3O39A

Crystal structure of spy
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
FKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKAKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFEKRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic protein related to spheroblast formation
publication title Genetic selection designed to stabilize proteins uncovers a chaperone called Spy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3o39A00
3O39A 2Y3DA 3OEOA 3ITFA 3LAYA 3ZG1A 3QZCA 2Y39A 2Y3HA 3EPVA 2Y3BA 2Y3GA
chains in the Genus database with same CATH superfamily
1ORYA 1EKYA 2LSEA 3A11A 4KNWA 2YWAA 1H9TA 3DM9B 4QI0A 4JTAB 1U0BB 4Z9IA 3U2LA 3F46A 3C7JA 2I8BA 4J7YA 5JP7A 2YLDA 3FMSA 3S27A 2NPUA 2DGJA 4MVQA 4ONSA 4PJLA 2RSEB 2PNOA 4PJMA 4CDYA 2FFHA 3M4BA 4Q4ZF 4QI2A 1PCXA 4XWJA 3PCVA 1T6UA 2PP4A 2B0HA 4G7HF 3KPHA 2YKZA 3O10A 2Q9CA 1IZMA 3X1OA 3U8PA 3L1MA 5A6BD 1M2OA 1VYIA 2NG1A 3FHDA 1S7ZA 4MTFA 1ZHWA 2Q9BA 3EG9A 2WZGA 3RF3A 1PD0A 5L0JA 5A6AA 4IARA 3HNLA 1G4US 3ZIBA 1U6HA 2Y3HA 3EH2A 3GWNA 4ULWA 3MYFA 2I15A 1OKKD 1FTSA 2LFFA 3X2QC 3FXHA 1D1BA 4K0DA 3OEOA 4G7ZF 5D91A 1WASA 3IQTA 3AJMA 2NUPA 4KI2A 1TFOB 1YYJA 3EG9B 5CI8A 4N6HA 2A0BA 2KC3A 3LLIA 5DQTA 2YLGA 4U5BE 3Q6MA 2B0JA 4EIYA 4P6IC 5BQIA 2H7BA 1AVOB 1D0XA 1VB5A 2YL7A 4XEKA 1Q0KA 4C3DA 1ZW3A 2HMQA 1TWHA 3NMKA 4HFFB 3DAGA 2NUPB 3W8IA 3LNMB 1ZHXA 5K0IA 4MS2A 1HMOA 4NQFA 1OCZC 3G4XA 1QLEC 1ZHYA 2F22A 1E85A 2Z15A 4OD5A 1MMGA 2Y3BA 3EJNA 4U5EE 1JRAA 1V55C 4MVOA 1CGME 1I4ZA 5A69A 1O5HA 3FAPB 3EH1A 2ZXOA 3KMIA 3ATPA 2CCYA 3SXMA 1LS1A 2CNWA 3ZTZA 5A6JA 5B1BC 2MWQA 2XRHA 4E7SA 5L0IA 3DJUB 3L8IA 5DS6A 1OQCA 3U5SA 3RYLA 1O87A 4B6IA 2PX0A 4G7OF 2A69F 1ZHZA 2Y69C 4QDLA 3LS1A 1YJGA 2AU5A 4BJTA 2WVNA 1BBHA 5L0FA 1NU9C 2OKUA 3N2ZB 4OIRF 3U0CA 1GM5A 3A9CA 2IM8A 3JYYA 3W4YA 1LVKA 1ZU5A 3JRTA 3O39A 1ORJA 2V3CC 4DVZA 2R7TA 4JW1A 4MVZA 1WTYA 1EA8A 2CGEA 1MNDA 4IJJA 5T3TA 3T4RA 3T6BA 4A2NB 4DRJB 1QQ3A 2VCAA 3L34A 4PACA 4Z9JA 4U5GA 1TR2A 1CPRA 1BZ4A 2W4MA 2XM0A 4PFOA 5JS5A 2R7UA 1K40A 1XZPA 3IQ5A 2OJED 5D92A 3NDBB 3LAYA 3GEIA 3U2MA 3DWWA 5B3IA 1E83A 1NLXA 3H2VA 2KSFA 3CAXA 3WAQA 1MMDA 2IOQA 2R7WA 2E87A 1JPNA 5BQHA 1VMAA 1A7EA 3TOMA 4BG0A 1D1AA 1WWPA 3FAJA 2EPLX 3JTLO 5T3WA 4DOZA 4JJGA 1PD1A 1ST6A 4W8PA 2CW0F 2HMZA 2XS1A 2AWCA 1YAUO 1RCPA 3K1IA 3V7OA 1KU2A 1TQGA 5COGA 2ZXWC 4C3EA 4YT2A 4IGGA 2HV7A 4HE8D 2WVOA 3U3FA 4C3BA 5E33A 4BEJA 5JT4A 1A0BA 2J9VA 2EPKX 3JSZA 3B0PA 4DBRA 2EPNA 2KJGA 3AG2C 5KYUA 3GANA 2Q3TA 2XLMA 4OD4A 2XLVA 3W2VA 3WODF 1FFHA 4D4XA 3NYLA 3TULA 2IYLD 2J7PA 1QSPA 2CYDA 2J0XA 3LLKA 2Q00A 1HE9A 5L0DA 1ORSC 3OWTA 1ZYRF 2WZLA 3H2UA 4JEBA 1BDJB 2DYRC 3F47A 3K33A 3L0IA 4MTOA 3LUTB 5DLJA 4DXWA 3CEXA 2KQ9A 2QNLA 4GQHA 3IEEA 1LS4A 4RDAA 3SEOA 3SNHA 2EIKC 2MYSA 2W4BA 2YL0A 3NKDA 4I3MA 1W2WA 5AGFA 3ZQVA 4AX2A 4BEMJ 3JYHA 4YT5A 1WGWA 4XPYA 2VASA 3HNIA 4O6MA 1U89A 4CS9C 1N1CA 1MMNA 2H7OA 3I5QA 3VYWA 2J0WA 3I5PA 3AG4C 1OCCC 3ECSA 3HLZA 4AL1A 4DRHB 3QZCA 4CSAC 4H4KC 4XPXA 2IXOA 3C62A 1M2VA 2XL4A 3Q6NA 1K04A 4U5DE 1E2XA 4YT4A 2GDCA 2LD6A 1NZEA 3C8GD 1Y4CA 3EPVA 1AUEA 4FX5A 1D0YA 2XLEA 1VOMA 2OEVA 2A1DD 3JT1A 3GEEA 2UUHA 4WJ0A 2YRFA 3JRMO 2J45A 4MW3A 4MVSA 3VM6A 5JRAA 1A7DA 3EGDA 1M2VB 3RW0A 4CS8C 2GAQA 5BUOA 5AC4A 5A6BA 1H7IA 2R7XA 3ASOC 2HFIA 2H8AA 3CQZA 5A6KA 1E86A 4C7OA 1CGNA 2YEVA 2L6FA 3M15A 1HW2A 5KYYA 1M6TA 1KTMA 5TJ5E 4PJJA 1L7CA 1OKKA 5JLIA 4WGZA 2X51A 3CSKA 1JPJA 3LNRA 2L9JA 3E9VA 5CI9A 2R7SA 2OJQA 3EGDB 