3O39A

Crystal structure of spy
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
b'FKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKAKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFEKRLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic protein related to spheroblast formation
molecule tags Chaperone
source organism Escherichia coli
publication title Genetic selection designed to stabilize proteins uncovers a chaperone called Spy.
pubmed doi rcsb
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3o39A00
2Y3DA 2Y3GA 3LAYA 3ITFA 3QZCA 3EPVA 3ZG1A 2Y3BA 2Y3HA 3O39A 3OEOA 2Y39A
chains in the Genus database with same CATH superfamily
3EZIA 3IPMO 1NFOA 5BUOA 2YLGA 2G62A 3QZCA 4C3BA 4I3MA 3B0UX 4JKVA 4QDLA 4OIQF 3KL4A 4PFPA 3M4BA 1YZAA 3IQTA 1D0ZA 1JAFA 4LLCA 5A6BD 4DRJB 2LCHA 3V5ZA 2FAPB 3JZ0A 4CIPA 4XPYA 2KGOA 1XWJA 3TK0A 3E9VA 1J8YF 5COGA 5EHHA 1QLEC 3S84A 2WB7A 1CGME 2R25A 5AC4A 2HJMA 2J0XA 3C62A 3NMIA 3EHMA 5KYYA 4OD5A 2OCCC 1ZW3A 4BG0A 1SZIA 3U2LA 1FMWA 1OCZC 1VYKA 3C18A 4N4WA 2XL4A 3DE9A 4YL3A 2CW0F 3LNMB 4H54A 4EBBA 3DD7A 2OOCA 3QVYA 1PD0A 1PCXA 1Q0KA 1QZXA 2AP3A 5DVWA 1NBBA 2HZ8A 4JCZA 4FWVA 4XLNF 4CBEA 4D4NA 5KYXB 2XXAA 3GM3A 1U89A 5JUAA 2GWWA 2H8AA 1EQ1A 2ZXOA 3N2ZB 3UGPA 1OR3A 2XM4A 3ASNC 1Z23A 3KKBA 2NUPA 4G7ZF 3QW0A 1C17M 3F47A 3VF0A 1VTMP 1FTSA 1Y6DA 4GQHA 4DRIB 3GM2A 3JT1A 4AX2A 4MVOA 4CIHA 3FOOA 4O79A 4PJMA 3JCUQ 2Z15A 1ZU4A 5CI8A 3UMKA 4CDAA 2XS1A 1BR1A 3OEOA 3EG9B 5FZTA 3MFNA 2GFHA 4JC7A 4JURI 3K7DA 2EILC 1QKRA 3UGOA 2MYSA 4U5FE 3HKKA 1LIHA 1XZQA 4PK4A 3EH2A 2KC3A 3B9QA 3S9OA 3GM1A 3MBGA 3B71A 3ZSUA 4CDVA 4YL0A 1LS1A 2W4MA 2UUHA 1AEPA 3K6BA 3LESA 2WZLA 3GODA 2J7PA 3NYJA 2AU5A 3AG4C 3GEHA 3DJNB 3FMSA 4OIRF 1ORJA 2RSEB 2OJQA 2WVNA 2XLEA 4J7TA 3TQOA 1L3PA 2CNWA 2QY9A 1BDJB 2A1DD 2X51A 4EHPA 2C04A 1D1CA 5FCLA 2J9WA 4JE9A 3U2MA 3EPVA 1LVKA 2GAQA 4XPWA 4G0HA 3Q7GA 2VC9A 5L0JA 3S29A 4G78A 3U3BA 4XEKA 2IXPA 2R7XA 4ER9A 3FDQA 1E2XA 1T01A 1R5ID 1ST6A 1RXQA 1E84A 1QSPA 1D1AA 4U5HA 4KC9A 1LE2A 4IARA 1NSGB 2VCCA 3EGXB 1E85A 3B0VC 2JPUA 1Z3IX 3ZQVA 3U3FA 3IHUA 4E17A 1C02A 2OG2A 2EIKC 2LFDA 3HNIA 2YWAA 4IGGA 1E83A 4MVRA 5EGYA 1RKEA 1TQGA 1CGNA 2YZSA 2PP4A 5JRAA 2KW3C 2HS5A 2G3VA 2PX3A 3EFOB 1G4US 1ZZPA 4ULWA 4XQ1A 2NUTB 2EIJC 3K1HA 4YN0B 1HE1A 4IJJA 4AE4A 5KYWB 1VB5A 5JS5A 2XLMA 4YL1A 2W4BA 1JPNA 256BA 2R03A 2YQYA 2BC5A 3C63A 3ZWIA 2WL8A 4LDRA 2ZPAA 4K7BA 2L81A 4U5EE 4B6IA 2P6VA 4PJJA 1JR8A 3POVA 2WVQA 3LEOA 2CNWD 3IQ6A 1T6QA 3EGXA 5L0FA 2ASRA 2XLVA 2Y3BA 2VCAA 3X2QC 1DOWA 3JTLO 4N6CA 4L6RA 2EINC 4EBJA 2IXMA 2M64A 5GPGB 1K04A 3NKDA 2GDCA 2ZXWC 4BJ5A 2XM0A 4I1OB 3W8HA 4DXWA 2JD3A 5JP7A 1LE4A 3ABMC 4EBKA 1V4AA 1G8XA 2XL8A 2CDQA 1XZPA 2HV6A 2Q4FA 4CX9A 1M6TA 4CJGA 1KU2A 3HNJA 4JJFA 4JTCB 4O7GA 4BJ5C 4EWCA 3SXZA 1YLMA 2EIMC 1OKKD 1B68A 3FAJA 4OINF 4Z9JA 2J9UA 2H7VC 2XLHA 2YL1A 1D1BA 3DWWA 2DYSC 4PJLA 3CAXA 2MHRA 3NMJA 2OU6A 1H7IA 5IY5C 1Q0GA 2HMZA 2Q9CA 2UUIA 3RIPA 4IRUA 3US6A 1QVXA 3U8PA 4P9TA 1GS9A 3K1IC 2Y3DA 4DJ9A 3LAYA 1OXKA 3RFYA 2QNLA 1MNDA 1YYXA 2NSFA 3QVZA 4C3EA 4YWQA 1TR2A 1ZYRF 5TJ5E 4Q7CA 3B0PA 4MTGA 2HMQA 1MMAA 2PBEA 3NRHA 1H9GA 2R7QA 4CJOA 3KYJA 4Z9HA 2L6HA 3W2WA 4BEMJ 4MVZA 1T6IA 2LSEA 2B0JA 5DQTA 3HTKC 4D4XA 4DBRA 3G4XA 4JTDB 1O87A 4OIPF 4WGYA 2HSQA 5L3QA 4LDKA 1RMVA 5E2QA 3R7CA 2FGYA 2J45A 3RKOF 3IQ5A 3PDMP 4QI0A 2YRFA 1BR4A 1WATA 3CQZA 5F5HA 4YK5A 4FAPB 1IZMA 1VYIA 5E3AA 2HUJA 3JSEO 4CSAA 4CS9C 3AG2C 3L34A 4ONSA 1A7DA 1YJGA 2XLOA 4U9DA 5L0DA 5D91A 3G50A 1ZHTA 3LJBA 2KJGA 2KYHA 3EQLF 4K0DA 3GANA 3BRJA 3J06A 2BE5F 1OW8A 5B3IA 2A0BA 3ECSA 2O9XA 3RYLA 2XXAB 3PMRA 1SMYF 3O55A 3LNRA 3S28A 2KNHA 2CYDA 5T3TA 4W8PA 1VMAA 2KSFA 5EK0A 1JOGA 3U9MA 3L8IA 4XTKA 2H7OA 3QMKA 1WN0A 4HFFB 3WHNA 4R32A 1LI7A 1WWPA 2DYRC 1TWCA 3TULA 4Q4ZF 3I4UA 1SF8A 4MQ9F 1AVOB 4LDQA 5BQHA 4IB4A 3M79A 3V7OA 1QPUA 1U6HA 3O6XA 5AGFA 1BZ4A 2R02A 2B0HA 1VK5A 3T6JA 5BQIA 1RKEB 2ZXRA 4EKWA 3W4YA 2XS8A 4NCQA 1Z5ZA 3I5QA 1A0BA 3DAGA 3LS0A 2NUTA 2YL0A 4U5CE 1D0YA 4CS7A 4E7ZA 4O6MA 2BL2A 2IM8A 5L0HA 1Z6AA 2YL3A 1OXBA 3F46A 4JEBA 4PACA 1ORYA 3TJ5A 3WODF 4BEJA 3HNKA 3HNLA 5COMA 3PCVA 2IXNA 4JJGA 5D92A 3U8VA 3WG7C 3MYFA 2CCYA 3ZC4A 5A6KA 1I4ZA 1LS4A 1SYQA 2LIGA 2C03A 2OEVA 3CSKA 4N6HA 4E7SA 5DS5A 2VCBA 3RW0A 2CGEA 1JMWA 1HW2A 4NTFA 1EA8A 2M4EA 1RJ9B 4NY3A 2AVKA 1K05A 3DE8A 4LLEA 3H2UA 1Q0DA 3SP1A 4BJTA 3S90A 4DOZA 4XEVA 4JRZA 2YKZA 4GYTA 1CGOA 4XLPF 1M56C 1FAPB 4HFKB 4MVMA 1VLSA 1Q0MA 2EPNA 1JPJA 2A6HF 2R7UA 3DAFA 4IAOA 1YA9A 1UFBA 1FFHA 1M2OA 3N24A 2J0WA 3EGDB 4G7HF 4W8KA 2J46A 3QW1A 5A6AA 3V5XA 5KYUB 3NKEA 3KH2A 4LACB 5E3CA 3ASOC 3DXJF 3EZHA 4WJ0A 4FESA 4IWBA 3MX3A 2R7RA 3AJMA 3AGTA 3HJCA 3L0IA 3GEIA 4CDYA 4ZLCA 2XLDA 3OA1A 3VAYA 4IAQA 5KYUA 3O39A 5COFA 2PFDA 1RJ9A 4RD9A 5A6JA 1EKYA 1YARO 1PD1A 1PV3A 4MVUA 3L8JA 3LLIA 4J7YA 4JEAA 4E18A 3RVZA 3U5SA 4OIOF 3RH3A 1A7VA 1G5ZA 2NSGA 3VRCA 1YVIA 1W2WA 1FMVA 2L6FA 3TOLA 1RKCA 2YLIA 3MLGA 4KBLA 4KNWA 4MNDA 4RBNA 5A6BA 3ZDLA 5JLIA 3K33A 2R7TA 1YDIA 4CSAC 5F28E 1TWAA 4MTFA 3T6BA 2XRHA 1VLTA 1OW6A 1I4YA 2FFHA 3EG9A 3SNHA 3JSZA 4BJ1A 4UDVA 1FR0A 4JW1A 1ZHYA 2XSEA 3LLKA 1OCOC 3CEXA 4K1OA 3DM9B 3LUTB 3NYMA 3SYNA 3T6GB 2Y39A 3V5YA 2DI3A 5CIVA 1JRAA 2E87A 3A9CA 5AC5A 3PHF2 2QE9A 1CPRA 2QTVA 2YLDA 3DJUB 2R7VA 4FX5A 1V74B 1TWGA 2OEXA 3SZRA 3KYIA 2P7VA 3I5PA 1OW7A 4U5DE 3EJNA 1NU7D 1ZVZA 3C8GA 1M57C 5DQZA 1WASA 2LD6A 4MVSA 3ABKC 1I5NA 3DMDA 4O6NA 2A6EF 3SXMA 2DGJA 1TWHA 2Q3TA 3DM5A 5B3SC 5KYYB 3SEOA 3UMHA 5DLJA 3EHNA 3U9JA 5JT4A 2Y3GA 1UG7A 4XEFA 2XL6A 2VH3A 3H65A 5CI9A 2WZFA 2ICWG 2KQ9A 1V55C 3BEHA 3RQGA 2JX0A 2RD9A 4U5BE 3GEEA 3LEVA 1APCA 1TFKB 4P9FA 1MMNA 5DS6A 1NFNA 5JSLA 4U5GA 4YT8A 4LERA 2ZD9A 2HKVA 3GWNA 5B1AC 4CS8C 1S05A 4WGZA 5HSWA 1G4WR 3HLZA 2R05A 3Q6NA 3Q7LA 4NC3A 3AG3C 1WOLA 2DB4A 1GGQA 2G3KA 4JTAB 3FHDA 2PX0A 4PR9A 3ZG1A 4NTBA 3ZIBA 3ZTZA 3JRTA 2EPKX 1R4TA 4C3DA 1LM3B 1D0XA 1LI5A 4DRHB 1T5OA 4I44A 4Z9IA 1YA7O 1HMDA 3ZQYA 4PFOA 3ABLC 4MVQA 2R7OA 2L7AA 3NMKA 5L0GA 3M4CA 4U9EA 1K40A 1YAUO 2P1AA 1YZCA 3H2VA 4WABA 1WTYA 3SXYA 3RQFA 1FFTC 2IXOA 4P6IC 3C8GD 1KNYA 4JCHA 3WAQA 1V54C 2W45A 2OJED 1L7CA 1KTMA 1U0BB 1NG1A 2IOQA 5T1DB 1BR2A 1M2VB 2IYLD 2YL7A 4MW3A 4AK9A 4ZLDA 3QTHA 3OWTA 4RDAA 3CZ6A 3DZAA 1H9TA 5HV9A 1OQCA 2MWQA 2I15A 2P61A 5DS4A 3NDBB 1H6GA 3VM6A 3EH1A 4J30B 1M2VA 3E70C 5B1BC 3ZVRA 4NQFA 4BJ6A 2ZXPA 3AGUA 5L3VA 3GORA 2I8BA 4XPXA 4BJ6C 2OQMA 4HE8D 1T9KA 2R7SA 5K0IA 2Q7RA 2Q9BA 3ZTMA 2PF4E 2W9YA 3DKAA 4I1MA 4DBQA 4CS8A 4KI2A 3FAPB 3Q6MA 2X0CA 1DOVA 4JIOA 1OR2A 4X0RA 3B29A 3M1CB 1O3UA 2HFIA 3R2PA 4N06A 4E0IA 5KYXA 3KMIA 1NZEA 2XLWA 3ATPA 3FXHA 4PJNA 2J9BA 3T9OA 1QQ3A 3IEEA 3MYIA 1GQAA 3LS1A 4ULVA 2V26A 4A2NB 4G7OF 1ORSC 3O10A 4YT5A 1LPEA 2OKUA 3JRMO 2NPUA 3TD7A 2A0UA 2Y3HA 1NLXA 3AOUA 1BBHA 1CPQA 3FOPA 1ZHZA 4DVZA 5A69A 3UNGC 2HJ3A 1C03A 2HSBA 3NYLA 3EFOA 2KK1A 4QI2A 1O5HA 3UR3C 5F5FA 3A11A 3AG1C 2NUPB 1Z63A 1HMOA 1SR2A 1ZU5A 3AQBA 3S27A 4J32B 3T4RA 3UMIA 2Q00A 4JVSA 1RCPA 3RVYA 1Y4CA 