3O39A

Crystal structure of spy
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
b'FKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKAKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFEKRLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic protein related to spheroblast formation
publication title Genetic selection designed to stabilize proteins uncovers a chaperone called Spy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3o39A00
2Y3BA 2Y3DA 3ITFA 3LAYA 3ZG1A 3O39A 2Y3HA 2Y3GA 3QZCA 3OEOA 2Y39A 3EPVA
chains in the Genus database with same CATH superfamily
5JS5A 1QZXA 3M1CB 2XXAA 1TFOB 4RD9A 1QPUA 3M79A 4U5EE 3O6XA 3V5XA 1GQAA 2HFIA 2KC3A 4MW8A 5L0IA 2R7QA 2YKZA 3LNMB 3J06A 1YZAA 1BR2A 1LE4A 1YLMA 3A9CA 2YLIA 1AEPA 4Z9HA 4YL3A 3K1HA 2R7RA 2J46A 3JSEO 5JVEA 1U6HA 1FMWA 1UFBA 2XS8A 3K6BA 4AL1A 3B0VC 4EUKB 2PFDA 3S90A 4ZLCA 2YLDA 5AGFA 4N4WA 2QUPA 3O10A 1WOLA 2J0XA 1BDJB 5CI8A 3B29A 4JZAA 2P0NA 1BBHA 2FGYA 2YRFA 2ZXRA 3CAXA 5KYWA 1YA9A 2R7SA 1BR1A 2RSEB 4O79A 5JT4A 4XEKA 1Z7Qc 1I4ZA 3PCVA 4NTBA 4N6HA 4YL0A 5T3WA 2J9BA 5TJ5E 1J8MF 5KYYA 1ZHWA 2W9YA 3EPVA 3O55A 4NCQA 3EGDA 3DAFA 2Y3DA 3IQ5A 4EBJA 3LESA 1SYQA 2UUHA 2XLOA 2BE5F 3M15A 3MX3A 3U8VA 1WGWA 3JYHA 3UGOA 3VM6A 4GYTA 1OCZC 1F1MA 3C63A 3PDMP 3F46A 3ZG1A 2HV6A 2WVNA 3NMKA 3RYLA 5BUOA 2L7AA 3K66A 4IJJA 2XRHA 3C8ZA 4IWBA 4JCHA 1Z6AA 4C7OA 5A6BD 2OEVA 3NG1A 2A0BA 1D1CA 4JVSA 3JZ0A 4K7BA 2L81A 2W4BA 1OCRC 2IXMA 4NTAA 3KYIA 3SXYA 2CDQA 1LE2A 3L8IA 4IAQA 2J9WA 1D0YA 1SMYF 1V74B 2YZSA 3UR3C 3EH1A 4JEAA 4E7ZA 4DBQA 3ECSA 4QI0A 1T01A 1D1BA 2YEVA 4MVUA 4CSAA 1JPNA 3SYNA 3WODF 1WTYA 2NSGA 4DVYP 1W2WA 5DS6A 3M4CA 3S84A 2M4EA 2LD6A 2ASRA 4PK4A 3X2QC 4C3BA 1QSPA 3QVZA 4G7ZF 3MBGA 4C3EA 3N2ZB 1RKEA 3CQZA 2R7UA 1BR4A 4JTDB 1UG7A 2GA0A 2VASA 2B0HA 2HS5A 2L9JA 3EGXA 4CX9A 1KNYA 3FDQA 3DKAA 3H2UA 3VRCA 1D0ZA 3S29A 5E3AA 2OQMA 3U2MA 3ITFA 3S27A 2OKUA 4GQHA 2AWCA 1E86A 5JRAA 4BG0A 1G4WR 4CS8C 3DM5A 4P6IC 3DI5A 2X0CA 4OIOF 1VLTA 3SEOA 5A6AA 1VLSA 1I4YA 4IAOA 1DOWA 4XPXA 1K05A 3B0UX 4HFFB 1GGQA 4H4KC 3L1MA 3U8PA 1YYJA 2EPMX 2W4MA 1E85A 4KI2A 2Q00A 3RH3A 3LEOA 1LI5A 3ZSUA 4W8PA 5EK0A 5BQHA 2D5RB 2JX0A 1QQ3A 1EA8A 2HKVA 5KYXA 1T9KA 2GWWA 4IARA 4AK9A 1TQGA 2V26A 1RXQA 2TMVP 3GEHA 3FOOA 2C03A 2R02A 2FAPB 4E0IA 5BQIA 3CEXA 5JP7A 4P9FA 3NYMA 4O6MA 1ZW2A 4RBNA 2E87A 2UUIA 2IBFA 1LKXA 2WZLA 3KYJA 4MVMA 3SXMA 3G4ZA 4CDYA 1T5OA 2EINC 3OWTA 2Q4FA 1A41A 1RJ9A 3B71A 1L7CA 3PMRA 4QDLA 2WB7A 1B68A 1Q0GA 1I5NA 4D4NA 1KU2A 1H9GA 4BEJA 4EWCA 3KH2A 1V54C 2PF4E 1FMVA 5CIVA 5EGYA 3IQCA 2CW0F 5L0DA 1T6QA 4OD4A 2NUTA 4KC9A 5F5HA 1NU9C 4EHPA 4YJWA 3RIPA 1FFHA 2KW3C 1O3UA 2R25A 3MYIA 4MTGA 1GS9A 1DOVA 2ZXOA 3QVYA 4IRUA 2EPLX 3FXHA 3KKBA 1PCXA 4JJGA 4G7HF 1VTMP 4PJLA 3RQEA 2Q9BA 2ETSA 4YT2A 2J45A 3W2WA 2QTVA 1JR8A 5E3CA 3WHNA 5D91A 3UNGC 3Q7GA 3V5ZA 2LP4A 4JE9A 1CGME 5L0GA 1HMDA 5DLJA 4CS9C 4L6RA 2D4UA 3HJCA 4OIQF 3JTLO 4CDVA 2IYLD 3RF3A 4FWVA 1JOGA 1NBBA 256BA 3GWLA 1ST6A 3DM9B 3EZHA 2XL4A 3RQGA 1KTMA 4BJ6A 2H7VC 1JAFA 2WZFA 2KSFA 1VYIA 1H7IA 1Z3IX 4JC7A 2IOQA 1MQVA 5B1BC 1FNTc 3JYYA 2LQGA 4AX2A 1MNDA 2A68F 4QI2A 5T1DB 3DWWA 1WASA 1YDIA 1Z5ZA 2VCBA 3ABMC 2AWYA 5L3QA 2MHRA 4RDAA 1M2OA 1NFNA 2R7XA 2CCYA 2FFHA 4CDAA 4XPYA 4K1OA 1Z63A 4A2NB 3RKOF 3HNLA 3UMHA 4OINF 4DXWA 3H2VA 4C3DA 1YZCA 2CNWA 2J7PA 2JD3A 4K0DA 2AU5A 1SF8A 5B1AC 4WGYA 4AE4A 1IZMA 3FHDA 4O6YA 4Z9JA 1M6TA 1NG1A 4XLNF 1Q0DA 2J9VA 3C8GA 3KMIA 3V5YA 1SR2A 2R7TA 3GODA 