2L6FA

Nmr solution structure of fat domain of fak complexed with ld2 and ld4 motifs of paxillin
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
176
Chain Sequence
MANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPHSNLSELDRLLLELNAVQHNPPSSATRELDELMASLSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase,cell adhesion
molecule keywords Focal adhesion kinase 1, linker1, Paxillin, linker2, Paxilli
publication title NMR Solution Structure of Fat Domain of Fak Complexed with Ld2 and Ld4 Motifs of Paxillin
rcsb
source organism Gallus gallus, unidentified
total genus 62
structure length 176
sequence length 215
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2l6fA00
1QVXA 1WWPA 2L6FA 3AJMA 4XEKA 5F28E 4XEFA 3TULA 1JOGA 1K05A 1WTYA 2HSBA 2KK1A 3C8GB 1K04A 4EBJA 4R32A 3MFNA 1OW7A 4NQFA 1UFBA 3BRJA 3B71A 3RQFA 3C18A 3S9OA 2Q00A 3O10A 3JYYA 4EBKA 1WOLA 3GM3A 2PBEA 2L6HA 1V4AA 1OW8A 3C8GA 3L8JA 2L6GA 3RQEA 3U3FA 3C8GD 2JPUA 2JX0A 3GM1A 3GM2A 1O3UA 3U0CA 2LK4A 2YWAA 3L8IA 1KNYA 1PV3A 3K7DA 3JZ0A 1KTMA 1ZZPA 1K40A 4XEVA 3RQGA 1OW6A
chains in the Genus database with same CATH superfamily
2KQ9A 1ZHYA 2XLHA 1FNTc 1NFNA 1TFKB 2W4BA 3DJUB 4HEAJ 4CSAC 2CNWA 1Y4CA 3ABKC 4C7OA 3IEEA 3ECSA 3HLZA 2Y3BA 3B71A 4U9DA 2E87A 1D0XA 1WN0A 1APCA 1NU7D 1WATA 4DBQA 2XS8A 2J7PA 2Y39A 4IWBA 4UDVA 5A6AA 1LE2A 2A6EF 1GGQA 2X51A 3G4XA 3KMIA 3O6XA 1B68A 2Q7RA 3SXYA 2XLOA 2XS1A 4JTAB 2TMVP 3U3FA 4IB4A 1T6UA 2L81A 2UUHA 3GM1A 3LNRA 5AGFA 2F22A 1JRAA 3HNJA 4I1OB 3K1HA 4KI2A 2Q9BA 3M15A 1ORJA 4IGGA 1E85A 4Z9IA 1E83A 3E9VA 1R4TA 1D1BA 3VYWA 1G8XA 5A69A 1WWPA 4DXWA 2L6FA 2ZD9A 2FAPB 4FESA 4JURI 2R7RA 5KYYA 1J8MF 1NG1A 2KK1A 1OKKD 2IOQA 3EG9B 2ICWG 3EZIA 3IPMO 4W8KA 1E86A 2XLEA 1Z63A 3GODA 4IJJA 4NQFA 4ZLCA 5EGYA 1TFOB 2V3CC 4P9FA 5L0HA 1Q0GA 2KC3A 3DE9A 4JW1A 4JZAA 3PCVA 4CDVA 1U89A 3K1IA 3UNGC 3SNHA 2PF4E 4N4WA 3EPVA 1M2VB 4BJ1A 4C3DA 1T6IA 4U5HA 5JSLA 1G5ZA 3CQZA 1KNYA 2R7OA 2IXOA 2G3VA 3TJ5A 1JPNA 1IW7F 5E3CA 3H2UA 4CS8C 1YDIA 3V5YA 3ZDLA 3KKBA 3W2VA 4J32B 1ZW2A 4KNVA 5F5FA 1VLSA 3TJ6A 4ULVA 1HW2A 5T3TA 2ZPAA 4OIQF 4GQHA 4R32A 3GEEA 3MFNA 4JJGA 2R25A 1OXBA 3OEOA 4WABA 5KYUA 1UFBA 5K0IA 5L0JA 3RQFA 3M4BA 5JUAA 3L0IA 2CCYA 4MVZA 2L6HA 1I4ZA 4N6HA 4OD4A 2P61A 3L8JA 4MTFA 4YK5A 4AK9A 4OINF 3F47A 1VB5A 2VCBA 3C8GD 4FX5A 1D0YA 4MW3A 4PR9A 1I4YA 4I44A 4K1OA 2HKVA 2HUJA 4H54A 4O7GA 5CI9A 3POVA 4MW8A 4H4KC 2B0HA 4L6RA 3RVZA 4BJ5A 1HE1A 2AP3A 2W9YA 2LFFA 1NLXA 2XL6A 1T5OA 4A4AA 1OCZC 2VH3A 4KC9A 4PJMA 1MMGA 4RBNA 3VF0A 2D4UA 3HNIA 2WL8A 1YARO 4MS2A 1RCPA 4MVUA 4XEFA 3S0XA 1EKYA 1NFOA 2WVQA 