3JYHA 3U0CA 1MMGA 2NG1A 1AUEA 2WZGA 5T3WA 1IW7F 4XWJA 4EIYA 1VOMA 2HV7A 2EPMX 4C7OA 5BQGA 4AL1A 1ZW2A 2LQGA 4A4AA 1TFOB 2LK4A 1FNTc 1Z7Qc 3L1MA 2AWCA 4NTAA 4MTOA 2VB6A 2J7PD 2QUPA 3M15A 1A7EA 1NU9C 3ITFA 3VYWA 3W8IA 4BPMA 3DI5A 2Q9AA 4E0HA 3IQCA 3RQEA 1MNEA 2R9RB 4OD4A 2D4UA 1YYJA 2VASA 4HEAJ 1E86A 4H4KC 2J8WA 2A68F 2TMVP 4DVYP 3C8GB 3W2VA 1A41A 2AWYA 1MQVA 2EPLX 4JZAA 2V3CC 2LFFA 2Y69C 3JYYA 3SXKA 1OCRC 2YEVA 2PNOA 4CS9A 4ANJA 2IBFA 2YHSA 4EUKB 1N1CA 3GWLA 1LKXA 1T6UA 4Q5SF 1ZHWA 2R7WA 2A69F 2ETSA 4AE4B 5KYWA 3K1IA 4YT4A 2EPOA 3TOMA 2LP4A 2YVKA 4C7OB 2GA0A 1EI7A 5E33A 1ZHXA 1OKKA 5KYNA 4F4BA 1GM5A 3X1OA 3G4ZA 3NG1A 4MS2A 2D5RB 4YJWA 3TJ6A 4MW8A 1MMDA 2H7BA 2J9VA 3C7JA 1S7ZA 4GEHA 1OCCC 2F22A 1Q0FA 3AQCA 4O6YA 3RF3A 5JVEA 4M63A 1F1MA 3C8ZA 1J8MF 1HE9A 2QLAA 1HW1A 5L0CA 1WGWA 1TKNA 2P0NA 2L9JA 3K66A 2WVOA 4YT2A 3KPHA 1HY5A 4AL0A 3EGDA 3FVYA 4KNVA 3S0XA 2L6GA 3N0TA 5L0IA
chains in the Genus database with same CATH topology
3EZIA 5BUOA 2G62A 3QZCA 4C3BA 4I3MA 3B0UX 4QDLA 4OIQF 3KL4A 4PFPA 1D0ZA 4LLCA 2KGOA 3E9VA 1J8YF 5EHHA 1QLEC 2WB7A 2J0XA 5KYYA 3EHMA 4OD5A 2OCCC 4BG0A 1SZIA 1FMWA 1OCZC 1VYKA 2XL4A 2CW0F 4EBBA 3DD7A 5DVWA 1PD0A 1PCXA 1QZXA 5KYXB 4FWVA 4XLNF 4CBEA 2XXAA 2ZXOA 3N2ZB 3UGPA 3ASNC 1Z23A 3KKBA 2NUPA 4G7ZF 3F47A 1FTSA 3JT1A 4AX2A 4CIHA 4O79A 4PJMA 3JCUQ 2Z15A 1ZU4A 5CI8A 3UMKA 1BR1A 3OEOA 3EG9B 2GFHA 4JURI 3K7DA 2EILC 3UGOA 2MYSA 4U5FE 4PK4A 3EH2A 3B9QA 3ZSUA 1LS1A 2W4MA 3K6BA 3LESA 2WZLA 3GODA 2J7PA 3NYJA 3AG4C 3DJNB 4OIRF 2WVNA 2CNWA 2QY9A 2X51A 2A1DD 2C04A 1D1CA 5FCLA 2J9WA 3EPVA 1LVKA 4G0HA 3Q7GA 3S29A 2R7XA 2IXPA 3FDQA 1ST6A 1D1AA 4U5HA 4KC9A 3EGXB 3B0VC 1Z3IX 2OG2A 2EIKC 5EGYA 2YZSA 2PP4A 2KW3C 2G3VA 3EFOB 2PX3A 4ULWA 2NUTB 2EIJC 3K1HA 4YN0B 4AE4A 4IJJA 5KYWB 2W4BA 1JPNA 2WL8A 2ZPAA 4K7BA 2L81A 4U5EE 4B6IA 2P6VA 4PJJA 3POVA 2WVQA 2CNWD 3EGXA 2Y3BA 3X2QC 2EINC 2IXMA 3NKDA 2ZXWC 4BJ5A 4I1OB 3W8HA 2JD3A 3ABMC 1G8XA 2CDQA 2HV6A 1KU2A 4JJFA 4O7GA 4BJ5C 4EWCA 2EIMC 1OKKD 3FAJA 4OINF 2J9UA 2H7VC 1D1BA 2DYSC 4PJLA 5IY5C 3RIPA 2Q9CA 4IRUA 3K1IC 2Y3DA 3LAYA 3RFYA 1MNDA 4YWQA 4C3EA 1TR2A 1ZYRF 4Q7CA 3B0PA 1MMAA 3NRHA 2R7QA 3W2WA 2LSEA 2B0JA 5DQTA 3HTKC 4DBRA 1O87A 4OIPF 5L3QA 5E2QA 2FGYA 2J45A 3RKOF 4QI0A 1BR4A 3CQZA 5F5HA 1IZMA 1VYIA 5E3AA 4CSAA 4CS9C 3AG2C 3L34A 5D91A 1ZHTA 3LJBA 2KJGA 3EQLF 4K0DA 3GANA 2BE5F 3RYLA 3ECSA 2O9XA 2XXAB 3PMRA 1SMYF 3LNRA 3S28A 2KNHA 5T3TA 1VMAA 4XTKA 2H7OA 3QMKA 4HFFB 2DYRC 1TWCA 4Q4ZF 3I4UA 1SF8A 4MQ9F 3V7OA 3O6XA 1VK5A 3T6JA 2ZXRA 1Z5ZA 3I5QA 3DAGA 3LS0A 2NUTA 4U5CE 4E7ZA 1D0YA 4CS7A 4O6MA 1Z6AA 3F46A 4BEJA 3WODF 5D92A 4JJGA 2IXNA 3WG7C 3ZC4A 3CSKA 4E7SA 5DS5A 2C03A 2CGEA 2M4EA 1RJ9B 4NY3A 4LLEA 3SP1A 4BJTA 4DOZA 4GYTA 4XLPF 1M56C 4HFKB 1JPJA 2A6HF 2R7UA 3DAFA 4IAOA 1FFHA 1M2OA 3N24A 2J0WA 3EGDB 4G7HF 4W8KA 2J46A 5KYUB 3NKEA 3KH2A 4LACB 5E3CA 3ASOC 3DXJF 3EZHA 4WJ0A 4FESA 4IWBA 3MX3A 2R7RA 3HJCA 3L0IA 4ZLCA 3OA1A 3VAYA 5KYUA 3O39A 2PFDA 1RJ9A 4RD9A 1PD1A 3LLIA 4OIOF 3RH3A 1W2WA 1FMVA 3MLGA 4KNWA 4KBLA 4MNDA 4RBNA 2R7TA 3K33A 4CSAC 1TWAA 3T6BA 2XRHA 2FFHA 4BJ1A 3EG9A 3SNHA 3JSZA 4JW1A 1ZHYA 2XSEA 3LLKA 1OCOC 3NYMA 3DM9B 3SYNA 2Y39A 2E87A 2R7VA 3PHF2 2QTVA 3DJUB 4FX5A 1TWGA 3SZRA 2P7VA 3I5PA 4U5DE 5DQZA 3EJNA 1NU7D 1M57C 4O6NA 3ABKC 3DMDA 2A6EF 2DGJA 1TWHA 2Q3TA 3DM5A 5B3SC 5KYYB 3SEOA 3UMHA 5DLJA 3EHNA 2Y3GA 2VH3A 3H65A 5CI9A 2WZFA 2KQ9A 1V55C 4U5BE 3LEVA 1MMNA 5DS6A 4U5GA 4YT8A 4LERA 5B1AC 4CS8C 5HSWA 3HLZA 3Q6NA 3Q7LA 3AG3C 