3O39A

Crystal structure of spy
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
FKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKAKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFEKRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Periplasmic protein related to spheroblast formation
publication title Genetic selection designed to stabilize proteins uncovers a chaperone called Spy.
pubmed doi rcsb
source organism Escherichia coli
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3o39A00
3LAYA 2Y3DA 2Y3GA 2Y39A 3O39A 3ZG1A 3OEOA 2Y3HA 3QZCA 2Y3BA 3EPVA 3ITFA
chains in the Genus database with same CATH superfamily
4XLNF 1Z6AA 3LESA 2LFFA 3PCVA 1ZW2A 2BL2A 4M63A 3IQ6A 2J9VA 1T5OA 1LPEA 4LERA 5FCLA 1NSGB 1OXBA 3AG4C 4FESA 3EPVA 3W8IA 4MW3A 3S27A 1A41A 3M4CA 4OIPF 1J8YF 3S84A 2QE9A 4DBQA 2W45A 1QQ3A 2IXNA 2A6EF 3N2ZB 3DJUB 3ABKC 1Y6DA 3HNKA 3U8PA 2XLHA 4KBLA 1FMWA 5D92A 1D1BA 4XLPF 4Q4ZF 2YQYA 4KC9A 3Q6NA 4W8KA 2A0UA 2OU6A 3EG9B 3A11A 1OCOC 4U9EA 1WWPA 3U5SA 1M56C 2Q7RA 1T6IA 3ZSUA 1D0XA 2FGYA 1NZEA 1R5ID 1YVIA 2CNWA 3BRJA 3V5XA 3EGDB 2WVQA 2BE5F 1EI7A 2J7PA 3S90A 1Q0DA 1UG7A 2OJQA 3MX3A 4XEVA 4MVSA 4L6RA 2WZLA 2FAPB 4AL0A 1IW7F 1T01A 2NSFA 3NKDA 1TWGA 1HE9A 2Z15A 1JMWA 1NU9C 2XSEA 4MTGA 3ECSA 3SXZA 2CYDA 4H4KC 2HZ8A 4MS2A 1C02A 4WJ0A 2UUIA 4K1OA 3G50A 3GM3A 2LQGA 2TMVP 2XL8A 4Z9IA 4ER9A 5CI9A 2JX0A 4I1MA 2XLDA 2AU5A 3JRTA 1QVXA 3H2UA 2WL8A 1JR8A 1KU2A 3TK0A 2KQ9A 3HLZA 4E7SA 1H9TA 3VYWA 1TWHA 4U5HA 1I4ZA 1O5HA 1A7VA 4MVMA 4YK5A 4P9TA 4MTOA 1SR2A 3V7OA 2ZPAA 1M2OA 3MYFA 2LCHA 2J9UA 2ASRA 3LS1A 2J7PD 1LKXA 1YLMA 2X0CA 3SXKA 1H7IA 3NYMA 2YLGA 1F1MA 3L0IA 1Z63A 2L6FA 5E3AA 1A7DA 3W4YA 5K0IA 4PK4A 3MFNA 4NTAA 4Q7CA 3HNLA 2NPUA 4E17A 4DRJB 1GS9A 4EWCA 3ZIBA 5D91A 5F5FA 2KC3A 5KYUA 4H54A 4AE4B 2XS1A 1QKRA 3TD7A 2L7AA 1QSPA 2WVOA 1QPUA 4JEBA 2J0WA 2J0XA 4JRZA 4CDYA 1JRAA 2YEVA 3NYLA 4JTCB 2C04A 5CI8A 3O55A 4JW1A 1D0YA 5E2QA 5TJ5E 3DMDA 1T6UA 2QUPA 3FXHA 3ABLC 3FHDA 4P6IC 3AJMA 1E83A 2ZXWC 5B1AC 3GM1A 4HFKB 2KGOA 2MWQA 4CS9C 5T3TA 3DD7A 3QVYA 3U3BA 2YHSA 3SP1A 2GWWA 4XEKA 2GFHA 4MVZA 2VASA 3RQFA 4CDAA 3T6JA 3WAQA 3JYHA 3B0VC 1HY5A 3L34A 4IARA 3U2LA 4DJ9A 1YJGA 2AWYA 3UGPA 1B68A 4CSAC 3EGDA 3KH2A 4N6HA 1OW8A 4DRIB 4MVOA 1MMGA 3DAFA 2YLDA 4QI0A 4K0DA 3DM9B 5B1BC 3QTHA 4JTAB 5E3CA 4OIRF 4NQFA 2EIJC 5DS4A 1VK5A 1H6GA 2B0HA 3SYNA 2XXAA 2O9XA 1XWJA 3T6BA 3OEOA 2R03A 1TWAA 1APCA 2HS5A 1L7CA 2AVKA 4Z9HA 5BQGA 5BQIA 1ZVZA 3S9OA 3VM6A 1YA9A 3H2VA 4EBBA 3POVA 3EH1A 2NUPB 4JJGA 4LLEA 5T3WA 2L9JA 3LUTB 1WN0A 3T9OA 4G7OF 3CZ6A 4CS9A 2F22A 1OR3A 2MYSA 3G4ZA 4LDQA 2CGEA 2VCBA 3LEOA 3CAXA 5COGA 1LM3B 1OW7A 1YARO 1ZW3A 4YT4A 4G7HF 2EPKX 3SXYA 3IQTA 4D4XA 1MNEA 3K1HA 1E2XA 1M6TA 1RMVA 3SXMA 1L3PA 2HJ3A 4JC7A 5L0HA 2XRHA 4PJLA 3S29A 4XEFA 3IQCA 2XS8A 5L3QA 2R7RA 1ZU4A 4MVUA 2WZGA 1RKEA 1VLTA 3O6XA 4IAQA 1U0BB 2A6HF 5KYUB 1OW6A 2LP4A 2YWAA 4CSAA 2W4MA 4AE4A 3NMKA 4EBKA 3C18A 3B0UX 5F5HA 2E87A 3JZ0A 2H7OA 4U5GA 3LAYA 1AVOB 2YL3A 2NG1A 1FMVA 2Q3TA 3RYLA 1C03A 4C3EA 4NTBA 1ZZPA 3O39A 5L0JA 2VCAA 3RH3A 3LJBA 4MVRA 1BZ4A 1OQCA 2VC9A 4U5CE 2JD3A 2EPNA 3NMIA 3ZTZA 3HKKA 1G5ZA 3B0PA 2P7VA 4DVZA 1A7EA 2HUJA 1Q0MA 3K7DA 2PX0A 4BG0A 4CX9A 3IHUA 1G8XA 5L3VA 4LACB 4P9FA 3QVZA 2PX3A 4OIQF 3FMSA 4NY3A 1LE4A 2W9YA 3KPHA 4G7ZF 3ASNC 3T4RA 3NDBB 3WHNA 1ZHZA 3JCUQ 4BJ6C 1WASA 2VH3A 4PR9A 4OINF 3MBGA 1PD0A 3NYJA 4U5BE 4G78A 3DE8A 2ETSA 4I3MA 3DI5A 4J30B 5CIVA 4R32A 1K40A 3TOMA 4QI2A 3G4XA 