2L6FA

Nmr solution structure of fat domain of fak complexed with ld2 and ld4 motifs of paxillin
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
176
Chain Sequence
b'MANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPHSNLSELDRLLLELNAVQHNPPSSATRELDELMASLSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Focal adhesion kinase 1, linker1, Paxillin, linker2, Paxilli
publication title NMR Solution Structure of Fat Domain of Fak Complexed with Ld2 and Ld4 Motifs of Paxillin
rcsb
source organism Gallus gallus, unidentified
molecule tags Transferase,cell adhesion
total genus 62
structure length 176
sequence length 215
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2l6fA00
2PBEA 3MFNA 1K04A 3B71A 2L6HA 1V4AA 4EBJA 3RQEA 1JOGA 1WOLA 3JYYA 3C8GD 1PV3A 4NQFA 2Q00A 1KTMA 3C8GB 4XEVA 1KNYA 3C18A 3GM3A 1K05A 3RQFA 2JX0A 3C8GA 1WTYA 4EBKA 4XEFA 5F28E 3K7DA 1ZZPA 1O3UA 4R32A 3GM2A 1K40A 3JZ0A 3O10A 3U0CA 4XEKA 1OW8A 2L6GA 3L8JA 3TULA 3AJMA 2L6FA 2JPUA 2LK4A 2KK1A 1OW7A 3S9OA 1OW6A 3GM1A 3L8IA 3RQGA 1UFBA 1QVXA 2HSBA 1WWPA 3BRJA 3U3FA 2YWAA
chains in the Genus database with same CATH superfamily
2KNHA 1NBBA 4QDLA 1V74B 2PBEA 3U5SA 4E17A 4D4XA 1JMWA 3E9VA 1YA7O 3JTLO 1M56C 1ZU5A 1Q0DA 1RKEA 4C3EA 4PFOA 3EGXB 3JRTA 5KYYA 2LIGA 3M79A 2PP4A 4N06A 2LCHA 2NPUA 3UMHA 1QPUA 3FAPB 1XZPA 3VAYA 2O9XA 4MS2A 1M2OA 5COFA 3SNHA 3ZQYA 1JAFA 4CS9A 4ULVA 1L7CA 3OWTA 5KYWA 3O39A 3NG1A 4IB4A 4N6CA 2QUPA 3U8PA 1CPRA 1SMYF 2JPUA 1A7EA 3LLKA 4DBRA 4YT2A 4W8KA 3H65A 3M4CA 1BDJB 3K1HA 2NSGA 2YLGA 3DJUB 2OJED 3J06A 4H4KC 4O6NA 1R4TA 3VYWA 2AVKA 2LSEA 4J32B 3RF3A 1YLMA 2DB4A 2FGYA 3W2VA 1JPJA 3MBGA 3IQCA 2H7OA 4EBJA 3HTKC 3O6XA 3IQTA 4WABA 3C8GD 3M1CB 2Q00A 4MTOA 4EKWA 3C8GB 2Y3GA 3CAXA 4FAPB 1YYXA 3POVA 3C18A 3VF0A 4BEMJ 4BJ1A 4FESA 3RW0A 2JX0A 1EI7A 3B9QA 5JVEA 3DM5A 3V5XA 3T6BA 3HNLA 4CX9A 5JUAA 1AVOB 1OCZC 3T9OA 2A69F 3AG2C 3DI5A 1Y6DA 3LEVA 4O79A 4EIYA 1FAPB 1Z23A 2QE9A 1OR3A 4JEBA 4WGZA 3RYLA 3FHDA 4A4AA 1V54C 3O55A 3SXMA 1E85A 1F1MA 4J30B 5JSLA 2J9VA 1ZHWA 5B1BC 3M15A 5L0DA 2GA0A 1Q0MA 3B71A 1M2VA 4DVYP 4MQ9F 3B29A 4PK4A 2EINC 3U9JA 2HV7A 3CQZA 3IQ5A 5CI9A 5EGYA 3NYMA 1OR2A 1TWGA 1YVIA 3ATPA 2OJQA 3QZCA 3UMKA 2V3CC 4E18A 3B0UX 1WTYA 3GANA 4JTDB 3DD7A 2KYHA 1D0ZA 3G50A 2XLHA 5A6AA 2BC5A 3WODF 3GM2A 4KC9A 2H7VC 3JYHA 4Z9IA 4YT8A 3S0XA 1MMAA 3WAQA 2Q7RA 1YARO 5L3VA 2R7TA 1NG1A 1OW8A 3TULA 1TWAA 2R9RB 3Q6NA 3JSZA 4PJNA 4PR9A 4ZLCA 2TMVP 3LESA 2J9BA 2P0NA 1VK5A 1LI5A 3W4YA 1OW6A 3ECSA 3IHUA 4QI2A 4U9EA 4CJGA 4GEHA 2G3KA 3TJ5A 2EIKC 2B0JA 4CBEA 1T01A 3LS0A 1A7VA 1RKEB 4YT5A 1H9TA 