4JURI 3EG9B 3GEEA 1XZQA 5E33A 1SZIA 3RVYA 3MLGA 3LEVA 3DD7A 2KK1A 2NG1A 1XZPA 4U5BE 3EFOA 3AG1C 2MYSA 3LNRA 2A1DD 5T3TA 3T4RA 3U9MA 3ZVRA 2H8AA 2F22A 2YWAA 1HE9A 3C62A 3EQLF 1LS1A 3K33A 2EIMC 3N24A 3SP1A 2GFHA 2C04A 3ZC4A 1MMNA 4U5CE 3UGPA 1R4TA 2KYHA 2GDCA 2R03A 2XLWA 3AQBA 3I5PA 3NKEA 4DOZA 4FAPB 1VOMA 3GWNA 3ZIBA 2CYDA 1NLXA 2YL0A 5JSLA 2QY9A 2EILC 4FESA 1LI7A 1OXKA 1FFTC 3DAGA 1OCOC 3DE9A 3TJ6A 1FTSA 4BJTA 1J8YF 2LFFA 4J30B 4EIYA 3SXKA 4YWQA 1ZW3A 2ZXPA 2ZPAA 4PACA 3GEIA 4D4XA 1G8XA 4CSAC 4IB4A 2KNHA 2OCCC 2ZXWC 2QLAA 3LUTB 2BC5A 1VK5A 2HJMA 4JCZA 4U5DE 5COMA 1TR2A 3ASOC 3U5SA 3E9VA 1LVKA 2G62A 3I4UA 1S05A 1L3PA 4NY3A 3K1IC 1HY5A 1YAUO 4NQFA 4OIRF 1Y4CA 3FAJA 5A6KA 1FAPB 2VCAA 1TWHA 4MVRA 5A69A 3CZ6A 3N0TA 3U9JA 1AVOB 1A0BA 3L0IA 2H7OA 2R7VA 3IQTA 2HMZA 4DBRA 5AC5A 3RW0A 2R7WA 4IGGA 1M2VB 2V3CC 1TWCA 5IY5C 2WVOA 4XEFA 4XEVA 3DXJF 2Q7RA 1Z23A 4B6IA 3M4BA 1OR2A 4E0HA 1PD1A 2DB4A 1BZ4A 3HLZA 1MMDA 1OCCC 3GM2A 3ZTMA 1QKRA 2IXOA 5AC4A 2A6HF 1APCA 5COFA 4BJ5A 3ZWIA 2G3VA 3GM1A 4JW1A 2J9UA 2XLHA 4N06A 3NDBB 4R32A 4CS8A 2OJED 4LERA 4NTFA 3FVYA 3GANA 3R7CA 2ZD9A 1LIHA 3NKDA 1OKKA 3EH2A 3UMIA 2R05A 2M64A 1HW2A 2NUPB 1G5ZA 1T6IA 2YL1A 3EZIA 4Z9IA 2XXAB 3T6BA 1TWAA 1VMAA 2J8WA 2KQ9A 1NFOA 4PFOA 1E2XA 3W2VA 2YL7A 3C7JA 1CGOA 1YVIA 2VC9A 4XWJA 2XS1A 1JPJA 3LS1A 3O39A 4XTKA 2JPUA 2BL2A 2LK4A 5DVWA 4BJ1A 4G7OF 2HZ8A 2NSFA 1OQCA 2Y39A 3U3BA 4GEHA 3W8HA 4U5HA 2DYSC 3R2PA 4H54A 2O9XA 2EPOA 1CPRA 3AG3C 1NSGB 3QTHA 3SZRA 2LFDA 4CIPA 2PX0A 3L34A 3SXZA 1VB5A 3JCUQ 1ORJA 5DS5A 2PP4A 3TJ5A 4JRZA 2Y69C 2ICWG 3OA1A 1AUEA 4ULWA 4ANJA 4YT5A 2HV7A 4MTOA 5KYWB 5KYUA 3LAYA 2KGOA 4KNWA 4XQ1A 3ZQVA 2XM0A 4OIPF 1OXBA 1ZU5A 1R5ID 2QNLA 3ATPA 5F28E 5DQZA 4I1OB 4MVOA 2Z15A 2W45A 2A69F 2VH3A 5KYYB 2HJ3A 1RKCA 3EGDB 4LLEA 5L0HA 3B9QA 4E17A 1EI7A 4PJNA 4YN0B 3ZTZA 5L0CA 3JT1A 2XLDA 1XWJA 4WABA 2HSQA 5L0FA 1IW7F 1K04A 1HW1A 1NZEA 3AG2C 1ZU4A 3IQ6A 4PFPA 3VAYA 4UDVA 1ORYA 2XL8A 2EIJC 2CGEA 3QZCA 1QLEC 3H65A 4P9TA 4I44A 2Q3TA 2VCCA 4C7OB 1M56C 2P6VA 1EKYA 1NU7D 5F5FA 5B3IA 4MNDA 1E83A 5A6BA 2HMQA 3L8JA 1ZHTA 2A0UA 4J7YA 2P61A 1ZHXA 1Q0MA 2VB6A 4G78A 3ZQYA 3NYLA 2YL3A 2LIGA 1T6UA 1YARO 2OG2A 4M63A 2OOCA 4I1MA 1S7ZA 1YJGA 3I5QA 4JEBA 2J0WA 3EHMA 4AL0A 2L6HA 2PBEA 5L3VA 1YA7O 4HE8D 1K40A 4KNVA 3TD7A 2GAQA 3DMDA 3NMJA 1MMGA 1TKNA 4HEAJ 4DRIB 3LLKA 1RKEB 1TWGA 2P7VA 1PV3A 4Q4ZF 1V55C 4DVZA 2IXPA 3FAPB 4J7TA 4JTCB 2EPNA 4PR9A 3AGTA 3WG7C 4EKWA 2DI3A 3EGXB 3U3FA 3OEOA 2EIKC 3C18A 3S9OA 1JRAA 4WGZA 2Y3BA 3TK0A 3KL4A 4LDKA 3DJNB 1ZYRF 1H6GA 2H7BA 3IPMO 4PJMA 5A6JA 3B0PA 4LDQA 4A4AA 3SNHA 3WAQA 4U9DA 3FMSA 5BQGA 3RQFA 3TOLA 1Q0FA 2KJGA 2P1AA 2PNOA 2XL6A 2OJQA 3EJNA 2I8BA 4F4BA 5JUAA 1E84A 1C02A 1TFKB 2RD9A 4MVZA 3RVZA 1CPQA 1RMVA 3HNKA 1D1AA 4MW3A 3QW0A 3K7DA 1CGNA 4O7GA 4U5GA 4U9EA 3U2LA 5CI9A 1M57C 3A11A 5KYXB 3MYFA 3HNIA 5DQTA 2XM4A 3AGUA 3IEEA 4NC3A 5GPGB 3UMKA 3VF0A 2IM8A 4CS7A 4DRHB 1MNEA 4MQ9F 2L6FA 3ZDLA 4J32B 5HV9A 1U0BB 5JLIA 3GORA 2CNWD 2J7PD 2DGJA 5KYUB 1ZZPA 1O87A 3W8IA 4MTFA 4ONSA 3V7OA 5L0JA 1Y6DA 4YT4A 3MFNA 2EPKX 4JTAB 3C8GD 2Y3GA 2AVKA 4WJ0A 4KBLA 4CJOA 1RJ9B 3U0CA 4LACB 2HUJA 4JIOA 4O6NA 5E2QA 5HSWA 2XSEA 3AOUA 1U89A 5COGA 3Q6NA 4JJFA 3NYJA 3EG9A 1LPEA 3POVA 4BEMJ 3Q7LA 3K1IA 2YLGA 2NUTB 2PX3A 3US6A 4DRJB 3JRMO 1FR0A 3ABKC 3ASNC 3FOPA 2YHSA 4YL1A 3T6JA 3W4YA 3HKKA 3TQOA 4CBEA 2WL8A 1O5HA 1JMWA 3QW1A 1ZHZA 1PD0A 1ZVZA 2I15A 5K0IA 3JSZA 1A7DA 4BJ5C 4JKVA 4MVSA 3PHF2 2MWQA 4HFKB 2R9RB 