4ULVA 2BC5A 4HEAJ 1O3UA 2I15A 5DLJA 4JJFA 4HE8D 3RQGA 1NLXA 4YN0B 3VF0A 2YL7A 1NBBA 1ORYA 3U3FA 2IOQA 2WZFA 3C8GB 4DXWA 1CGME 2R7VA 2V3CC 2V26A 2XXAB 1LE2A 1A0BA 3RF3A 3Q6MA 1D0ZA 4JVSA 1TQGA 2PBEA 3DAGA 2KYHA 4EBJA 2ZXRA 3FOOA 3R7CA 4BJ5C 3PHF2 1BDJB 1D1AA 2GAQA 2DYSC 4BJTA 1BR4A 1YDIA 2NUPA 4U5DE 2YL0A 2CW0F 2CNWD 4UDVA 1OCRC 4IB4A 2KK1A 1M57C 3ZTMA 5DQTA 2XL6A 4MVQA 3F47A 3RVZA 3T6GB 2D5RB 1BR1A 4W8PA 3SNHA 1VYIA 1Z3IX 2R7QA 4PJMA 4EUKB 1U6HA 2OOCA 1MMDA 3JTLO 1RKEB 2Y3BA 3V5YA 1IZMA 2J45A 4KNWA 3WG7C 4BJ6A 3S0XA 1EKYA 5KYWB 1PV3A 2OJED 3UMKA 1FR0A 1VOMA 2HV7A 2J9WA 2Q4FA 2RSEB 1K05A 1TWCA 3AG1C 4YL0A 4XPYA 3U2MA 4PFPA 1E85A 5A6JA 4FWVA 1ZYRF 5AC5A 2Q9BA 3JSZA 3C63A 3HTKC 4JTDB 5B3SC 4ONSA 3RVYA 4GEHA 2G3KA 3UMIA 1TFKB 2Y69C 4XWJA 3ZG1A 2MHRA 3UR3C 2Y3HA 4E18A 2J46A 1NU7D 2OCCC 5COMA 3GANA 4O7GA 3GWNA 4DBRA 1OR2A 2DYRC 2IYLD 2R05A 3QW0A 2RD9A 2XM0A 4BJ5A 4OD5A 1Z7Qc 2OQMA 1ZU5A 2ZXOA 3JT1A 1OCZC 2DI3A 2Y39A 1T6QA 2EIKC 3Q7LA 3BEHA 3U9JA 1Q0FA 2R7SA 3IEEA 1WOLA 2H7VC 2QLAA 3ZWIA 1V74B 3UNGC 5L0GA 2OEVA 2AP3A 3MLGA 4AX2A 1MMAA 1YYJA 1XZPA 3EZIA 5JSLA 4EIYA 2PNOA 3DE9A 2XLEA 2R9RB 5JP7A 3HNJA 1HMOA 4OD4A 1LVKA 1Q0KA 4F4BA 3AQBA 3UGOA 1ST6A 1MMNA 3EFOB 3C8GA 3DXJF 1RKCA 3TJ6A 1VLSA 3AG3C 3V5ZA 1JPJA 4RBNA 3VAYA 3W2WA 2KW3C 2A69F 1LIHA 1ZHXA 3SZRA 3RIPA 2EPLX 4ZLCA 3W8HA 1ZHWA 3E9VA 4O6MA 5KYYB 2I8BA 3PMRA 3I4UA 2A68F 3LEVA 4O6NA 2OKUA 5EK0A 1I5NA 1HW1A 2LFDA 2J8WA 4E0HA 4IRUA 3C62A 3RQEA 1N1CA 2IXPA 2UUHA 3K6BA 2D4UA 2PFDA 2P6VA 3X1OA 5JVEA 2XLVA 3QMKA 4QDLA 2DGJA 1CGNA 1HMDA 1SZIA 2LK4A 4I1OB 1T9KA 4XPWA 1JAFA 3DJNB 3L8JA 4FAPB 2YLIA 2JPUA 4CBEA 2NUTB 1TKNA 1KTMA 4G0HA 2J9BA 3DZAA 5BQHA 2R7OA 3CEXA 2HV6A 3C8GD 2P0NA 3K1IC 3RKOF 5DVWA 2DB4A 4BPMA 5KYWA 2H7BA 1HE1A 2WVNA 1BBHA 3GEHA 4NC3A 5T1DB 1W2WA 1RJ9B 1K04A 1YAUO 2IXOA 4GQHA 5JLIA 3IPMO 4YL1A 3CSKA 4U5EE 4YT5A 1Z5ZA 4JURI 3B29A 5HV9A 5F28E 2PF4E 4JE9A 1GGQA 2G62A 1V54C 2X51A 4NTFA 4YT2A 3B9QA 2KNHA 3ZQYA 4J32B 4HFFB 4Q5SF 3JSEO 4JZAA 4WGYA 2L81A 3C7JA 3EGXB 2LD6A 2M4EA 4C7OB 1H9GA 1FTSA 1OCCC 2NSGA 4JCHA 5L0CA 4OIOF 1SF8A 3SEOA 1LS1A 2C03A 3AG2C 1VMAA 3F46A 3TOLA 3DM5A 1CPQA 3EHNA 3GORA 3IQ5A 3N24A 3EZHA 4EHPA 3J06A 1XZQA 1SMYF 2L6HA 3LLIA 4J7TA 3KYIA 3NG1A 3NMJA 1JOGA 3WODF 2Q9AA 2IXMA 4ULWA 4A2NB 5DS6A 1RXQA 3FDQA 2PP4A 4IAOA 2GDCA 3GEIA 3E70C 2EIMC 4AK9A 5GPGB 1C17M 1J8MF 3CQZA 2R7TA 2OEXA 2Y3DA 2R7XA 2XLOA 4XTKA 1KNYA 5A6KA 1AEPA 3K1IA 5JT4A 2R7WA 3LS0A 3EFOA 2EPOA 3M1CB 2HKVA 3TJ5A 4BJ1A 5A69A 3AGUA 1VB5A 2Y3GA 5COFA 1JPNA 2QY9A 4MTFA 2EINC 3N0TA 2KJGA 3I5PA 5KYXB 2XLMA 3GWLA 5KYYA 5A6BD 4O6YA 3EHMA 1LI7A 4YWQA 2M64A 4JCZA 4PJNA 1AUEA 4LDRA 2R25A 1YZAA 1YZCA 3AOUA 4XPXA 4N4WA 3GM2A 4PJJA 4IWBA 1NFOA 1NFNA 4X0RA 4CIHA 5DQZA 4LDKA 4BEMJ 1FNTc 1WATA 1TFOB 1FFTC 3U0CA 3FVYA 4U9DA 1EQ1A 4RD9A 3K33A 1WGWA 3ATPA 1PCXA 3X2QC 2IBFA 3QW1A 256BA 1UFBA 1G4US 3LNMB 2NUTA 1TR2A 4KI2A 2A1DD 4C3BA 1D1CA 4DVYP 3DWWA 3JRMO 4WGZA 5IY5C 1LS4A 3HNIA 3US6A 2HJMA 1LI5A 1RJ9A 2R7UA 4FX5A 1M2VA 4YJWA 3R2PA 4LLCA 1YYXA 4CDVA 2YVKA 4KNVA 1G4WR 5E33A 3I5QA 4CJOA 2HSBA 1PD1A 4MQ9F 2QNLA 2XL4A 4MNDA 1CGOA 3U8VA 3AQCA 1GQAA 3HJCA 5KYNA 1QLEC 4RDAA 3B71A 4AL1A 1ORSC 5EGYA 1YA7O 1NG1A 3JYYA 1HW2A 4NCQA 1I4YA 3W2VA 3C8ZA 4U5FE 4CS8C 4PACA 3EGXA 4C7OA 1DOVA 4CS7A 3LNRA 1S05A 3Q7GA 3L8IA 1VTMP 1FAPB 4MW8A 1QZXA 3L1MA 5FZTA 1R4TA 5AC4A 1E84A 1OKKA 2YKZA 4N06A 4B6IA 5A6AA 2Q00A 3KL4A 1CPRA 2EILC 2Q9CA 2B0JA 2CDQA 3NRHA 1S7ZA 3EH2A 3OWTA 