4MW8A 4DVZA 5KYYB 1PD0A 4AL0A 1JOGA 5E33A 2P6VA 2IYLD 1PV3A 3F47A 3I5QA 4E7SA 2MHRA 2YKZA 5COGA 4FWVA 1CGNA 1T5OA 3RQFA 3SXZA 3EZIA 2R05A 4XEFA 4WGYA 4JTCB 1I4YA 2J7PD 2XSEA 5F28E 3ZSUA 4I3MA 3TJ6A 3UGPA 3Q6MA 5JS5A 1K40A 1SZIA 4E0HA 1J8MF 3DKAA 2OEVA 5JRAA 1B68A 4HFKB 4XEKA 4CS8A 3LNMB 4G7ZF 2KSFA 3QW0A 1TFKB 3V5YA 1EKYA 5AC5A 1G4WR 1OW7A 3LLIA 2HS5A 2YHSA 1ZVZA 3EHMA 4MVRA 1TQGA 2HUJA 3PMRA 3ZIBA 1GGQA 4N4WA 3W2WA 4NTFA 4O6MA 2IXNA 3CEXA 1GM5A 3BRJA 4XPYA 2J9UA 2JD3A 4MVSA 2Q4FA 3AG3C 5JLIA 4MTFA 5EHHA 1OKKA 3HNJA 3NKEA 4NQFA 4IARA 1OQCA 4G7OF 3K1IA 1XWJA 2YL1A 1JRAA 3NMJA 2R7QA 1BR2A 3EJNA 3SP1A 2OKUA 3LUTB 1D0YA 5B1AC 3NYLA 1LE2A 1ST6A 1N1CA 2I8BA 4IRUA 3QMKA 2XLVA 3O10A 1CGME 2HV6A 3OEOA 4EUKB 1EA8A 1MMNA 3AG4C 2NUPA 5E3CA 4LERA 4O7GA 2KK1A 1QQ3A 2NG1A 1Z3IX 2Y3BA 1YDIA 3U9MA 2B0HA 3EG9B 1RJ9A 3KMIA 1R5ID 4RDAA 3GEHA 3NYJA 3L8IA 4MNDA 2A6HF 1A0BA 2EPOA 2XLDA 1M2VB 4LDKA 4P6IC 2LP4A 3ZTZA 4U5CE 2YWAA 2OG2A 1Q0FA 3C8ZA 5D91A 2Y69C 256BA 4QI0A 1FFTC 2XLEA 2C03A 2XXAB 4JE9A 1OXBA 2VCBA 1C02A 4RD9A 3T6GB 1RCPA 3UMIA 1T6QA 2D5RB 4C3DA 4E0IA 4C7OA 3X1OA 2KC3A 4U9DA 4CSAC 2HKVA 1JPNA 2DYRC 2Y39A 1FR0A 5A6BD 2VCAA 4YN0B 2WL8A 2C04A 2IM8A 1SR2A 2HMQA 2L6GA 3DXJF 4JIOA 3HNKA 1U89A 5T3WA 1ZYRF 3IPMO 1VOMA 5BUOA 3JSEO 4NCQA 1VB5A 1VMAA 3DAFA 4ONSA 4PJJA 1O87A 2NUTA 3WG7C 2DYSC 3DAGA 3IEEA 4I1OB 4BJ6C 5KYXA 4MW3A 3RH3A 1LVKA 2UUHA 2XLMA 3DE8A 5T1DB 2ETSA 1WASA 1E2XA 1D1AA 1Z6AA 3FMSA 1MNDA 1TWHA 2CNWA 4HE8D 3RKOF 4BJ5A 1OCOC 3ASOC 1KNYA 4W8PA 3TK0A 1TWCA 3S90A 2R03A 4H54A 3SXYA 5HSWA 1FNTc 2GAQA 4D4NA 1Z5ZA 2YL3A 3KKBA 5A6JA 2XL6A 2OQMA 5L0CA 3EH2A 3R7CA 3FOPA 2LD6A 4ANJA 3M4BA 3N2ZB 3LS1A 2HJMA 2KGOA 2CGEA 4YL3A 2G62A 1D1BA 3ABKC 1M57C 3TD7A 4NTBA 3RQGA 1OKKD 1PCXA 1OCCC 2J8WA 4J7TA 2CW0F 2IOQA 1HY5A 3LJBA 2Y3HA 1HMOA 2CCYA 1LS1A 3EGDA 5E3AA 3RVZA 1MMGA 1NU9C 3OA1A 5FZTA 4AE4A 3LAYA 1ZW2A 3JYYA 3Q7LA 5BQGA 4DOZA 4XTKA 3S28A 4PJLA 2A6EF 3N24A 2ZPAA 4NC3A 3ZQVA 4MVQA 2XLOA 2R7VA 2J46A 2WZFA 4AK9A 1GQAA 2UUIA 3QW1A 1U0BB 2NUPB 3QVYA 5HV9A 1BR1A 5L0FA 1C17M 4YK5A 3EFOA 1V55C 1MQVA 1RJ9B 5BQIA 2R7XA 1HMDA 1VYKA 3QVZA 5F5HA 4CIPA 2J9WA 4OIOF 1BR4A 2XM4A 4K1OA 4MTGA 2YEVA 5D92A 1ZHTA 3GM1A 4KNWA 2VH3A 2LFDA 1AEPA 3T4RA 4KI2A 1NU7D 3AGUA 3U3FA 3C7JA 5K0IA 2XRHA 3ZC4A 2J45A 1M6TA 2EILC 4MVUA 3VRCA 4CIHA 4C7OB 3FVYA 2Q9AA 2Q9CA 4CS8C 4P9FA 5A6KA 3Q7GA 2XL4A 4XPWA 3GM3A 4LLCA 2I15A 1K05A 1G5ZA 1QSPA 3MLGA 4JJGA 1LPEA 3EQLF 4K0DA 3V7OA 5KYWB 1E86A 5DQZA 2RSEB 1NSGB 3K7DA 4Z9HA 3UR3C 1BZ4A 2L7AA 3JCUQ 4FX5A 2R7OA 4IAQA 2W45A 1MMDA 2M64A 3B0PA 3GWNA 5KYUA 4OINF 3HLZA 4Q7CA 