1NZEA

Crystal structure of psbq polypeptide of photosystem ii from higher plants
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
112
structure length
112
Chain Sequence
b'FYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxygen-evolving enhancer protein 3
publication title Crystal structure of the PsbQ protein of photosystem II from higher plants
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 43
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2003-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1nzeA00
2MWQA 3JCUQ 1NZEA 1VYKA 3RFYA 3LS0A 3LS1A 3ZSUA
chains in the Genus database with same CATH superfamily
2L81A 1FFHA 1G4WR 4XEVA 1UG7A 3S0XA 3ITFA 3AQCA 2AP3A 3JZ0A 3ZDLA 2ICWG 5T3TA 4FAPB 3PHF2 3JSZA 2NSGA 2KNHA 4C7OA 3S90A 2A68F 3Q7LA 3K33A 4XLNF 3N0TA 5A69A 2J9VA 3VM6A 2XXAA 2HFIA 3NYJA 4E7ZA 2J9WA 4CX9A 1WGWA 2LSEA 5JSLA 4IB4A 3U2LA 1QZXA 3DJUB 2J8WA 1NSGB 2J0XA 4YL1A 1A0BA 3WAQA 3WHNA 4IGGA 3O10A 4NC3A 4P9FA 4N4WA 4GYTA 4QI2A 1I4YA 1FR0A 3AG1C 2HS5A 256BA 2YRFA 4MVSA 1TQGA 4JIOA 4C3EA 2IYLD 4DRJB 2VB6A 4FX5A 4MVOA 2HJ3A 2M64A 1Z5ZA 2VCBA 4IARA 1GGQA 1ORYA 2P61A 1V74B 1DOVA 5D92A 2KJGA 3H2VA 2R7XA 3OEOA 4J7TA 2Q4FA 3NKEA 2VC9A 4U5CE 4JJFA 5KYWB 2Y3DA 4F4BA 1HW2A 3K6BA 5DLJA 5JRAA 4JCZA 1OCZC 2VCAA 3EQLF 4YN0B 4PR9A 1MMDA 4HEAJ 4N6HA 2P6VA 3LAYA 3IPMO 1UFBA 4I44A 2CNWA 2IBFA 2EPLX 4ULWA 1D0XA 2NUPB 1VOMA 3DZAA 3POVA 4H54A 3B0VC 3BRJA 4BPMA 5JP7A 2H7BA 3H2UA 3AJMA 2YLIA 2ZXWC 4YWQA 4KI2A 4C3BA 3AQBA 5T3WA 1JAFA 2XLHA 1WN0A 2GAQA 1N1CA 2L6HA 3CAXA 3NYLA 3EZIA 4JC7A 5KYYA 4PJLA 1E2XA 1L7CA 1Q0KA 3DM5A 4RDAA 1O5HA 3KPHA 3QMKA 4MNDA 4G78A 4PK4A 3T6GB 3HJCA 3KKBA 3SXZA 1VK5A 3UGOA 3HNLA 1R4TA 4RD9A 2O9XA 3DE9A 4OIRF 5KYUB 1Y6DA 5BQHA 1XWJA 2A0UA 2B0HA 2G3KA 4YT4A 3C62A 1GS9A 5F28E 1B68A 3HNKA 4IAQA 2DGJA 1BR1A 