JZ0 A;  3U0C A;  3BRJ A;  1OW8 A;  3C8G A;  3JYY A;  3TUL A;  3GM2 A;  3RQG A;  2JPU A; 
#chains in the Genus database with same CATH topology
 1A41 A;  3EQL F;  2YLD A;  1NG1 A;  3L34 A;  2A0U A;  4K7B A;  1VTM P;  1BDJ B;  3MLG A;  3W8I A;  3KH2 A;  1OCC C;  2NG1 A;  5F5H A;  3B71 A;  1NU9 C;  5BQI A;  2CYD A;  3ABK C;  3GOR A;  1OXB A;  1ZYR F;  2A6E F;  3EGX A;  5D91 A;  4C3E A;  4CS9 C;  4XPW A;  4OIR F;  1M2O A;  2D5R B;  3O55 A;  1NBB A;  3E9V A;  3RIP A;  3DJN B;  2M4E A;  2EPL X;  2IXM A;  3JSE O;  1GS9 A;  3EH2 A;  4C7O B;  1JPN A;  4CDY A;  1RXQ A;  2FGY A;  2XLM A;  4JJF A;  3NRH A;  4JTD B;  1CGM E;  2EPN A;  2XLV A;  1NZE A;  2A69 F;  3O6X A;  1FMV A;  4IAR A;  5L0J A;  3FXH A;  3Q7G A;  3JYY A;  4A2N B;  1NLX A;  2J0X A;  4O7G A;  5DS4 A;  3W4Y A;  5E3A A;  1LE4 A;  3FHD A;  4O6N A;  2EIL C;  1ZHX A;  1M56 C;  1QSP A;  1ZVZ A;  2A0B A;  2QE9 A;  4O6Y A;  3SXY A;  5EHH A;  2LFD A;  1I4Z A;  2BC5 A;  1CGN A;  1L7C A;  1V54 C;  2CW0 F;  3C7J A;  3JSZ A;  2YL7 A;  2TMV P;  3TOM A;  1A0B A;  5HV9 A;  3OWT A;  3H2U A;  5KYY B;  1SYQ A;  3Q7L A;  2CGE A;  2LIG A;  3K1I A;  5T3W A;  4YT8 A;  4Z9H A;  1T5O A;  1YVI A;  3L8I A;  4U5D E;  4EKW A;  3K1H A;  2J9W A;  2CNW A;  3B9Q A;  3KYI A;  4QI2 A;  5GPG B;  1TWG A;  1E85 A;  3QVZ A;  4EIY A;  2OCC C;  5A6B A;  4BG0 A;  5CI9 A;  2I15 A;  4OIP F;  4U5F E;  4G78 A;  1SMY F;  1T6I A;  3SEO A;  1JPJ A;  4AE4 B;  4K1O A;  3MYI A;  2KSF A;  2IBF A;  1VOM A;  1ZHT A;  5E2Q A;  2Z15 A;  2J46 A;  3AJM A;  2DI3 A;  1T9K A;  1R4T A;  2R03 A;  4MVZ A;  4AL0 A;  1ORJ A;  4BJT A;  2ZD9 A;  1JAF A;  1ZU4 A;  1PV3 A;  1LIH A;  2Q9C A;  2ICW G;  2W9Y A;  2H7B A;  2XLE A;  4RBN A;  1WOL A;  5T3T A;  4DJ9 A;  2KJG A;  3HTK C;  2IM8 A;  1HMD A;  4YN0 B;  3W2W A;  256B A;  4JCZ A;  4Q4Z F;  3PDM P;  3AQC A;  5COF A;  3VM6 A;  2R7U A;  1ORY A;  5L0I A;  4PJN A;  2E87 A;  4BJ6 A;  4NY3 A;  3ZQY A;  1VYK A;  1K40 A;  3POV A;  3F46 A;  1GQA A;  4DBQ A;  3UMK A;  3RQF A;  2NUT B;  4AL1 A;  2PP4 A;  4PFO A;  4U5H A;  1N1C A;  2Y69 C;  1WN0 A;  4B6I A;  4W8P A;  3U2M A;  3RVY A;  2EIJ C;  5A6B D;  1BZ4 A;  2H7O A;  1WWP A;  2Q00 A;  2OG2 A;  3JT1 A;  4CBE A;  4O79 A;  3A9C A;  2XS8 A;  3WAQ A;  1G4W R;  3QMK A;  1NU7 D;  1YZA A;  2R7X A;  3V5Z A;  3NMJ A;  2V3C C;  5TJ5 E;  1TQG A;  4P6I C;  2AP3 A;  2YL1 A;  5L0F A;  1HW2 A;  2C04 A;  3C8Z A;  4XTK A;  4EBJ A;  1E83 A;  1NFO A;  2EPO A;  2LK4 A;  1LI7 A;  2IOQ A;  2YL3 A;  3IQC A;  3C8G B;  1LKX A;  2HFI A;  2L81 A;  1OR2 A;  2I8B A;  3NKE A;  3X2Q C;  3S90 A;  5COM A;  2HSQ A;  3H65 A;  4AK9 A;  1YA9 A;  5KYX B;  2XS1 A;  4PJJ A;  4BEJ A;  3EHN A;  3LES A;  3K1I C;  3U2L A;  2P0N A;  4IGG A;  3EFO A;  5DQT A;  3NYJ A;  2ZXP A;  1RJ9 A;  5B1A C;  3SXK A;  1XZP A;  4DVZ A;  1VB5 A;  4WJ0 A;  1QLE C;  2QUP A;  1E86 A;  3SNH A;  2P7V A;  4MW3 A;  4NTB A;  5L0D A;  2J7P A;  3EGD B;  4CS8 A;  2VCB A;  2X0C A;  4LDQ A;  1QPU A;  3RFY A;  3S28 A;  2Q4F A;  1M2V B;  5JRA A;  1PD1 A;  1TWC A;  2ZXO A;  4E18 A;  1NFN A;  4MTO A;  3GM1 A;  3M79 A;  1D0Y A;  3CAX A;  4U9D A;  2UUI A;  3NYL A;  2KW3 C;  3Q6N A;  1A7E A;  1UFB A;  3ZQV A;  3AQB A;  3B0V C;  1VLS A;  3LJB A;  1ZW2 A;  2G3K A;  2R7Q A;  3RH3 A;  3EZH A;  5JLI A;  4CX9 A;  4E0H A;  3S84 A;  2J45 A;  4YT5 A;  1JRA A;  2AWC A;  2HJ3 A;  3GAN A;  3NMI A;  3U9M A;  5KYW A;  5KYU B;  2VC9 A;  2WL8 A;  4QDL A;  1Q0G A;  1WTY A;  3QTH A;  2H8A A;  4E0I A;  1G5Z A;  1HW1 A;  4CJG A;  1MNE A;  4IB4 A;  4MND A;  4BJ6 C;  4YWQ A;  2EPK X;  4LDK A;  4LLC A;  4XEF A;  3DXJ F;  3W8H A;  1F1M A;  1ZHZ A;  1M6T A;  3FMS A;  3JCU Q;  4EWC A;  3B0U X;  1L3P A;  3QVY A;  3ZTM A;  4YK5 A;  3QW0 A;  5FCL A;  5BUO A;  2XL6 A;  4CS7 A;  2J7P D;  3Q6M A;  4P9F A;  3B29 A;  5D92 A;  2JX0 A;  4BJ5 A;  2IYL D;  2MYS A;  2J8W A;  3LAY A;  4NTA A;  3WG7 C;  4EHP A;  4C3D A;  1AEP A;  2AWY A;  2BL2 A;  3ZSU A;  4R32 A;  5JS5 A;  2QY9 A;  2AU5 A;  3HNL A;  3JZ0 A;  4XLP F;  3CEX A;  1WAT A;  3BRJ A;  3K6B A;  3U8V A;  3G4Z A;  1FFT C;  5EGY A;  4Q7C A;  1BR1 A;  1D0Z A;  3T4R A;  3V5X A;  2B0H A;  2WVO A;  3EPV A;  2EIN C;  5E33 A;  3T9O A;  1EA8 A;  2NPU A;  2XXA A;  3EGX B;  2M64 A;  4J32 B;  2L6H A;  3ZC4 A;  2YRF A;  2R7V A;  3G50 A;  3HLZ A;  2QNL A;  1OCZ C;  2LSE A;  3EH1 A;  3GEI A;  4JJG A;  4MVS A;  1ZHY A;  4DVY P;  1SF8 A;  2F22 A;  1B68 A;  2HUJ A;  3HJC A;  2VCA A;  1IZM A;  5F28 E;  2GWW A;  2XLH A;  1FR0 A;  3ZTZ A;  4JIO A;  1HMO A;  4J7T A;  4U5E E;  2IXN A;  2XLO A;  2Y3D A;  3NKD A;  5FZT A;  3UGO A;  2P1A A;  1H9T A;  1TWA A;  1H9G A;  