1DOWA 2NUTB 1HE1A 2AU5A 3KH2A 1VLTA 3K1IC 4U5BE 5KYXB 2HZ8A 3FAJA 3S9OA 3FXHA 3S84A 5EK0A 3G4XA 3JRMO 2W4MA 2M4EA 3A9CA 2ZXRA 2CNWD 2F22A 3HKKA 1RKCA 1LIHA 2Q9BA 3N0TA 4PFPA 4AL1A 1HW1A 4XLNF 5DS6A 2FFHA 1ZHYA 4U5GA 1KTMA 2WVNA 3R2PA 2PF4E 3ZTMA 4XEVA 3W8IA 4I44A 5DS4A 3K6BA 4MVOA 3C8GA 3U2MA 3ZVRA 2KW3C 3U2LA 4I1MA 1ZZPA 1J8YF 1YYJA 1OCRC 4Q4ZF 3G4ZA 1QLEC 1Y4CA 2EPMX 1RMVA 1EQ1A 3EH1A 5CIVA 1YZAA 2LQGA 3KYIA 1SYQA 2R7SA 2HFIA 4GQHA 3RFYA 3W8HA 3FDQA 2WZGA 3A11A 2YL0A 2YQYA 3DWWA 4JTAB 4LDRA 2IBFA 4P9TA 1D0XA 4EWCA 5COMA 1AUEA 4OIRF 3EGDB 4HFFB 4AE4B 2HSBA 2PNOA 2EPKX 3GWLA 2ASRA 3NDBB 1ZHZA 5DVWA 4U5DE 3EPVA 1TFOB 2OEXA 2IXOA 1V4AA 2QY9A 4CS9C 3DMDA 1ORYA 4OD4A 4EHPA 4YJWA 1TKNA 2YVKA 5L0IA 2H8AA 4DJ9A 2GFHA 1I5NA 3RIPA 3EFOB 5BQHA 3DJNB 3I4UA 3EHNA 3LEOA 1E83A 4A2NB 3E70C 2VC9A 3C63A 3L8JA 4X0RA 3TQOA 4DRHB 1YA9A 2L6FA 4JJFA 3PDMP 1H6GA 4MVMA 2CDQA 2Y3DA 3ZWIA 2A1DD 4U5EE 1H9GA 5JT4A 2QLAA 2W4BA 4KNVA 2DI3A 3I5PA 5JP7A 1ZHXA 4G0HA 4DRIB 4IJJA 3SYNA 1UG7A 2R02A 2ZXPA 1FFHA 2WVOA 1HW2A 4XPXA 1Z63A 4JCZA 4OIPF 2R7UA 1WGWA 3L0IA 1ZW3A 4ER9A 3US6A 1W2WA 5KYUB 4JVSA 4XLPF 5B3SC 3SZRA 3ABLC 2AP3A 4JW1A 2VB6A 3FOOA 2J7PA 2FAPB 3GORA 2VASA 1CGOA 2OOCA 1WATA 2XS1A 4IWBA 4DRJB 1S7ZA 1TR2A 4G78A 2HJ3A 4ULWA 1IW7F 2PX0A 3HJCA 4CSAA 3X2QC 2XL8A 2YL7A 3U3BA 3PHF2 5DQTA 3DM9B 2ZD9A 4IAOA 1OXKA 2AWYA 1A41A 2D4UA 5AGFA 3AGTA 1K04A 2X0CA 4JZAA 4KBLA 2OCCC 4XWJA 3RQEA 3K33A 4CDAA 4LLEA 1YJGA 2P7VA 2IXPA 3SEOA 2GWWA 1FMWA 3AQCA 3RVYA 2E87A 4JKVA 3ZDLA 2WVQA 5DLJA 4BJ6A 2A68F 1QZXA 5L3QA 3HNIA 4J7YA 4AX2A 4DXWA 1PD1A 5CI8A 4JC7A 3U0CA 1G4US 1NLXA 3K66A 3DZAA 3ASNC 1D1CA 2KJGA 1L3PA 4G7HF 4DBQA 4WJ0A 4Q5SF 4PJMA 2EPNA 3UGOA 3TOLA 4HEAJ 5GPGB 4YT4A 3T6JA 2KQ9A 3AG1C 4U5FE 1UFBA 3EG9A 5F5FA 3SXKA 2QTVA 4NY3A 1HE9A 2Q3TA 3KPHA 1Z7Qc 4CDYA 3B0VC 3C62A 3KL4A 2GDCA 3MYIA 2X51A 2HMZA 1NZEA 2R7RA 1LKXA 4PACA 2VCCA 2YLDA 3NMKA 3TOMA 2XXAA 2P1AA 2XM0A 1IZMA 1LM3B 2BL2A 1A7DA 1RXQA 4XQ1A 1Q0GA 2PFDA 2PX3A 3EGXA 4IGGA 1QKRA 5T3TA 1LI7A 4M63A 4YL1A 3EZHA 5TJ5E 1VYIA 3L1MA 4ZLDA 2A0UA 1DOVA 4YWQA 4RBNA 5A6BA 1H7IA 1T6UA 1ZU4A 3ITFA 1E84A 4OIQF 2ZXWC 2ICWG 3IQ6A 4CS7A 2W9YA 5L0GA 1O5HA 2YLIA 4C3BA 3MFNA 1BBHA 4L6RA 2L6HA 1C03A 2IXMA 4YL0A 3MYFA 5L0JA 1WOLA 4LACB 5IY5C 4BEJA 2MWQA 4E7ZA 2Z15A 4BPMA 1SF8A 2EPLX 3ABMC 4MVZA 2EIMC 2A0BA 1FMVA 4F4BA 2WB7A 4EBKA 1FTSA 4CJOA 3S29A 2NSFA 3NKDA 2ZXOA 3GEIA 4R32A 3MX3A 4JEAA 4LDQA 5A69A 3CSKA 3DE9A 1T9KA 3JT1A 3H2UA 1VLSA 5L0HA 3H2VA 3GODA 4U5HA 3AJMA 3ZG1A 2MYSA 1CPQA 4NTAA 5AC4A 4GYTA 3CZ6A 3KYJA 1LE4A 1S05A 4JURI 2RD9A 2R25A 2V26A 2XLWA 4JCHA 3U8VA 