2AVKA 3JT1A 1OXBA 4JTCB 4YT2A 2IXNA 2QY9A 3C18A 3FAPB 4K0DA 4NY3A 4ZLDA 2OEXA 2W9YA 1OXKA 3C63A 1ORJA 2R02A 4HFKB 2MHRA 2D5RB 4WABA 3NMKA 2J7PD 1E86A 4J30B 2XLWA 4DBRA 2R03A 3RIPA 2WZLA 2L6GA 2HKVA 1D1BA 4P9TA 4YL0A 1VTMP 3EJNA 1H9TA 2V26A 5CI9A 3TULA 4XEKA 3EHNA 3EHMA 3TJ5A 4CS8C 4X0RA 4JEBA 2ZXRA 1WOLA 1VLSA 5COGA 1Z23A 3Q7GA 1JPJA 5L3QA 2R7WA 1LI5A 4LLEA 3U3BA 5KYWA 1OKKD 1BR2A 1Q0MA 4LERA 3DI5A 4O6YA 2Q7RA 2HSQA 1YARO 1G5ZA 4PACA 4U5GA 3AG2C 4BJ5A 1G8XA 1JPNA 1LVKA 1SF8A 4BEMJ 2XLVA 2BC5A 1M2OA 2NUPA 2Q9AA 2XL4A 3EG9B 1S05A 3QZCA 1LI7A 3R2PA 4GEHA 3TJ6A 1C17M 4MS2A 3OWTA 1YAUO 1SMYF 1ZZPA 4G7HF 3S28A 1FFTC 1EQ1A 4JEAA 4L6RA 3V5XA 1CGNA 3G4XA 1LM3B 2EPKX 2HSBA 3JRMO 2QLAA 1APCA 3FOOA 3K1IC 3N2ZB 3RFYA 3RKOF 3NRHA 3U5SA 2WZGA 3HNJA 3SZRA 5L0HA 1HY5A 3ZTMA 4YL3A 5AC5A 1D0ZA 5KYUA 5EGYA 3QVZA 2ZXPA 3S29A 4Q4ZF 4JCHA 4G0HA 2I15A 4WGZA 3FXHA 1NU9C 3T4RA 4U5BE 3UR3C 1TWGA 3B29A 3KH2A 3WODF 1O87A 3RQGA 4EBKA 1FAPB 2YLDA 3F46A 5A6KA 4D4XA 1ZU4A 4EHPA 1HE1A 1PD0A 3ZSUA 4RBNA 3DM9B 5E33A 1QPUA 2C03A 2R9RB 1QQ3A 3DAGA 4FWVA 3X2QC 5JUAA 2NSFA 3L34A 4IWBA 5F5HA 3O55A 1MNEA 3DJNB 2A0BA 1OCCC 1VB5A 3JSEO 4KC9A 1J8MF 1BR4A 2HMQA 4XQ1A 3B0PA 2AU5A 4BEJA 5L0IA 1FMVA 1WASA 3U3FA 1OW6A 3TD7A 3GEEA 4JRZA 1WTYA 2X0CA 1T9KA 3RYLA 1EKYA 3ABMC 4AL0A 3W8HA 2W45A 1Z3IX 4DXWA 3MFNA 2XL8A 1AVOB 4NTAA 4C3DA 2UUIA 3N24A 3GEIA 3V5ZA 2JPUA 1FTSA 2XM4A 3C7JA 5E3CA 2KQ9A 3M4CA 4J32B 3VAYA 1V55C 2M4EA 3T6JA 2IXMA 2Y39A 5GPGB 5A6BD 4NTFA 1NFOA 3DAFA 2XL6A 3VF0A 4OIPF 1OCRC 3EG9A 4O7GA 4QI0A 4XEFA 4FESA 3SXYA 4IRUA 3VRCA 1E85A 2DI3A 2KYHA 2Y3HA 4O6MA 3JTLO 2R05A 2W4MA 3GODA 3TQOA 2CW0F 4NCQA 3V5YA 1ZU5A 2EPOA 1MMNA 1U6HA 4CS9C 5DQTA 4CJGA 3LUTB 1W2WA 1EI7A 3FAJA 4AL1A 5KYNA 2XSEA 4ANJA 1Z63A 2ZD9A 2YVKA 1PCXA 2DB4A 2OOCA 3GM2A 3ZC4A 1LS1A 2JX0A 4IJJA 5CIVA 2OQMA 3Q6NA 5E2QA 