1F1MA 4PJLA 1JR8A 4IARA 3DM5A 3V7OA 1ZHZA 2DB4A 4MVRA 1LI7A 2NUPB 2P1AA 3GORA 2Y3HA 5A6KA 3T9OA 4C3EA 1QZXA 2A69F 2R9RB 1W2WA 2VC9A 2XSEA 3JCUQ 3FVYA 4K0DA 4YT5A 3R7CA 2YEVA 2DGJA 1JPJA 3HKKA 5JS5A 3FXHA 2NG1A 4MVOA 1H9GA 3B29A 2EIKC 1H6GA 3ZC4A 3W8HA 4Q7CA 1G4US 4RD9A 4BEMJ 3RF3A 4CBEA 2D5RB 3W8IA 4E7SA 3FDQA 4DBRA 3A11A 2EPOA 3EZHA 4CS9C 4LACB 1PD0A 1QPUA 2X0CA 3HTKC 1MMDA 3LS1A 1EA8A 5D91A 1VYIA 2OQMA 1HMOA 3CZ6A 3BRJA 2J9VA 1YA7O 2YRFA 3QZCA 2LIGA 4E0HA 4PACA 3FOOA 3N24A 4CIPA 3U2MA 3Q6MA 1ORSC 2I15A 3JSZA 3E70C 3Q7GA 2ZXOA 1M2OA 3EHNA 5JLIA 2WZLA 1FAPB 3I5PA 3L8IA 3UMHA 3G50A 3JZ0A 3S28A 3ZWIA 5AC4A 4QDLA 5DLJA 1M56C 4E7ZA 2ZXPA 5A6JA 4JRZA 3MBGA 1BBHA 2EPLX 3BEHA 4O6YA 5T1DB 2R7XA 2EPNA 3UMIA 3QVZA 3MX3A 1LS4A 2FFHA 3NMJA 3EGXA 4YT8A 1T9KA 4EBJA 1KU2A 1YAUO 3L1MA 4O6NA 2WVOA 3NKDA 1Z7Qc 3M1CB 4CDYA 3TD7A 1U0BB 3C18A 2PX0A 3QW0A 5DQTA 2Q00A 5B1BC 2YLGA 3RVYA 2XXAB 4PK4A 2GDCA 4JEBA 1TWAA 2QLAA 3QVYA 1YJGA 4NTFA 5EK0A 4EUKB 1DOVA 3RFYA 4HFKB 3T4RA 1QQ3A 2OG2A 5A6BD 2OJQA 2AVKA 1RKEA 1JAFA 3B0PA 3SXZA 2M4EA 1V74B 3NYJA 3K7DA 1D0ZA 3ITFA 3NRHA 3U5SA 2R7TA 2EPMX 2R03A 1NSGB 2XXAA 1M6TA 5DS6A 1RMVA 4EIYA 2OEXA 1OKKA 1LKXA 3DM9B 3MLGA 1BR1A 1LE4A 1A0BA 2Y3GA 3C8GB 3S29A 2W4MA 2HMQA 1D1AA 4KNWA 5KYWA 1AUEA 1Q0DA 1XWJA 1QKRA 2GAQA 1RKCA 3JT1A 2EILC 2YQYA 1ZHTA 3ZQYA 2J45A 2ZXRA 4EKWA 4ER9A 4BJ6C 3X1OA 1V4AA 2J7PD 3WAQA 2XLWA 2YL3A 4E18A 2IM8A 3U9MA 2XLVA 2HS5A 1FR0A 3G4ZA 3EQLF 4EBBA 2LK4A 5DVWA 3ZQVA 4NY3A 3V5XA 3EFOB 3NKEA 3FAJA 3JRMO 3KL4A 1C03A 1K40A 2B0JA 3ABLC 4DJ9A 4X0RA 3UGOA 1OCRC 3NYLA 5FCLA 2Q9CA 2J9UA 2KNHA 3K66A 3W4YA 1ORYA 3DWWA 2XLMA 3GEHA 5FZTA 5KYXB 3C7JA 2C03A 1QSPA 4JCHA 3UR3C 1TWHA 5BQIA 1ST6A 4CSAA 4AL1A 1GQAA 2KW3C 2L9JA 4LLEA 4FAPB 1YVIA 4DRJB 4EWCA 3GM3A 1HE9A 4MVQA 3C8GA 4LDQA 1GM5A 1VTMP 4I3MA 3AOUA 4C3BA 3EG9A 5DS4A 4LLCA 3VRCA 2IXNA 4YL0A 3IQ5A 4K7BA 4PJJA 2LSEA 2NUTB 3FMSA 4U5FE 1LPEA 1Y6DA 3GWNA 4YJWA 2RSEB 3ZIBA 3B0VC 2W45A 3ATPA 2J46A 4N06A 3TK0A 2A6HF 4WGYA 2VASA 4YWQA 1YYXA 2PX3A 3RH3A 4B6IA 1AEPA 5KYNA 4MTOA 1M2VA 2HJ3A 3EH1A 4Z9HA 3NDBB 2HSBA 3ZG1A 2WZGA 1EI7A 3JTLO 4U5DE 5E3AA 3EH2A 3PDMP 1BR2A 4OIPF 3UGPA 1BDJB 2DYRC 4JC7A 3H65A 4JKVA 1HW1A 3K6BA 4XWJA 3S9OA 3O39A 4HE8D 2QY9A 3J06A 1TKNA 4N6CA 4JVSA 2LQGA 3EGDB 3HJCA 1H9TA 3LEOA 3A9CA 2L6GA 2P0NA 1Z3IX 2WZFA 2JD3A 4YT4A 2EIMC 1H7IA 3OA1A 3SP1A 3LNMB 1RJ9B 2Q3TA 1L7CA 1S05A 5JRAA 1ZU5A 4XPYA 1MMNA 2XLDA 3T6JA 2R05A 3WG7C 4XLNF 4NTAA 5JVEA 4KBLA 5BUOA 2DYSC 1Q0FA 3SYNA 4ZLDA 1FFTC 3N0TA 1MNEA 1HMDA 1J8YF 1JOGA 1WTYA 1LM3B 2OU6A 2QE9A 4G78A 4CS8A 2CYDA 3NYMA 3T6BA 4IRUA 