4IJJA 3MYIA 3GEEA 3ZC4A 5DS5A 3O10A 2XM4A 1Y4CA 3ASOC 4EKWA 2ICWG 1ORJA 3GODA 5AGFA 2VCCA 1ZHTA 2AWCA 3K66A 2HFIA 4Z9JA 1GM5A 3ABMC 4DRHB 1Z23A 3EG9A 3H65A 3ZDLA 2EPMX 3A9CA 4WABA 1O87A 4JIOA 3ITFA 1V55C 4E0IA 2P61A 4JKVA 2FFHA 5KYXA 3RFYA 2KSFA 1ZHYA 3FOPA 4YL3A 1U89A 3UMHA 2H8AA 1OKKD 1VYKA 2HSQA 4ANJA 3FAJA 4C3DA 5L0IA 3KKBA 2GA0A 3ZQVA 4CS8A 3AGTA 2LIGA 2W4BA 3KYJA 1WTYA 2VB6A 1V4AA 2L6GA 3DKAA 3PDMP 2HMZA 3M15A 4O79A 1OXKA 1E86A 4CIPA 1Q0GA 3KMIA 5JRAA 5JUAA 5BUOA 5L0FA 2A0BA 2P1AA 2CCYA 2YZSA 5JS5A 2WB7A 1BR2A 1FFHA 2ZXPA 3ZVRA 2YRFA 5HSWA 3M79A 3U9MA 4I44A 4BEJA 3VRCA 1M2VB 1MQVA 2IM8A 3EQLF 3RW0A 5A6BA 3TQOA 4GYTA 4CJGA 2HMQA 2G3VA 3OA1A 4A4AA 4DOZA 4E7ZA 5EHHA 2YL1A 2ZD9A 3LLKA 4PFOA 3TULA 2OG2A 1RCPA 2XLWA 4K7BA 3M4BA 4YT8A 4XQ1A 4IGGA 5L0DA 3NKEA 1MNDA 2LSEA 4N6CA 4J7YA 4JEAA 3EJNA 2R02A 4D4NA 5B3IA 4ZLDA 3FAPB 2QTVA 3QZCA 1EA8A 1DOWA 3S28A 1SYQA
chains in the Genus database with same CATH topology
4XLNF 1Z6AA 3LESA 4M63A 2J9VA 4LERA 5FCLA 3AG4C 4FESA 3EPVA 3W8IA 3S27A 4OIPF 1J8YF 4DBQA 2W45A 2IXNA 2A6EF 3N2ZB 3DJUB 3ABKC 4KBLA 1FMWA 5D92A 1D1BA 4XLPF 4Q4ZF 4KC9A 3Q6NA 4W8KA 3EG9B 1OCOC 1M56C 3ZSUA 1D0XA 2FGYA 1NZEA 2CNWA 3EGDB 2WVQA 2BE5F 2J7PA 3MX3A 2WZLA 1IW7F 3NKDA 1TWGA 2Z15A 1NU9C 2XSEA 3ECSA 4H4KC 4WJ0A 5CI9A 4I1MA 3JRTA 2WL8A 1KU2A 2KQ9A 3HLZA 4E7SA 3VYWA 1TWHA 4U5HA 1O5HA 3V7OA 2ZPAA 1M2OA 2J9UA 3LS1A 2J7PD 1LKXA 3NYMA 3L0IA 5E3AA 4PK4A 4EWCA 4Q7CA 3ZIBA 5D91A 5F5FA 5KYUA 4AE4B 3TD7A 2WVOA 2J0WA 2J0XA 2YEVA 3NYLA 2C04A 5CI8A 4JW1A 1D0YA 5E2QA 3DMDA 3ABLC 3FHDA 4P6IC 2ZXWC 5B1AC 4HFKB 4CS9C 2KGOA 2MWQA 5T3TA 3DD7A 2YHSA 3SP1A 2GFHA 2VASA 3T6JA 3JYHA 3B0VC 3L34A 3UGPA 4CSAC 3EGDA 3KH2A 1MMGA 3DAFA 4QI0A 4K0DA 3DM9B 5B1BC 5E3CA 4OIRF 2EIJC 5DS4A 1VK5A 3SYNA 2XXAA 2O9XA 3T6BA 3OEOA 1TWAA 3POVA 4EBBA 3EH1A 2NUPB 4JJGA 4LLEA 5T3WA 2L9JA 4G7OF 3CZ6A 4CS9A 2MYSA 2CGEA 1Z63A 4G7HF 4YT4A 1MNEA 3K1HA 2XRHA 4PJLA 3S29A 2R7RA 5L3QA 1ZU4A 2WZGA 3O6XA 2A6HF 5KYUB 4CSAA 2W4MA 4AE4A 3B0UX 5F5HA 2E87A 2H7OA 4U5GA 3LAYA 2NG1A 1FMVA 2Q3TA 3RYLA 4C3EA 3O39A 3RH3A 3LJBA 4U5CE 2JD3A 3B0PA 4DVZA 2P7VA 3K7DA 2PX0A 4BG0A 5L3VA 1G8XA 4LACB 2PX3A 4OIQF 4NY3A 2W9YA 4G7ZF 3ASNC 3T4RA 3NDBB 1ZHZA 3JCUQ 4BJ6C 2VH3A 4OINF 1PD0A 3NYJA 4U5BE 4I3MA 4J30B 4QI2A 4HEAJ 5DLJA 4JJFA 4HE8D 4ZLCA 4YN0B 2IOQA 2WZFA 2R7VA 2V3CC 2V26A 2XXAB 3Q6MA 1D0ZA 4JVSA 3DAGA 2ZXRA 4BJ5C 3PHF2 1D1AA 4BJTA 2DYSC 1BR4A 2NUPA 4U5DE 2CW0F 2CNWD 1OCRC 1M57C 5DQTA 3F47A 2D5RB 1BR1A 3SNHA 1VYIA 1Z3IX 2R7QA 4PJMA 1MMDA 2Y3BA 1IZMA 2J45A 4KNWA 3WG7C 4BJ6A 3S0XA 5KYWB 3UMKA 1VOMA 2HV7A 2J9WA 1TWCA 3AG1C 4PFPA 4FWVA 1ZYRF 2Q9BA 3JSZA 3HTKC 5B3SC 4GEHA 2G3KA 3UMIA 2Y69C 4XWJA 3ZG1A 3UR3C 2Y3HA 2J46A 1NU7D 2OCCC 3GANA 4O7GA 4DBRA 2DYRC 2IYLD 4BJ5A 4OD5A 1ZU5A 2ZXOA 3JT1A 1OCZC 2Y39A 2EIKC 3Q7LA 2R7SA 3IEEA 2H7VC 3UNGC 3MLGA 4AX2A 1MMAA 3EZIA 4OD4A 1LVKA 4F4BA 3AQBA 3UGOA 1ST6A 1MMNA 3EFOB 3DXJF 3AG3C 1JPJA 4RBNA 3VAYA 3W2WA 2KW3C 2A69F 1ZHXA 3SZRA 3RIPA 3W8HA 1ZHWA 3E9VA 4O6MA 5KYYB 2I8BA 3PMRA 3I4UA 2A68F 3LEVA 4O6NA 4IRUA 1N1CA 2IXPA 3K6BA 2PFDA 2P6VA 3X1OA 3QMKA 4QDLA 2DGJA 1SZIA 4I1OB 3DJNB 4CBEA 2NUTB 1TKNA 4G0HA 3DZAA 2R7OA 3K1IC 2HV6A 3RKOF 5KYWA 5DVWA 2H7BA 2WVNA 5T1DB 1W2WA 1RJ9B 2IXOA 3CSKA 4U5EE 4YT5A 1Z5ZA 4JURI 2PF4E 2G62A 1V54C 2X51A 4YT2A 3B9QA 2KNHA 4J32B 4HFFB 4Q5SF 4JZAA 2L81A 3EGXB 2M4EA 4C7OB 1FTSA 1OCCC 4JCHA 4OIOF 1SF8A 3SEOA 1LS1A 2C03A 3AG2C 1VMAA 3F46A 3DM5A 3EHNA 3N24A 3EZHA 1SMYF 3LLIA 