4OINF 4MVMA 2X51A 3AGTA 3EGXB 4LDQA 2Y69C 4U5FE 2FFHA 3SXKA 2VCCA 3VYWA 1K05A 2A6EF 4JJGA 1VYIA 3K66A 1R5ID 2GFHA 1TR2A 4K7BA 2A1DD 3S27A 5EHHA 2J9UA 2ASRA 1HW1A 2HUJA 2XLDA 2J7PA 3GWLA 3JYHA 2EIMC 3GM1A 5F5FA 5L0CA 3U8PA 4ZLCA 3CEXA 1E83A 2EILC 2TMVP 3AGUA 4XPYA 5KYXB 3EH2A 3IEEA 2HMZA 1WWPA 2A6HF 4CJOA 4PFOA 1LKXA 1EA8A 3A9CA 4OIOF 2J46A 1BDJB 1ZHXA 2Q00A 3RVYA 1ZHYA 4B6IA 1T5OA 1OKKA 3ASOC 4YT5A 4D4NA 1XZQA 3ZQVA 1BZ4A 5JLIA 2YZSA 3LESA 4CDYA 2E87A 2G62A 1V54C 2XS1A 3U2MA 1SZIA 3RH3A 4E7SA 1SR2A 5JS5A 3O6XA 2PF4E 3AG4C 3S84A 4MTOA 1ZW2A 4EWCA 2EPMX 1JR8A 3GORA 2EPNA 2CCYA 1OW8A 3MYFA 4Z9IA 3W8IA 1A7VA 1BBHA 1I4ZA 4PJNA 2R7SA 3LLIA 2P1AA 2XLEA 3DXJF 2NG1A 1RMVA 2EINC 2ZPAA 3JRTA 4LLCA 4JTDB 1RJ9B 4JZAA 1Q0DA 1NLXA 4R32A 3UMHA 3ZTZA 1DOWA 5HV9A 1FMWA 1RXQA 3FOPA 2P7VA 2XRHA 2QNLA 4KBLA 4BJ6C 1YDIA 2YL0A 5HSWA 1D0YA 1OW7A 3K1HA 2L9JA 3LJBA 1ST6A 3HLZA 4JKVA 2LD6A 4MQ9F 1ZVZA 1SYQA 2R25A 4MVZA 4BJTA 4CSAC 2PX3A 3IQ5A 4EBJA 1JMWA 1ORSC 1CGME 3RQEA 1FNTc 1RCPA 1TKNA 1OR3A 5JVEA 3EGXA 4A4AA 1VLTA 5DS6A 1C02A 2J45A 4ER9A 2EIKC 4LDKA 3T6BA 3LLKA 2MWQA 4U5DE 3J06A 3RVZA 1TFOB 3FHDA 1S7ZA 1YZAA 3ZWIA 2RD9A 2RSEB 4XPWA 3SEOA 4BJ1A 3GANA 4CS7A 3NMJA 2LIGA 3M1CB 1T01A 5KYXA 2GWWA 2OU6A 2H7VC 2Q3TA 1HE9A 2BE5F 1JOGA 4EIYA 4N6CA 3M15A 1QLEC 2XLMA 3LEOA 2YLGA 2YWAA 4UDVA 1M57C 4QDLA 5L0DA 4I1MA 4KNVA 3GEHA 4PJJA 4WGYA 1RKCA 2F22A 3OA1A 2AWCA 3IQTA 2LFDA 5BQIA 4MW3A 3I5PA 3IQ6A 1V4AA 4EKWA 3UGPA 1MMAA 3L8IA 5A6BA 5AC4A 2ZXOA 3CQZA 4ONSA 2V3CC 4MVUA 5JT4A 2YEVA 5COFA 2B0JA 2YL3A 3QVYA 5EK0A 3FDQA 1NFNA 3IQCA 2XS8A 1ZHWA 2OJED 3DKAA 3HTKC 3LS1A 4LDRA 4PJMA 3EFOB 1OCOC 3DE8A 2H8AA 3KMIA 4MTGA 4PFPA 3NDBB 4Q5SF 3S9OA 1RJ9A 1T6UA 5K0IA 1MMGA 1XZPA 3QW0A 4LACB 4G7ZF 1YYXA 5BUOA 4YJWA 1LPEA 5L3VA 5CI8A 2EIJC 5DVWA 2QUPA 4DRHB 1VMAA 4HFFB 5AGFA 2J0WA 3K1IA 