3T6GB 3CSKA 4LLCA 1WN0A 4BPMA 3GM3A 2Y3HA 4EBBA 5B3SC 1H9TA 4G0HA 1V4AA 1ORSC 2DYRC 2Q9CA 3RFYA 2XLMA 4W8KA 3Q6MA 3NRHA 1GM5A 2LSEA 2YVKA 5FZTA 1A7EA 4XPWA 4ULVA 1G4US 3IHUA 4YT8A 1HMOA 4DJ9A 4XLPF 3DZAA 3G50A 3LS0A 3LJBA 3QMKA 4N6CA 3KPHA 3AJMA 4Q5SF 4I3MA 1Q0KA 3E70C 2X51A 3JRTA 5KYNA 2XLEA 2LCHA 3T9OA 4LDRA 4MVQA 3TULA 1EQ1A 4OD5A 2L6GA 3S28A 4E7SA 1QVXA 2YQYA 2R7OA 4X0RA 1C17M 1OW6A 3VYWA 3TOMA 2NPUA 4Q7CA 4MS2A 1WATA 3G4XA 2A6EF 1HE1A 1LS4A 4YK5A 4CJGA 1LM3B 3AG4C 3DJUB 5FCLA 1OW8A 2NUPA 1M2VA 3EHNA 3X1OA 4FX5A 4PJJA 4AE4B 1MMAA 4U5FE 3HTKC 2B0JA 1OR3A 1RCPA 3C8GB 4CIHA 1N1CA 1OW7A 3F47A 3BEHA 1VYKA 4EBKA 1D0XA 3BRJA 4E18A 3NMIA 2WZGA 4ZLDA 2OEXA 5EHHA 1YYXA 3S0XA 2G3KA 2IXNA 2XLVA 3HNJA 1OKKD 2QE9A 3EFOB 4BJ6C 2OU6A 4CS9A 1A7VA 5D92A 1WWPA 5DS4A 3AQCA 1C03A 4ER9A 2AP3A 3ABLC 3DE8A 2HSBA 1ZHYA 2Q9AA 3LLIA 2WVQA
chains in the Genus database with same CATH topology
1QZXA 3M1CB 2XXAA 4RD9A 4U5EE 3O6XA 2R7QA 1BR2A 2R7RA 3K1HA 2J46A 1FMWA 3K6BA 3B0VC 2PFDA 4ZLCA 2J0XA 5CI8A 4JZAA 2FGYA 2ZXRA 5KYWA 2R7SA 1BR1A 4O79A 5T3WA 1J8MF 5KYYA 1ZHWA 2W9YA 3EPVA 3EGDA 3DAFA 2Y3DA 3LESA 3MX3A 2BE5F 1WGWA 3JYHA 3UGOA 4GYTA 1OCZC 3F46A 3ZG1A 2HV6A 2WVNA 3RYLA 5BUOA 4IJJA 3K66A 2XRHA 4IWBA 4JCHA 4C7OA 1Z6AA 3NG1A 1D1CA 4JVSA 4K7BA 2L81A 2W4BA 1OCRC 2IXMA 2CDQA 2J9WA 1D0YA 1SMYF 2YZSA 3UR3C 3EH1A 4E7ZA 4DBQA 3ECSA 4QI0A 2YEVA 1D1BA 4CSAA 1JPNA 3SYNA 3WODF 4DVYP 1W2WA 5DS6A 2M4EA 4PK4A 3X2QC 4C3BA 4G7ZF 4C3EA 3N2ZB 3CQZA 2R7UA 1BR4A 2VASA 3EGXA 2L9JA 3FDQA 1D0ZA 3S29A 5E3AA 3ITFA 3S27A 4BG0A 4CS8C 4OIOF 3DM5A 4P6IC 3SEOA 4IAOA 3B0UX 4HFFB 4H4KC 2W4MA 4KI2A 3RH3A 3ZSUA 2D5RB 5KYXA 4AK9A 2V26A 2C03A 3NYMA 4O6MA 4RBNA 5KYUA 2E87A 2WZLA 1LKXA 2EINC 3OWTA 1RJ9A 3PMRA 4QDLA 2WB7A 1KU2A 4BEJA 4EWCA 3KH2A 1V54C 2PF4E 1FMVA 5EGYA 2CW0F 4OD4A 2NUTA 4KC9A 5F5HA 1NU9C 4YJWA 3RIPA 1FFHA 2KW3C 2ZXOA 4JJGA 4IRUA 3KKBA 1PCXA 4G7HF 4PJLA 4YT2A 2Q9BA 2J45A 3W2WA 2QTVA 5E3CA 5D91A 3UNGC 3Q7GA 5DLJA 4CS9C 4OIQF 3HJCA 2IYLD 4FWVA 1ST6A 3DM9B 3EZHA 2XL4A 4BJ6A 2H7VC 2WZFA 1VYIA 1Z3IX 2IOQA 5B1BC 4AX2A 4QI2A 1MNDA 2A68F 5T1DB 3ABMC 1Z5ZA 5L3QA 4RDAA 1M2OA 2R7XA 2FFHA 1Z63A 4A2NB 3RKOF 3UMHA 4OINF 4C3DA 2CNWA 2J7PA 2JD3A 4K0DA 1SF8A 5B1AC 4AE4A 1IZMA 3FHDA 4O6YA 4XLNF 1NG1A 2J9VA 3KMIA 2R7TA 3GODA 4JURI 3EG9B 5E33A 1SZIA 3MLGA 3LEVA 3DD7A 2NG1A 4U5BE 3EFOA 3AG1C 2MYSA 3LNRA 2A1DD 5T3TA 3T4RA 3ZVRA 3EQLF 3K33A 1LS1A 2EIMC 3N24A 3SP1A 2GFHA 2C04A 3ZC4A 1MMNA 4U5CE 3UGPA 3AQBA 3I5PA 3NKEA 4DOZA 1VOMA 3ZIBA 2QY9A 2EILC 4FESA 3DAGA 1FFTC 1OCOC 4BJTA 1FTSA 1J8YF 4YWQA 4J30B 2ZXPA 2ZPAA 4CSAC 1G8XA 2KNHA 2OCCC 2ZXWC 1VK5A 4U5DE 1TR2A 3ASOC 3E9VA 1LVKA 2G62A 3I4UA 4NY3A 3K1IC 4OIRF 3FAJA 1TWHA 3CZ6A 3N0TA 3L0IA 2H7OA 2R7VA 4DBRA 2R7WA 2V3CC 1M2VB 1TWCA 5IY5C 2WVOA 3DXJF 1Z23A 4B6IA 1PD1A 3HLZA 1MMDA 1OCCC 2IXOA 2A6HF 4BJ5A 2G3VA 4JW1A 2J9UA 4N06A 3NDBB 4CS8A 4LERA 3FVYA 3GANA 3NKDA 1OKKA 3EH2A 3UMIA 2NUPB 3EZIA 2XXAB 3T6BA 1TWAA 1VMAA 2KQ9A 4PFOA 3W2VA 4XWJA 5DVWA 1JPJA 3LS1A 3O39A 4XTKA 4BJ1A 4G7OF 2Y39A 4GEHA 3W8HA 4U5HA 2DYSC 2O9XA 3AG3C 3SZRA 2PX0A 3L34A 3JCUQ 5DS5A 2PP4A 2Y69C 3OA1A 4ULWA 4ANJA 4YT5A 2HV7A 5KYWB 3LAYA 2KGOA 4KNWA 4OIPF 1ZU5A 5DQZA 4I1OB 2Z15A 2W45A 2A69F 2VH3A 5KYYB 4LLEA 3EGDB 3B9QA 4YN0B 4PJNA 3JT1A 1IW7F 1NZEA 3AG2C 4PFPA 3VAYA 1ZU4A 2EIJC 2CGEA 3QZCA 1QLEC 3H65A 4I44A 2Q3TA 4C7OB 1M56C 2P6VA 1NU7D 5F5FA 4MNDA 1ZHTA 1ZHXA 2VB6A 3NYLA 2OG2A 4M63A 4I1MA 1S7ZA 3I5QA 2J0WA 3EHMA 5L3VA 