1LVKA 2J0WA 3AQBA 2QUPA 2LP4A 3FAPB 2BC5A 2AU5A 3AGTA 1A7VA 3I5QA 5L3VA 2H7OA 2HMZA 4QI0A 1YLMA 4BJTA 3FHDA 1LS1A 3GEIA 2A1DD 3IHUA 1ZYRF 2AWYA 1I5NA 3UMKA 2C04A 3RQEA 2XM0A 5L3QA 3DMDA 3AG2C 2J9WA 3U0CA 2R7SA 4HFFB 2XM4A 2IYLD 4U5EE 3TQOA 2HSQA 4CX9A 2XL8A 2G3KA 2CDQA 3JRTA 2NUPA 1UG7A 4MNDA 1HY5A 3S27A 5BQGA 4ULWA 3EGDA 4XPWA 3B0UX 1PD1A 3DAGA 5L0CA 4BG0A 1YZCA 2YHSA 4JEAA 1OXKA 3WODF 5JP7A 4QI2A 2PFDA 5B3SC 1Z5ZA 2Z15A 1K04A 1TR2A 5COGA 2KYHA 3ASNC 4E17A 3F46A 1YZAA 2CW0F 3U9JA 5EHHA 3LJBA 2XRHA 1MQVA 2HV6A 2IBFA 3K1IC 3W2WA 3RW0A 1ZU4A 1CPQA 3QTHA 2PBEA 2UUIA 2VCAA 4GYTA 4P6IC 1BR4A 2HV7A 2QNLA 5A6BA 1PCXA 3DI5A 3GWLA 3KYIA 2HJMA 2YLIA 1WGWA 4J7TA 5KYYB 4AE4B 1ZW3A 4DRIB 4WGZA 2YL0A 1SF8A 3ASOC 4EHPA 3IQCA 4CJGA 4O6MA 4JTDB 1QVXA 3U2LA 3PMRA 2EIJC 1OCOC 2OKUA 4AL0A 2YLDA 4CS7A 2GA0A 4CIHA 3TULA 4G7OF 1K05A 1BZ4A 1RXQA 2H8AA 3GANA 3KYJA 4J30B 4JTCB 3ZTZA 1AVOB 2CNWD 4LDKA 1OW7A 4IAOA 3RYLA 4CS9A 4DVZA 1SZIA 3NMKA 2YL7A 2MWQA 2IXMA 1ZVZA 3C63A 4WJ0A 5T3WA 3O10A 1LI5A 5B3IA 4NTBA 4YT2A 2Q9AA 2YZSA 2Y3DA 4XLPF 3EHMA 1T01A 2JPUA 4BJ5C 4BEJA 2R7WA 3ZTMA 4DRHB 2LCHA 1QLEC 3DJNB 4W8PA 5DQZA 4D4NA 1CGOA 5KYUB 2P7VA 1R5ID 2OJED 2ZXWC 2ASRA 3FOPA 2A68F 2G62A 4I1MA 2GWWA 3AG4C 4U9EA 5E33A 4A2NB 3LAYA 3R2PA 4J7YA 3HNKA 1Z6AA 4XEKA 2GFHA 3DE8A 5GPGB 4BPMA 4JCZA 2CGEA 4AE4A 1E84A 1E2XA 3EJNA 3CEXA 3ABMC 3U8PA 1T6QA 2KSFA 2VB6A 1G4WR 4AX2A 4E0IA 2BE5F 3HNLA 1Z23A 4GEHA 4NC3A 3DAFA 3DZAA 1VK5A 4D4XA 1SMYF 1D1CA 1VYKA 1YYJA 1WOLA 2NSFA 2YL1A 3JYHA 3Q7LA 2OEVA 4MQ9F 1JMWA 3OWTA 4MTGA 4U5GA 2VCCA 3IQTA 4PJNA 1IZMA 3AG1C 1ZHWA 3TOMA 2HZ8A 2R02A 2A0BA 2M64A 1DOWA 1YA9A 1S7ZA 4JE9A 3M4CA 1NZEA 2EINC 3US6A 2I8BA 1EQ1A 2A0UA 1V55C 3NG1A 2PP4A 4XEVA 1L3PA 4JJFA 1GS9A 4O79A 5B1AC 3LS0A 2YKZA 1OQCA 2NSGA 1FMVA 1OR2A 1FTSA 2NPUA 3MYIA 5AC5A 2DI3A 5COFA 2KGOA 1MNDA 1FMWA 2H7BA 5JT4A 5HSWA 3EFOA 4Q4ZF 1SYQA 2RD9A 2LD6A 4DOZA 1NBBA 3WHNA 2KJGA 5DS5A 1FFHA 2HFIA 3K33A 3SZRA 3LLKA 3DD7A 3QW1A 4U5BE 1TQGA 2P6VA 1O87A 1C02A 1C17M 2J8WA 2R7QA 5KYXA 4BJ6A 3B9QA 3N2ZB 5TJ5E 3ZVRA 1ZHXA 1M57C 3X2QC 1MMAA 2YWAA 4LERA 4YL3A 2OOCA 3KH2A 3LUTB 1PV3A 4M63A 4YN0B 2IXPA 4F4BA 2EPKX 4YL1A 4FWVA 4PFOA 1O5HA 3LESA 3SXKA 1Q0KA 3DKAA 2J9BA 3M79A 3O55A 2NUTA 3S90A 4U5CE 5CI8A 4G0HA 4RDAA 4DVYP 3V5ZA 4ONSA 5BQHA 3RIPA 1TWCA 3AGUA 5HV9A 1Q0MA 5IY5C 2PNOA 1VMAA 4P9TA 3SEOA 5L0IA 3JYYA 1VLTA 2QTVA 2R7VA 1A7EA 3CSKA 1CPRA 1OW8A 1XZQA 256BA 2BL2A 2O9XA 3NMIA 3VAYA 1OCCC 4OIOF 3I4UA 3JSEO 5COMA 4PFPA 2WB7A 3GM2A 2JX0A 4ANJA 4G7ZF 5L0DA 3IQ6A 3CAXA 3EGXB 3U8VA 3ZSUA 3AQCA 2V26A 4MVMA 4C7OB 4CJOA 4NCQA 1A7DA 2Q4FA 