1T6QA 1LS4A 4AE4B 4YT8A 1GM5A 2GDCA 5E3AA 1CGOA 2QE9A 2WVOA 1M2VB 2OJQA 2VASA 3M79A 4W8KA 1NG1A 3ABKC 1A41A 3JCUQ 3ZIBA 3W4YA 4EBBA 1A7EA 1C03A 3ATPA 1Z7Qc 2IM8A 2C04A 3GM3A 2A69F 3PCVA 2VH3A 4OD4A 3I4UA 5FZTA 4E0HA 3AOUA 5A6AA 2DYRC 2CGEA 2WZFA 3MX3A 3ZG1A 2H7OA 2I8BA 3ASNC 1TFKB 3O39A 4K1OA 4U5HA 3FMSA 3KYJA 4HE8D 1F1MA 3MYIA 4BG0A 1OQCA 4XPXA 4OIQF 3NG1A 3W2VA 4I1OB 2CDQA 1YA7O 3KL4A 3TOMA 3BEHA 2CYDA 2R7QA 1IZMA 3JYYA 2R7OA 4CIPA 1WATA 3C8GD 2KSFA 3V7OA 5L0FA 3UMIA 3X1OA 1VYKA 2AWYA 4M63A 3AG3C 3GWNA 1Y4CA 1U0BB 3ZQYA 4H4KC 1ZW3A 1YLMA 1A7DA 3EGDB 3Q6MA 4Z9HA 4DJ9A 2Y3BA 3E9VA 4JVSA 1H9GA 4YK5A 2LFFA 4DBQA 5DS5A 1M6TA 2UUHA 4MTFA 2W4BA 1KNYA 2YL7A 1YA9A 2GA0A 2HZ8A 2LQGA 1RKEB 2WVNA 1H6GA 2Y3GA 3CZ6A 1YVIA 1Z6AA 2OEVA 3NMIA 3NYMA 3H65A 2L6FA 2J9BA 4U5EE 1MQVA 1ZHZA 3EFOA 2JD3A 2KK1A 3ECSA 2NUTA 5B1BC 4G7OF 1H7IA 3SP1A 1YZCA 2WB7A 2Z15A 2PP4A 1I5NA 2L7AA 1TWCA 2HV6A 3M4BA 4MW8A 4P6IC 2XM0A 2D4UA 4EUKB 1D1AA 2PFDA 4CS9A 1ZYRF 5B3SC 1TWAA 1OR2A 2YHSA 4AE4A 2YQYA 3U9JA 4E17A 3DD7A 1KU2A 2G3VA 3EPVA 2LK4A 1M2VA 1QKRA 3TK0A 4XLPF 1YYJA 1PD1A 2HV7A 1LE4A 2R7VA 3R7CA 1AEPA 1IW7F 2R7RA 2R7TA 1KTMA 2MYSA 3TOLA 1PV3A 4BJ5C 1JRAA 1AUEA 2FGYA 2P0NA 4GQHA 3UMKA 1O3UA 3SNHA 4XTKA 3G50A 3T9OA 3IHUA 3B71A 4JTAB 1ZHTA 1J8YF 4CDAA 4Z9JA 2CNWD 2Q9CA 4OD5A 5D91A 3K7DA 4CIHA 3L0IA 3HNIA 3CSKA 3RW0A 3LNMB 3EH1A 3MLGA 4MVRA 3C8GB 4AX2A 2NPUA 4NQFA 2YKZA 3UNGC 1TWHA 3FVYA 1U89A 4E0IA 4Q7CA 3L1MA 5DS4A 5B1AC 3G4ZA 1K40A 4CDVA 3LNRA 1NBBA 2PNOA 1GQAA 5T1DB 1NZEA 4I3MA 4C7OB 3EGDA 5BQGA 2KC3A 2PBEA 3LS0A 4U9EA 4O79A 2XXAB 4A2NB 1HMOA 3QW1A 2QTVA 1G4US 3QTHA 4N06A 2Q9BA 2OCCC 1RKEA 2R7UA 3US6A 3F47A 5DQZA 3NKDA 4MVQA 5TJ5E 3B9QA 3C8ZA 3E70C 3LEVA 1M56C 4KNWA 3W2WA 4U9DA 2XLOA 2WL8A 3L8JA 3ZVRA 4CS8A 2LCHA 3I5QA 3PMRA 5COMA 5IY5C 1Q0FA 2DYSC 5L0GA 5L0JA 2KW3C 