1MMG A;  1W2W A;  1WGW A;  3O39 A;  4YL1 A;  4MVM A;  4CS8 C;  1YAR O;  3LNR A;  3L0I A;  4JRZ A;  4ONS A;  3RW0 A;  2PX3 A;  4GQH A;  1OW8 A;  4OD5 A;  2LCH A;  1NSG B;  3CQZ A;  3GEH A;  4JEB A;  3VRC A;  1HE9 A;  1FNT c;  2R7T A;  3KL4 A;  3EHM A;  4LER A;  4G7O F;  1J8M F;  4IRU A;  3DZA A;  1TKN A;  3LLK A;  2NSG A;  4MVO A;  3K66 A;  2EPM X;  4JUR I;  3UR3 C;  4CDV A;  5KYN A;  2QTV A;  1J8Y F;  4E7S A;  2R7S A;  4DXW A;  4UDV A;  1RMV A;  4JE9 A;  2WZF A;  1K04 A;  3TD7 A;  3EG9 A;  3EZI A;  4KC9 A;  1YZC A;  3GWN A;  1OKK D;  2NUP A;  3IQ5 A;  2G62 A;  4JCH A;  1K05 A;  3DKA A;  3LLI A;  4NCQ A;  3DD7 A;  3B0P A;  3TQO A;  5BQG A;  3GOD A;  3T6B A;  3S9O A;  3JYH A;  1VYI A;  4I3M A;  1C02 A;  4ER9 A;  4JTA B;  2W4M A;  1V55 C;  4E17 A;  2FAP B;  2A68 F;  1IW7 F;  3RQG A;  3TJ5 A;  3ZVR A;  2DYR C;  5IY5 C;  2DYS C;  3N0T A;  3HNK A;  4MVQ A;  4BJ5 C;  5HSW A;  4H54 A;  2PFD A;  1KNY A;  1U0B B;  4EBK A;  1RKE A;  1LM3 B;  2L6G A;  3DM5 A;  3U8P A;  1SR2 A;  3LNM B;  4PAC A;  2ZXW C;  2L6F A;  1V74 B;  1Z6A A;  2GDC A;  1PD0 A;  2R7O A;  5JT4 A;  3AGT A;  2W4B A;  3I5P A;  2HV6 A;  1GM5 A;  4ULW A;  1EQ1 A;  1BR2 A;  2W45 A;  5L0G A;  1JR8 A;  4FX5 A;  4L6R A;  3S0X A;  3FDQ A;  3VF0 A;  1ORS C;  3FVY A;  1TFO B;  4JKV A;  3VAY A;  5JP7 A;  3X1O A;  1KTM A;  3NYM A;  1RKC A;  3SYN A;  2YKZ A;  1XWJ A;  2Y3B A;  3LEV A;  1OW7 A;  1JMW A;  5AC5 A;  4CS9 A;  4JEA A;  2YEV A;  1R5I D;  2CCY A;  3UGP A;  5DS5 A;  4J30 B;  2Q7R A;  4DRI B;  2G3V A;  2C03 A;  4OIQ F;  3SXZ A;  1DOW A;  2HSB A;  2WVQ A;  3KYJ A;  3LS1 A;  1OW6 A;  3ASN C;  1Q0F A;  3U5S A;  4F4B A;  1A7D A;  2R7R A;  1D1A A;  2P61 A;  5A69 A;  2YVK A;  4CDA A;  4BEM J;  3AG1 C;  4MVR A;  4P9T A;  3RQE A;  2OOC A;  1XZQ A;  2J9V A;  2YLI A;  4U5C E;  1QZX A;  1YYX A;  3M15 A;  4PJM A;  2OJE D;  1ZW3 A;  2XSE A;  4I1O B;  4PFP A;  3U9J A;  2J0W A;  5E3C A;  4CSA A;  3EFO B;  4ANJ A;  1YA7 O;  4N06 A;  3DJU B;  3E70 C;  3KMI A;  3U3B A;  5DQZ A;  4OIN F;  3SXM A;  4A4A A;  1C17 M;  1D0X A;  3U0C A;  2Y3H A;  4JC7 A;  4LLE A;  1SZI A;  4M63 A;  4AX2 A;  1G4U S;  3N2Z B;  4MW8 A;  1EKY A;  5COG A;  4YL3 A;  3AGU A;  3ZG1 A;  3AG2 C;  3MYF A;  3DAG A;  4OIO F;  3TK0 A;  3HNI A;  4CIH A;  1QKR A;  3IQ6 A;  2P6V A;  4J7Y