2YRFA 2EIJC 3BEHA 5FCLA 3NMIA 1JR8A 1APCA 2YZSA 2G3VA 5B3IA 4B6IA 1NFNA 2P61A 1VTMP 1KU2A 2LFFA 4Z9JA 2L81A 3NRHA 4BG0A 1ORSC 3L34A 3QTHA 2L9JA 2H7BA 3V5ZA 3WHNA 5KYNA 1WN0A 1O3UA 1ORJA 4UDVA 1G8XA 1T6IA 1YAUO 1MNEA 2HSQA 3AQBA 3GEEA 3AOUA 3JZ0A 3PCVA 4K7BA 4O6YA 1GS9A 5E2QA 3S27A 1Q0KA 4EBBA 4JRZA 4OD5A 2WZLA 1I4ZA 1NFOA 2XS8A 5DS5A 1U6HA 2J0XA 3F46A 2AWCA 1YZCA 2BE5F 2CYDA 2LK4A 3VM6A 2OU6A 3UNGC 3LNRA 2J0WA 4BJ5C 4CDVA 2DGJA 2R7WA 1LS4A 4N6HA 1QVXA 2QNLA 1WWPA 1XZQA 4BJTA
chains in the Genus database with same CATH topology
2PBEA 3MFNA 1K04A 3B71A 2L6HA 1V4AA 4EBJA 3RQEA 1JOGA 1WOLA 3JYYA 3C8GD 1PV3A 4NQFA 2Q00A 1KTMA 3C8GB 4XEVA 1KNYA 3C18A 3GM3A 1K05A 3RQFA 2JX0A 3C8GA 1WTYA 4EBKA 4XEFA 5F28E 3K7DA 1ZZPA 1O3UA 4R32A 3GM2A 1K40A 3JZ0A 3O10A 3U0CA 4XEKA 1OW8A 2L6GA 3L8JA 3TULA 3AJMA 2L6FA 2JPUA 2LK4A 2KK1A 1OW7A 3S9OA 1OW6A 3GM1A 3L8IA 3RQGA 1UFBA 1QVXA 2HSBA 1WWPA 3BRJA 3U3FA 2YWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBE A;  3MFN A;  1K04 A;  3B71 A;  2L6H A;  1V4A A;  4EBJ A;  3RQE A;  1JOG A;  1WOL A;  3JYY A;  3C8G D;  1PV3 A;  4NQF A;  2Q00 A;  1KTM A;  3C8G B;  4XEV A;  1KNY A;  3C18 A;  3GM3 A;  1K05 A;  3RQF A;  2JX0 A;  3C8G A;  1WTY A;  4EBK A;  4XEF A;  5F28 E;  3K7D A;  1ZZP A;  1O3U A;  4R32 A;  3GM2 A;  1K40 A;  3JZ0 A;  3O10 A;  3U0C A;  4XEK A;  1OW8 A;  2L6G A;  3L8J A;  3TUL A;  3AJM A;  2L6F A;  2JPU A;  2LK4 A;  2KK1 A;  1OW7 A;  3S9O A;  1OW6 A;  3GM1 A;  3L8I A;  3RQG A;  1UFB A;  1QVX A;  2HSB A;  1WWP A;  3BRJ A;  3U3F A;  2YWA A; 
#chains in the Genus database with same CATH topology
 2KNH A;  1NBB A;  4QDL A;  1V74 B;  2PBE A;  3U5S A;  4E17 A;  4D4X A;  1JMW A;  3E9V A;  1YA7 O;  3JTL O;  1M56 C;  1ZU5 A;  1Q0D A;  1RKE A;  4C3E A;  4PFO A;  3EGX B;  3JRT A;  5KYY A;  2LIG A;  3M79 A;  2PP4 A;  4N06 A;  2LCH A;  2NPU A;  3UMH A;  1QPU A;  3FAP B;  1XZP A;  3VAY A;  2O9X A;  4MS2 A;  1M2O A;  5COF A;  3SNH A;  3ZQY A;  1JAF A;  4CS9 A;  4ULV A;  1L7C A;  3OWT A;  5KYW A;  3O39 A;  3NG1 A;  4IB4 A;  4N6C A;  2QUP A;  3U8P A;  1CPR A;  1SMY F;  2JPU A;  1A7E A;  3LLK A;  4DBR A;  4YT2 A;  4W8K A;  3H65 A;  3M4C A;  1BDJ B;  3K1H A;  2NSG A;  2YLG A;  3DJU B;  2OJE D;  3J06 A;  4H4K C;  4O6N A;  1R4T A;  3VYW A;  2AVK A;  2LSE A;  4J32 B;  3RF3 A;  1YLM A;  2DB4 A;  2FGY A;  3W2V A;  1JPJ A;  3MBG A;  3IQC A;  2H7O A;  4EBJ A;  3HTK C;  3O6X A;  3IQT A;  4WAB A;  3C8G D;  3M1C B;  2Q00 A;  4MTO A;  4EKW A;  3C8G B;  2Y3G A;  3CAX A;  4FAP B;  1YYX A;  3POV A;  3C18 A;  3VF0 A;  4BEM J;  4BJ1 A;  4FES A;  3RW0 A;  2JX0 