3LEVA 4XPXA 2LFDA 3AJMA 2MYSA 2WVNA 5F28E 4G7HF 4MVSA 4CDAA 1RJ9A 2XL4A 1NU9C 3C8ZA 2MHRA 1CGNA 4Z9JA 3VM6A 3H2VA 1RKEB 5D92A 3RKOF 1V54C 3QMKA 3AG3C 3L34A 4EBKA 1LIHA 1OR3A 4IAQA 1WASA 4XQ1A 4XTKA 2YVKA 3TOLA 5CIVA 1N1CA 1U6HA 4JIOA 2ETSA 2AWCA 5L0GA 2R7UA 3Q6NA 4Q5SF 1O3UA 1VOMA 4OIRF 3MYFA 3KPHA 3SXMA 3DXJF 3LLIA 2FGYA 1XZPA 4OD5A 5KYWB 3C62A 3T6GB 5F5HA 3PHF2 2L7AA 2OCCC 3U3BA 1TWGA 2J0XA 1ZZPA 4LDRA 5L0FA 3RQGA 1A41A 1CGME 1KTMA 5E2QA 1SR2A 2H7VC 1OW6A 3S84A 2Y69C
chains in the Genus database with same CATH topology
1QVXA 1WWPA 2L6FA 3AJMA 4XEKA 5F28E 4XEFA 3TULA 1JOGA 1K05A 1WTYA 2HSBA 2KK1A 3C8GB 1K04A 4EBJA 4R32A 3MFNA 1OW7A 4NQFA 1UFBA 3BRJA 3B71A 3RQFA 3C18A 3S9OA 2Q00A 3O10A 3JYYA 4EBKA 1WOLA 3GM3A 2PBEA 2L6HA 1V4AA 1OW8A 3C8GA 3L8JA 2L6GA 3RQEA 3U3FA 3C8GD 2JPUA 2JX0A 3GM1A 3GM2A 1O3UA 3U0CA 2LK4A 2YWAA 3L8IA 1KNYA 1PV3A 3K7DA 3JZ0A 1KTMA 1ZZPA 1K40A 4XEVA 3RQGA 1OW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVX A;  1WWP A;  2L6F A;  3AJM A;  4XEK A;  5F28 E;  4XEF A;  3TUL A;  1JOG A;  1K05 A;  1WTY A;  2HSB A;  2KK1 A;  3C8G B;  1K04 A;  4EBJ A;  4R32 A;  3MFN A;  1OW7 A;  4NQF A;  1UFB A;  3BRJ A;  3B71 A;  3RQF A;  3C18 A;  3S9O A;  2Q00 A;  3O10 A;  3JYY A;  4EBK A;  1WOL A;  3GM3 A;  2PBE A;  2L6H A;  1V4A A;  1OW8 A;  3C8G A;  3L8J A;  2L6G A;  3RQE A;  3U3F A;  3C8G D;  2JPU A;  2JX0 A;  3GM1 A;  3GM2 A;  1O3U A;  3U0C A;  2LK4 A;  2YWA A;  3L8I A;  1KNY A;  1PV3 A;  3K7D A;  3JZ0 A;  1KTM A;  1ZZP A;  1K40 A;  4XEV A;  3RQG A;  1OW6 A; 
#chains in the Genus database with same CATH topology
 2KQ9 A;  1ZHY A;  2XLH A;  1FNT c;  1NFN A;  1TFK B;  2W4B A;  3DJU B;  4HEA J;  4CSA C;  2CNW A;  1Y4C A;  3ABK C;  4C7O A;  3IEE A;  3ECS A;  3HLZ A;  2Y3B A;  3B71 A;  4U9D A;  2E87 A;  1D0X A;  1WN0 A;  1APC A;  1NU7 D;  1WAT A;  4DBQ A;  2XS8 A;  2J7P A;  2Y39 A;  4IWB A;  4UDV A;  5A6A A;  1LE2 A;  2A6E F;  1GGQ A;  2X51 A;  3G4X A;  3KMI A;  3O6X A;  1B68 A;  2Q7R A;  3SXY A;  2XLO A;  2XS1 A;  4JTA B;  2TMV P;  3U3F A;  4IB4 A;  1T6U A;  2L81 A;  2UUH A;  3GM1 A;  3LNR A;  5AGF A;  2F22 A;  1JRA A;  3HNJ A;  4I1O B;  3K1H A;  4KI2 A;  2Q9B A;  3M15 A;  1ORJ A;  4IGG A;  1E85 A;  4Z9I A;  1E83 A;  3E9V A;  1R4T A;  1D1B A;  3VYW A;  1G8X A;  5A69 A;  1WWP A;  4DXW A;  2L6F A;  2ZD9 A;  2FAP B;  4FES A;  4JUR I;  2R7R A;  5KYY A;  1J8M F;  1NG1 A;  2KK1 A;  1OKK D;  2IOQ A;  3EG9 B;  2ICW G;  3EZI A;  3IPM O;  4W8K A;  1E86 A;  2XLE A;  1Z63 A;  3GOD A;  4IJJ A;  4NQF A;  4ZLC A;  5EGY A;  1TFO B;  2V3C C;  4P9F A;  5L0H A;  1Q0G A;  