2G3KA 3FHDA 2PX0A 3ZG1A 3ZIBA 4C3DA 3JRTA 1D0XA 4I44A 4PFOA 3ABLC 2R7OA 1FFTC 2IXOA 4P6IC 4JCHA 1V54C 2W45A 1NG1A 2IOQA 5T1DB 1BR2A 1M2VB 2IYLD 4AK9A 4ZLDA 3OWTA 4RDAA 3CZ6A 3DZAA 2MWQA 3NDBB 3EH1A 4J30B 1M2VA 3E70C 5B1BC 3ZVRA 4BJ6A 5L3VA 2ZXPA 2I8BA 4BJ6C 4HE8D 2R7SA 2Q9BA 2PF4E 2W9YA 4I1MA 4DBQA 4CS8A 4KI2A 3Q6MA 4X0RA 3M1CB 4N06A 5KYXA 3KMIA 1NZEA 4PJNA 3IEEA 4A2NB 3LS1A 4G7OF 2V26A 4YT5A 3TD7A 2Y3HA 1ZHZA 4DVZA 3UNGC 3NYLA 3EFOA 4QI2A 1O5HA 3UR3C 5F5FA 3AG1C 2NUPB 1Z63A 1ZU5A 3AQBA 3UMIA 3S27A 3T4RA 4J32B 4JVSA 3JYHA 1MMGA 2NG1A 2WZGA 5T3WA 1IW7F 4XWJA 1VOMA 2HV7A 4C7OA 2VB6A 2J7PD 3VYWA 1NU9C 3ITFA 3W8IA 2Q9AA 1MNEA 4OD4A 2VASA 4HEAJ 4H4KC 2A68F 4DVYP 3W2VA 4JZAA 2V3CC 2Y69C 1OCRC 2YEVA 4CS9A 4ANJA 2YHSA 1N1CA 1LKXA 4Q5SF 1ZHWA 2R7WA 2A69F 4AE4B 5KYWA 4YT4A 4C7OB 5E33A 1ZHXA 1OKKA 5KYNA 4F4BA 3X1OA 3NG1A 2D5RB 4YJWA 1MMDA 2H7BA 2J9VA 1S7ZA 4GEHA 1OCCC 4O6YA 3AQCA 4M63A 1J8MF 1WGWA 1TKNA 2L9JA 3K66A 2WVOA 4YT2A 3EGDA 3FVYA 4KNVA 3S0XA 5DS4A 3N0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y3D A;  2Y3G A;  3LAY A;  3ITF A;  3QZC A;  3EPV A;  3ZG1 A;  2Y3B A;  2Y3H A;  3O39 A;  3OEO A;  2Y39 A; 
#chains in the Genus database with same CATH topology
 3EZI A;  3IPM O;  1NFO A;  5BUO A;  2YLG A;  2G62 A;  3QZC A;  4C3B A;  4I3M A;  3B0U X;  4JKV A;  4QDL A;  4OIQ F;  3KL4 A;  4PFP A;  3M4B A;  1YZA A;  3IQT A;  1D0Z A;  1JAF A;  4LLC A;  5A6B D;  4DRJ B;  2LCH A;  3V5Z A;  2FAP B;  3JZ0 A;  4CIP A;  4XPY A;  2KGO A;  1XWJ A;  3TK0 A;  3E9V A;  1J8Y F;  5COG A;  5EHH A;  1QLE C;  3S84 A;  2WB7 A;  1CGM E;  2R25 A;  5AC4 A;  2HJM A;  2J0X A;  3C62 A;  3NMI A;  3EHM A;  5KYY A;  4OD5 A;  2OCC C;  1ZW3 A;  4BG0 A;  1SZI A;  3U2L A;  1FMW A;  1OCZ C;  1VYK A;  3C18 A;  4N4W A;  2XL4 A;  3DE9 A;  4YL3 A;  2CW0 F;  3LNM B;  4H54 A;  4EBB A;  3DD7 A;  2OOC A;  3QVY A;  1PD0 A;  1PCX A;  1Q0K A;  1QZX A;  2AP3 A;  5DVW A;  1NBB A;  2HZ8 A;  4JCZ A;  4FWV A;  4XLN F;  4CBE A;  4D4N A;  5KYX B;  2XXA A;  3GM3 A;  1U89 A;  5JUA A;  2GWW A;  2H8A A;  1EQ1 A;  2ZXO A;  3N2Z B;  3UGP A;  1OR3 A;  2XM4 A;  3ASN C;  1Z23 A;  3KKB A;  2NUP A;  4G7Z F;  3QW0 A;  1C17 M;  3F47 A;  3VF0 A;  1VTM P;  1FTS A;  1Y6D A;  4GQH A;  4DRI B;  3GM2 A;  3JT1 A;  4AX2 A;  4MVO A;  4CIH A;  3FOO A;  4O79 A;  4PJM A;  3JCU Q;  2Z15 A;  1ZU4 A;  5CI8 A;  3UMK A;  4CDA A;  2XS1 A;  1BR1 A;  3OEO A;  3EG9 B;  5FZT A;  3MFN A;  2GFH A;  4JC7 A;  4JUR I;  3K7D A;  2EIL C;  1QKR A;  3UGO A;  2MYS A;  4U5F E;  3HKK A;  1LIH A;  1XZQ A;  4PK4 A;  3EH2 A;  2KC3 A;  3B9Q A;  3S9O A;  3GM1 A;  3MBG A;  3B71 A;  3ZSU A;  4CDV A;  4YL0 A;  1LS1 A;  2W4M A;  2UUH A;  1AEP A;  3K6B A;  3LES A;  2WZL A;  3GOD A;  2J7P A;  3NYJ A;  2AU5 A;  3AG4 C;  3GEH A;  3DJN B;  3FMS A;  4OIR F;  1ORJ A;  2RSE B;  2OJQ A;  2WVN A;  2XLE A;  4J7T A;  3TQO A;  1L3P A;  2CNW A;  2QY9 A;  1BDJ B;  2A1D D;  2X51 A;  4EHP A;  2C04 A;  1D1C A;  5FCL A;  2J9W A;  4JE9 A;  3U2M A;  3EPV A;  1LVK A;  2GAQ A;  4XPW A;  4G0H A;  3Q7G A;  2VC9 A;  5L0J A;  3S29 A;  4G78 A;  3U3B A;  4XEK A;  2IXP A;  2R7X A;  4ER9 A;  3FDQ A;  1E2X A;  1T01 A;  1R5I D;  1ST6 A;  1RXQ A;  1E84 A;  1QSP A;  1D1A A;  4U5H A;  4KC9 A;  1LE2 A;  4IAR A;  1NSG B;  2VCC A;  3EGX B;  1E85 A;  3B0V C;  2JPU A;  1Z3I X;  3ZQV A;  3U3F A;  3IHU A;  4E17 A;  1C02 A;  2OG2 A;  2EIK C;  2LFD A;  3HNI A;  2YWA A;  4IGG A;  1E83 A;  4MVR A;  5EGY A;  1RKE A;  