4JCHA 4CIPA 1Q0DA 4P9FA 2HJ3A 5F28E 1VTMP 4ER9A 1JAFA 4C7OB 2EIJC 3NMJA 5KYYB 2VB6A 3C63A 1ZW2A 1CPQA 1YZCA 5F5HA 2H7VC 4JC7A 2R7QA 4IB4A 3LESA 2R03A 1QVXA 4XTKA 1JR8A 1FMWA 2OOCA 1RKEA 3QVZA 1B68A 1MQVA 3GORA 1A41A 1APCA 2LP4A 2P0NA 3DXJF 2EIMC 3QW0A 4FWVA 3U3BA 3S0XA 2YL3A 3DJNB 1TWAA 3BRJA 3NKEA 4BJ5A 5DQZA 1Z63A 4MTGA 3ZSUA 2HKVA 2D5RB 2YLIA 3AOUA 2L6HA 3W2WA 1I5NA 1RKEB 2M64A 5GPGB 3U9JA 3N24A 4LDQA 3CZ6A 1QPUA 4G0HA 4PJNA 3DAFA 4DRIB 3RQGA 4EHPA 2NSFA 3QTHA 2RD9A 2WL8A 3L8JA 3EZHA 1LI5A 3R7CA 2VH3A 5KYUB 1V74B 3RQEA 4J30B 2G3KA 3SXYA 3NYJA 5L0HA 2R02A 2C04A 1OCRC 4E0HA 1VLSA 4EWCA 3B0UX 2ETSA 2VC9A 4BJ6A 4DBQA 5L0GA 3AGUA 1Z7Qc 2FAPB 2IXPA 2JPUA 3KYJA 3K1HA 2KK1A 3UGPA 2YL1A 3ZC4A 2PF4E 3UR3C 4E18A 2LK4A 2NUTA 2XL8A 1LKXA 4E17A 1RKCA 2HS5A 1DOWA 3DD7A 4I1OB 2R25A 5JSLA 4CX9A 2WVQA 5KYXA 5F5FA 1BR1A 1ZVZA 3I4UA 1LE4A 3NMIA 1DOVA 2A68F 3IQCA 4E7ZA 1QKRA 3QMKA 3SP1A 2XLOA 2J9UA 5HSWA 1OW8A 1UFBA 2IXMA 2NUTB 2KGOA 2HUJA 3T6GB 4AL0A 5KYXB 2AVKA 3GM1A 3KYIA 3O55A 3EZIA 4IWBA 1Z6AA 4H54A 3QW1A 2CDQA 1HW1A 3TK0A 1T6QA 1K05A 3PMRA 4JEAA 3ZWIA 4CDVA 3T9OA 3AG3C 4JRZA 5BQGA 3FOPA 2W45A 3EQLF 4JCZA 2TMVP 5B3SC 1AEPA 3RH3A 2G62A 4WGYA 3UMHA 5EGYA 2Q4FA 4U9DA 1HY5A 2YQYA 4X0RA 5E2QA 3VAYA 1I4YA 2Y39A 1WOLA 1RJ9A 3N0TA 3WHNA 1PV3A 4YN0B 2YHSA 3MFNA 2QE9A 2X0CA 4ZLCA 3RKOF 1LM3B 1ZZPA 4JKVA 4J32B 2QTVA 1C02A 4LLEA 3LJBA 1Q0MA 5JVEA 4A4AA 2VCCA 1G8XA 3VF0A 2OG2A 1O3UA 4NTFA 4NY3A 1OXBA 3J06A 1RJ9B 4U9EA 1YA9A 2ICWG 4EBKA 2A6EF 4O6NA 3B29A 5DS4A 3TOLA 1WATA 4MVRA 3C8GA 4L6RA 2LFDA 4RBNA 2D4UA 2QY9A 3DMDA 1SR2A 2HSBA 2PBEA 3RQFA 2OU6A 3C18A 3MX3A 3ZQYA 1TKNA 3ABMC 3DI5A 2P6VA 4MVMA 1Q0FA 1SYQA 4N06A 4DVYP 2IXNA 4JTDB 3B9QA 1FAPB 3HTKC 4U5CE 1GQAA 3HKKA 3TJ5A 2P7VA 3TD7A 4NTBA 1WN0A 1R5ID 2G3VA 3C8GB 3O6XA 4N4WA 4CDAA 4CJOA 1FNTc 5DS5A 4I44A 2XXAA 5JUAA 4Z9HA 3AGTA 2ZD9A 3KKBA 4MVUA 4CBEA 5E3CA 1IW7F 2W9YA 3E70C 4OIPF 1Z23A 1BR2A 1T9KA 3KH2A 3RFYA 4AE4A 4CS7A 2V26A 2J46A 1V54C 3EHNA 2IBFA 1GGQA 1YDIA 2Y3DA 4YJWA 1SMYF 2O9XA 3ITFA 4ULVA 3ZG1A 2XLDA 1Z5ZA 4KNVA 3IQ6A 3UGOA 1RMVA 4PFPA 5HV9A 2XXAB 3ASNC 4KC9A 3FVYA 4JJFA 1MMAA 2BL2A 2GFHA 3GWLA 2KNHA 2OCCC 4LACB 3WG7C 2AWYA 1KNYA 1G5ZA 3IHUA 1LIHA 1OR3A 3M79A 1M57C 4AE4B 2UUIA 2JX0A 2Q9AA 3S9OA 2P61A 1S05A 4N6CA 4AK9A 4E0IA 1E84A 3FDQA 2EPOA 5IY5C 1ZU4A 1OW7A 3K1IC 3V5XA 2J9BA 1EQ1A 4GEHA 2BE5F 3AQBA 1NFOA 3G50A 1JOGA 2DYSC 3SYNA 4JE9A 3V5YA 1JMWA 3V5ZA 4EKWA 4LDKA 4XLNF 1NFNA 2ZXRA 1TFKB 1H6GA 3AQCA 4CJGA 4YL0A 2HZ8A 1YVIA 3M1CB 3IPMO 1LE2A 3TQOA 4J7TA 1XZQA 1VYKA 3G4ZA 3UMKA 2XLWA 2FGYA 1TWCA 2LIGA 4YL1A 4OINF 3ZTMA 3H65A 4M63A 4D4NA 4CIHA 4EBJA 1GS9A 4GYTA 2L81A 3NG1A 1NSGB 3AG1C 3JZ0A 4RD9A 3EFOA 3S29A 5FCLA 2Q7RA 1QZXA 2OEXA 3KL4A 2KW3C 3MBGA 4R32A 3SXKA 4YT8A 1NU7D 1FMVA 2PFDA 3GODA 1YA7O 2R05A 4LERA 4LLCA 5B1AC 1EI7A 4DJ9A 1YARO 4PK4A 1VK5A 3GEHA 4NTAA 5FZTA 256BA 3DE8A 2OQMA 4ANJA 1M56C 3ZVRA 2C03A 2BC5A 2XM4A 1G4WR 4NC3A 2L7AA 2LCHA 3EFOB 1OW6A 3MYIA 3U8VA 1F1MA 3K7DA 3JCUQ 3R2PA 4LDRA 4O79A 4CS9A 5COMA 1YLMA 4IAQA 3S84A 1Q0GA 2A0UA 2A6HF 4NCQA 3K66A 4CSAA 4IRUA 1D1CA 1SZIA 2EILC 1T5OA 3EGXA 1VLTA 1L3PA 2XLHA 3S28A 3W8HA 5CIVA 1Z3IX 2ZPAA 4MQ9F 4I1MA 2XSEA 3S90A 4XPWA 2MHRA 3NYMA 2M4EA 2WZFA 4W8KA 4JURI 3VRCA 3DM5A 4YK5A 2R7VA 1NBBA 2CNWD 2J9WA 4F4BA 1T01A 1TWGA 2EINC 2L6GA 3PDMP 2J8WA 4OIQF 1SF8A 2AP3A 3EGXB 4K1OA 4CS8A 4G78A 4MNDA 5DVWA 4BJ1A 2YZSA 3US6A 5T1DB 4OIOF 2R7OA 2ASRA 1T6IA 2PX3A 3MLGA 4YL3A 5KYWA 