3NG1A 3WODF 2Q9AA 2IXMA 4ULWA 4A2NB 5DS6A 3FDQA 2PP4A 4IAOA 3E70C 2EIMC 4AK9A 1J8MF 3CQZA 2R7TA 2Y3DA 2R7XA 4XTKA 2R7WA 3LS0A 3EFOA 3M1CB 4BJ1A 2Y3GA 1JPNA 2QY9A 2EINC 3N0TA 2KJGA 3I5PA 5KYXB 5KYYA 4O6YA 3EHMA 4YWQA 4PJNA 4PJJA 4IWBA 4X0RA 4CIHA 5DQZA 1FFTC 3FVYA 4RD9A 3K33A 1WGWA 1PCXA 3X2QC 2NUTA 4KI2A 1TR2A 2A1DD 4C3BA 1D1CA 4DVYP 5IY5C 2R7UA 1RJ9A 4FX5A 1M2VA 4YJWA 4LLCA 4KNVA 5E33A 3I5QA 1PD1A 4MQ9F 2XL4A 4MNDA 3AQCA 3HJCA 5KYNA 1QLEC 4RDAA 5EGYA 1NG1A 3W2VA 4U5FE 4CS8C 3EGXA 4C7OA 4CS7A 3LNRA 3Q7GA 1QZXA 1OKKA 4B6IA 4N06A 3KL4A 2EILC 2Q9CA 2B0JA 2CDQA 3NRHA 1S7ZA 3EH2A 3OWTA 4IJJA 3ZC4A 5DS5A 3ASOC 3GODA 1ZHTA 3K66A 3ABMC 1Z23A 3EG9A 3H65A 1O87A 3ITFA 1V55C 2FFHA 5KYXA 3RFYA 1ZHYA 3UMHA 1OKKD 1VYKA 4ANJA 4C3DA 3FAJA 3KKBA 4CS8A 2W4BA 2VB6A 4O79A 3KMIA 5BUOA 2YZSA 2WB7A 1FFHA 1BR2A 2ZXPA 3ZVRA 5HSWA 4I44A 4BEJA 1M2VB 3EQLF 4GYTA 2G3VA 3OA1A 4DOZA 5EHHA 4E7ZA 3LLKA 4PFOA 2OG2A 4K7BA 4YT8A 3NKEA 1MNDA 2LSEA 3EJNA 4ZLDA 2QTVA 3QZCA 3S28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAY A;  2Y3D A;  2Y3G A;  2Y39 A;  3O39 A;  3ZG1 A;  3OEO A;  2Y3H A;  3QZC A;  2Y3B A;  3EPV A;  3ITF A; 
#chains in the Genus database with same CATH topology
 4XLN F;  1Z6A A;  3LES A;  2LFF A;  3PCV A;  1ZW2 A;  2BL2 A;  4M63 A;  3IQ6 A;  2J9V A;  1T5O A;  1LPE A;  4LER A;  5FCL A;  1NSG B;  1OXB A;  3AG4 C;  4FES A;  3EPV A;  3W8I A;  4MW3 A;  3S27 A;  1A41 A;  3M4C A;  4OIP F;  1J8Y F;  3S84 A;  2QE9 A;  4DBQ A;  2W45 A;  1QQ3 A;  2IXN A;  2A6E F;  3N2Z B;  3DJU B;  3ABK C;  1Y6D A;  3HNK A;  3U8P A;  2XLH A;  4KBL A;  1FMW A;  5D92 A;  1D1B A;  4XLP F;  4Q4Z F;  2YQY A;  4KC9 A;  3Q6N A;  4W8K A;  2A0U A;  2OU6 A;  3EG9 B;  3A11 A;  1OCO C;  4U9E A;  1WWP A;  3U5S A;  1M56 C;  2Q7R A;  1T6I A;  3ZSU A;  1D0X A;  2FGY A;  1NZE A;  1R5I D;  1YVI A;  2CNW A;  3BRJ A;  3V5X A;  3EGD B;  2WVQ A;  2BE5 F;  1EI7 A;  2J7P A;  3S90 A;  1Q0D A;  1UG7 A;  2OJQ A;  3MX3 A;  4XEV A;  4MVS A;  4L6R A;  2WZL A;  2FAP B;  4AL0 A;  1IW7 F;  1T01 A;  2NSF A;  3NKD A;  1TWG A;  1HE9 A;  2Z15 A;  1JMW A;  1NU9 C;  2XSE A;  4MTG A;  3ECS A;  3SXZ A;  2CYD A;  4H4K C;  2HZ8 A;  4MS2 A;  1C02 A;  4WJ0 A;  2UUI A;  4K1O A;  3G50 A;  3GM3 A;  2LQG A;  2TMV P;  2XL8 A;  4Z9I A;  4ER9 A;  5CI9 A;  2JX0 A;  4I1M A;  2XLD A;  2AU5 A;  3JRT A;  1QVX A;  3H2U A;  2WL8 A;  1JR8 A;  1KU2 A;  3TK0 A;  2KQ9 A;  3HLZ A;  4E7S A;  1H9T A;  3VYW A;  1TWH A;  4U5H A;  1I4Z A;  1O5H A;  1A7V A;  4MVM A;  4YK5 A;  4P9T A;  4MTO A;  1SR2 A;  3V7O A;  2ZPA A;  1M2O A;  3MYF A;  2LCH A;  2J9U A;  2ASR A;  3LS1 A;  2J7P D;  1LKX A;  1YLM A;  2X0C A;  3SXK A;  1H7I A;  3NYM A;  2YLG A;  1F1M A;  3L0I A;  1Z63 A;  2L6F A;  5E3A A;  1A7D A;  3W4Y A;  5K0I A;  4PK4 A;  3MFN A;  4NTA A;  4Q7C A;  3HNL A;  2NPU A;  4E17 A;  4DRJ B;  1GS9 A;  4EWC A;  3ZIB A;  5D91 A;  5F5F A;  2KC3 A;  5KYU A;  4H54 A;  4AE4 B;  2XS1 A;  1QKR A;  3TD7 A;  2L7A A;  1QSP A;  2WVO A;  1QPU A;  4JEB A;  2J0W A;  2J0X A;  4JRZ A;  4CDY A;  1JRA A;  2YEV A;  3NYL A;  4JTC B;  2C04 A;  5CI8 A;  3O55 A;  4JW1 A;  1D0Y A;  5E2Q A;  5TJ5 E;  3DMD A;  1T6U A;  2QUP A;  3FXH A;  3ABL C;  3FHD A;  4P6I C;  3AJM A;  1E83 A;  2ZXW C;  5B1A C;  3GM1 A;  4HFK B;  2KGO A;  2MWQ A;  4CS9 C;  5T3T A;  3DD7 A;  3QVY A;  3U3B A;  2YHS A;  3SP1 A;  2GWW A;  4XEK A;  2GFH A;  4MVZ A;  2VAS A;  3RQF A;  4CDA A;  3T6J A;  3WAQ A;  3JYH A;  3B0V C;  1HY5 A;  