4HE8D 4KNVA 3TD7A 3DMDA 1MMGA 1TKNA 4HEAJ 4Q4ZF 3LLKA 1TWGA 2P7VA 1V55C 4DVZA 2IXPA 3WG7C 3EGXB 3OEOA 2EIKC 2Y3BA 3KL4A 3DJNB 1ZYRF 4PJMA 2H7BA 3B0PA 3SNHA 2KJGA 3EJNA 4F4BA 2I8BA 1D1AA 3K7DA 4O7GA 4U5GA 5CI9A 1M57C 5KYXB 5DQTA 3IEEA 3UMKA 4CS7A 1MNEA 4MQ9F 4J32B 2CNWD 2J7PD 2DGJA 5KYUB 3W8IA 1O87A 3V7OA 4YT4A 4WJ0A 2Y3GA 4KBLA 1RJ9B 4LACB 5E2QA 4O6NA 5HSWA 2XSEA 3Q6NA 4JJFA 3NYJA 3EG9A 3POVA 3Q7LA 2NUTB 2PX3A 3ABKC 3ASNC 2YHSA 3T6JA 4CBEA 2WL8A 1O5HA 1ZHZA 1PD0A 3JSZA 4BJ5C 3PHF2 2MWQA 4HFKB 3CSKA 4LLCA 2Y3HA 4EBBA 5B3SC 4G0HA 2DYRC 2Q9CA 3RFYA 4W8KA 3Q6MA 3NRHA 2LSEA 4YT8A 4XLPF 3DZAA 3LS0A 3LJBA 3QMKA 4Q5SF 4I3MA 3E70C 2X51A 3JRTA 5KYNA 4OD5A 3S28A 4E7SA 2R7OA 4X0RA 3VYWA 4Q7CA 2A6EF 3AG4C 3DJUB 5FCLA 3EHNA 3X1OA 1M2VA 4FX5A 4PJJA 4AE4B 1MMAA 4U5FE 3HTKC 2B0JA 4CIHA 1N1CA 3F47A 1VYKA 1D0XA 2WZGA 4ZLDA 5EHHA 3S0XA 2G3KA 2IXNA 1OKKD 3EFOB 4BJ6C 4CS9A 5D92A 5DS4A 3AQCA 3ABLC 2NUPA 1ZHYA 2Q9AA 3LLIA 2WVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y3B A;  2Y3D A;  3ITF A;  3LAY A;  3ZG1 A;  3O39 A;  2Y3H A;  2Y3G A;  3QZC A;  3OEO A;  2Y39 A;  3EPV A; 
#chains in the Genus database with same CATH topology
 5JS5 A;  1QZX A;  3M1C B;  2XXA A;  1TFO B;  4RD9 A;  1QPU A;  3M79 A;  4U5E E;  3O6X A;  3V5X A;  1GQA A;  2HFI A;  2KC3 A;  4MW8 A;  5L0I A;  2R7Q A;  2YKZ A;  3LNM B;  3J06 A;  1YZA A;  1BR2 A;  1LE4 A;  1YLM A;  3A9C A;  2YLI A;  1AEP A;  4Z9H A;  4YL3 A;  3K1H A;  2R7R A;  2J46 A;  3JSE O;  5JVE A;  1U6H A;  1FMW A;  1UFB A;  2XS8 A;  3K6B A;  4AL1 A;  3B0V C;  4EUK B;  2PFD A;  3S90 A;  4ZLC A;  2YLD A;  5AGF A;  4N4W A;  2QUP A;  3O10 A;  1WOL A;  2J0X A;  1BDJ B;  5CI8 A;  3B29 A;  4JZA A;  2P0N A;  1BBH A;  2FGY A;  2YRF A;  2ZXR A;  3CAX A;  5KYW A;  1YA9 A;  2R7S A;  1BR1 A;  2RSE B;  4O79 A;  5JT4 A;  4XEK A;  1Z7Q c;  1I4Z A;  3PCV A;  4NTB A;  4N6H A;  4YL0 A;  5T3W A;  2J9B A;  5TJ5 E;  1J8M F;  5KYY A;  1ZHW A;  2W9Y A;  3EPV A;  3O55 A;  4NCQ A;  3EGD A;  3DAF A;  2Y3D A;  3IQ5 A;  4EBJ A;  3LES A;  1SYQ A;  2UUH A;  2XLO A;  2BE5 F;  3M15 A;  3MX3 A;  3U8V A;  1WGW A;  3JYH A;  3UGO A;  3VM6 A;  4GYT A;  1OCZ C;  1F1M A;  3C63 A;  3PDM P;  3F46 A;  3ZG1 A;  2HV6 A;  2WVN A;  3NMK A;  3RYL A;  5BUO A;  2L7A A;  3K66 A;  4IJJ A;  2XRH A;  3C8Z A;  4IWB A;  4JCH A;  1Z6A A;  4C7O A;  5A6B D;  2OEV A;  3NG1 A;  2A0B A;  1D1C A;  4JVS A;  3JZ0 A;  4K7B A;  2L81 A;  2W4B A;  1OCR C;  2IXM A;  4NTA A;  3KYI A;  3SXY A;  2CDQ A;  1LE2 A;  3L8I A;  4IAQ A;  2J9W A;  1D0Y A;  1SMY F;  1V74 B;  2YZS A;  3UR3 C;  3EH1 A;  4JEA A;  4E7Z A;  4DBQ A;  3ECS A;  4QI0 A;  1T01 A;  1D1B A;  2YEV A;  4MVU A;  4CSA A;  1JPN A;  3SYN A;  3WOD F;  1WTY A;  2NSG A;  4DVY P;  1W2W A;  5DS6 A;  3M4C A;  3S84 A;  2M4E A;  2LD6 A;  2ASR A;  4PK4 A;  3X2Q C;  4C3B A;  1QSP A;  3QVZ A;  4G7Z F;  3MBG A;  4C3E A;  3N2Z B;  1RKE A;  3CQZ A;  2R7U A;  1BR4 A;  4JTD B;  1UG7 A;  2GA0 A;  2VAS A;  2B0H A;  2HS5 A;  2L9J A;  3EGX A;  4CX9 A;  1KNY A;  3FDQ A;  3DKA A;  3H2U A;  3VRC A;  1D0Z A;  3S29 A;  5E3A A;  2OQM A;  3U2M A;  3ITF A;  3S27 A;  2OKU A;  4GQH A;  2AWC A;  1E86 A;  5JRA A;  4BG0 A;  1G4W R;  4CS8 C;  3DM5 A;  4P6I C;  3DI5 A;  2X0C A;  4OIO F;  1VLT A;  3SEO A;  5A6A A;  1VLS A;  1I4Y A;  4IAO A;  1DOW A;  4XPX A;  1K05 A;  3B0U X;  4HFF B;  1GGQ A;  4H4K C;  3L1M A;  3U8P A;  1YYJ A;  2EPM X;  2W4M A;  1E85 A;  4KI2 A;  2Q00 A;  3RH3 A;  