A;  4X0R A;  5L0C A;  2OEX A;  2KC3 A;  3MX3 A;  2WB7 A;  4Z9I A;  1RCP A;  3LUT B;  5CIV A;  4G7Z F;  4KI2 A;  1LPE A;  3HKK A;  1KU2 A;  5CI8 A;  4ZLD A;  1VMA A;  2Q9A A;  2YZS A;  2GFH A;  4NC3 A;  3M4B A;  3PMR A;  3ABM C;  1YDI A;  4WAB A;  1H6G A;  3DE8 A;  1FMW A;  1ZHW A;  5KYW B;  4XEK A;  4DRJ B;  2HKV A;  4ULV A;  4YT4 A;  2KQ9 A;  2VCC A;  5B3I A;  2A1D D;  1U89 A;  2NSF A;  3RYL A;  3FOP A;  4C7O A;  2A6H F;  1Z3I X;  4HFF B;  2XL4 A;  3IQT A;  5A6K A;  4MS2 A;  2OJQ A;  2R05 A;  1AUE A;  2J9B A;  3IHU A;  4KBL A;  2ZXR A;  4U5G A;  4WGZ A;  3KKB A;  3TJ6 A;  5JUA A;  2FFH A;  4IJJ A;  4XEV A;  3F47 A;  1T6Q A;  2VAS A;  1S7Z A;  2Y39 A;  3U3F A;  1EI7 A;  2XM0 A;  1OKK A;  4GEH A;  4LDR A;  3L1M A;  5JVE A;  1FFH A;  4MVU A;  2HS5 A;  4HE8 D;  3WOD F;  1YLM A;  1MND A;  4DBR A;  3K7D A;  1T01 A;  2ETS A;  4IWB A;  3GEE A;  2WZG A;  3VYW A;  5L0H A;  5KYY A;  3O10 A;  2D4U A;  3AG3 C;  2XXA B;  2ZPA A;  1MMA A;  4DRH B;  1AVO B;  2DB4 A;  2XL8 A;  3NG1 A;  3QW1 A;  1MMD A;  1A7V A;  3MBG A;  3OEO A;  4U5B E;  4CJO A;  2X51 A;  3TUL A;  1MMN A;  4PK4 A;  2JD3 A;  3DM9 B;  4RDA A;  1BR4 A;  3UMI A;  4O6M A;  2HJM A;  4IAQ A;  4CSA C;  3CSK A;  1CPQ A;  4EBB A;  1Z63 A;  1QQ3 A;  4AE4 A;  2LFF A;  2Q3T A;  3SZR A;  5AC4 A;  1S05 A;  1Z7Q c;  5L3V A;  1YYJ A;  1Q0D A;  3PCV A;  2R9R B;  3DMD A;  4PR9 A;  5B3S C;  4LAC B;  3V5Y A;  1DOV A;  2KGO A;  1OXK A;  1C03 A;  4BJ1 A;  1V4A A;  4QI0 A;  3G4X A;  5F5F A;  4NQF A;  2CDQ A;  2J9U A;  1YJG A;  2EIM C;  2L9J A;  2Y3G A;  1Q0K A;  4MQ9 F;  3ATP A;  4XQ1 A;  4D4X A;  1Y4C A;  2HV7 A;  2QLA A;  3JRT A;  4EUK B;  2O9X A;  1TR2 A;  2IXP A;  2RD9 A;  3R2P A;  2H7V C;  4N4W A;  4YL0 A;  3SP1 A;  2RSE B;  4MTF A;  3GM2 A;  1Z23 A;  2HMQ A;  3LS0 A;  3RKO F;  3HNJ A;  3ZDL A;  2KK1 A;  4ZLC A;  2V26 A;  2KYH A;  5DS6 A;  3GM3 A;  2HMZ A;  2KNH A;  3OA1 A;  2NUT A;  4KNV A;  1GGQ A;  1CGO A;  1OR3 A;  2GA0 A;  3EG9 B;  1H7I A;  2PX0 A;  3IPM O;  4XPY A;  1O87 A;  3C18 A;  4XPX A;  4FES A;  3M1C B;  2LP4 A;  1LS4 A;  2NUP B;  2VB6 A;  3TOL A;  1U6H A;  5AGF A;  1E2X A;  1G8X A;  2WZL A;  1HY5 A;  2DGJ A;  3ASO C;  4RD9 A;  3US6 A;  4DOZ A;  1ZZP A;  4YT2 A;  2OQM A;  1M57 C;  1O3U A;  4NTF A;  4XLN F;  2XLW A;  1MQV A;  3DWW A;  