3L34 A;  4IAR A;  3U2L A;  4DJ9 A;  1YJG A;  2AWY A;  3UGP A;  1B68 A;  4CSA C;  3EGD A;  3KH2 A;  4N6H A;  1OW8 A;  4DRI B;  4MVO A;  1MMG A;  3DAF A;  2YLD A;  4QI0 A;  4K0D A;  3DM9 B;  5B1B C;  3QTH A;  4JTA B;  5E3C A;  4OIR F;  4NQF A;  2EIJ C;  5DS4 A;  1VK5 A;  1H6G A;  2B0H A;  3SYN A;  2XXA A;  2O9X A;  1XWJ A;  3T6B A;  3OEO A;  2R03 A;  1TWA A;  1APC A;  2HS5 A;  1L7C A;  2AVK A;  4Z9H A;  5BQG A;  5BQI A;  1ZVZ A;  3S9O A;  3VM6 A;  1YA9 A;  3H2V A;  4EBB A;  3POV A;  3EH1 A;  2NUP B;  4JJG A;  4LLE A;  5T3W A;  2L9J A;  3LUT B;  1WN0 A;  3T9O A;  4G7O F;  3CZ6 A;  4CS9 A;  2F22 A;  1OR3 A;  2MYS A;  3G4Z A;  4LDQ A;  2CGE A;  2VCB A;  3LEO A;  3CAX A;  5COG A;  1LM3 B;  1OW7 A;  1YAR O;  1ZW3 A;  4YT4 A;  4G7H F;  2EPK X;  3SXY A;  3IQT A;  4D4X A;  1MNE A;  3K1H A;  1E2X A;  1M6T A;  1RMV A;  3SXM A;  1L3P A;  2HJ3 A;  4JC7 A;  5L0H A;  2XRH A;  4PJL A;  3S29 A;  4XEF A;  3IQC A;  2XS8 A;  5L3Q A;  2R7R A;  1ZU4 A;  4MVU A;  2WZG A;  1RKE A;  1VLT A;  3O6X A;  4IAQ A;  1U0B B;  2A6H F;  5KYU B;  1OW6 A;  2LP4 A;  2YWA A;  4CSA A;  2W4M A;  4AE4 A;  3NMK A;  4EBK A;  3C18 A;  3B0U X;  5F5H A;  2E87 A;  3JZ0 A;  2H7O A;  4U5G A;  3LAY A;  1AVO B;  2YL3 A;  2NG1 A;  1FMV A;  2Q3T A;  3RYL A;  1C03 A;  4C3E A;  4NTB A;  1ZZP A;  3O39 A;  5L0J A;  2VCA A;  3RH3 A;  3LJB A;  4MVR A;  1BZ4 A;  1OQC A;  2VC9 A;  4U5C E;  2JD3 A;  2EPN A;  3NMI A;  3ZTZ A;  3HKK A;  1G5Z A;  3B0P A;  2P7V A;  4DVZ A;  1A7E A;  2HUJ A;  1Q0M A;  3K7D A;  2PX0 A;  4BG0 A;  4CX9 A;  3IHU A;  1G8X A;  5L3V A;  4LAC B;  4P9F A;  3QVZ A;  2PX3 A;  4OIQ F;  3FMS A;  4NY3 A;  1LE4 A;  2W9Y A;  3KPH A;  4G7Z F;  3ASN C;  3T4R A;  3NDB B;  3WHN A;  1ZHZ A;  3JCU Q;  4BJ6 C;  1WAS A;  2VH3 A;  4PR9 A;  4OIN F;  3MBG A;  1PD0 A;  3NYJ A;  4U5B E;  4G78 A;  3DE8 A;  2ETS A;  4I3M A;  3DI5 A;  4J30 B;  5CIV A;  4R32 A;  1K40 A;  3TOM A;  4QI2 A;  3G4X A;  4ULV A;  2BC5 A;  4HEA J;  1O3U A;  2I15 A;  5DLJ A;  4JJF A;  4HE8 D;  3RQG A;  1NLX A;  4YN0 B;  3VF0 A;  2YL7 A;  1NBB A;  1ORY A;  3U3F A;  2IOQ A;  2WZF A;  3C8G B;  4DXW A;  1CGM E;  2R7V A;  2V3C C;  2V26 A;  2XXA B;  1LE2 A;  1A0B A;  3RF3 A;  3Q6M A;  1D0Z A;  4JVS A;  1TQG A;  2PBE A;  3DAG A;  2KYH A;  4EBJ A;  2ZXR A;  3FOO A;  3R7C A;  4BJ5 C;  3PHF 2;  1BDJ B;  1D1A A;  2GAQ A;  2DYS C;  4BJT A;  1BR4 A;  1YDI A;  2NUP A;  4U5D E;  2YL0 A;  2CW0 F;  2CNW D;  4UDV A;  1OCR C;  4IB4 A;  2KK1 A;  1M57 C;  3ZTM A;  5DQT A;  2XL6 A;  4MVQ A;  3F47 A;  3RVZ A;  3T6G B;  2D5R B;  1BR1 A;  4W8P A;  3SNH A;  1VYI A;  1Z3I X;  2R7Q A;  4PJM A;  4EUK B;  1U6H A;  2OOC A;  1MMD A;  3JTL O;  1RKE B;  2Y3B A;  3V5Y A;  1IZM A;  2J45 A;  4KNW A;  3WG7 C;  4BJ6 A;  3S0X A;  1EKY A;  5KYW B;  1PV3 A;  2OJE D;  3UMK A;  1FR0 A;  1VOM A;  2HV7 A;  2J9W A;  2Q4F A;  2RSE B;  1K05 A;  1TWC A;  3AG1 C;  4YL0 A;  4XPY A;  3U2M A;  4PFP A;  1E85 A;  5A6J A;  4FWV A;  1ZYR F;  5AC5 A;  2Q9B A;  3JSZ A;  3C63 A;  3HTK C;  4JTD B;  5B3S C;  4ONS A;  3RVY A;  4GEH A;  2G3K A;  3UMI A;  1TFK B;  2Y69 C;  4XWJ A;  3ZG1 A;  2MHR A;  3UR3 C;  2Y3H A;  4E18 A;  2J46 A;  1NU7 D;  2OCC C;  5COM A;  3GAN A;  4O7G A;  3GWN A;  4DBR A;  1OR2 A;  2DYR C;  2IYL D;  2R05 A;  3QW0 A;  2RD9 A;  2XM0 A;  4BJ5 A;  4OD5 A;  1Z7Q c;  2OQM A;  1ZU5 A;  2ZXO A;  3JT1 A;  1OCZ C;  2DI3 A;  2Y39 A;  1T6Q A;  2EIK C;  3Q7L A;  3BEH A;  3U9J A;  1Q0F A;  2R7S A;  3IEE A;  