3LEO A;  1LI5 A;  3ZSU A;  4W8P A;  5EK0 A;  5BQH A;  2D5R B;  2JX0 A;  1QQ3 A;  1EA8 A;  2HKV A;  5KYX A;  1T9K A;  2GWW A;  4IAR A;  4AK9 A;  1TQG A;  2V26 A;  1RXQ A;  2TMV P;  3GEH A;  3FOO A;  2C03 A;  2R02 A;  2FAP B;  4E0I A;  5BQI A;  3CEX A;  5JP7 A;  4P9F A;  3NYM A;  4O6M A;  1ZW2 A;  4RBN A;  2E87 A;  2UUI A;  2IBF A;  1LKX A;  2WZL A;  3KYJ A;  4MVM A;  3SXM A;  3G4Z A;  4CDY A;  1T5O A;  2EIN C;  3OWT A;  2Q4F A;  1A41 A;  1RJ9 A;  3B71 A;  1L7C A;  3PMR A;  4QDL A;  2WB7 A;  1B68 A;  1Q0G A;  1I5N A;  4D4N A;  1KU2 A;  1H9G A;  4BEJ A;  4EWC A;  3KH2 A;  1V54 C;  2PF4 E;  1FMV A;  5CIV A;  5EGY A;  3IQC A;  2CW0 F;  5L0D A;  1T6Q A;  4OD4 A;  2NUT A;  4KC9 A;  5F5H A;  1NU9 C;  4EHP A;  4YJW A;  3RIP A;  1FFH A;  2KW3 C;  1O3U A;  2R25 A;  3MYI A;  4MTG A;  1GS9 A;  1DOV A;  2ZXO A;  3QVY A;  4IRU A;  2EPL X;  3FXH A;  3KKB A;  1PCX A;  4JJG A;  4G7H F;  1VTM P;  4PJL A;  3RQE A;  2Q9B A;  2ETS A;  4YT2 A;  2J45 A;  3W2W A;  2QTV A;  1JR8 A;  5E3C A;  3WHN A;  5D91 A;  3UNG C;  3Q7G A;  3V5Z A;  2LP4 A;  4JE9 A;  1CGM E;  5L0G A;  1HMD A;  5DLJ A;  4CS9 C;  4L6R A;  2D4U A;  3HJC A;  4OIQ F;  3JTL O;  4CDV A;  2IYL D;  3RF3 A;  4FWV A;  1JOG A;  1NBB A;  256B A;  3GWL A;  1ST6 A;  3DM9 B;  3EZH A;  2XL4 A;  3RQG A;  1KTM A;  4BJ6 A;  2H7V C;  1JAF A;  2WZF A;  2KSF A;  1VYI A;  1H7I A;  1Z3I X;  4JC7 A;  2IOQ A;  1MQV A;  5B1B C;  1FNT c;  3JYY A;  2LQG A;  4AX2 A;  1MND A;  2A68 F;  4QI2 A;  5T1D B;  3DWW A;  1WAS A;  1YDI A;  1Z5Z A;  2VCB A;  3ABM C;  2AWY A;  5L3Q A;  2MHR A;  4RDA A;  1M2O A;  1NFN A;  2R7X A;  2CCY A;  2FFH A;  4CDA A;  4XPY A;  4K1O A;  1Z63 A;  4A2N B;  3RKO F;  3HNL A;  3UMH A;  4OIN F;  4DXW A;  3H2V A;  4C3D A;  1YZC A;  2CNW A;  2J7P A;  2JD3 A;  4K0D A;  2AU5 A;  1SF8 A;  5B1A C;  4WGY A;  4AE4 A;  1IZM A;  3FHD A;  4O6Y A;  4Z9J A;  1M6T A;  1NG1 A;  4XLN F;  1Q0D A;  2J9V A;  3C8G A;  3KMI A;  3V5Y A;  1SR2 A;  2R7T A;  3GOD A;  4JUR I;  3EG9 B;  3GEE A;  1XZQ A;  5E33 A;  1SZI A;  3RVY A;  3MLG A;  3LEV A;  3DD7 A;  2KK1 A;  2NG1 A;  1XZP A;  4U5B E;  3EFO A;  3AG1 C;  2MYS A;  3LNR A;  2A1D D;  5T3T A;  3T4R A;  3U9M A;  3ZVR A;  2H8A A;  2F22 A;  2YWA A;  1HE9 A;  3C62 A;  3EQL F;  1LS1 A;  3K33 A;  2EIM C;  3N24 A;  3SP1 A;  2GFH A;  2C04 A;  3ZC4 A;  1MMN A;  4U5C E;  3UGP A;  1R4T A;  2KYH A;  2GDC A;  2R03 A;  2XLW A;  3AQB A;  3I5P A;  3NKE A;  4DOZ A;  4FAP B;  1VOM A;  3GWN A;  3ZIB A;  2CYD A;  1NLX A;  2YL0 A;  5JSL A;  2QY9 A;  2EIL C;  4FES A;  1LI7 A;  1OXK A;  1FFT C;  3DAG A;  1OCO C;  3DE9 A;  3TJ6 A;  1FTS A;  4BJT A;  1J8Y F;  2LFF A;  4J30 B;  4EIY A;  3SXK A;  4YWQ A;  1ZW3 A;  2ZXP A;  2ZPA A;  4PAC A;  3GEI A;  4D4X A;  1G8X A;  4CSA C;  4IB4 A;  2KNH A;  2OCC C;  2ZXW C;  2QLA A;  3LUT B;  2BC5 A;  1VK5 A;  2HJM A;  4JCZ A;  4U5D E;  5COM A;  1TR2 A;  3ASO C;  3U5S A;  3E9V A;  1LVK A;  2G62 A;  3I4U A;  1S05 A;  1L3P A;  4NY3 A;  3K1I C;  1HY5 A;  1YAU O;  4NQF A;  4OIR F;  1Y4C A;  3FAJ A;  5A6K A;  1FAP B;  2VCA A;  1TWH A;  4MVR A;  5A69 A;  3CZ6 A;  3N0T A;  3U9J A;  1AVO B;  1A0B A;  3L0I A;  2H7O A;  2R7V A;  3IQT A;  2HMZ A;  4DBR A;  5AC5 A;  3RW0 A;  2R7W A;  4IGG A;  1M2V B;  2V3C C;  1TWC A;  5IY5 C;  2WVO A;  4XEF A;  4XEV A;  3DXJ F;  2Q7R A;  1Z23 A;  4B6I A;  3M4B A;  1OR2 A;  4E0H A;  1PD1 A;  2DB4 A;  1BZ4 A;  3HLZ A;  1MMD A;  1OCC C;  3GM2 A;  3ZTM A;  1QKR A;  2IXO