3B0VC 4WABA 2LQGA 2KYHA 3JSEO 1LI7A 4O7GA 4O6YA 1C03A 5AC5A 1C17M 4PR9A 3EHMA 4IAOA 4U5FE 3RVZA 4EUKB 5L3QA 2EPMX 4UDVA 1ZHTA 3DZAA 3GM2A 2XS8A 3PHF2 4FESA 4Q5SF 1HMDA 4HEAJ 4JTCB 3UMIA 5KYWB 3C8ZA 3QVYA 1YYXA 1LPEA 3HNKA 4HFKB 1OR2A 1Y6DA 3LEVA 2HV6A 4U5HA 4KBLA 4XQ1A 3NRHA 1NG1A 3SZRA 3DE9A 3UNGC 4BJ5C 4XEVA 1CGOA 2DB4A 2P1AA 1UG7A 4XEFA 2GWWA 2VCBA 3GM3A 3ABKC 1OCOC 3B71A 1J8MF 4MW8A 2HJMA 4FAPB 2QLAA 2R7RA 1MNEA 1D0ZA 3SXZA 5E3AA 1H9GA 3ABLC 5KYNA 4JZAA 1BR4A 4JVSA 1RXQA 3DKAA 3RVYA 2Y3GA 3HNJA 1YZAA 4P9TA 3ZDLA 2QUPA 3T6JA 1A7VA 2DI3A 2YVKA 2J7PD 3FOOA 4EBBA 1R4TA 3OA1A 2HSQA 5EHHA 1V4AA 5COFA 3POVA 4ZLDA 4BJ6C 1HE1A 1FR0A 2NSGA 3RIPA 3U9MA 2R9RB 2WB7A 1FFTC 3LEOA 5L0CA 3K6BA 3TJ6A 3M4CA 1OXKA 1XWJA 3Q7LA 3BEHA 3LS0A 1J8YF 3Q7GA 5EK0A 4XLPF 4JIOA 4Q7CA 4BPMA 2ZXPA 2GA0A 2JD3A 2XL6A 3HJCA 5L3VA 4K7BA 4YWQA
chains in the Genus database with same CATH topology
2LSEA 4KNWA 3DM9B 4QI0A 3F46A 2I8BA 3S27A 2DGJA 4Q4ZF 4PJLA 4PJMA 2FFHA 4QI2A 1PCXA 4XWJA 2PP4A 4G7HF 2Q9CA 1IZMA 3X1OA 1M2OA 1VYIA 2NG1A 3FHDA 1S7ZA 1ZHWA 2Q9BA 3EG9A 2WZGA 1PD0A 3ZIBA 3EH2A 2Y3HA 4ULWA 3X2QC 1OKKD 1FTSA 4K0DA 1D1BA 3OEOA 4G7ZF 5D91A 4KI2A 2NUPA 5CI8A 3EG9B 3LLIA 5DQTA 4U5BE 3Q6MA 2B0JA 4P6IC 2H7BA 1D0XA 4C3DA 1TWHA 4HFFB 3DAGA 2NUPB 3W8IA 1ZHXA 1OCZC 1QLEC 1ZHYA 2Z15A 4OD5A 1MMGA 2Y3BA 3EJNA 4U5EE 1V55C 1O5HA 3EH1A 2ZXOA 3KMIA 1LS1A 2CNWA 5B1BC 2MWQA 2XRHA 3DJUB 5DS6A 3RYLA 1O87A 4B6IA 2PX0A 4G7OF 2A69F 1ZHZA 2Y69C 4QDLA 3LS1A 4BJTA 2WVNA 1NU9C 3N2ZB 4OIRF 1LVKA 1ZU5A 3JRTA 3O39A 2V3CC 4DVZA 2R7TA 4JW1A 3T6BA 4A2NB 2CGEA 1MNDA 4IJJA 5T3TA 3T4RA 3L34A 4U5GA 1TR2A 2W4MA 2R7UA 4PFOA 3NDBB 5D92A 3LAYA 1MMDA 2IOQA 2R7WA 2E87A 1JPNA 1VMAA 4BG0A 1D1AA 3FAJA 5T3WA 4DOZA 4JJGA 1PD1A 1ST6A 2CW0F 3V7OA 1KU2A 2ZXWC 4C3EA 4YT2A 4C3BA 2HV7A 4HE8D 2WVOA 5E33A 4BEJA 2J9VA 3JSZA 3B0PA 4DBRA 3AG2C 2KJGA 5KYUA 3GANA 2Q3TA 4OD4A 3W2VA 3WODF 1FFHA 3NYLA 2IYLD 2J7PA 2J0XA 3LLKA 3OWTA 1ZYRF 2WZLA 3F47A 2DYRC 3K33A 3L0IA 5DLJA 2KQ9A 4RDAA 3IEEA 3SEOA 5KYUB 3SNHA 2EIKC 2MYSA 2W4BA 3NKDA 4I3MA 1W2WA 3JYHA 4YT5A 1WGWA 2VASA 4O6MA 4CS9C 1N1CA 1MMNA 2H7OA 3I5QA 3VYWA 2J0WA 3I5PA 3AG4C 1OCCC 3ECSA 3HLZA 4CSAC 3QZCA 4H4KC 2IXOA 1M2VA 2XL4A 3Q6NA 4U5DE 4YT4A 1NZEA 3EPVA 4FX5A 1D0YA 1VOMA 2A1DD 3JT1A 4WJ0A 2J45A 3EGDA 1M2VB 4CS8C 2R7XA 5BUOA 3ASOC 3CQZA 4C7OA 2YEVA 5KYYA 4PJJA 1OKKA 2X51A 3CSKA 1JPJA 3LNRA 2L9JA 3E9VA 5CI9A 2R7SA 3EGDB 4JCHA 4C7OB 2EIJC 5KYYB 2VB6A 5F5HA 2H7VC 2R7QA 3LESA 4XTKA 1FMWA 3DXJF 2EIMC 4FWVA 3S0XA 3DJNB 1TWAA 3NKEA 4BJ5A 5DQZA 1Z63A 3ZSUA 2D5RB 3W2WA 3N24A 3CZ6A 4G0HA 4PJNA 3DAFA 2WL8A 3EZHA 2VH3A 4J30B 2G3KA 3NYJA 2C04A 1OCRC 4EWCA 3B0UX 4DBQA 4BJ6A 2IXPA 3UGPA 3K1HA 3ZC4A 2PF4E 3UR3C 2NUTA 1LKXA 5KYXA 3DD7A 4I1OB 2WVQA 5F5FA 1BR1A 3I4UA 2A68F 4E7ZA 3QMKA 3SP1A 2J9UA 5HSWA 2IXMA 2NUTB 2KGOA 5KYXB 3EZIA 4IWBA 1Z6AA 2CDQA 3PMRA 3AG3C 2W45A 3EQLF 5B3SC 3RH3A 2G62A 3UMHA 5EGYA 4X0RA 5E2QA 3VAYA 2Y39A 1RJ9A 3N0TA 4YN0B 2YHSA 4ZLCA 3RKOF 4J32B 2QTVA 4LLEA 3LJBA 1G8XA 2OG2A 4NY3A 1RJ9B 2A6EF 4O6NA 5DS4A 4AX2A 4RBNA 2QY9A 3DMDA 3MX3A 1TKNA 3ABMC 2P6VA 4N06A 4DVYP 2IXNA 3B9QA 3HTKC 4U5CE 2P7VA 3TD7A 2G3VA 3O6XA 5DS5A 2XXAA 4I44A 3KKBA 4CBEA 5E3CA 1IW7F 2W9YA 3E70C 4OIPF 1Z23A 1BR2A 3KH2A 3RFYA 4AE4A 4CS7A 2V26A 2J46A 1V54C 3EHNA 2Y3DA 4YJWA 1SMYF 2O9XA 3ITFA 3ZG1A 1Z5ZA 4KNVA 2XXAB 3UGOA 4PFPA 3ASNC 4KC9A 3FVYA 4JJFA 1MMAA 2GFHA 2KNHA 2OCCC 4LACB 3WG7C 4AE4B 1M57C 2Q9AA 4AK9A 3FDQA 5IY5C 