A;  1EI7 A;  3B9Q A;  5JVE A;  3DM5 A;  3V5X A;  3T6B A;  3HNL A;  4CX9 A;  5JUA A;  1AVO B;  1OCZ C;  3T9O A;  2A69 F;  3AG2 C;  3DI5 A;  1Y6D A;  3LEV A;  4O79 A;  4EIY A;  1FAP B;  1Z23 A;  2QE9 A;  1OR3 A;  4JEB A;  4WGZ A;  3RYL A;  3FHD A;  4A4A A;  1V54 C;  3O55 A;  3SXM A;  1E85 A;  1F1M A;  4J30 B;  5JSL A;  2J9V A;  1ZHW A;  5B1B C;  3M15 A;  5L0D A;  2GA0 A;  1Q0M A;  3B71 A;  1M2V A;  4DVY P;  4MQ9 F;  3B29 A;  4PK4 A;  2EIN C;  3U9J A;  2HV7 A;  3CQZ A;  3IQ5 A;  5CI9 A;  5EGY A;  3NYM A;  1OR2 A;  1TWG A;  1YVI A;  3ATP A;  2OJQ A;  3QZC A;  3UMK A;  2V3C C;  4E18 A;  3B0U X;  1WTY A;  3GAN A;  4JTD B;  3DD7 A;  2KYH A;  1D0Z A;  3G50 A;  2XLH A;  5A6A A;  2BC5 A;  3WOD F;  3GM2 A;  4KC9 A;  2H7V C;  3JYH A;  4Z9I A;  4YT8 A;  3S0X A;  1MMA A;  3WAQ A;  2Q7R A;  1YAR O;  5L3V A;  2R7T A;  1NG1 A;  1OW8 A;  3TUL A;  1TWA A;  2R9R B;  3Q6N A;  3JSZ A;  4PJN A;  4PR9 A;  4ZLC A;  2TMV P;  3LES A;  2J9B A;  2P0N A;  1VK5 A;  1LI5 A;  3W4Y A;  1OW6 A;  3ECS A;  3IHU A;  4QI2 A;  4U9E A;  4CJG A;  4GEH A;  2G3K A;  3TJ5 A;  2EIK C;  2B0J A;  4CBE A;  1T01 A;  3LS0 A;  1A7V A;  1RKE B;  4YT5 A;  1H9T A;  4MW8 A;  4DVZ A;  5KYY B;  1PD0 A;  4AL0 A;  1JOG A;  5E33 A;  2P6V A;  2IYL D;  1PV3 A;  3F47 A;  3I5Q A;  4E7S A;  2MHR A;  2YKZ A;  5COG A;  4FWV A;  1CGN A;  1T5O A;  3RQF A;  3SXZ A;  3EZI A;  2R05 A;  4XEF A;  4WGY A;  4JTC B;  1I4Y A;  2J7P D;  2XSE A;  5F28 E;  3ZSU A;  4I3M A;  3TJ6 A;  3UGP A;  3Q6M A;  5JS5 A;  1K40 A;  1SZI A;  4E0H A;  1J8M F;  3DKA A;  2OEV A;  5JRA A;  1B68 A;  4HFK B;  4XEK A;  4CS8 A;  3LNM B;  4G7Z F;  2KSF A;  3QW0 A;  1TFK B;  3V5Y A;  1EKY A;  5AC5 A;  1G4W R;  1OW7 A;  3LLI A;  2HS5 A;  2YHS A;  1ZVZ A;  3EHM A;  4MVR A;  1TQG A;  2HUJ A;  3PMR A;  3ZIB A;  1GGQ A;  4N4W A;  3W2W A;  4NTF A;  4O6M A;  2IXN A;  3CEX A;  1GM5 A;  3BRJ A;  4XPY A;  2J9U A;  2JD3 A;  4MVS A;  2Q4F A;  3AG3 C;  5JLI A;  4MTF A;  5EHH A;  1OKK A;  3HNJ A;  3NKE A;  4NQF A;  4IAR A;  1OQC A;  4G7O F;  3K1I A;  1XWJ A;  2YL1 A;  1JRA A;  3NMJ A;  2R7Q A;  1BR2 A;  3EJN A;  3SP1 A;  2OKU A;  3LUT B;  1D0Y A;  5B1A C;  3NYL A;  1LE2 A;  1ST6 A;  1N1C A;  2I8B A;  4IRU A;  3QMK A;  2XLV A;  3O10 A;  1CGM E;  2HV6 A;  3OEO A;  4EUK B;  1EA8 A;  1MMN A;  3AG4 C;  2NUP A;  5E3C A;  4LER A;  4O7G A;  2KK1 A;  1QQ3 A;  2NG1 A;  1Z3I X;  2Y3B A;  1YDI A;  3U9M A;  2B0H A;  3EG9 B;  1RJ9 A;  3KMI A;  1R5I D;  4RDA A;  3GEH A;  3NYJ A;  3L8I A;  4MND A;  2A6H F;  1A0B A;  2EPO A;  2XLD A;  1M2V B;  4LDK A;  4P6I C;  2LP4 A;  3ZTZ A;  4U5C E;  2YWA