1TQG A;  1CGN A;  2YZS A;  2PP4 A;  5JRA A;  2KW3 C;  2HS5 A;  2G3V A;  2PX3 A;  3EFO B;  1G4U S;  1ZZP A;  4ULW A;  4XQ1 A;  2NUT B;  2EIJ C;  3K1H A;  4YN0 B;  1HE1 A;  4IJJ A;  4AE4 A;  5KYW B;  1VB5 A;  5JS5 A;  2XLM A;  4YL1 A;  2W4B A;  1JPN A;  256B A;  2R03 A;  2YQY A;  2BC5 A;  3C63 A;  3ZWI A;  2WL8 A;  4LDR A;  2ZPA A;  4K7B A;  2L81 A;  4U5E E;  4B6I A;  2P6V A;  4PJJ A;  1JR8 A;  3POV A;  2WVQ A;  3LEO A;  2CNW D;  3IQ6 A;  1T6Q A;  3EGX A;  5L0F A;  2ASR A;  2XLV A;  2Y3B A;  2VCA A;  3X2Q C;  1DOW A;  3JTL O;  4N6C A;  4L6R A;  2EIN C;  4EBJ A;  2IXM A;  2M64 A;  5GPG B;  1K04 A;  3NKD A;  2GDC A;  2ZXW C;  4BJ5 A;  2XM0 A;  4I1O B;  3W8H A;  4DXW A;  2JD3 A;  5JP7 A;  1LE4 A;  3ABM C;  4EBK A;  1V4A A;  1G8X A;  2XL8 A;  2CDQ A;  1XZP A;  2HV6 A;  2Q4F A;  4CX9 A;  1M6T A;  4CJG A;  1KU2 A;  3HNJ A;  4JJF A;  4JTC B;  4O7G A;  4BJ5 C;  4EWC A;  3SXZ A;  1YLM A;  2EIM C;  1OKK D;  1B68 A;  3FAJ A;  4OIN F;  4Z9J A;  2J9U A;  2H7V C;  2XLH A;  2YL1 A;  1D1B A;  3DWW A;  2DYS C;  4PJL A;  3CAX A;  2MHR A;  3NMJ A;  2OU6 A;  1H7I A;  5IY5 C;  1Q0G A;  2HMZ A;  2Q9C A;  2UUI A;  3RIP A;  4IRU A;  3US6 A;  1QVX A;  3U8P A;  4P9T A;  1GS9 A;  3K1I C;  2Y3D A;  4DJ9 A;  3LAY A;  1OXK A;  3RFY A;  2QNL A;  1MND A;  1YYX A;  2NSF A;  3QVZ A;  4C3E A;  4YWQ A;  1TR2 A;  1ZYR F;  5TJ5 E;  4Q7C A;  3B0P A;  4MTG A;  2HMQ A;  1MMA A;  2PBE A;  3NRH A;  1H9G A;  2R7Q A;  4CJO A;  3KYJ A;  4Z9H A;  2L6H A;  3W2W A;  4BEM J;  4MVZ A;  1T6I A;  2LSE A;  2B0J A;  5DQT A;  3HTK C;  4D4X A;  4DBR A;  3G4X A;  4JTD B;  1O87 A;  4OIP F;  4WGY A;  2HSQ A;  5L3Q A;  4LDK A;  1RMV A;  5E2Q A;  3R7C A;  2FGY A;  2J45 A;  3RKO F;  3IQ5 A;  3PDM P;  4QI0 A;  2YRF A;  1BR4 A;  1WAT A;  3CQZ A;  5F5H A;  4YK5 A;  4FAP B;  1IZM A;  1VYI A;  5E3A A;  2HUJ A;  3JSE O;  4CSA A;  4CS9 C;  3AG2 C;  3L34 A;  4ONS A;  1A7D A;  1YJG A;  2XLO A;  4U9D A;  5L0D A;  5D91 A;  3G50 A;  1ZHT A;  3LJB A;  2KJG A;  2KYH A;  3EQL F;  4K0D A;  3GAN A;  3BRJ A;  3J06 A;  2BE5 F;  1OW8 A;  5B3I A;  2A0B A;  3ECS A;  2O9X A;  3RYL A;  2XXA B;  3PMR A;  1SMY F;  3O55 A;  3LNR A;  3S28 A;  2KNH A;  2CYD A;  5T3T A;  4W8P A;  1VMA A;  2KSF A;  5EK0 A;  1JOG A;  3U9M A;  3L8I A;  4XTK A;  2H7O A;  3QMK A;  1WN0 A;  4HFF B;  3WHN A;  4R32 A;  1LI7 A;  1WWP A;  2DYR C;  1TWC A;  3TUL A;  4Q4Z F;  3I4U A;  1SF8 A;  4MQ9 F;  1AVO B;  4LDQ A;  5BQH A;  4IB4 A;  3M79 A;  3V7O A;  1QPU A;  1U6H A;  3O6X A;  5AGF A;  1BZ4 A;  2R02 A;  2B0H A;  1VK5 A;  3T6J A;  5BQI A;  1RKE B;  2ZXR A;  4EKW A;  3W4Y A;  2XS8 A;  4NCQ A;  1Z5Z A;  3I5Q A;  1A0B A;  3DAG A;  3LS0 A;  2NUT A;  2YL0 A;  4U5C E;  1D0Y A;  4CS7 A;  4E7Z A;  4O6M A;  2BL2 A;  2IM8 A;  5L0H A;  1Z6A A;  2YL3 A;  1OXB A;  3F46 A;  4JEB A;  4PAC A;  1ORY A;  3TJ5 A;  3WOD F;  4BEJ A;  3HNK A;  3HNL A;  5COM A;  3PCV A;  2IXN A;  4JJG A;  5D92 A;  3U8V A;  3WG7 C;  3MYF A;  2CCY A;  3ZC4 A;  5A6K A;  1I4Z A;  1LS4 A;  1SYQ A;  2LIG A;  2C03 A;  2OEV A;  3CSK A;  4N6H A;  4E7S A;  5DS5 A;  2VCB A;  3RW0 A;  2CGE A;  1JMW A;  1HW2 A;  4NTF A;  1EA8 A;  2M4E A;  1RJ9 B;  4NY3 A;  2AVK A;  1K05 A;  3DE8 A;  4LLE A;  3H2U A;  1Q0D A;  3SP1 A;  4BJT A;  3S90 A;  4DOZ A;  4XEV A;  4JRZ A;  2YKZ A;  4GYT A;  1CGO A;  4XLP F;  1M56 C;  1FAP B;  4HFK B;  4MVM A;  1VLS A;  1Q0M A;  2EPN A;  1JPJ A;  2A6H F;  2R7U A;  3DAF A;  4IAO A;  1YA9 A;  1UFB A;  1FFH A;  