2KC3 A;  3DE9 A;  4JW1 A;  4JZA A;  3PCV A;  4CDV A;  1U89 A;  3K1I A;  3UNG C;  3SNH A;  2PF4 E;  4N4W A;  3EPV A;  1M2V B;  4BJ1 A;  4C3D A;  1T6I A;  4U5H A;  5JSL A;  1G5Z A;  3CQZ A;  1KNY A;  2R7O A;  2IXO A;  2G3V A;  3TJ5 A;  1JPN A;  1IW7 F;  5E3C A;  3H2U A;  4CS8 C;  1YDI A;  3V5Y A;  3ZDL A;  3KKB A;  3W2V A;  4J32 B;  1ZW2 A;  4KNV A;  5F5F A;  1VLS A;  3TJ6 A;  4ULV A;  1HW2 A;  5T3T A;  2ZPA A;  4OIQ F;  4GQH A;  4R32 A;  3GEE A;  3MFN A;  4JJG A;  2R25 A;  1OXB A;  3OEO A;  4WAB A;  5KYU A;  1UFB A;  5K0I A;  5L0J A;  3RQF A;  3M4B A;  5JUA A;  3L0I A;  2CCY A;  4MVZ A;  2L6H A;  1I4Z A;  4N6H A;  4OD4 A;  2P61 A;  3L8J A;  4MTF A;  4YK5 A;  4AK9 A;  4OIN F;  3F47 A;  1VB5 A;  2VCB A;  3C8G D;  4FX5 A;  1D0Y A;  4MW3 A;  4PR9 A;  1I4Y A;  4I44 A;  4K1O A;  2HKV A;  2HUJ A;  4H54 A;  4O7G A;  5CI9 A;  3POV A;  4MW8 A;  4H4K C;  2B0H A;  4L6R A;  3RVZ A;  4BJ5 A;  1HE1 A;  2AP3 A;  2W9Y A;  2LFF A;  1NLX A;  2XL6 A;  1T5O A;  4A4A A;  1OCZ C;  2VH3 A;  4KC9 A;  4PJM A;  1MMG A;  4RBN A;  3VF0 A;  2D4U A;  3HNI A;  2WL8 A;  1YAR O;  4MS2 A;  1RCP A;  4MVU A;  4XEF A;  3S0X A;  1EKY A;  1NFO A;  2WVQ A;  1F1M A;  4PJL A;  1JR8 A;  4IAR A;  3DM5 A;  3V7O A;  1ZHZ A;  2DB4 A;  4MVR A;  1LI7 A;  2NUP B;  2P1A A;  3GOR A;  2Y3H A;  5A6K A;  3T9O A;  4C3E A;  1QZX A;  2A69 F;  2R9R B;  1W2W A;  2VC9 A;  2XSE A;  3JCU Q;  3FVY A;  4K0D A;  4YT5 A;  3R7C A;  2YEV A;  2DGJ A;  1JPJ A;  3HKK A;  5JS5 A;  3FXH A;  2NG1 A;  4MVO A;  1H9G A;  3B29 A;  2EIK C;  1H6G A;  3ZC4 A;  3W8H A;  4Q7C A;  1G4U S;  4RD9 A;  4BEM J;  3RF3 A;  4CBE A;  2D5R B;  3W8I A;  4E7S A;  3FDQ A;  4DBR A;  3A11 A;  2EPO A;  3EZH A;  4CS9 C;  4LAC B;  1PD0 A;  1QPU A;  2X0C A;  3HTK C;  1MMD A;  3LS1 A;  1EA8 A;  5D91 A;  1VYI A;  2OQM A;  1HMO A;  3CZ6 A;  3BRJ A;  2J9V A;  1YA7 O;  2YRF A;  3QZC A;  2LIG A;  4E0H A;  4PAC A;  3FOO A;  3N24 A;  4CIP A;  3U2M A;  3Q6M A;  1ORS C;  2I15 A;  3JSZ A;  3E70 C;  3Q7G A;  2ZXO A;  1M2O A;  3EHN A;  5JLI A;  2WZL A;  1FAP B;  3I5P A;  3L8I A;  3UMH A;  3G50 A;  3JZ0 A;  3S28 A;  3ZWI A;  5AC4 A;  4QDL A;  5DLJ A;  1M56 C;  4E7Z A;  2ZXP A;  5A6J A;  4JRZ A;  3MBG A;  1BBH A;  2EPL X;  3BEH A;  4O6Y A;  5T1D B;  2R7X A;  2EPN A;  3UMI A;  3QVZ A;  3MX3 A;  1LS4 A;  2FFH A;  3NMJ A;  3EGX A;  4YT8 A;  1T9K A;  4EBJ A;  1KU2 A;  1YAU O;  3L1M A;  4O6N A;  2WVO A;  3NKD A;  1Z7Q c;  3M1C B;  4CDY A;  3TD7 A;  1U0B B;  3C18 A;  2PX0 A;  3QW0 A;  5DQT A;  2Q00 A;  5B1B C;  2YLG A;  3RVY A;  2XXA B;  4PK4 A;  2GDC A;  4JEB A;  1TWA A;  2QLA