A;  2OG2 A;  1Q0F A;  3C8Z A;  5D91 A;  2Y69 C;  256B A;  4QI0 A;  1FFT C;  2XLE A;  2C03 A;  2XXA B;  4JE9 A;  1OXB A;  2VCB A;  1C02 A;  4RD9 A;  3T6G B;  1RCP A;  3UMI A;  1T6Q A;  2D5R B;  4C3D A;  4E0I A;  4C7O A;  3X1O A;  2KC3 A;  4U9D A;  4CSA C;  2HKV A;  1JPN A;  2DYR C;  2Y39 A;  1FR0 A;  5A6B D;  2VCA A;  4YN0 B;  2WL8 A;  2C04 A;  2IM8 A;  1SR2 A;  2HMQ A;  2L6G A;  3DXJ F;  4JIO A;  3HNK A;  1U89 A;  5T3W A;  1ZYR F;  3IPM O;  1VOM A;  5BUO A;  3JSE O;  4NCQ A;  1VB5 A;  1VMA A;  3DAF A;  4ONS A;  4PJJ A;  1O87 A;  2NUT A;  3WG7 C;  2DYS C;  3DAG A;  3IEE A;  4I1O B;  4BJ6 C;  5KYX A;  4MW3 A;  3RH3 A;  1LVK A;  2UUH A;  2XLM A;  3DE8 A;  5T1D B;  2ETS A;  1WAS A;  1E2X A;  1D1A A;  1Z6A A;  3FMS A;  1MND A;  1TWH A;  2CNW A;  4HE8 D;  3RKO F;  4BJ5 A;  1OCO C;  3ASO C;  1KNY A;  4W8P A;  3TK0 A;  1TWC A;  3S90 A;  2R03 A;  4H54 A;  3SXY A;  5HSW A;  1FNT c;  2GAQ A;  4D4N A;  1Z5Z A;  2YL3 A;  3KKB A;  5A6J A;  2XL6 A;  2OQM A;  5L0C A;  3EH2 A;  3R7C A;  3FOP A;  2LD6 A;  4ANJ A;  3M4B A;  3N2Z B;  3LS1 A;  2HJM A;  2KGO A;  2CGE A;  4YL3 A;  2G62 A;  1D1B A;  3ABK C;  1M57 C;  3TD7 A;  4NTB A;  3RQG A;  1OKK D;  1PCX A;  1OCC C;  2J8W A;  4J7T A;  2CW0 F;  2IOQ A;  1HY5 A;  3LJB A;  2Y3H A;  1HMO A;  2CCY A;  1LS1 A;  3EGD A;  5E3A A;  3RVZ A;  1MMG A;  1NU9 C;  3OA1 A;  5FZT A;  4AE4 A;  3LAY A;  1ZW2 A;  3JYY A;  3Q7L A;  5BQG A;  4DOZ A;  4XTK A;  3S28 A;  4PJL A;  2A6E F;  3N24 A;  2ZPA A;  4NC3 A;  3ZQV A;  4MVQ A;  2XLO A;  2R7V A;  2J46 A;  2WZF A;  4AK9 A;  1GQA A;  2UUI A;  3QW1 A;  1U0B B;  2NUP B;  3QVY A;  5HV9 A;  1BR1 A;  5L0F A;  1C17 M;  4YK5 A;  3EFO A;  1V55 C;  1MQV A;  1RJ9 B;  5BQI A;  2R7X A;  1HMD A;  1VYK A;  3QVZ A;  5F5H A;  4CIP A;  2J9W A;  4OIO F;  1BR4 A;  2XM4 A;  4K1O A;  4MTG A;  2YEV A;  5D92 A;  1ZHT A;  3GM1 A;  4KNW A;  2VH3 A;  2LFD A;  1AEP A;  3T4R A;  4KI2 A;  1NU7 D;  3AGU A;  3U3F A;  3C7J A;  5K0I A;  2XRH A;  3ZC4 A;  2J45 A;  1M6T A;  2EIL C;  4MVU A;  3VRC A;  4CIH A;  4C7O B;  3FVY A;  2Q9A A;  2Q9C A;  4CS8 C;  4P9F A;  5A6K A;  3Q7G A;  2XL4 A;  4XPW A;  3GM3 A;  4LLC A;  2I15 A;  1K05 A;  1G5Z A;  1QSP A;  3MLG A;  4JJG A;  1LPE A;  3EQL F;  4K0D A;  3V7O A;  5KYW B;  1E86 A;  5DQZ A;  2RSE B;  1NSG B;  3K7D A;  4Z9H A;  3UR3 C;  1BZ4 A;  2L7A A;  3JCU Q;  4FX5 A;  2R7O A;  4IAQ A;  2W45 A;  1MMD A;  2M64 A;  3B0P A;  3GWN A;  5KYU A;  4OIN F;  3HLZ A;  4Q7C A;  1DOW A;  2NUT B;  1HE1 A;  2AU5 A;  3KH2 A;  1VLT A;  3K1I C;  4U5B E;  5KYX B;  2HZ8 A;  3FAJ A;  3S9O A;  3FXH A;  3S84 A;  