1M2O A;  3N24 A;  2J0W A;  3EGD B;  4G7H F;  4W8K A;  2J46 A;  3QW1 A;  5A6A A;  3V5X A;  5KYU B;  3NKE A;  3KH2 A;  4LAC B;  5E3C A;  3ASO C;  3DXJ F;  3EZH A;  4WJ0 A;  4FES A;  4IWB A;  3MX3 A;  2R7R A;  3AJM A;  3AGT A;  3HJC A;  3L0I A;  3GEI A;  4CDY A;  4ZLC A;  2XLD A;  3OA1 A;  3VAY A;  4IAQ A;  5KYU A;  3O39 A;  5COF A;  2PFD A;  1RJ9 A;  4RD9 A;  5A6J A;  1EKY A;  1YAR O;  1PD1 A;  1PV3 A;  4MVU A;  3L8J A;  3LLI A;  4J7Y A;  4JEA A;  4E18 A;  3RVZ A;  3U5S A;  4OIO F;  3RH3 A;  1A7V A;  1G5Z A;  2NSG A;  3VRC A;  1YVI A;  1W2W A;  1FMV A;  2L6F A;  3TOL A;  1RKC A;  2YLI A;  3MLG A;  4KBL A;  4KNW A;  4MND A;  4RBN A;  5A6B A;  3ZDL A;  5JLI A;  3K33 A;  2R7T A;  1YDI A;  4CSA C;  5F28 E;  1TWA A;  4MTF A;  3T6B A;  2XRH A;  1VLT A;  1OW6 A;  1I4Y A;  2FFH A;  3EG9 A;  3SNH A;  3JSZ A;  4BJ1 A;  4UDV A;  1FR0 A;  4JW1 A;  1ZHY A;  2XSE A;  3LLK A;  1OCO C;  3CEX A;  4K1O A;  3DM9 B;  3LUT B;  3NYM A;  3SYN A;  3T6G B;  2Y39 A;  3V5Y A;  2DI3 A;  5CIV A;  1JRA A;  2E87 A;  3A9C A;  5AC5 A;  3PHF 2;  2QE9 A;  1CPR A;  2QTV A;  2YLD A;  3DJU B;  2R7V A;  4FX5 A;  1V74 B;  1TWG A;  2OEX A;  3SZR A;  3KYI A;  2P7V A;  3I5P A;  1OW7 A;  4U5D E;  3EJN A;  1NU7 D;  1ZVZ A;  3C8G A;  1M57 C;  5DQZ A;  1WAS A;  2LD6 A;  4MVS A;  3ABK C;  1I5N A;  3DMD A;  4O6N A;  2A6E F;  3SXM A;  2DGJ A;  1TWH A;  2Q3T A;  3DM5 A;  5B3S C;  5KYY B;  3SEO A;  3UMH A;  5DLJ A;  3EHN A;  3U9J A;  5JT4 A;  2Y3G A;  1UG7 A;  4XEF A;  2XL6 A;  2VH3 A;  3H65 A;  5CI9 A;  2WZF A;  2ICW G;  2KQ9 A;  1V55 C;  3BEH A;  3RQG A;  2JX0 A;  2RD9 A;  4U5B E;  3GEE A;  3LEV A;  1APC A;  1TFK B;  4P9F A;  1MMN A;  5DS6 A;  1NFN A;  5JSL A;  4U5G A;  4YT8 A;  4LER A;  2ZD9 A;  2HKV A;  3GWN A;  5B1A C;  4CS8 C;  1S05 A;  4WGZ A;  5HSW A;  1G4W R;  3HLZ A;  2R05 A;  3Q6N A;  3Q7L A;  4NC3 A;  3AG3 C;  1WOL A;  2DB4 A;  1GGQ A;  2G3K A;  4JTA B;  3FHD A;  2PX0 A;  4PR9 A;  3ZG1 A;  4NTB A;  3ZIB A;  3ZTZ A;  3JRT A;  2EPK X;  1R4T A;  4C3D A;  1LM3 B;  1D0X A;  1LI5 A;  4DRH B;  1T5O A;  4I44 A;  4Z9I A;  1YA7 O;  1HMD A;  3ZQY A;  4PFO A;  3ABL C;  4MVQ A;  2R7O A;  2L7A A;  3NMK A;  5L0G A;  3M4C A;  4U9E A;  1K40 A;  1YAU O;  2P1A A;  1YZC A;  3H2V A;  4WAB A;  1WTY A;  3SXY A;  3RQF A;  1FFT C;  2IXO A;  4P6I C;  3C8G D;  1KNY A;  4JCH A;  3WAQ A;  1V54 C;  2W45 A;  2OJE D;  1L7C A;  1KTM A;  1U0B B;  1NG1 A;  2IOQ A;  5T1D B;  1BR2 A;  1M2V B;  2IYL D;  2YL7 A;  4MW3 A;  4AK9 A;  4ZLD A;  3QTH A;  3OWT A;  4RDA A;  3CZ6 A;  3DZA A;  1H9T A;  5HV9 A;  1OQC A;  2MWQ A;  2I15 A;  2P61 A;  5DS4 A;  3NDB B;  1H6G A;  3VM6 A;  3EH1 A;  4J30 B;  1M2V A;  3E70 C;  5B1B C;  3ZVR A;  4NQF A;  4BJ6 A;  2ZXP A;  3AGU A;  5L3V A;  3GOR A;  2I8B A;  4XPX A;  4BJ6 C;  2OQM A;  4HE8 D;  1T9K A;  2R7S A;  5K0I A;  2Q7R A;  2Q9B A;  3ZTM A;  2PF4 E;  2W9Y A;  3DKA A;  4I1M A;  4DBQ A;  4CS8 A;  4KI2 A;  3FAP B;  3Q6M A;  2X0C A;  1DOV A;  4JIO A;  1OR2 A;  4X0R A;  3B29 A;  3M1C B;  1O3U A;  2HFI A;  3R2P A;  4N06 A;  4E0I A;  5KYX A;  3KMI A;  1NZE A;  2XLW A;  3ATP A;  3FXH A;  4PJN A;  2J9B A;  3T9O A;  1QQ3 A;  3IEE A;  3MYI A;  1GQA A;  3LS1 A;  4ULV A;  2V26 A;  4A2N B;  4G7O F;  1ORS C;  3O10 A;  4YT5 A;  1LPE A;  2OKU A;  3JRM O;  2NPU A;  3TD7 A;  2A0U A;  2Y3H A;  1NLX A;  3AOU A;  1BBH A;  1CPQ A;  3FOP A;  1ZHZ A;  4DVZ A;  5A69 A;  3UNG C;  2HJ3 A;  1C03 A;  2HSB A;  3NYL A;  3EFO A;  2KK1 A;  4QI2 