A;  3QVY A;  1YJG A;  4NTF A;  5EK0 A;  4EUK B;  1DOV A;  3RFY A;  4HFK B;  3T4R A;  1QQ3 A;  2OG2 A;  5A6B D;  2OJQ A;  2AVK A;  1RKE A;  1JAF A;  3B0P A;  3SXZ A;  2M4E A;  1V74 B;  3NYJ A;  3K7D A;  1D0Z A;  3ITF A;  3NRH A;  3U5S A;  2R7T A;  2EPM X;  2R03 A;  1NSG B;  2XXA A;  1M6T A;  5DS6 A;  1RMV A;  4EIY A;  2OEX A;  1OKK A;  1LKX A;  3DM9 B;  3MLG A;  1BR1 A;  1LE4 A;  1A0B A;  2Y3G A;  3C8G B;  3S29 A;  2W4M A;  2HMQ A;  1D1A A;  4KNW A;  5KYW A;  1AUE A;  1Q0D A;  1XWJ A;  1QKR A;  2GAQ A;  1RKC A;  3JT1 A;  2EIL C;  2YQY A;  1ZHT A;  3ZQY A;  2J45 A;  2ZXR A;  4EKW A;  4ER9 A;  4BJ6 C;  3X1O A;  1V4A A;  2J7P D;  3WAQ A;  2XLW A;  2YL3 A;  4E18 A;  2IM8 A;  3U9M A;  2XLV A;  2HS5 A;  1FR0 A;  3G4Z A;  3EQL F;  4EBB A;  2LK4 A;  5DVW A;  3ZQV A;  4NY3 A;  3V5X A;  3EFO B;  3NKE A;  3FAJ A;  3JRM O;  3KL4 A;  1C03 A;  1K40 A;  2B0J A;  3ABL C;  4DJ9 A;  4X0R A;  3UGO A;  1OCR C;  3NYL A;  5FCL A;  2Q9C A;  2J9U A;  2KNH A;  3K66 A;  3W4Y A;  1ORY A;  3DWW A;  2XLM A;  3GEH A;  5FZT A;  5KYX B;  3C7J A;  2C03 A;  1QSP A;  4JCH A;  3UR3 C;  1TWH A;  5BQI A;  1ST6 A;  4CSA A;  4AL1 A;  1GQA A;  2KW3 C;  2L9J A;  4LLE A;  4FAP B;  1YVI A;  4DRJ B;  4EWC A;  3GM3 A;  1HE9 A;  4MVQ A;  3C8G A;  4LDQ A;  1GM5 A;  1VTM P;  4I3M A;  3AOU A;  4C3B A;  3EG9 A;  5DS4 A;  4LLC A;  3VRC A;  2IXN A;  4YL0 A;  3IQ5 A;  4K7B A;  4PJJ A;  2LSE A;  2NUT B;  3FMS A;  4U5F E;  1LPE A;  1Y6D A;  3GWN A;  4YJW A;  2RSE B;  3ZIB A;  3B0V C;  2W45 A;  3ATP A;  2J46 A;  4N06 A;  3TK0 A;  2A6H F;  4WGY A;  2VAS A;  4YWQ A;  1YYX A;  2PX3 A;  3RH3 A;  4B6I A;  1AEP A;  5KYN A;  4MTO A;  1M2V A;  2HJ3 A;  3EH1 A;  4Z9H A;  3NDB B;  2HSB A;  3ZG1 A;  2WZG A;  1EI7 A;  3JTL O;  4U5D E;  5E3A A;  3EH2 A;  3PDM P;  1BR2 A;  4OIP F;  3UGP A;  1BDJ B;  2DYR C;  4JC7 A;  3H65 A;  4JKV A;  1HW1 A;  3K6B A;  4XWJ A;  3S9O A;  3O39 A;  4HE8 D;  2QY9 A;  3J06 A;  1TKN A;  4N6C A;  4JVS A;  2LQG A;  3EGD B;  3HJC A;  1H9T A;  3LEO A;  3A9C A;  2L6G A;  2P0N A;  1Z3I X;  2WZF A;  2JD3 A;  4YT4 A;  2EIM C;  1H7I A;  3OA1 A;  3SP1 A;  3LNM B;  1RJ9 B;  2Q3T A;  1L7C A;  1S05 A;  5JRA A;  1ZU5 A;  4XPY A;  1MMN A;  2XLD A;  3T6J A;  2R05 A;  3WG7 C;  4XLN F;  4NTA A;  5JVE A;  4KBL A;  5BUO A;  2DYS C;  1Q0F A;  3SYN A;  4ZLD A;  1FFT C;  3N0T A;  1MNE A;  1HMD A;  1J8Y F;  1JOG A;  1WTY A;  1LM3 B;  2OU6 A;  2QE9 A;  4G78 A;  4CS8 A;  2CYD A;  3NYM A;  3T6B A;  4IRU A;  1LVK A;  2J0W A;  3AQB A;  2QUP A;  2LP4 A;  3FAP B;  2BC5 A;  2AU5 A;  3AGT A;  1A7V A;  3I5Q A;  5L3V A;  2H7O A;  2HMZ A;  4QI0 A;  1YLM A;  4BJT A;  3FHD A;  1LS1 A;  3GEI A;  2A1D D;  3IHU A;  1ZYR F;  2AWY A;  1I5N A;  3UMK A;  2C04 A;  3RQE A;  2XM0 A;  5L3Q A;  3DMD A;  3AG2 C;  2J9W A;  3U0C A;  2R7S A;  4HFF B;  2XM4 A;  2IYL D;  4U5E E;  3TQO A;  2HSQ A;  4CX9 A;  2XL8 A;  2G3K A;  2CDQ A;  3JRT A;  2NUP A;  1UG7 A;  4MND A;  1HY5 A;  3S27 A;  5BQG A;  4ULW A;  3EGD A;  4XPW A;  3B0U X;  1PD1 A;  3DAG A;  5L0C A;  4BG0 A;  1YZC A;  2YHS A;  4JEA A;  1OXK A;  3WOD F;  5JP7 A;  4QI2 A;  2PFD A;  5B3S C;  1Z5Z A;  2Z15 A;  1K04 A;  1TR2 A;  5COG A;  2KYH A;  3ASN C;  4E17 A;  3F46 A;  1YZA A;  2CW0 F;  3U9J A;  5EHH A;  3LJB A;  2XRH A;  1MQV A;  2HV6 A;  2IBF A;  3K1I C;  3W2W A;  3RW0 A;  1ZU4 A;  1CPQ A;  3QTH A;  2PBE A;  2UUI A;  2VCA A;  4GYT A;  4P6I C;  1BR4 A;  2HV7 A;  2QNL A;  5A6B A;  1PCX A;  3DI5 A;  3GWL A;  3KYI A;  2HJM A;  2YLI A;  1WGW A;  4J7T A;  5KYY B;  4AE4 B;  1ZW3 A;  4DRI B;  4WGZ A;  2YL0 A;  1SF8 A;  3ASO C;  4EHP A;  3IQC A;  4CJG A;  4O6M A;  4JTD B;  1QVX A;  3U2L A;  3PMR A;  2EIJ C;  1OCO C;  2OKU A;  4AL0 A;  2YLD A;  4CS7 A;  2GA0 A;  4CIH A;  3TUL A;  4G7O F;  1K05 A;  1BZ4 A;  1RXQ A;  2H8A A;  3GAN A;  3KYJ A;  4J30 B;  4JTC B;  3ZTZ A;  1AVO B;  2CNW D;  4LDK A;  1OW7 A;  4IAO A;  3RYL A;  4CS9 A;  4DVZ A;  1SZI A;  3NMK A;  2YL7 A;  2MWQ A;  2IXM A;  1ZVZ A;  3C63 A;  4WJ0 A;  5T3W A;  3O10 A;  1LI5 A;  5B3I A;  4NTB A;  4YT2 A;  2Q9A A;  2YZS A;  2Y3D A;  4XLP F;  3EHM A;  1T01 A;  2JPU A;  4BJ5 C;  4BEJ A;  2R7W A;  3ZTM A;  4DRH B;  2LCH A;  1QLE C;  3DJN B;  4W8P A;  5DQZ A;  4D4N A;  1CGO A;  5KYU B;  2P7V A;  1R5I D;  2OJE D;  2ZXW C;  2ASR A;  3FOP A;  2A68 F;  2G62 A;  4I1M A;  2GWW A;  3AG4 C;  4U9E A;  5E33 A;  4A2N B;  3LAY A;  3R2P A;  4J7Y A;  3HNK A;  1Z6A A;  4XEK A;  2GFH A;  3DE8 A;  5GPG B;  4BPM A;  4JCZ A;  2CGE A;  4AE4 A;  1E84 A;  1E2X A;  3EJN A;  3CEX A;  3ABM C;  3U8P A;  1T6Q A;  2KSF A;  2VB6 A;  1G4W R;  4AX2 A;  4E0I A;  2BE5 F;  3HNL A;  1Z23 A;  4GEH A;  4NC3 A;  3DAF A;  3DZA A;  1VK5 A;  4D4X A;  1SMY F;  1D1C A;  1VYK A;  1YYJ A;  1WOL A;  2NSF A;  2YL1 A;  3JYH A;  3Q7L A;  2OEV A;  4MQ9 F;  1JMW A;  3OWT A;  4MTG A;  4U5G A;  2VCC A;  3IQT A;  4PJN A;  1IZM A;  3AG1 C;  1ZHW A;  3TOM A;  2HZ8 A;  2R02 A;  2A0B A;  2M64 A;  1DOW A;  1YA9 A;  1S7Z A;  4JE9 A;  3M4C A;  1NZE A;  2EIN C;  3US6 A;  2I8B A;  1EQ1 A;  2A0U A;  1V55 C;  3NG1 A;  2PP4 A;  4XEV A;  1L3P A;  4JJF A;  1GS9 A;  4O79 A;  5B1A C;  3LS0 A;  2YKZ A;  1OQC A;  2NSG A;  1FMV A;  1OR2 A;  1FTS A;  2NPU A;  3MYI A;  5AC5 A;  