5EK0 A;  3G4X A;  3JRM O;  2W4M A;  2M4E A;  3A9C A;  2ZXR A;  2CNW D;  2F22 A;  3HKK A;  1RKC A;  1LIH A;  2Q9B A;  3N0T A;  4PFP A;  4AL1 A;  1HW1 A;  4XLN F;  5DS6 A;  2FFH A;  1ZHY A;  4U5G A;  1KTM A;  2WVN A;  3R2P A;  2PF4 E;  3ZTM A;  4XEV A;  3W8I A;  4I44 A;  5DS4 A;  3K6B A;  4MVO A;  3C8G A;  3U2M A;  3ZVR A;  2KW3 C;  3U2L A;  4I1M A;  1ZZP A;  1J8Y F;  1YYJ A;  1OCR C;  4Q4Z F;  3G4Z A;  1QLE C;  1Y4C A;  2EPM X;  1RMV A;  1EQ1 A;  3EH1 A;  5CIV A;  1YZA A;  2LQG A;  3KYI A;  1SYQ A;  2R7S A;  2HFI A;  4GQH A;  3RFY A;  3W8H A;  3FDQ A;  2WZG A;  3A11 A;  2YL0 A;  2YQY A;  3DWW A;  4JTA B;  4LDR A;  2IBF A;  4P9T A;  1D0X A;  4EWC A;  5COM A;  1AUE A;  4OIR F;  3EGD B;  4HFF B;  4AE4 B;  2HSB A;  2PNO A;  2EPK X;  3GWL A;  2ASR A;  3NDB B;  1ZHZ A;  5DVW A;  4U5D E;  3EPV A;  1TFO B;  2OEX A;  2IXO A;  1V4A A;  2QY9 A;  4CS9 C;  3DMD A;  1ORY A;  4OD4 A;  4EHP A;  4YJW A;  1TKN A;  2YVK A;  5L0I A;  2H8A A;  4DJ9 A;  2GFH A;  1I5N A;  3RIP A;  3EFO B;  5BQH A;  3DJN B;  3I4U A;  3EHN A;  3LEO A;  1E83 A;  4A2N B;  3E70 C;  2VC9 A;  3C63 A;  3L8J A;  4X0R A;  3TQO A;  4DRH B;  1YA9 A;  2L6F A;  4JJF A;  3PDM P;  1H6G A;  4MVM A;  2CDQ A;  2Y3D A;  3ZWI A;  2A1D D;  4U5E E;  1H9G A;  5JT4 A;  2QLA A;  2W4B A;  4KNV A;  2DI3 A;  3I5P A;  5JP7 A;  1ZHX A;  4G0H A;  4DRI B;  4IJJ A;  3SYN A;  1UG7 A;  2R02 A;  2ZXP A;  1FFH A;  2WVO A;  1HW2 A;  4XPX A;  1Z63 A;  4JCZ A;  4OIP F;  2R7U A;  1WGW A;  3L0I A;  1ZW3 A;  4ER9 A;  3US6 A;  1W2W A;  5KYU B;  4JVS A;  4XLP F;  5B3S C;  3SZR A;  3ABL C;  2AP3 A;  4JW1 A;  2VB6 A;  3FOO A;  2J7P A;  2FAP B;  3GOR A;  2VAS A;  1CGO A;  2OOC A;  1WAT A;  2XS1 A;  4IWB A;  4DRJ B;  1S7Z A;  1TR2 A;  4G78 A;  2HJ3 A;  4ULW A;  1IW7 F;  2PX0 A;  3HJC A;  4CSA A;  3X2Q C;  2XL8 A;  2YL7 A;  3U3B A;  3PHF 2;  5DQT A;  3DM9 B;  2ZD9 A;  4IAO A;  1OXK A;  2AWY A;  1A41 A;  2D4U A;  5AGF A;  3AGT A;  1K04 A;  2X0C A;  4JZA A;  4KBL A;  2OCC C;  4XWJ A;  3RQE A;  3K33 A;  4CDA A;  4LLE A;  1YJG A;  2P7V A;  2IXP A;  3SEO A;  2GWW A;  1FMW A;  3AQC A;  3RVY A;  2E87 A;  4JKV A;  3ZDL A;  2WVQ A;  5DLJ A;  4BJ6 A;  2A68 F;  1QZX A;  5L3Q A;  3HNI A;  4J7Y A;  4AX2 A;  4DXW A;  1PD1 A;  5CI8 A;  4JC7 A;  3U0C A;  1G4U S;  1NLX A;  3K66 A;  3DZA A;  3ASN C;  1D1C A;  2KJG A;  1L3P A;  4G7H F;  4DBQ A;  4WJ0 A;  4Q5S F;  4PJM A;  2EPN A;  3UGO A;  3TOL A;  4HEA J;  5GPG B;  4YT4 A;  3T6J A;  2KQ9 A;  3AG1 C;  4U5F E;  1UFB A;  3EG9 A;  5F5F A;  3SXK A;  2QTV A;  4NY3 A;  1HE9 A;  2Q3T A;  3KPH A;  1Z7Q c;  4CDY A;  3B0V C;  