A;  5AC4 A;  2A6H F;  1APC A;  5COF A;  4BJ5 A;  3ZWI A;  2G3V A;  3GM1 A;  4JW1 A;  2J9U A;  2XLH A;  4N06 A;  3NDB B;  4R32 A;  4CS8 A;  2OJE D;  4LER A;  4NTF A;  3FVY A;  3GAN A;  3R7C A;  2ZD9 A;  1LIH A;  3NKD A;  1OKK A;  3EH2 A;  3UMI A;  2R05 A;  2M64 A;  1HW2 A;  2NUP B;  1G5Z A;  1T6I A;  2YL1 A;  3EZI A;  4Z9I A;  2XXA B;  3T6B A;  1TWA A;  1VMA A;  2J8W A;  2KQ9 A;  1NFO A;  4PFO A;  1E2X A;  3W2V A;  2YL7 A;  3C7J A;  1CGO A;  1YVI A;  2VC9 A;  4XWJ A;  2XS1 A;  1JPJ A;  3LS1 A;  3O39 A;  4XTK A;  2JPU A;  2BL2 A;  2LK4 A;  5DVW A;  4BJ1 A;  4G7O F;  2HZ8 A;  2NSF A;  1OQC A;  2Y39 A;  3U3B A;  4GEH A;  3W8H A;  4U5H A;  2DYS C;  3R2P A;  4H54 A;  2O9X A;  2EPO A;  1CPR A;  3AG3 C;  1NSG B;  3QTH A;  3SZR A;  2LFD A;  4CIP A;  2PX0 A;  3L34 A;  3SXZ A;  1VB5 A;  3JCU Q;  1ORJ A;  5DS5 A;  2PP4 A;  3TJ5 A;  4JRZ A;  2Y69 C;  2ICW G;  3OA1 A;  1AUE A;  4ULW A;  4ANJ A;  4YT5 A;  2HV7 A;  4MTO A;  5KYW B;  5KYU A;  3LAY A;  2KGO A;  4KNW A;  4XQ1 A;  3ZQV A;  2XM0 A;  4OIP F;  1OXB A;  1ZU5 A;  1R5I D;  2QNL A;  3ATP A;  5F28 E;  5DQZ A;  4I1O B;  4MVO A;  2Z15 A;  2W45 A;  2A69 F;  2VH3 A;  5KYY B;  2HJ3 A;  1RKC A;  3EGD B;  4LLE A;  5L0H A;  3B9Q A;  4E17 A;  1EI7 A;  4PJN A;  4YN0 B;  3ZTZ A;  5L0C A;  3JT1 A;  2XLD A;  1XWJ A;  4WAB A;  2HSQ A;  5L0F A;  1IW7 F;  1K04 A;  1HW1 A;  1NZE A;  3AG2 C;  1ZU4 A;  3IQ6 A;  4PFP A;  3VAY A;  4UDV A;  1ORY A;  2XL8 A;  2EIJ C;  2CGE A;  3QZC A;  1QLE C;  3H65 A;  4P9T A;  4I44 A;  2Q3T A;  2VCC A;  4C7O B;  1M56 C;  2P6V A;  1EKY A;  1NU7 D;  5F5F A;  5B3I A;  4MND A;  1E83 A;  5A6B A;  2HMQ A;  3L8J A;  1ZHT A;  2A0U A;  4J7Y A;  2P61 A;  1ZHX A;  1Q0M A;  2VB6 A;  4G78 A;  3ZQY A;  3NYL A;  2YL3 A;  2LIG A;  1T6U A;  1YAR O;  2OG2 A;  4M63 A;  2OOC A;  4I1M A;  1S7Z A;  1YJG A;  3I5Q A;  4JEB A;  2J0W A;  3EHM A;  4AL0 A;  2L6H A;  2PBE A;  5L3V A;  1YA7 O;  4HE8 D;  1K40 A;  4KNV A;  3TD7 A;  2GAQ A;  3DMD A;  3NMJ A;  1MMG A;  1TKN A;  4HEA J;  4DRI B;  3LLK A;  1RKE B;  1TWG A;  2P7V A;  1PV3 A;  4Q4Z F;  1V55 C;  4DVZ A;  2IXP A;  3FAP B;  4J7T A;  4JTC B;  2EPN A;  4PR9 A;  3AGT A;  3WG7 C;  4EKW A;  2DI3 A;  3EGX B;  3U3F A;  3OEO A;  2EIK C;  3C18 A;  3S9O A;  1JRA A;  4WGZ A;  2Y3B A;  3TK0 A;  3KL4 A;  4LDK A;  3DJN B;  1ZYR F;  1H6G A;  2H7B A;  3IPM O;  4PJM A;  5A6J A;  3B0P A;  4LDQ A;  4A4A A;  3SNH A;  3WAQ A;  4U9D A;  3FMS A;  5BQG A;  3RQF A;  3TOL A;  1Q0F A;  2KJG A;  2P1A A;  2PNO A;  2XL6 A;  2OJQ A;  3EJN A;  2I8B A;  4F4B A;  5JUA A;  1E84 A;  1C02 A;  1TFK B;  2RD9 A;  4MVZ A;  3RVZ A;  1CPQ A;  1RMV A;  3HNK A;  1D1A A;  4MW3 A;  3QW0 A;  3K7D A;  1CGN A;  4O7G A;  4U5G A;  4U9E A;  3U2L A;  5CI9 A;  1M57 C;  3A11 A;  5KYX B;  3MYF A;  3HNI A;  5DQT A;  2XM4 A;  3AGU A;  3IEE A;  4NC3 A;  5GPG B;  3UMK A;  3VF0 A;  2IM8 A;  4CS7 A;  4DRH B;  1MNE A;  4MQ9 F;  2L6F A;  3ZDL A;  4J32 B;  5HV9 A;  1U0B B;  5JLI A;  3GOR A;  2CNW D;  2J7P D;  2DGJ A;  5KYU B;  1ZZP A;  1O87 A;  3W8I A;  4MTF A;  4ONS A;  3V7O A;  5L0J A;  1Y6D A;  4YT4 A;  3MFN A;  2EPK X;  4JTA B;  3C8G D;  2Y3G A;  2AVK A;  4WJ0 A;  4KBL A;  4CJO A;  1RJ9 B;  3U0C A;  4LAC B;  2HUJ A;  4JIO A;  4O6N A;  5E2Q A;  5HSW A;  2XSE A;  3AOU A;  1U89 A;  5COG A;  3Q6N A;  4JJF A;  3NYJ A;  3EG9 A;  1LPE A;  3POV A;  4BEM J;  3Q7L A;  3K1I A;  2YLG A;  2NUT B;  2PX3 A;  3US6 A;  4DRJ B;  3JRM O;  1FR0 A;  3ABK