1WOL A;  2H7V C;  2QLA A;  3ZWI A;  1V74 B;  3UNG C;  5L0G A;  2OEV A;  2AP3 A;  3MLG A;  4AX2 A;  1MMA A;  1YYJ A;  1XZP A;  3EZI A;  5JSL A;  4EIY A;  2PNO A;  3DE9 A;  2XLE A;  2R9R B;  5JP7 A;  3HNJ A;  1HMO A;  4OD4 A;  1LVK A;  1Q0K A;  4F4B A;  3AQB A;  3UGO A;  1ST6 A;  1MMN A;  3EFO B;  3C8G A;  3DXJ F;  1RKC A;  3TJ6 A;  1VLS A;  3AG3 C;  3V5Z A;  1JPJ A;  4RBN A;  3VAY A;  3W2W A;  2KW3 C;  2A69 F;  1LIH A;  1ZHX A;  3SZR A;  3RIP A;  2EPL X;  4ZLC A;  3W8H A;  1ZHW A;  3E9V A;  4O6M A;  5KYY B;  2I8B A;  3PMR A;  3I4U A;  2A68 F;  3LEV A;  4O6N A;  2OKU A;  5EK0 A;  1I5N A;  1HW1 A;  2LFD A;  2J8W A;  4E0H A;  4IRU A;  3C62 A;  3RQE A;  1N1C A;  2IXP A;  2UUH A;  3K6B A;  2D4U A;  2PFD A;  2P6V A;  3X1O A;  5JVE A;  2XLV A;  3QMK A;  4QDL A;  2DGJ A;  1CGN A;  1HMD A;  1SZI A;  2LK4 A;  4I1O B;  1T9K A;  4XPW A;  1JAF A;  3DJN B;  3L8J A;  4FAP B;  2YLI A;  2JPU A;  4CBE A;  2NUT B;  1TKN A;  1KTM A;  4G0H A;  2J9B A;  3DZA A;  5BQH A;  2R7O A;  3CEX A;  2HV6 A;  3C8G D;  2P0N A;  3K1I C;  3RKO F;  5DVW A;  2DB4 A;  4BPM A;  5KYW A;  2H7B A;  1HE1 A;  2WVN A;  1BBH A;  3GEH A;  4NC3 A;  5T1D B;  1W2W A;  1RJ9 B;  1K04 A;  1YAU O;  2IXO A;  4GQH A;  5JLI A;  3IPM O;  4YL1 A;  3CSK A;  4U5E E;  4YT5 A;  1Z5Z A;  4JUR I;  3B29 A;  5HV9 A;  5F28 E;  2PF4 E;  4JE9 A;  1GGQ A;  2G62 A;  1V54 C;  2X51 A;  4NTF A;  4YT2 A;  3B9Q A;  2KNH A;  3ZQY A;  4J32 B;  4HFF B;  4Q5S F;  3JSE O;  4JZA A;  4WGY A;  2L81 A;  3C7J A;  3EGX B;  2LD6 A;  2M4E A;  4C7O B;  1H9G A;  1FTS A;  1OCC C;  2NSG A;  4JCH A;  5L0C A;  4OIO F;  1SF8 A;  3SEO A;  1LS1 A;  2C03 A;  3AG2 C;  1VMA A;  3F46 A;  3TOL A;  3DM5 A;  1CPQ A;  3EHN A;  3GOR A;  3IQ5 A;  3N24 A;  3EZH A;  4EHP A;  3J06 A;  1XZQ A;  1SMY F;  2L6H A;  3LLI A;  4J7T A;  3KYI A;  3NG1 A;  3NMJ A;  1JOG A;  3WOD F;  2Q9A A;  2IXM A;  4ULW A;  4A2N B;  5DS6 A;  1RXQ A;  3FDQ A;  2PP4 A;  4IAO A;  2GDC A;  3GEI A;  3E70 C;  2EIM C;  4AK9 A;  5GPG B;  1C17 M;  1J8M F;  3CQZ A;  2R7T A;  2OEX A;  2Y3D A;  2R7X A;  2XLO A;  4XTK A;  1KNY A;  5A6K A;  1AEP A;  3K1I A;  5JT4 A;  2R7W A;  3LS0 A;  3EFO A;  2EPO A;  3M1C B;  2HKV A;  3TJ5 A;  4BJ1 A;  5A69 A;  3AGU A;  1VB5 A;  2Y3G A;  5COF A;  1JPN A;  2QY9 A;  4MTF A;  2EIN C;  3N0T A;  2KJG A;  3I5P A;  5KYX B;  2XLM A;  3GWL A;  5KYY A;  5A6B D;  4O6Y A;  3EHM A;  1LI7 A;  4YWQ A;  2M64 A;  4JCZ A;  4PJN A;  1AUE A;  4LDR A;  2R25 A;  1YZA A;  1YZC A;  3AOU A;  4XPX A;  4N4W A;  3GM2 A;  4PJJ A;  4IWB A;  1NFO A;  1NFN A;  4X0R A;  4CIH A;  5DQZ A;  4LDK A;  4BEM J;  1FNT c;  1WAT A;  1TFO B;  1FFT C;  3U0C A;  3FVY A;  4U9D A;  1EQ1 A;  4RD9 A;  3K33 A;  1WGW A;  3ATP A;  1PCX A;  3X2Q C;  2IBF A;  3QW1 A;  256B A;  1UFB A;  1G4U S;  3LNM B;  2NUT A;  1TR2 A;  4KI2 A;  2A1D D;  4C3B A;  1D1C A;  4DVY P;  3DWW A;  3JRM O;  4WGZ A;  5IY5 C;  1LS4 A;  3HNI A;  3US6 A;  2HJM A;  1LI5 A;  1RJ9 A;  2R7U A;  4FX5 A;  1M2V A;  4YJW A;  3R2P A;  4LLC A;  1YYX A;  4CDV A;  2YVK A;  4KNV A;  1G4W R;  5E33 A;  3I5Q A;  4CJO A;  2HSB A;  1PD1 A;  4MQ9 F;  2QNL A;  2XL4 A;  4MND A;  1CGO A;  3U8V A;  3AQC A;  1GQA A;  3HJC A;  5KYN A;  1QLE C;  4RDA A;  3B71 A;  4AL1 A;  1ORS C;  5EGY A;  1YA7 O;  1NG1 A;  3JYY A;  1HW2 A;  4NCQ A;  1I4Y A;  3W2V A;  3C8Z A;  4U5F E;  4CS8 C;  4PAC A;  3EGX A;  4C7O A;  1DOV A;  4CS7 A;  3LNR A;  1S05 A;  3Q7G A;  3L8I A;  1VTM P;  1FAP B;  4MW8 A;  