1ZU4A 3K1IC 4GEHA 2BE5F 3AQBA 2DYSC 3SYNA 4XLNF 2ZXRA 3AQCA 3M1CB 1VYKA 3UMKA 2FGYA 1TWCA 4OINF 4CIHA 3H65A 4M63A 4GYTA 2L81A 3NG1A 3AG1C 4RD9A 3EFOA 3S29A 5FCLA 1QZXA 3KL4A 2KW3C 4YT8A 1NU7D 1FMVA 2PFDA 3GODA 4LERA 4LLCA 5B1AC 4PK4A 1VK5A 4ANJA 1M56C 3ZVRA 2C03A 4E7SA 3EFOB 4CS9A 3K7DA 3JCUQ 4O79A 2A6HF 3K66A 4CSAA 4IRUA 1D1CA 1SZIA 2EILC 3EGXA 3S28A 3W8HA 1Z3IX 2ZPAA 4MQ9F 4I1MA 2XSEA 3NYMA 2M4EA 2WZFA 4W8KA 4JURI 3DM5A 2R7VA 2CNWD 2J9WA 4F4BA 1TWGA 2EINC 4OIQF 1SF8A 3EGXB 4CS8A 5DVWA 4MNDA 4BJ1A 2YZSA 5T1DB 4OIOF 2R7OA 2PX3A 3MLGA 5KYWA 3B0VC 4O7GA 4O6YA 3EHMA 4IAOA 4U5FE 5L3QA 1ZHTA 3DZAA 3PHF2 4FESA 4Q5SF 3UMIA 4HEAJ 5KYWB 4HFKB 4U5HA 3LEVA 3SZRA 2HV6A 4KBLA 3NRHA 1NG1A 3UNGC 4BJ5C 3ABKC 1OCOC 1J8MF 2R7RA 1MNEA 1D0ZA 5E3AA 5KYNA 3ABLC 4JZAA 1BR4A 4JVSA 2Y3GA 3T6JA 2J7PD 4EBBA 3OA1A 5EHHA 4ZLDA 3POVA 4BJ6C 3RIPA 2WB7A 1FFTC 3K6BA 3Q7LA 3LS0A 1J8YF 3Q7GA 4XLPF 4Q7CA 2ZXPA 2JD3A 3HJCA 5L3VA 4K7BA 4YWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O39 A;  2Y3D A;  3OEO A;  3ITF A;  3LAY A;  3ZG1 A;  3QZC A;  2Y39 A;  2Y3H A;  3EPV A;  2Y3B A;  2Y3G A; 
#chains in the Genus database with same CATH topology
 1ORY A;  1EKY A;  2LSE A;  3A11 A;  4KNW A;  2YWA A;  1H9T A;  3DM9 B;  4QI0 A;  4JTA B;  1U0B B;  4Z9I A;  3U2L A;  3F46 A;  3C7J A;  2I8B A;  4J7Y A;  5JP7 A;  2YLD A;  3FMS A;  3S27 A;  2NPU A;  2DGJ A;  4MVQ A;  4ONS A;  4PJL A;  2RSE B;  2PNO A;  4PJM A;  4CDY A;  2FFH A;  3M4B A;  4Q4Z F;  4QI2 A;  1PCX A;  4XWJ A;  3PCV A;  1T6U A;  2PP4 A;  2B0H A;  4G7H F;  3KPH A;  2YKZ A;  3O10 A;  2Q9C A;  1IZM A;  3X1O A;  3U8P A;  3L1M A;  5A6B D;  1M2O A;  1VYI A;  2NG1 A;  3FHD A;  1S7Z A;  4MTF A;  1ZHW A;  2Q9B A;  3EG9 A;  2WZG A;  3RF3 A;  1PD0 A;  5L0J A;  5A6A A;  4IAR A;  3HNL A;  1G4U S;  3ZIB A;  1U6H A;  2Y3H A;  3EH2 A;  3GWN A;  4ULW A;  3MYF A;  2I15 A;  1OKK D;  1FTS A;  2LFF A;  3X2Q C;  3FXH A;  1D1B A;  4K0D A;  3OEO A;  4G7Z F;  5D91 A;  1WAS A;  3IQT A;  3AJM A;  2NUP A;  4KI2 A;  1TFO B;  1YYJ A;  3EG9 B;  5CI8 A;  4N6H A;  2A0B A;  2KC3 A;  3LLI A;  5DQT A;  2YLG A;  4U5B E;  3Q6M A;  2B0J A;  4EIY A;  4P6I C;  5BQI A;  2H7B A;  1AVO B;  1D0X A;  1VB5 A;  2YL7 A;  4XEK A;  1Q0K A;  4C3D A;  1ZW3 A;  2HMQ A;  1TWH A;  3NMK A;  4HFF B;  3DAG A;  2NUP B;  3W8I A;  3LNM B;  1ZHX A;  5K0I A;  4MS2 A;  1HMO A;  4NQF A;  1OCZ C;  3G4X A;  1QLE C;  1ZHY A;  2F22 A;  1E85 A;  2Z15 A;  4OD5 A;  1MMG A;  2Y3B A;  3EJN A;  4U5E E;  1JRA A;  1V55 C;  4MVO A;  1CGM E;  1I4Z A;  5A69 A;  1O5H A;  3FAP B;  3EH1 A;  2ZXO A;  3KMI A;  3ATP A;  2CCY A;  3SXM A;  1LS1 A;  2CNW A;  3ZTZ A;  5A6J A;  5B1B C;  2MWQ A;  2XRH A;  4E7S A;  5L0I A;  3DJU B;  3L8I A;  5DS6 A;  1OQC A;  3U5S A;  3RYL A;  1O87 A;  4B6I A;  2PX0 A;  4G7O F;  2A69 F;  1ZHZ A;  2Y69 C;  4QDL A;  3LS1 A;  1YJG A;  2AU5 A;  4BJT A;  2WVN A;  1BBH A;  5L0F A;  1NU9 C;  2OKU A;  3N2Z B;  4OIR F;  3U0C A;  1GM5 A;  3A9C A;  2IM8 A;  3JYY A;  3W4Y A;  1LVK A;  1ZU5 A;  3JRT A;  3O39 A;  1ORJ A;  2V3C C;  4DVZ A;  2R7T A;  4JW1 A;  4MVZ A;  1WTY A;  1EA8 A;  2CGE A;  1MND A;  4IJJ A;  5T3T A;  3T4R A;  3T6B A;  4A2N B;  4DRJ B;  1QQ3 A;  2VCA A;  3L34 A;  4PAC A;  4Z9J A;  4U5G A;  1TR2 A;  1CPR A;  1BZ4 A;  2W4M A;  2XM0 A;  4PFO A;  5JS5 A;  2R7U A;  1K40 A;  1XZP A;  3IQ5 A;  2OJE D;  5D92 A;  3NDB B;  3LAY A;  3GEI A;  3U2M A;  3DWW A;  5B3I A;  1E83 A;  1NLX A;  3H2V A;  2KSF