A;  1O5H A;  3UR3 C;  5F5F A;  3A11 A;  3AG1 C;  2NUP B;  1Z63 A;  1HMO A;  1SR2 A;  1ZU5 A;  3AQB A;  3S27 A;  4J32 B;  3T4R A;  3UMI A;  2Q00 A;  4JVS A;  1RCP A;  3RVY A;  1Y4C A;  3JYH A;  3U0C A;  1MMG A;  2NG1 A;  1AUE A;  2WZG A;  5T3W A;  1IW7 F;  4XWJ A;  4EIY A;  1VOM A;  2HV7 A;  2EPM X;  4C7O A;  5BQG A;  4AL1 A;  1ZW2 A;  2LQG A;  4A4A A;  1TFO B;  2LK4 A;  1FNT c;  1Z7Q c;  3L1M A;  2AWC A;  4NTA A;  4MTO A;  2VB6 A;  2J7P D;  2QUP A;  3M15 A;  1A7E A;  1NU9 C;  3ITF A;  3VYW A;  3W8I A;  4BPM A;  3DI5 A;  2Q9A A;  4E0H A;  3IQC A;  3RQE A;  1MNE A;  2R9R B;  4OD4 A;  2D4U A;  1YYJ A;  2VAS A;  4HEA J;  1E86 A;  4H4K C;  2J8W A;  2A68 F;  2TMV P;  4DVY P;  3C8G B;  3W2V A;  1A41 A;  2AWY A;  1MQV A;  2EPL X;  4JZA A;  2V3C C;  2LFF A;  2Y69 C;  3JYY A;  3SXK A;  1OCR C;  2YEV A;  2PNO A;  4CS9 A;  4ANJ A;  2IBF A;  2YHS A;  4EUK B;  1N1C A;  3GWL A;  1LKX A;  1T6U A;  4Q5S F;  1ZHW A;  2R7W A;  2A69 F;  2ETS A;  4AE4 B;  5KYW A;  3K1I A;  4YT4 A;  2EPO A;  3TOM A;  2LP4 A;  2YVK A;  4C7O B;  2GA0 A;  1EI7 A;  5E33 A;  1ZHX A;  1OKK A;  5KYN A;  4F4B A;  1GM5 A;  3X1O A;  3G4Z A;  3NG1 A;  4MS2 A;  2D5R B;  4YJW A;  3TJ6 A;  4MW8 A;  1MMD A;  2H7B A;  2J9V A;  3C7J A;  1S7Z A;  4GEH A;  1OCC C;  2F22 A;  1Q0F A;  3AQC A;  4O6Y A;  3RF3 A;  5JVE A;  4M63 A;  1F1M A;  3C8Z A;  1J8M F;  1HE9 A;  2QLA A;  1HW1 A;  5L0C A;  1WGW A;  1TKN A;  2P0N A;  2L9J A;  3K66 A;  2WVO A;  4YT2 A;  3KPH A;  1HY5 A;  4AL0 A;  3EGD A;  3FVY A;  4KNV A;  3S0X A;  2L6G A;  3N0T A;  5L0I A; 
#chains in the Genus database with same CATH homology
 3EZI A;  5BUO A;  2G62 A;  3QZC A;  4C3B A;  4I3M A;  3B0U X;  4QDL A;  4OIQ F;  3KL4 A;  4PFP A;  1D0Z A;  4LLC A;  2KGO A;  3E9V A;  1J8Y F;  5EHH A;  1QLE C;  2WB7 A;  2J0X A;  5KYY A;  3EHM A;  4OD5 A;  2OCC C;  4BG0 A;  1SZI A;  1FMW A;  1OCZ C;  1VYK A;  2XL4 A;  2CW0 F;  4EBB A;  3DD7 A;  5DVW A;  1PD0 A;  1PCX A;  1QZX A;  5KYX B;  4FWV A;  4XLN F;  4CBE A;  2XXA A;  2ZXO A;  3N2Z B;  3UGP A;  3ASN C;  1Z23 A;  3KKB A;  2NUP A;  4G7Z F;  3F47 A;  1FTS A;  3JT1 A;  4AX2 A;  4CIH A;  4O79 A;  4PJM A;  3JCU Q;  2Z15 A;  1ZU4 A;  5CI8 A;  3UMK A;  1BR1 A;  3OEO A;  3EG9 B;  2GFH A;  4JUR I;  3K7D A;  2EIL C;  3UGO A;  2MYS A;  4U5F E;  4PK4 A;  3EH2 A;  3B9Q A;  3ZSU A;  1LS1 A;  2W4M A;  3K6B A;  3LES A;  2WZL A;  3GOD A;  2J7P A;  3NYJ A;  3AG4 C;  3DJN B;  4OIR F;  2WVN A;  2CNW A;  2QY9 A;  2X51 A;  2A1D D;  2C04 A;  1D1C A;  5FCL A;  2J9W A;  3EPV A;  1LVK A;  4G0H A;  3Q7G A;  3S29 A;  2R7X A;  2IXP A;  3FDQ A;  1ST6 A;  1D1A A;  4U5H A;  4KC9 A;  3EGX B;  3B0V C;  1Z3I X;  2OG2 A;  2EIK C;  5EGY A;  2YZS A;  2PP4 A;  2KW3 C;  2G3V A;  3EFO B;  2PX3 A;  4ULW A;  2NUT B;  2EIJ C;  3K1H A;  4YN0 B;  4AE4 A;  4IJJ A;  5KYW B;  2W4B A;  1JPN A;  2WL8 A;  2ZPA A;  4K7B A;  2L81 A;  4U5E E;  4B6I A;  2P6V A;  4PJJ A;  3POV A;  2WVQ A;  2CNW D;  3EGX A;  2Y3B A;  3X2Q C;  2EIN C;  2IXM A;  3NKD A;  2ZXW C;  4BJ5 A;  4I1O B;  3W8H A;  2JD3 A;  3ABM C;  1G8X A;  2CDQ A;  2HV6 A;  1KU2 A;  4JJF A;  4O7G A;  4BJ5 C;  4EWC A;  2EIM C;  1OKK D;  3FAJ A;  4OIN F;  2J9U A;  2H7V C;  1D1B A;  2DYS C;  4PJL A;  5IY5 C;  3RIP A;  2Q9C A;  4IRU A;  3K1I C;  2Y3D A;  3LAY A;  3RFY A;  1MND A;  4YWQ A;  4C3E A;  1TR2 A;  1ZYR F;  4Q7C A;  3B0P A;  1MMA A;  3NRH A;  2R7Q A;  3W2W A;  2LSE A;  2B0J A;  5DQT A;  3HTK C;  4DBR A;  1O87 A;  4OIP