1QZX A;  3L1M A;  5FZT A;  1R4T A;  5AC4 A;  1E84 A;  1OKK A;  2YKZ A;  4N06 A;  4B6I A;  5A6A A;  2Q00 A;  3KL4 A;  1CPR A;  2EIL C;  2Q9C A;  2B0J A;  2CDQ A;  3NRH A;  1S7Z A;  3EH2 A;  3OWT A;  4IJJ A;  3MYI A;  3GEE A;  3ZC4 A;  5DS5 A;  3O10 A;  2XM4 A;  1Y4C A;  3ASO C;  4EKW A;  2ICW G;  1ORJ A;  3GOD A;  5AGF A;  2VCC A;  1ZHT A;  2AWC A;  3K66 A;  2HFI A;  4Z9J A;  1GM5 A;  3ABM C;  4DRH B;  1Z23 A;  3EG9 A;  3H65 A;  3ZDL A;  2EPM X;  3A9C A;  4WAB A;  1O87 A;  4JIO A;  3ITF A;  1V55 C;  4E0I A;  2P61 A;  4JKV A;  2FFH A;  5KYX A;  3RFY A;  2KSF A;  1ZHY A;  3FOP A;  4YL3 A;  1U89 A;  3UMH A;  2H8A A;  1OKK D;  1VYK A;  2HSQ A;  4ANJ A;  3FAJ A;  4C3D A;  5L0I A;  3KKB A;  2GA0 A;  3ZQV A;  4CS8 A;  3AGT A;  2LIG A;  2W4B A;  3KYJ A;  1WTY A;  2VB6 A;  1V4A A;  2L6G A;  3DKA A;  3PDM P;  2HMZ A;  3M15 A;  4O79 A;  1OXK A;  1E86 A;  4CIP A;  1Q0G A;  3KMI A;  5JRA A;  5JUA A;  5BUO A;  5L0F A;  2A0B A;  2P1A A;  2CCY A;  2YZS A;  5JS5 A;  2WB7 A;  1BR2 A;  1FFH A;  2ZXP A;  3ZVR A;  2YRF A;  5HSW A;  3M79 A;  3U9M A;  4I44 A;  4BEJ A;  3VRC A;  1M2V B;  1MQV A;  2IM8 A;  3EQL F;  3RW0 A;  5A6B A;  3TQO A;  4GYT A;  4CJG A;  2HMQ A;  2G3V A;  3OA1 A;  4A4A A;  4DOZ A;  4E7Z A;  5EHH A;  2YL1 A;  2ZD9 A;  3LLK A;  4PFO A;  3TUL A;  2OG2 A;  1RCP A;  2XLW A;  4K7B A;  3M4B A;  4YT8 A;  4XQ1 A;  4IGG A;  5L0D A;  3NKE A;  1MND A;  2LSE A;  4N6C A;  4J7Y A;  4JEA A;  3EJN A;  2R02 A;  4D4N A;  5B3I A;  4ZLD A;  3FAP B;  2QTV A;  3QZC A;  1EA8 A;  1DOW A;  3S28 A;  1SYQ A; 
#chains in the Genus database with same CATH homology
 4XLN F;  1Z6A A;  3LES A;  4M63 A;  2J9V A;  4LER A;  5FCL A;  3AG4 C;  4FES A;  3EPV A;  3W8I A;  3S27 A;  4OIP F;  1J8Y F;  4DBQ A;  2W45 A;  2IXN A;  2A6E F;  3N2Z B;  3DJU B;  3ABK C;  4KBL A;  1FMW A;  5D92 A;  1D1B A;  4XLP F;  4Q4Z F;  4KC9 A;  3Q6N A;  4W8K A;  3EG9 B;  1OCO C;  1M56 C;  3ZSU A;  1D0X A;  2FGY A;  1NZE A;  2CNW A;  3EGD B;  2WVQ A;  2BE5 F;  2J7P A;  3MX3 A;  2WZL A;  1IW7 F;  3NKD A;  1TWG A;  2Z15 A;  1NU9 C;  2XSE A;  3ECS A;  4H4K C;  4WJ0 A;  5CI9 A;  4I1M A;  3JRT A;  2WL8 A;  1KU2 A;  2KQ9 A;  3HLZ A;  4E7S A;  3VYW A;  1TWH A;  4U5H A;  1O5H A;  3V7O A;  2ZPA A;  1M2O A;  2J9U A;  3LS1 A;  2J7P D;  1LKX A;  3NYM A;  3L0I A;  5E3A A;  4PK4 A;  4EWC A;  4Q7C A;  3ZIB A;  5D91 A;  5F5F A;  5KYU A;  4AE4 B;  3TD7 A;  2WVO A;  2J0W A;  2J0X A;  2YEV A;  3NYL A;  2C04 A;  5CI8 A;  4JW1 A;  1D0Y A;  5E2Q A;  3DMD A;  3ABL C;  3FHD A;  4P6I C;  2ZXW C;  5B1A C;  4HFK B;  4CS9 C;  2KGO A;  2MWQ A;  5T3T A;  3DD7 A;  2YHS A;  3SP1 A;  2GFH A;  2VAS A;  3T6J A;  3JYH A;  3B0V C;  3L34 A;  3UGP A;  4CSA C;  3EGD A;  3KH2 A;  1MMG A;  3DAF A;  4QI0 A;  4K0D A;  3DM9 B;  5B1B C;  5E3C A;  4OIR F;  2EIJ C;  5DS4 A;  1VK5 A;  3SYN A;  2XXA A;  2O9X A;  3T6B A;  3OEO A;  1TWA A;  3POV A;  4EBB A;  3EH1 A;  2NUP B;  4JJG A;  4LLE A;  5T3W A;  2L9J A;  4G7O F;  3CZ6 A;  4CS9 A;  2MYS A;  2CGE A;  1Z63 A;  4G7H F;  4YT4 A;  1MNE A;  3K1H A;  2XRH A;  4PJL A;  3S29 A;  2R7R A;  5L3Q A;  1ZU4 A;  2WZG A;  3O6X A;  2A6H F;  5KYU B;  4CSA A;  2W4M A;  4AE4 A;  3B0U X;  5F5H A;  2E87 A;  2H7O A;  4U5G A;  3LAY A;  2NG1 A;  1FMV A;  2Q3T A;  3RYL A;  4C3E A;  3O39 A;  3RH3 A;  3LJB A;  4U5C E;  2JD3 A;  3B0P A;  4DVZ A;  2P7V A;  3K7D A;  2PX0 A;  4BG0 A;  5L3V A;  1G8X A;  4LAC B;  2PX3 A;  4OIQ F;  4NY3 A;  2W9Y A;  4G7Z