A;  3CAX A;  3WAQ A;  1MMD A;  2IOQ A;  2R7W A;  2E87 A;  1JPN A;  5BQH A;  1VMA A;  1A7E A;  3TOM A;  4BG0 A;  1D1A A;  1WWP A;  3FAJ A;  2EPL X;  3JTL O;  5T3W A;  4DOZ A;  4JJG A;  1PD1 A;  1ST6 A;  4W8P A;  2CW0 F;  2HMZ A;  2XS1 A;  2AWC A;  1YAU O;  1RCP A;  3K1I A;  3V7O A;  1KU2 A;  1TQG A;  5COG A;  2ZXW C;  4C3E A;  4YT2 A;  4IGG A;  2HV7 A;  4HE8 D;  2WVO A;  3U3F A;  4C3B A;  5E33 A;  4BEJ A;  5JT4 A;  1A0B A;  2J9V A;  2EPK X;  3JSZ A;  3B0P A;  4DBR A;  2EPN A;  2KJG A;  3AG2 C;  5KYU A;  3GAN A;  2Q3T A;  2XLM A;  4OD4 A;  2XLV A;  3W2V A;  3WOD F;  1FFH A;  4D4X A;  3NYL A;  3TUL A;  2IYL D;  2J7P A;  1QSP A;  2CYD A;  2J0X A;  3LLK A;  2Q00 A;  1HE9 A;  5L0D A;  1ORS C;  3OWT A;  1ZYR F;  2WZL A;  3H2U A;  4JEB A;  1BDJ B;  2DYR C;  3F47 A;  3K33 A;  3L0I A;  4MTO A;  3LUT B;  5DLJ A;  4DXW A;  3CEX A;  2KQ9 A;  2QNL A;  4GQH A;  3IEE A;  1LS4 A;  4RDA A;  3SEO A;  3SNH A;  2EIK C;  2MYS A;  2W4B A;  2YL0 A;  3NKD A;  4I3M A;  1W2W A;  5AGF A;  3ZQV A;  4AX2 A;  4BEM J;  3JYH A;  4YT5 A;  1WGW A;  4XPY A;  2VAS A;  3HNI A;  4O6M A;  1U89 A;  4CS9 C;  1N1C A;  1MMN A;  2H7O A;  3I5Q A;  3VYW A;  2J0W A;  3I5P A;  3AG4 C;  1OCC C;  3ECS A;  3HLZ A;  4AL1 A;  4DRH B;  3QZC A;  4CSA C;  4H4K C;  4XPX A;  2IXO A;  3C62 A;  1M2V A;  2XL4 A;  3Q6N A;  1K04 A;  4U5D E;  1E2X A;  4YT4 A;  2GDC A;  2LD6 A;  1NZE A;  3C8G D;  1Y4C A;  3EPV A;  1AUE A;  4FX5 A;  1D0Y A;  2XLE A;  1VOM A;  2OEV A;  2A1D D;  3JT1 A;  3GEE A;  2UUH A;  4WJ0 A;  2YRF A;  3JRM O;  2J45 A;  4MW3 A;  4MVS A;  3VM6 A;  5JRA A;  1A7D A;  3EGD A;  1M2V B;  3RW0 A;  4CS8 C;  2GAQ A;  5BUO A;  5AC4 A;  5A6B A;  1H7I A;  2R7X A;  3ASO C;  2HFI A;  2H8A A;  3CQZ A;  5A6K A;  1E86 A;  4C7O A;  1CGN A;  2YEV A;  2L6F A;  3M15 A;  1HW2 A;  5KYY A;  1M6T A;  1KTM A;  5TJ5 E;  4PJJ A;  1L7C A;  1OKK A;  5JLI A;  4WGZ A;  2X51 A;  3CSK A;  1JPJ A;  3LNR A;  2L9J A;  3E9V A;  5CI9 A;  2R7S A;  2OJQ A;  3EGD B;  4JCH A;  4CIP A;  1Q0D A;  4P9F A;  2HJ3 A;  5F28 E;  1VTM P;  4ER9 A;  1JAF A;  4C7O B;  2EIJ C;  3NMJ A;  5KYY B;  2VB6 A;  3C63 A;  1ZW2 A;  1CPQ A;  1YZC A;  5F5H A;  2H7V C;  4JC7 A;  2R7Q A;  4IB4 A;  3LES A;  2R03 A;  1QVX A;  4XTK A;  1JR8 A;  1FMW A;  2OOC A;  1RKE A;  3QVZ A;  1B68 A;  1MQV A;  3GOR A;  1A41 A;  1APC A;  2LP4 A;  2P0N A;  3DXJ F;  2EIM C;  3QW0 A;  4FWV A;  3U3B A;  3S0X A;  2YL3 A;  3DJN B;  1TWA A;  3BRJ A;  3NKE A;  4BJ5 A;  5DQZ A;  1Z63 A;  4MTG A;  3ZSU A;  2HKV A;  2D5R B;  2YLI A;  3AOU A;  2L6H A;  3W2W A;  1I5N A;  1RKE B;  2M64 A;  5GPG B;  3U9J A;  3N24 A;  4LDQ A;  3CZ6 A;  1QPU A;  4G0H A;  4PJN A;  3DAF A;  4DRI B;  3RQG A;  4EHP A;  2NSF A;  3QTH A;  2RD9 A;  2WL8 A;  3L8J A;  3EZH A;  1LI5 A;  3R7C A;  2VH3 A;  5KYU B;  1V74 B;  3RQE A;  4J30 B;  2G3K A;  3SXY A;  3NYJ A;  5L0H A;  2R02 A;  2C04 A;  1OCR C;  4E0H A;  1VLS A;  4EWC A;  3B0U X;  2ETS A;  2VC9 A;  4BJ6 A;  4DBQ A;  5L0G A;  3AGU A;  1Z7Q c;  2FAP B;  2IXP A;  2JPU A;  3KYJ A;  3K1H A;  2KK1 A;  3UGP A;  2YL1 A;  3ZC4 A;  2PF4 E;  3UR3 C;  4E18 A;  2LK4 A;  2NUT A;  2XL8 A;  1LKX A;  4E17 A;  1RKC A;  2HS5 A;  1DOW A;  3DD7 A;  4I1O B;  2R25 A;  5JSL A;  4CX9 A;  2WVQ A;  5KYX A;  5F5F A;  1BR1 A;  1ZVZ A;  3I4U A;  1LE4 A;  3NMI A;  1DOV A;  2A68 F;  3IQC A;  4E7Z A;  1QKR A;  3QMK A;  3SP1 A;  2XLO A;  2J9U A;  5HSW A;  1OW8 A;  1UFB A;  2IXM A;  2NUT B;  2KGO A;  2HUJ A;  3T6G B;  4AL0 A;  5KYX B;  2AVK A;  3GM1 A;  3KYI A;  3O55 A;  3EZI A;  4IWB A;  1Z6A A;  4H54 A;  3QW1 A;  2CDQ A;  1HW1 A;  3TK0 A;  1T6Q A;  1K05 A;  3PMR A;  4JEA A;  3ZWI A;  4CDV A;  3T9O A;  3AG3 C;  4JRZ A;  5BQG A;  3FOP A;  2W45 A;  3EQL F;  4JCZ A;  2TMV P;  5B3S C;  1AEP A;  3RH3 A;  2G62 A;  4WGY A;  3UMH A;  5EGY A;  2Q4F A;  4U9D A;  1HY5 A;  2YQY A;  4X0R A;  5E2Q A;  3VAY A;  1I4Y A;  2Y39 A;  1WOL A;  1RJ9 A;  3N0T A;  3WHN A;  1PV3 A;  4YN0 B;  2YHS A;  3MFN A;  2QE9 A;  2X0C A;  4ZLC A;  3RKO F;  1LM3 B;  1ZZP A;  4JKV A;  4J32 B;  2QTV A;  1C02 A;  4LLE A;  3LJB A;  1Q0M A;  5JVE A;  4A4A A;  2VCC A;  1G8X A;  3VF0 A;  2OG2 A;  1O3U A;  4NTF A;  4NY3 A;  1OXB A;  3J06 A;  1RJ9 B;  4U9E A;  1YA9 A;  2ICW G;  4EBK A;  2A6E F;  4O6N A;  3B29 A;  5DS4 A;  3TOL A;  1WAT A;  4MVR A;  3C8G A;  4L6R A;  2LFD A;  4RBN A;  2D4U A;  2QY9 A;  3DMD A;  1SR2 A;  2HSB A;  2PBE A;  3RQF A;  2OU6 A;  3C18 A;  3MX3 A;  3ZQY A;  1TKN A;  3ABM C;  3DI5 A;  2P6V A;  4MVM A;  1Q0F A;  1SYQ A;  4N06 A;  4DVY P;  2IXN A;  4JTD B;  3B9Q A;  1FAP B;  3HTK C;  4U5C E;  1GQA A;  3HKK A;  3TJ5 A;  2P7V A;  3TD7 A;  4NTB A;  1WN0 A;  1R5I D;  2G3V A;  3C8G B;  3O6X A;  4N4W A;  4CDA A;  4CJO A;  1FNT c;  5DS5 A;  4I44 A;  2XXA A;  5JUA A;  4Z9H A;  3AGT A;  2ZD9 A;  3KKB A;  4MVU A;  4CBE A;  5E3C A;  1IW7 F;  2W9Y A;  3E70 C;  4OIP F;  1Z23 A;  1BR2 A;  1T9K A;  3KH2 A;  3RFY A;  4AE4 A;  4CS7 A;  2V26 A;  2J46 A;  1V54 C;  3EHN A;  2IBF A;  1GGQ A;  1YDI A;  2Y3D A;  4YJW A;  1SMY F;  2O9X A;  3ITF A;  4ULV A;  3ZG1 A;  2XLD A;  1Z5Z A;  4KNV A;  3IQ6 A;  3UGO A;  1RMV A;  4PFP A;  5HV9 A;  2XXA B;  3ASN C;  4KC9 A;  3FVY A;  4JJF A;  1MMA A;  2BL2 A;  2GFH A;  3GWL A;  2KNH A;  2OCC C;  4LAC B;  3WG7 C;  2AWY A;  1KNY A;  1G5Z A;  3IHU A;  1LIH A;  1OR3 A;  3M79 A;  1M57 C;  4AE4 B;  2UUI A;  2JX0 A;  2Q9A A;  3S9O A;  2P61 A;  1S05 A;  4N6C A;  4AK9 A;  4E0I A;  1E84 A;  3FDQ A;  2EPO A;  5IY5 C;  1ZU4 A;  1OW7 A;  3K1I C;  3V5X A;  2J9B A;  1EQ1 A;  4GEH A;  2BE5 F;  3AQB A;  1NFO A;  3G50 A;  1JOG A;  2DYS C;  3SYN A;  4JE9 A;  3V5Y A;  1JMW A;  3V5Z A;  4EKW A;  4LDK A;  4XLN F;  1NFN A;  2ZXR A;  1TFK B;  1H6G A;  3AQC A;  4CJG A;  4YL0 A;  2HZ8 A;  1YVI A;  3M1C B;  3IPM O;  1LE2 A;  3TQO A;  4J7T A;  1XZQ A;  1VYK A;  3G4Z A;  3UMK A;  2XLW A;  2FGY A;  1TWC A;  2LIG A;  4YL1 A;  4OIN F;  3ZTM A;  3H65 A;  4M63 A;  4D4N A;  4CIH A;  4EBJ A;  1GS9 A;  4GYT A;  2L81 A;  3NG1 A;  1NSG B;  3AG1 C;  3JZ0 A;  4RD9 A;  3EFO A;  3S29 A;  5FCL A;  2Q7R A;  1QZX A;  2OEX A;  3KL4 A;  2KW3 C;  3MBG A;  4R32 A;  3SXK A;  4YT8 A;  1NU7 D;  1FMV A;  2PFD A;  3GOD A;  1YA7 O;  2R05 A;  4LER A;  4LLC A;  5B1A C;  1EI7 A;  4DJ9 A;  1YAR O;  4PK4 A;  1VK5 A;  3GEH A;  4NTA A;  5FZT A;  256B A;  3DE8 A;  2OQM A;  4ANJ A;  1M56 C;  3ZVR A;  2C03 A;  2BC5 A;  2XM4 A;  1G4W R;  4NC3 A;  2L7A A;  2LCH A;  3EFO B;  1OW6 A;  3MYI A;  3U8V A;  1F1M A;  3K7D A;  3JCU Q;  3R2P A;  4LDR A;  4O79 A;  4CS9 A;  5COM A;  1YLM A;  4IAQ A;  3S84 A;  1Q0G A;  2A0U A;  2A6H F;  4NCQ A;  3K66 A;  4CSA A;  4IRU A;  1D1C A;  1SZI A;  2EIL C;  1T5O A;  3EGX A;  1VLT A;  1L3P A;  2XLH A;  3S28 A;  3W8H A;  5CIV A;  1Z3I X;  2ZPA A;  4MQ9 F;  4I1M A;  2XSE A;  3S90 A;  4XPW A;  2MHR A;  3NYM A;  2M4E A;  2WZF A;  4W8K A;  4JUR I;  3VRC A;  3DM5 A;  4YK5 A;  2R7V A;  1NBB A;  2CNW D;  2J9W