3C62 A;  3KL4 A;  2GDC A;  3MYI A;  2X51 A;  2HMZ A;  1NZE A;  2R7R A;  1LKX A;  4PAC A;  2VCC A;  2YLD A;  3NMK A;  3TOM A;  2XXA A;  2P1A A;  2XM0 A;  1IZM A;  1LM3 B;  2BL2 A;  1A7D A;  1RXQ A;  4XQ1 A;  1Q0G A;  2PFD A;  2PX3 A;  3EGX A;  4IGG A;  1QKR A;  5T3T A;  1LI7 A;  4M63 A;  4YL1 A;  3EZH A;  5TJ5 E;  1VYI A;  3L1M A;  4ZLD A;  2A0U A;  1DOV A;  4YWQ A;  4RBN A;  5A6B A;  1H7I A;  1T6U A;  1ZU4 A;  3ITF A;  1E84 A;  4OIQ F;  2ZXW C;  2ICW G;  3IQ6 A;  4CS7 A;  2W9Y A;  5L0G A;  1O5H A;  2YLI A;  4C3B A;  3MFN A;  1BBH A;  4L6R A;  2L6H A;  1C03 A;  2IXM A;  4YL0 A;  3MYF A;  5L0J A;  1WOL A;  4LAC B;  5IY5 C;  4BEJ A;  2MWQ A;  4E7Z A;  2Z15 A;  4BPM A;  1SF8 A;  2EPL X;  3ABM C;  4MVZ A;  2EIM C;  2A0B A;  1FMV A;  4F4B A;  2WB7 A;  4EBK A;  1FTS A;  4CJO A;  3S29 A;  2NSF A;  3NKD A;  2ZXO A;  3GEI A;  4R32 A;  3MX3 A;  4JEA A;  4LDQ A;  5A69 A;  3CSK A;  3DE9 A;  1T9K A;  3JT1 A;  3H2U A;  1VLS A;  5L0H A;  3H2V A;  3GOD A;  4U5H A;  3AJM A;  3ZG1 A;  2MYS A;  1CPQ A;  4NTA A;  5AC4 A;  4GYT A;  3CZ6 A;  3KYJ A;  1LE4 A;  1S05 A;  4JUR I;  2RD9 A;  2R25 A;  2V26 A;  2XLW A;  4JCH A;  3U8V A;  2YRF A;  2EIJ C;  3BEH A;  5FCL A;  3NMI A;  1JR8 A;  1APC A;  2YZS A;  2G3V A;  5B3I A;  4B6I A;  1NFN A;  2P61 A;  1VTM P;  1KU2 A;  2LFF A;  4Z9J A;  2L81 A;  3NRH A;  4BG0 A;  1ORS C;  3L34 A;  3QTH A;  2L9J A;  2H7B A;  3V5Z A;  3WHN A;  5KYN A;  1WN0 A;  1O3U A;  1ORJ A;  4UDV A;  1G8X A;  1T6I A;  1YAU O;  1MNE A;  2HSQ A;  3AQB A;  3GEE A;  3AOU A;  3JZ0 A;  3PCV A;  4K7B A;  4O6Y A;  1GS9 A;  5E2Q A;  3S27 A;  1Q0K A;  4EBB A;  4JRZ A;  4OD5 A;  2WZL A;  1I4Z A;  1NFO A;  2XS8 A;  5DS5 A;  1U6H A;  2J0X A;  3F46 A;  2AWC A;  1YZC A;  2BE5 F;  2CYD A;  2LK4 A;  3VM6 A;  2OU6 A;  3UNG C;  3LNR A;  2J0W A;  4BJ5 C;  4CDV A;  2DGJ A;  2R7W A;  1LS4 A;  4N6H A;  1QVX A;  2QNL A;  1WWP A;  1XZQ A;  4BJT A; 
#chains in the Genus database with same CATH homology
 2PBE A;  3MFN A;  1K04 A;  3B71 A;  2L6H A;  1V4A A;  4EBJ A;  3RQE A;  1JOG A;  1WOL A;  3JYY A;  3C8G D;  1PV3 A;  4NQF A;  2Q00 A;  1KTM A;  3C8G B;  4XEV A;  1KNY A;  3C18 A;  3GM3 A;  1K05 A;  3RQF A;  2JX0 A;  3C8G A;  1WTY A;  4EBK A;  4XEF A;  5F28 E;  3K7D A;  1ZZP A;  1O3U A;  4R32 A;  3GM2 A;  1K40 A;  3JZ0 A;  3O10 A;  3U0C A;  4XEK A;  1OW8 A;  2L6G A;  3L8J A;  3TUL A;  3AJM A;  2L6F A;  2JPU A;  2LK4 A;  2KK1 A;  1OW7 A;  3S9O A;  1OW6 A;  3GM1 A;  3L8I A;  3RQG A;  1UFB A;  1QVX A;  2HSB A;  1WWP A;  3BRJ A;  3U3F A;  2YWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...