2DI3 A;  5COF A;  2KGO A;  1MND A;  1FMW A;  2H7B A;  5JT4 A;  5HSW A;  3EFO A;  4Q4Z F;  1SYQ A;  2RD9 A;  2LD6 A;  4DOZ A;  1NBB A;  3WHN A;  2KJG A;  5DS5 A;  1FFH A;  2HFI A;  3K33 A;  3SZR A;  3LLK A;  3DD7 A;  3QW1 A;  4U5B E;  1TQG A;  2P6V A;  1O87 A;  1C02 A;  1C17 M;  2J8W A;  2R7Q A;  5KYX A;  4BJ6 A;  3B9Q A;  3N2Z B;  5TJ5 E;  3ZVR A;  1ZHX A;  1M57 C;  3X2Q C;  1MMA A;  2YWA A;  4LER A;  4YL3 A;  2OOC A;  3KH2 A;  3LUT B;  1PV3 A;  4M63 A;  4YN0 B;  2IXP A;  4F4B A;  2EPK X;  4YL1 A;  4FWV A;  4PFO A;  1O5H A;  3LES A;  3SXK A;  1Q0K A;  3DKA A;  2J9B A;  3M79 A;  3O55 A;  2NUT A;  3S90 A;  4U5C E;  5CI8 A;  4G0H A;  4RDA A;  4DVY P;  3V5Z A;  4ONS A;  5BQH A;  3RIP A;  1TWC A;  3AGU A;  5HV9 A;  1Q0M A;  5IY5 C;  2PNO A;  1VMA A;  4P9T A;  3SEO A;  5L0I A;  3JYY A;  1VLT A;  2QTV A;  2R7V A;  1A7E A;  3CSK A;  1CPR A;  1OW8 A;  1XZQ A;  256B A;  2BL2 A;  2O9X A;  3NMI A;  3VAY A;  1OCC C;  4OIO F;  3I4U A;  3JSE O;  5COM A;  4PFP A;  2WB7 A;  3GM2 A;  2JX0 A;  4ANJ A;  4G7Z F;  5L0D A;  3IQ6 A;  3CAX A;  3EGX B;  3U8V A;  3ZSU A;  3AQC A;  2V26 A;  4MVM A;  4C7O B;  4CJO A;  4NCQ A;  1A7D A;  2Q4F A;  3LEV A;  4XPX A;  2LFD A;  3AJM A;  2MYS A;  2WVN A;  5F28 E;  4G7H F;  4MVS A;  4CDA A;  1RJ9 A;  2XL4 A;  1NU9 C;  3C8Z A;  2MHR A;  1CGN A;  4Z9J A;  3VM6 A;  3H2V A;  1RKE B;  5D92 A;  3RKO F;  1V54 C;  3QMK A;  3AG3 C;  3L34 A;  4EBK A;  1LIH A;  1OR3 A;  4IAQ A;  1WAS A;  4XQ1 A;  4XTK A;  2YVK A;  3TOL A;  5CIV A;  1N1C A;  1U6H A;  4JIO A;  2ETS A;  2AWC A;  5L0G A;  2R7U A;  3Q6N A;  4Q5S F;  1O3U A;  1VOM A;  4OIR F;  3MYF A;  3KPH A;  3SXM A;  3DXJ F;  3LLI A;  2FGY A;  1XZP A;  4OD5 A;  5KYW B;  3C62 A;  3T6G B;  5F5H A;  3PHF 2;  2L7A A;  2OCC C;  3U3B A;  1TWG A;  2J0X A;  1ZZP A;  4LDR A;  5L0F A;  3RQG A;  1A41 A;  1CGM E;  1KTM A;  5E2Q A;  1SR2 A;  2H7V C;  1OW6 A;  3S84 A;  2Y69 C; 
#chains in the Genus database with same CATH homology
 1QVX A;  1WWP A;  2L6F A;  3AJM A;  4XEK A;  5F28 E;  4XEF A;  3TUL A;  1JOG A;  1K05 A;  1WTY A;  2HSB A;  2KK1 A;  3C8G B;  1K04 A;  4EBJ A;  4R32 A;  3MFN A;  1OW7 A;  4NQF A;  1UFB A;  3BRJ A;  3B71 A;  3RQF A;  3C18 A;  3S9O A;  2Q00 A;  3O10 A;  3JYY A;  4EBK A;  1WOL A;  3GM3 A;  2PBE A;  2L6H A;  1V4A A;  1OW8 A;  3C8G A;  3L8J A;  2L6G A;  3RQE A;  3U3F A;  3C8G D;  2JPU A;  2JX0 A;  3GM1 A;  3GM2 A;  1O3U A;  3U0C A;  2LK4 A;  2YWA A;  3L8I A;  1KNY A;  1PV3 A;  3K7D A;  3JZ0 A;  1KTM A;  1ZZP A;  1K40 A;  4XEV A;  3RQG A;  1OW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...