F;  3ASN C;  3T4R A;  3NDB B;  1ZHZ A;  3JCU Q;  4BJ6 C;  2VH3 A;  4OIN F;  1PD0 A;  3NYJ A;  4U5B E;  4I3M A;  4J30 B;  4QI2 A;  4HEA J;  5DLJ A;  4JJF A;  4HE8 D;  4ZLC A;  4YN0 B;  2IOQ A;  2WZF A;  2R7V A;  2V3C C;  2V26 A;  2XXA B;  3Q6M A;  1D0Z A;  4JVS A;  3DAG A;  2ZXR A;  4BJ5 C;  3PHF 2;  1D1A A;  4BJT A;  2DYS C;  1BR4 A;  2NUP A;  4U5D E;  2CW0 F;  2CNW D;  1OCR C;  1M57 C;  5DQT A;  3F47 A;  2D5R B;  1BR1 A;  3SNH A;  1VYI A;  1Z3I X;  2R7Q A;  4PJM A;  1MMD A;  2Y3B A;  1IZM A;  2J45 A;  4KNW A;  3WG7 C;  4BJ6 A;  3S0X A;  5KYW B;  3UMK A;  1VOM A;  2HV7 A;  2J9W A;  1TWC A;  3AG1 C;  4PFP A;  4FWV A;  1ZYR F;  2Q9B A;  3JSZ A;  3HTK C;  5B3S C;  4GEH A;  2G3K A;  3UMI A;  2Y69 C;  4XWJ A;  3ZG1 A;  3UR3 C;  2Y3H A;  2J46 A;  1NU7 D;  2OCC C;  3GAN A;  4O7G A;  4DBR A;  2DYR C;  2IYL D;  4BJ5 A;  4OD5 A;  1ZU5 A;  2ZXO A;  3JT1 A;  1OCZ C;  2Y39 A;  2EIK C;  3Q7L A;  2R7S A;  3IEE A;  2H7V C;  3UNG C;  3MLG A;  4AX2 A;  1MMA A;  3EZI A;  4OD4 A;  1LVK A;  4F4B A;  3AQB A;  3UGO A;  1ST6 A;  1MMN A;  3EFO B;  3DXJ F;  3AG3 C;  1JPJ A;  4RBN A;  3VAY A;  3W2W A;  2KW3 C;  2A69 F;  1ZHX A;  3SZR A;  3RIP A;  3W8H A;  1ZHW A;  3E9V A;  4O6M A;  5KYY B;  2I8B A;  3PMR A;  3I4U A;  2A68 F;  3LEV A;  4O6N A;  4IRU A;  1N1C A;  2IXP A;  3K6B A;  2PFD A;  2P6V A;  3X1O A;  3QMK A;  4QDL A;  2DGJ A;  1SZI A;  4I1O B;  3DJN B;  4CBE A;  2NUT B;  1TKN A;  4G0H A;  3DZA A;  2R7O A;  3K1I C;  2HV6 A;  3RKO F;  5KYW A;  5DVW A;  2H7B A;  2WVN A;  5T1D B;  1W2W A;  1RJ9 B;  2IXO A;  3CSK A;  4U5E E;  4YT5 A;  1Z5Z A;  4JUR I;  2PF4 E;  2G62 A;  1V54 C;  2X51 A;  4YT2 A;  3B9Q A;  2KNH A;  4J32 B;  4HFF B;  4Q5S F;  4JZA A;  2L81 A;  3EGX B;  2M4E A;  4C7O B;  1FTS A;  1OCC C;  4JCH A;  4OIO F;  1SF8 A;  3SEO A;  1LS1 A;  2C03 A;  3AG2 C;  1VMA A;  3F46 A;  3DM5 A;  3EHN A;  3N24 A;  3EZH A;  1SMY F;  3LLI A;  3NG1 A;  3WOD F;  2Q9A A;  2IXM A;  4ULW A;  4A2N B;  5DS6 A;  3FDQ A;  2PP4 A;  4IAO A;  3E70 C;  2EIM C;  4AK9 A;  1J8M F;  3CQZ A;  2R7T A;  2Y3D A;  2R7X A;  4XTK A;  2R7W A;  3LS0 A;  3EFO A;  3M1C B;  4BJ1 A;  2Y3G A;  1JPN A;  2QY9 A;  2EIN C;  3N0T A;  2KJG A;  3I5P A;  5KYX B;  5KYY A;  4O6Y A;  3EHM A;  4YWQ A;  4PJN A;  4PJJ A;  4IWB A;  4X0R A;  4CIH A;  5DQZ A;  1FFT C;  3FVY A;  4RD9 A;  3K33 A;  1WGW A;  1PCX A;  3X2Q C;  2NUT A;  4KI2 A;  1TR2 A;  2A1D D;  4C3B A;  1D1C A;  4DVY P;  5IY5 C;  2R7U A;  1RJ9 A;  4FX5 A;  1M2V A;  4YJW A;  4LLC A;  4KNV A;  5E33 A;  3I5Q A;  1PD1 A;  4MQ9 F;  2XL4 A;  4MND A;  3AQC A;  3HJC A;  5KYN A;  1QLE C;  4RDA A;  5EGY A;  1NG1 A;  3W2V A;  4U5F E;  4CS8 C;  3EGX A;  4C7O A;  4CS7 A;  3LNR A;  3Q7G A;  1QZX A;  1OKK A;  4B6I A;  4N06 A;  3KL4 A;  2EIL C;  2Q9C A;  2B0J A;  2CDQ A;  3NRH A;  1S7Z A;  3EH2 A;  3OWT A;  4IJJ A;  3ZC4 A;  5DS5 A;  3ASO C;  3GOD A;  1ZHT A;  3K66 A;  3ABM C;  1Z23 A;  3EG9 A;  3H65 A;  1O87 A;  3ITF A;  1V55 C;  2FFH A;  5KYX A;  3RFY A;  1ZHY A;  3UMH A;  1OKK D;  1VYK A;  4ANJ A;  4C3D A;  3FAJ A;  3KKB A;  4CS8 A;  2W4B A;  2VB6 A;  4O79 A;  3KMI A;  5BUO A;  2YZS A;  2WB7 A;  1FFH A;  1BR2 A;  2ZXP A;  3ZVR A;  5HSW A;  4I44 A;  4BEJ A;  1M2V B;  3EQL F;  4GYT A;  2G3V A;  3OA1 A;  4DOZ A;  5EHH A;  4E7Z A;  3LLK A;  4PFO A;  2OG2 A;  4K7B A;  4YT8 A;  3NKE A;  1MND A;  2LSE A;  3EJN A;  4ZLD A;  2QTV A;  3QZC A;  3S28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...