A;  4F4B A;  1T01 A;  1TWG A;  2EIN C;  2L6G A;  3PDM P;  2J8W A;  4OIQ F;  1SF8 A;  2AP3 A;  3EGX B;  4K1O A;  4CS8 A;  4G78 A;  4MND A;  5DVW A;  4BJ1 A;  2YZS A;  3US6 A;  5T1D B;  4OIO F;  2R7O A;  2ASR A;  1T6I A;  2PX3 A;  3MLG A;  4YL3 A;  5KYW A;  3B0V C;  4WAB A;  2LQG A;  2KYH A;  3JSE O;  1LI7 A;  4O7G A;  4O6Y A;  1C03 A;  5AC5 A;  1C17 M;  4PR9 A;  3EHM A;  4IAO A;  4U5F E;  3RVZ A;  4EUK B;  5L3Q A;  2EPM X;  4UDV A;  1ZHT A;  3DZA A;  3GM2 A;  2XS8 A;  3PHF 2;  4FES A;  4Q5S F;  1HMD A;  4HEA J;  4JTC B;  3UMI A;  5KYW B;  3C8Z A;  3QVY A;  1YYX A;  1LPE A;  3HNK A;  4HFK B;  1OR2 A;  1Y6D A;  3LEV A;  2HV6 A;  4U5H A;  4KBL A;  4XQ1 A;  3NRH A;  1NG1 A;  3SZR A;  3DE9 A;  3UNG C;  4BJ5 C;  4XEV A;  1CGO A;  2DB4 A;  2P1A A;  1UG7 A;  4XEF A;  2GWW A;  2VCB A;  3GM3 A;  3ABK C;  1OCO C;  3B71 A;  1J8M F;  4MW8 A;  2HJM A;  4FAP B;  2QLA A;  2R7R A;  1MNE A;  1D0Z A;  3SXZ A;  5E3A A;  1H9G A;  3ABL C;  5KYN A;  4JZA A;  1BR4 A;  4JVS A;  1RXQ A;  3DKA A;  3RVY A;  2Y3G A;  3HNJ A;  1YZA A;  4P9T A;  3ZDL A;  2QUP A;  3T6J A;  1A7V A;  2DI3 A;  2YVK A;  2J7P D;  3FOO A;  4EBB A;  1R4T A;  3OA1 A;  2HSQ A;  5EHH A;  1V4A A;  5COF A;  3POV A;  4ZLD A;  4BJ6 C;  1HE1 A;  1FR0 A;  2NSG A;  3RIP A;  3U9M A;  2R9R B;  2WB7 A;  1FFT C;  3LEO A;  5L0C A;  3K6B A;  3TJ6 A;  3M4C A;  1OXK A;  1XWJ A;  3Q7L A;  3BEH A;  3LS0 A;  1J8Y F;  3Q7G A;  5EK0 A;  4XLP F;  4JIO A;  4Q7C A;  4BPM A;  2ZXP A;  2GA0 A;  2JD3 A;  2XL6 A;  3HJC A;  5L3V A;  4K7B A;  4YWQ A; 
#chains in the Genus database with same CATH homology
 2LSE A;  4KNW A;  3DM9 B;  4QI0 A;  3F46 A;  2I8B A;  3S27 A;  2DGJ A;  4Q4Z F;  4PJL A;  4PJM A;  2FFH A;  4QI2 A;  1PCX A;  4XWJ A;  2PP4 A;  4G7H F;  2Q9C A;  1IZM A;  3X1O A;  1M2O A;  1VYI A;  2NG1 A;  3FHD A;  1S7Z A;  1ZHW A;  2Q9B A;  3EG9 A;  2WZG A;  1PD0 A;  3ZIB A;  3EH2 A;  2Y3H A;  4ULW A;  3X2Q C;  1OKK D;  1FTS A;  4K0D A;  1D1B A;  3OEO A;  4G7Z F;  5D91 A;  4KI2 A;  2NUP A;  5CI8 A;  3EG9 B;  3LLI A;  5DQT A;  4U5B E;  3Q6M A;  2B0J A;  4P6I C;  2H7B A;  1D0X A;  4C3D A;  1TWH A;  4HFF B;  3DAG A;  2NUP B;  3W8I A;  1ZHX A;  1OCZ C;  1QLE C;  1ZHY A;  2Z15 A;  4OD5 A;  1MMG A;  2Y3B A;  3EJN A;  4U5E E;  1V55 C;  1O5H A;  3EH1 A;  2ZXO A;  3KMI A;  1LS1 A;  2CNW A;  5B1B C;  2MWQ A;  2XRH A;  3DJU B;  5DS6 A;  3RYL A;  1O87 A;  4B6I A;  2PX0 A;  4G7O F;  2A69 F;  1ZHZ A;  2Y69 C;  4QDL A;  3LS1 A;  4BJT A;  2WVN A;  1NU9 C;  3N2Z B;  4OIR F;  1LVK A;  1ZU5 A;  3JRT A;  3O39 A;  2V3C C;  4DVZ A;  2R7T A;  4JW1 A;  3T6B A;  4A2N B;  2CGE A;  1MND A;  4IJJ A;  5T3T A;  3T4R A;  3L34 A;  4U5G A;  1TR2 A;  2W4M A;  2R7U A;  4PFO A;  3NDB B;  5D92 A;  3LAY A;  1MMD A;  2IOQ A;  2R7W A;  2E87 A;  1JPN A;  1VMA A;  4BG0 A;  1D1A A;  3FAJ A;  5T3W A;  4DOZ A;  4JJG A;  1PD1 A;  1ST6 A;  2CW0 F;  3V7O A;  1KU2 A;  2ZXW C;  4C3E A;  4YT2 A;  4C3B A;  2HV7 A;  4HE8 D;  2WVO A;  5E33 A;  4BEJ A;  2J9V A;  3JSZ A;  3B0P A;  4DBR A;  3AG2 C;  2KJG A;  5KYU A;  3GAN A;  2Q3T A;  4OD4 A;  3W2V A;  3WOD F;  1FFH A;  3NYL A;  2IYL D;  2J7P A;  2J0X A;  3LLK A;  3OWT A;  1ZYR F;  2WZL A;  3F47 A;  2DYR C;  3K33 A;  3L0I A;  5DLJ A;  2KQ9 A;  4RDA A;  3IEE A;  3SEO A;  5KYU B;  3SNH A;  2EIK C;  2MYS A;  2W4B A;  3NKD A;  4I3M A;  1W2W A;  3JYH A;  4YT5 A;  1WGW A;  2VAS A;  4O6M A;  4CS9 C;  1N1C A;  1MMN A;  2H7O A;  3I5Q A;  3VYW A;  2J0W