3N24 A;  1LI5 A;  4JVS A;  1I4Y A;  3FOO A;  4Q5S F;  3UNG C;  2CNW D;  2BE5 F;  2OU6 A;  3AG4 C;  4D4N A;  3I4U A;  2B0J A;  3KPH A;  3H2V A;  1RKE B;  4N6H A;  3JTL O;  3C63 A;  3CZ6 A;  5DVW A;  3C8G A;  1UG7 A;  3FAJ A;  5A6J A;  4G7H F;  1Z5Z A;  4E7Z A;  2YQY A;  4I44 A;  1Q0M A;  1D1B A;  3ABL C;  5A6A A;  5KYX A;  3L8J A;  1FTS A;  3T6J A;  3S29 A;  5T1D B;  1OCR C;  1TFK B;  2GAQ A;  3LEO A;  4I1M A;  2PF4 E;  5DLJ A;  2R02 A;  3V7O A;  1LE2 A;  2LQG A;  2LD6 A;  4JZA A;  1O5H A;  5L3Q A;  4JW1 A;  3ITF A;  1Y6D A;  2YHS A;  1I5N A;  2YL0 A;  2YWA A;  3JRM O;  4U9E A;  4JTC B;  3EGD A;  3A11 A;  3J06 A;  4OD4 A;  1OCO C;  2R7W A;  2L7A A;  5JSL A;  3UMH A;  4HEA J;  1M2V A;  3EJN A;  3FAP B;  2EIK C;  2XRH A;  3M4C A;  1RJ9 B;  1VLT A;  2VH3 A;  4HFK B;  3PHF 2;  1E84 A;  3NDB B;  4XWJ A;  3ZIB A;  4N6C A;  1FAP B;  1PCX A;  4Z9J A;  2UUH A;  2R25 A;  3AOU A;  2OKU A;  1VK5 A;  1CPR A;  3T6G B;  2AVK A;  4IAO A;  1HE1 A;  2ASR A;  4YJW A;  3S27 A;  4GYT A;  4K0D A;  3C8G D;  2MWQ A;  5BQH A;  1APC A;  1OQC A;  4WGY A;  3RF3 A;  2IXO A;  3GWL A;  3WHN A;  4FWV A;  1D1C A;  2MHR A;  4MTG A;  5KYU A;  3K33 A;  5EK0 A;  5B1B C;  1JOG A;  3ZWI A;  4FAP B;  4W8K A;  4C3B A;  4CIP A;  3DAF A;  2WVN A;  3BEH A;  3W2V A;  2XLD A;  3ECS A;  3IEE A;  1TWH A;  3I5Q A;  3R7C A;  3RVZ A;  1T6U A;  1ZU5 A;  4PJL A;  3MFN A;  2PNO A;  3DE9 A;  1ST6 A;  2OEV A;  2PBE A;  1YAU O;  1WAS A;  3QZC A;  1LVK A;  3DI5 A;  1QVX A;  3NMK A;  4G0H A;  4H4K C;  5K0I A;  2Q9B A;  2XM4 A;  3C62 A;  4BPM A;  1BBH A;  1LS1 A;  2HZ8 A;  4KNW A;  2YLG A;  2JPU A; 
#chains in the Genus database with same CATH homology
 2KK1 A;  1WTY A;  2HSB A;  1OW6 A;  1WWP A;  2Q00 A;  3AJM A;  2L6H A;  3GM3 A;  3L8J A;  1KNY A;  3C8G D;  4EBK A;  4XEF A;  2L6G A;  3B71 A;  4XEV A;  3C18 A;  3U3F A;  2L6F A;  1PV3 A;  3RQE A;  1JOG A;  5F28 E;  1WOL A;  3L8I A;  2YWA A;  1ZZP A;  1K04 A;  4EBJ A;  3GM1 A;  2JX0 A;  1V4A A;  2LK4 A;  1O3U A;  3K7D A;  4NQF A;  3C8G B;  1K05 A;  3MFN A;  1K40 A;  1UFB A;  4R32 A;  3O10 A;  4XEK A;  1KTM A;  2PBE A;  1OW7 A;  3RQF A;  1QVX A;  3S9O A;  3JZ0 A;  3U0C A;  3BRJ A;  1OW8 A;  3C8G A;  3JYY A;  3TUL A;  3GM2 A;  3RQG A;  2JPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...