F;  5L3Q A;  5E2Q A;  2FGY A;  2J45 A;  3RKO F;  4QI0 A;  1BR4 A;  3CQZ A;  5F5H A;  1IZM A;  1VYI A;  5E3A A;  4CSA A;  4CS9 C;  3AG2 C;  3L34 A;  5D91 A;  1ZHT A;  3LJB A;  2KJG A;  3EQL F;  4K0D A;  3GAN A;  2BE5 F;  3RYL A;  3ECS A;  2O9X A;  2XXA B;  3PMR A;  1SMY F;  3LNR A;  3S28 A;  2KNH A;  5T3T A;  1VMA A;  4XTK A;  2H7O A;  3QMK A;  4HFF B;  2DYR C;  1TWC A;  4Q4Z F;  3I4U A;  1SF8 A;  4MQ9 F;  3V7O A;  3O6X A;  1VK5 A;  3T6J A;  2ZXR A;  1Z5Z A;  3I5Q A;  3DAG A;  3LS0 A;  2NUT A;  4U5C E;  4E7Z A;  1D0Y A;  4CS7 A;  4O6M A;  1Z6A A;  3F46 A;  4BEJ A;  3WOD F;  5D92 A;  4JJG A;  2IXN A;  3WG7 C;  3ZC4 A;  3CSK A;  4E7S A;  5DS5 A;  2C03 A;  2CGE A;  2M4E A;  1RJ9 B;  4NY3 A;  4LLE A;  3SP1 A;  4BJT A;  4DOZ A;  4GYT A;  4XLP F;  1M56 C;  4HFK B;  1JPJ A;  2A6H F;  2R7U A;  3DAF A;  4IAO A;  1FFH A;  1M2O A;  3N24 A;  2J0W A;  3EGD B;  4G7H F;  4W8K A;  2J46 A;  5KYU B;  3NKE A;  3KH2 A;  4LAC B;  5E3C A;  3ASO C;  3DXJ F;  3EZH A;  4WJ0 A;  4FES A;  4IWB A;  3MX3 A;  2R7R A;  3HJC A;  3L0I A;  4ZLC A;  3OA1 A;  3VAY A;  5KYU A;  3O39 A;  2PFD A;  1RJ9 A;  4RD9 A;  1PD1 A;  3LLI A;  4OIO F;  3RH3 A;  1W2W A;  1FMV A;  3MLG A;  4KNW A;  4KBL A;  4MND A;  4RBN A;  2R7T A;  3K33 A;  4CSA C;  1TWA A;  3T6B A;  2XRH A;  2FFH A;  4BJ1 A;  3EG9 A;  3SNH A;  3JSZ A;  4JW1 A;  1ZHY A;  2XSE A;  3LLK A;  1OCO C;  3NYM A;  3DM9 B;  3SYN A;  2Y39 A;  2E87 A;  2R7V A;  3PHF 2;  2QTV A;  3DJU B;  4FX5 A;  1TWG A;  3SZR A;  2P7V A;  3I5P A;  4U5D E;  5DQZ A;  3EJN A;  1NU7 D;  1M57 C;  4O6N A;  3ABK C;  3DMD A;  2A6E F;  2DGJ A;  1TWH A;  2Q3T A;  3DM5 A;  5B3S C;  5KYY B;  3SEO A;  3UMH A;  5DLJ A;  3EHN A;  2Y3G A;  2VH3 A;  3H65 A;  5CI9 A;  2WZF A;  2KQ9 A;  1V55 C;  4U5B E;  3LEV A;  1MMN A;  5DS6 A;  4U5G A;  4YT8 A;  4LER A;  5B1A C;  4CS8 C;  5HSW A;  3HLZ A;  3Q6N A;  3Q7L A;  3AG3 C;  2G3K A;  3FHD A;  2PX0 A;  3ZG1 A;  3ZIB A;  4C3D A;  3JRT A;  1D0X A;  4I44 A;  4PFO A;  3ABL C;  2R7O A;  1FFT C;  2IXO A;  4P6I C;  4JCH A;  1V54 C;  2W45 A;  1NG1 A;  2IOQ A;  5T1D B;  1BR2 A;  1M2V B;  2IYL D;  4AK9 A;  4ZLD A;  3OWT A;  4RDA A;  3CZ6 A;  3DZA A;  2MWQ A;  3NDB B;  3EH1 A;  4J30 B;  1M2V A;  3E70 C;  5B1B C;  3ZVR A;  4BJ6 A;  5L3V A;  2ZXP A;  2I8B A;  4BJ6 C;  4HE8 D;  2R7S A;  2Q9B A;  2PF4 E;  2W9Y A;  4I1M A;  4DBQ A;  4CS8 A;  4KI2 A;  3Q6M A;  4X0R A;  3M1C B;  4N06 A;  5KYX A;  3KMI A;  1NZE A;  4PJN A;  3IEE A;  4A2N B;  3LS1 A;  4G7O F;  2V26 A;  4YT5 A;  3TD7 A;  2Y3H A;  1ZHZ A;  4DVZ A;  3UNG C;  3NYL A;  3EFO A;  4QI2 A;  1O5H A;  3UR3 C;  5F5F A;  3AG1 C;  2NUP B;  1Z63 A;  1ZU5 A;  3AQB A;  3UMI A;  3S27 A;  3T4R A;  4J32 B;  4JVS A;  3JYH A;  1MMG A;  2NG1 A;  2WZG A;  5T3W A;  1IW7 F;  4XWJ A;  1VOM A;  2HV7 A;  4C7O A;  2VB6 A;  2J7P D;  3VYW A;  1NU9 C;  3ITF A;  3W8I A;  2Q9A A;  1MNE A;  4OD4 A;  2VAS A;  4HEA J;  4H4K C;  2A68 F;  4DVY P;  3W2V A;  4JZA A;  2V3C C;  2Y69 C;  1OCR C;  2YEV A;  4CS9 A;  4ANJ A;  2YHS A;  1N1C A;  1LKX A;  4Q5S F;  1ZHW A;  2R7W A;  2A69 F;  4AE4 B;  5KYW A;  4YT4 A;  4C7O B;  5E33 A;  1ZHX A;  1OKK A;  5KYN A;  4F4B A;  3X1O A;  3NG1 A;  2D5R B;  4YJW A;  1MMD A;  2H7B A;  2J9V A;  1S7Z A;  4GEH A;  1OCC C;  4O6Y A;  3AQC A;  4M63 A;  1J8M F;  1WGW A;  1TKN A;  2L9J A;  3K66 A;  2WVO A;  4YT2 A;  3EGD A;  3FVY A;  4KNV A;  3S0X A;  5DS4 A;  3N0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...