A;  3I5P A;  3AG4 C;  1OCC C;  3ECS A;  3HLZ A;  4CSA C;  3QZC A;  4H4K C;  2IXO A;  1M2V A;  2XL4 A;  3Q6N A;  4U5D E;  4YT4 A;  1NZE A;  3EPV A;  4FX5 A;  1D0Y A;  1VOM A;  2A1D D;  3JT1 A;  4WJ0 A;  2J45 A;  3EGD A;  1M2V B;  4CS8 C;  2R7X A;  5BUO A;  3ASO C;  3CQZ A;  4C7O A;  2YEV A;  5KYY A;  4PJJ A;  1OKK A;  2X51 A;  3CSK A;  1JPJ A;  3LNR A;  2L9J A;  3E9V A;  5CI9 A;  2R7S A;  3EGD B;  4JCH A;  4C7O B;  2EIJ C;  5KYY B;  2VB6 A;  5F5H A;  2H7V C;  2R7Q A;  3LES A;  4XTK A;  1FMW A;  3DXJ F;  2EIM C;  4FWV A;  3S0X A;  3DJN B;  1TWA A;  3NKE A;  4BJ5 A;  5DQZ A;  1Z63 A;  3ZSU A;  2D5R B;  3W2W A;  3N24 A;  3CZ6 A;  4G0H A;  4PJN A;  3DAF A;  2WL8 A;  3EZH A;  2VH3 A;  4J30 B;  2G3K A;  3NYJ A;  2C04 A;  1OCR C;  4EWC A;  3B0U X;  4DBQ A;  4BJ6 A;  2IXP A;  3UGP A;  3K1H A;  3ZC4 A;  2PF4 E;  3UR3 C;  2NUT A;  1LKX A;  5KYX A;  3DD7 A;  4I1O B;  2WVQ A;  5F5F A;  1BR1 A;  3I4U A;  2A68 F;  4E7Z A;  3QMK A;  3SP1 A;  2J9U A;  5HSW A;  2IXM A;  2NUT B;  2KGO A;  5KYX B;  3EZI A;  4IWB A;  1Z6A A;  2CDQ A;  3PMR A;  3AG3 C;  2W45 A;  3EQL F;  5B3S C;  3RH3 A;  2G62 A;  3UMH A;  5EGY A;  4X0R A;  5E2Q A;  3VAY A;  2Y39 A;  1RJ9 A;  3N0T A;  4YN0 B;  2YHS A;  4ZLC A;  3RKO F;  4J32 B;  2QTV A;  4LLE A;  3LJB A;  1G8X A;  2OG2 A;  4NY3 A;  1RJ9 B;  2A6E F;  4O6N A;  5DS4 A;  4AX2 A;  4RBN A;  2QY9 A;  3DMD A;  3MX3 A;  1TKN A;  3ABM C;  2P6V A;  4N06 A;  4DVY P;  2IXN A;  3B9Q A;  3HTK C;  4U5C E;  2P7V A;  3TD7 A;  2G3V A;  3O6X A;  5DS5 A;  2XXA A;  4I44 A;  3KKB A;  4CBE A;  5E3C A;  1IW7 F;  2W9Y A;  3E70 C;  4OIP F;  1Z23 A;  1BR2 A;  3KH2 A;  3RFY A;  4AE4 A;  4CS7 A;  2V26 A;  2J46 A;  1V54 C;  3EHN A;  2Y3D A;  4YJW A;  1SMY F;  2O9X A;  3ITF A;  3ZG1 A;  1Z5Z A;  4KNV A;  2XXA B;  3UGO A;  4PFP A;  3ASN C;  4KC9 A;  3FVY A;  4JJF A;  1MMA A;  2GFH A;  2KNH A;  2OCC C;  4LAC B;  3WG7 C;  4AE4 B;  1M57 C;  2Q9A A;  4AK9 A;  3FDQ A;  5IY5 C;  1ZU4 A;  3K1I C;  4GEH A;  2BE5 F;  3AQB A;  2DYS C;  3SYN A;  4XLN F;  2ZXR A;  3AQC A;  3M1C B;  1VYK A;  3UMK A;  2FGY A;  1TWC A;  4OIN F;  4CIH A;  3H65 A;  4M63 A;  4GYT A;  2L81 A;  3NG1 A;  3AG1 C;  4RD9 A;  3EFO A;  3S29 A;  5FCL A;  1QZX A;  3KL4 A;  2KW3 C;  4YT8 A;  1NU7 D;  1FMV A;  2PFD A;  3GOD A;  4LER A;  4LLC A;  5B1A C;  4PK4 A;  1VK5 A;  4ANJ A;  1M56 C;  3ZVR A;  2C03 A;  4E7S A;  3EFO B;  4CS9 A;  3K7D A;  3JCU Q;  4O79 A;  2A6H F;  3K66 A;  4CSA A;  4IRU A;  1D1C A;  1SZI A;  2EIL C;  3EGX A;  3S28 A;  3W8H A;  1Z3I X;  2ZPA A;  4MQ9 F;  4I1M A;  2XSE A;  3NYM A;  2M4E A;  2WZF A;  4W8K A;  4JUR I;  3DM5 A;  2R7V A;  2CNW D;  2J9W A;  4F4B A;  1TWG A;  2EIN C;  4OIQ F;  1SF8 A;  3EGX B;  4CS8 A;  5DVW A;  4MND A;  4BJ1 A;  2YZS A;  5T1D B;  4OIO F;  2R7O A;  2PX3 A;  3MLG A;  5KYW A;  3B0V C;  4O7G A;  4O6Y A;  3EHM A;  4IAO A;  4U5F E;  5L3Q A;  1ZHT A;  3DZA A;  3PHF 2;  4FES A;  4Q5S F;  3UMI A;  4HEA J;  5KYW B;  4HFK B;  4U5H A;  3LEV A;  3SZR A;  2HV6 A;  4KBL A;  3NRH A;  1NG1 A;  3UNG C;  4BJ5 C;  3ABK C;  1OCO C;  1J8M F;  2R7R A;  1MNE A;  1D0Z A;  5E3A A;  5KYN A;  3ABL C;  4JZA A;  1BR4 A;  4JVS A;  2Y3G A;  3T6J A;  2J7P D;  4EBB A;  3OA1 A;  5EHH A;  4ZLD A;  3POV A;  4BJ6 C;  3RIP A;  2WB7 A;  1FFT C;  3K6B A;  3Q7L A;  3LS0 A;  1J8Y F;  3Q7G A;  4XLP F;  4Q7C A;  2ZXP A;  2JD3 A;  3HJC A;  5L3V A;  4K7B A;  4YWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...