C;  3ASN C;  3FOP A;  2YHS A;  4YL1 A;  3T6J A;  3W4Y A;  3HKK A;  3TQO A;  4CBE A;  2WL8 A;  1O5H A;  1JMW A;  3QW1 A;  1ZHZ A;  1PD0 A;  1ZVZ A;  2I15 A;  5K0I A;  3JSZ A;  1A7D A;  4BJ5 C;  4JKV A;  4MVS A;  3PHF 2;  2MWQ A;  4HFK B;  2R9R B;  3T6G B;  3CSK A;  4LLC A;  1WN0 A;  4BPM A;  3GM3 A;  2Y3H A;  4EBB A;  5B3S C;  1H9T A;  4G0H A;  1V4A A;  1ORS C;  2DYR C;  2Q9C A;  3RFY A;  2XLM A;  4W8K A;  3Q6M A;  3NRH A;  1GM5 A;  2LSE A;  2YVK A;  5FZT A;  1A7E A;  4XPW A;  4ULV A;  1G4U S;  3IHU A;  4YT8 A;  1HMO A;  4DJ9 A;  4XLP F;  3DZA A;  3G50 A;  3LS0 A;  3LJB A;  3QMK A;  4N6C A;  3KPH A;  3AJM A;  4Q5S F;  4I3M A;  1Q0K A;  3E70 C;  2X51 A;  3JRT A;  5KYN A;  2XLE A;  2LCH A;  3T9O A;  4LDR A;  4MVQ A;  3TUL A;  1EQ1 A;  4OD5 A;  2L6G A;  3S28 A;  4E7S A;  1QVX A;  2YQY A;  2R7O A;  4X0R A;  1C17 M;  1OW6 A;  3VYW A;  3TOM A;  2NPU A;  4Q7C A;  4MS2 A;  1WAT A;  3G4X A;  2A6E F;  1HE1 A;  1LS4 A;  4YK5 A;  4CJG A;  1LM3 B;  3AG4 C;  3DJU B;  5FCL A;  1OW8 A;  2NUP A;  1M2V A;  3EHN A;  3X1O A;  4FX5 A;  4PJJ A;  4AE4 B;  1MMA A;  4U5F E;  3HTK C;  2B0J A;  1OR3 A;  1RCP A;  3C8G B;  4CIH A;  1N1C A;  1OW7 A;  3F47 A;  3BEH A;  1VYK A;  4EBK A;  1D0X A;  3BRJ A;  4E18 A;  3NMI A;  2WZG A;  4ZLD A;  2OEX A;  5EHH A;  1YYX A;  3S0X A;  2G3K A;  2IXN A;  2XLV A;  3HNJ A;  1OKK D;  2QE9 A;  3EFO B;  4BJ6 C;  2OU6 A;  4CS9 A;  1A7V A;  5D92 A;  1WWP A;  5DS4 A;  3AQC A;  1C03 A;  4ER9 A;  2AP3 A;  3ABL C;  3DE8 A;  2HSB A;  1ZHY A;  2Q9A A;  3LLI A;  2WVQ A; 
#chains in the Genus database with same CATH homology
 1QZX A;  3M1C B;  2XXA A;  4RD9 A;  4U5E E;  3O6X A;  2R7Q A;  1BR2 A;  2R7R A;  3K1H A;  2J46 A;  1FMW A;  3K6B A;  3B0V C;  2PFD A;  4ZLC A;  2J0X A;  5CI8 A;  4JZA A;  2FGY A;  2ZXR A;  5KYW A;  2R7S A;  1BR1 A;  4O79 A;  5T3W A;  1J8M F;  5KYY A;  1ZHW A;  2W9Y A;  3EPV A;  3EGD A;  3DAF A;  2Y3D A;  3LES A;  3MX3 A;  2BE5 F;  1WGW A;  3JYH A;  3UGO A;  4GYT A;  1OCZ C;  3F46 A;  3ZG1 A;  2HV6 A;  2WVN A;  3RYL A;  5BUO A;  4IJJ A;  3K66 A;  2XRH A;  4IWB A;  4JCH A;  4C7O A;  1Z6A A;  3NG1 A;  1D1C A;  4JVS A;  4K7B A;  2L81 A;  2W4B A;  1OCR C;  2IXM A;  2CDQ A;  2J9W A;  1D0Y A;  1SMY F;  2YZS A;  3UR3 C;  3EH1 A;  4E7Z A;  4DBQ A;  3ECS A;  4QI0 A;  2YEV A;  1D1B A;  4CSA A;  1JPN A;  3SYN A;  3WOD F;  4DVY P;  1W2W A;  5DS6 A;  2M4E A;  4PK4 A;  3X2Q C;  4C3B A;  4G7Z F;  4C3E A;  3N2Z B;  3CQZ A;  2R7U A;  1BR4 A;  2VAS A;  3EGX A;  2L9J A;  3FDQ A;  1D0Z A;  3S29 A;  5E3A A;  3ITF A;  3S27 A;  4BG0 A;  4CS8 C;  4OIO F;  3DM5 A;  4P6I C;  3SEO A;  4IAO A;  3B0U X;  4HFF B;  4H4K C;  2W4M A;  4KI2 A;  3RH3 A;  3ZSU A;  2D5R B;  5KYX A;  4AK9 A;  2V26 A;  2C03 A;  3NYM A;  4O6M A;  4RBN A;  5KYU A;  2E87 A;  2WZL A;  1LKX A;  2EIN C;  3OWT A;  1RJ9 A;  3PMR A;  4QDL A;  2WB7 A;  1KU2 A;  4BEJ A;  4EWC A;  3KH2 A;  1V54 C;  2PF4 E;  1FMV A;  5EGY A;  2CW0 F;  4OD4 A;  2NUT A;  4KC9 A;  5F5H A;  1NU9 C;  4YJW A;  3RIP A;  1FFH A;  2KW3 C;  2ZXO A;  4JJG A;  4IRU A;  3KKB A;  1PCX A;  4G7H F;  4PJL A;  4YT2 A;  2Q9B A;  2J45 A;  3W2W A;  2QTV A;  5E3C A;  5D91 A;  3UNG C;  3Q7G A;  5DLJ A;  4CS9 C;  4OIQ F;  3HJC A;  2IYL D;  4FWV A;  1ST6 A;  3DM9 B;  3EZH A;  2XL4 A;  4BJ6 A;  2H7V C;  2WZF A;  1VYI A;  1Z3I X;  2IOQ A;  5B1B C;  4AX2 A;  4QI2 A;  1MND A;  2A68 F;  5T1D B;  3ABM C;  1Z5Z A;  5L3Q A;  4RDA A;  1M2O A;  2R7X A;  2FFH A;  1Z63 A;  4A2N B;  3RKO F;  3UMH A;  4OIN F;  4C3D A;  2CNW A;  2J7P A;  2JD3 A;  4K0D A;  1SF8 A;  5B1A C;  4AE4 A;  1IZM A;  3FHD A;  4O6Y A;  4XLN F;  1NG1 A;  2J9V A;  3KMI A;  2R7T A;  3GOD A;  4JUR I;  3EG9 B;  5E33 A;  1SZI A;  3MLG A;  3LEV A;  3DD7 A;  2NG1 A;  4U5B E;  3EFO A;  3AG1 C;  2MYS A;  3LNR A;  2A1D D;  5T3T A;  3T4R A;  3ZVR A;  3EQL F;  3K33 A;  1LS1 A;  2EIM C;  3N24 A;  3SP1 A;  2GFH A;  2C04 A;  3ZC4 A;  1MMN A;  4U5C E;  3UGP A;  3AQB A;  3I5P A;  3NKE A;  4DOZ A;  1VOM A;  3ZIB A;  2QY9 A;  2EIL C;  4FES A;  3DAG A;  1FFT C;  1OCO C;  4BJT A;  1FTS A;  1J8Y F;  4YWQ A;  4J30 B;  2ZXP A;  2ZPA A;  4CSA C;  1G8X A;  2KNH A;  2OCC C;  2ZXW C;  1VK5 A;  4U5D E;  1TR2 A;  3ASO C;  3E9V A;  1LVK A;  2G62 A;  3I4U A;  4NY3 A;  3K1I C;  4OIR F;  3FAJ A;  1TWH A;  3CZ6 A;  3N0T A;  3L0I A;  2H7O A;  2R7V A;  4DBR A;  2R7W A;  2V3C C;  1M2V B;  1TWC A;  5IY5 C;  2WVO A;  3DXJ F;  1Z23 A;  4B6I A;  1PD1 A;  3HLZ A;  1MMD A;  1OCC C;  2IXO A;  2A6H F;  4BJ5 A;  2G3V A;  4JW1 A;  2J9U A;  4N06 A;  3NDB B;  4CS8 A;  4LER A;  3FVY A;  3GAN A;  3NKD A;  1OKK A;  3EH2 A;  3UMI A;  2NUP B;  3EZI A;  2XXA B;  3T6B A;  1TWA A;  1VMA A;  2KQ9 A;  4PFO A;  3W2V A;  4XWJ A;  5DVW A;  1JPJ A;  3LS1 A;  3O39 A;  4XTK A;  4BJ1 A;  4G7O F;  2Y39 A;  4GEH A;  3W8H A;  4U5H A;  2DYS C;  2O9X A;  3AG3 C;  3SZR A;  2PX0 A;  3L34 A;  3JCU Q;  5DS5 A;  2PP4 A;  2Y69 C;  3OA1 A;  4ULW A;  4ANJ A;  4YT5 A;  2HV7 A;  5KYW B;  3LAY A;  2KGO A;  4KNW A;  4OIP F;  1ZU5 A;  5DQZ A;  4I1O B;  2Z15 A;  2W45 A;  2A69 F;  2VH3 A;  5KYY B;  4LLE A;  3EGD B;  3B9Q A;  4YN0 B;  4PJN A;  3JT1 A;  1IW7 F;  1NZE A;  3AG2 C;  4PFP A;  3VAY A;  1ZU4 A;  2EIJ C;  2CGE A;  3QZC A;  1QLE C;  3H65 A;  4I44 A;  2Q3T A;  4C7O B;  1M56 C;  2P6V A;  1NU7 D;  5F5F A;  4MND A;  1ZHT A;  1ZHX A;  2VB6 A;  3NYL A;  2OG2 A;  4M63 A;  4I1M A;  1S7Z A;  3I5Q A;  2J0W A;  3EHM A;  5L3V A;  4HE8 D;  4KNV A;  3TD7 A;  3DMD A;  1MMG A;  1TKN A;  4HEA J;  4Q4Z F;  3LLK A;  1TWG A;  2P7V A;  1V55 C;  4DVZ A;  2IXP A;  3WG7 C;  3EGX B;  3OEO A;  2EIK C;  2Y3B A;  3KL4 A;  3DJN B;  1ZYR F;  4PJM A;  2H7B A;  3B0P A;  3SNH A;  2KJG A;  3EJN A;  4F4B A;  2I8B A;  1D1A A;  3K7D A;  4O7G A;  4U5G A;  5CI9 A;  1M57 C;  5KYX B;  5DQT A;  3IEE A;  3UMK A;  4CS7 A;  1MNE A;  4MQ9 F;  4J32 B;  2CNW D;  2J7P D;  2DGJ A;  5KYU B;  3W8I A;  1O87 A;  3V7O A;  4YT4 A;  4WJ0 A;  2Y3G A;  4KBL A;  1RJ9 B;  4LAC B;  5E2Q A;  4O6N A;  5HSW A;  2XSE A;  3Q6N A;  4JJF A;  3NYJ A;  3EG9 A;  3POV A;  3Q7L A;  2NUT B;  2PX3 A;  3ABK C;  3ASN C;  2YHS A;  3T6J A;  4CBE A;  2WL8 A;  1O5H A;  1ZHZ A;  1PD0 A;  3JSZ A;  4BJ5 C;  3PHF 2;  2MWQ A;  4HFK B;  3CSK A;  4LLC A;  2Y3H A;  4EBB A;  5B3S C;  4G0H A;  2DYR C;  2Q9C A;  3RFY A;  4W8K A;  3Q6M A;  3NRH A;  2LSE A;  4YT8 A;  4XLP F;  3DZA A;  3LS0 A;  3LJB A;  3QMK A;  4Q5S F;  4I3M A;  3E70 C;  2X51 A;  3JRT A;  5KYN A;  4OD5 A;  3S28 A;  4E7S A;  2R7O A;  4X0R A;  3VYW A;  4Q7C A;  2A6E F;  3AG4 C;  3DJU B;  5FCL A;  3EHN A;  3X1O A;  1M2V A;  4FX5 A;  4PJJ A;  4AE4 B;  1MMA A;  4U5F E;  3HTK C;  2B0J A;  4CIH A;  1N1C A;  3F47 A;  1VYK A;  1D0X A;  2WZG A;  4ZLD A;  5EHH A;  3S0X A;  2G3K A;  2IXN A;  1OKK D;  3EFO B;  4BJ6 C;  4CS9 A;  5D92 A;  5DS4 A;  3AQC A;  3ABL C;  2NUP A;  1ZHY A;  2Q9A A;  3LLI A;  2WVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...