2OG2A 2OKUA 4BJ6A 1CPQA 5FCLA 3HKKA 2YL1A 2PX0A 2IXOA 3RF3A 1MNDA 1QVXA 2IOQA 3U9MA 4E18A 4DOZA 4CSAA 3KYIA 3B0UX 2IXPA 3EZHA 4ULVA 3U8VA 4DRIB 4DVYP 1YJGA 4W8PA 3PDMP 1NU7D 4AK9A 4JW1A 2LP4A 3MBGA 3WG7C 3U0CA 2NUTB 1LE2A 4CBEA 4IAOA 4JE9A 1CPRA 2FAPB 4O6NA 1E84A 3RQFA 5B3IA 1QSPA 3ABLC 2BL2A 2HJMA 2KGOA 3SYNA 5A6JA 2WVQA 4NTBA 3DMDA 3DWWA 4WJ0A 1Q0GA 1L3PA 1LIHA 1D1CA 1T6IA 2ETSA 3A11A 4DVZA 4JURI 4XWJA 4J7YA 1K04A 1HMDA 3C8GA 3SXMA 5KYYB
chains in the Genus database with same CATH topology
2L81A 1FFHA 3S0XA 3ITFA 3AQCA 3PHF2 5T3TA 3JSZA 2KNHA 4C7OA 2A68F 3Q7LA 3K33A 4XLNF 3N0TA 2J9VA 2XXAA 3NYJA 4E7ZA 2J9WA 1WGWA 2LSEA 1QZXA 3DJUB 2J0XA 4GYTA 4QI2A 3AG1C 4C3EA 2IYLD 2VB6A 4FX5A 1Z5ZA 5D92A 2KJGA 2R7XA 3OEOA 3NKEA 4U5CE 4JJFA 5KYWB 2Y3DA 4F4BA 3K6BA 5DLJA 1OCZC 3EQLF 4YN0B 1MMDA 4HEAJ 2P6VA 3LAYA 4I44A 2CNWA 4ULWA 1D0XA 2NUPB 1VOMA 3DZAA 3POVA 3B0VC 2H7BA 2ZXWC 4YWQA 4KI2A 4C3BA 3AQBA 5T3WA 1N1CA 3NYLA 3EZIA 5KYYA 4PJLA 4RDAA 3DM5A 1O5HA 4MNDA 4PK4A 3HJCA 3KKBA 1VK5A 3UGOA 4RD9A 2O9XA 5KYUB 4OIRF 2G3KA 4YT4A 2DGJA 1BR1A 3JT1A 4YT2A 2IXNA 2QY9A 4K0DA 4NY3A 4ZLDA 2W9YA 4HFKB 2D5RB 2J7PD 4J30B 4DBRA 3RIPA 2WZLA 1D1BA 3EJNA 2V26A 5CI9A 3EHNA 3EHMA 4CS8C 4X0RA 2ZXRA 2R7WA 5L3QA 1Z23A 3Q7GA 1JPJA 5KYWA 1OKKD 1BR2A 4LERA 4O6YA 4U5GA 3AG2C 4BJ5A 1G8XA 1JPNA 1LVKA 1SF8A 1M2OA 2NUPA 2Q9AA 2XL4A 3EG9B 3QZCA 4GEHA 3OWTA 1SMYF 4G7HF 3S28A 1FFTC 3K1IC 3N2ZB 3RFYA 3RKOF 3NRHA 2WZGA 3SZRA 1D0ZA 5KYUA 5EGYA 2ZXPA 3S29A 4Q4ZF 4JCHA 4G0HA 1NU9C 3T4RA 4U5BE 3UR3C 1TWGA 3KH2A 3WODF 1O87A 3F46A 1ZU4A 1PD0A 3ZSUA 4RBNA 3DM9B 5E33A 2C03A 4FWVA 3X2QC 3DAGA 3L34A 4IWBA 5F5HA 1MNEA 3DJNB 4KC9A 1OCCC 1J8MF 1BR4A 3B0PA 4BEJA 1FMVA 3TD7A 3RYLA 3ABMC 3W8HA 2W45A 1Z3IX 4C3DA 3N24A 1FTSA 5E3CA 2KQ9A 4J32B 3VAYA 1V55C 2M4EA 3T6JA 2IXMA 2Y39A 3DAFA 4OIPF 1OCRC 3EG9A 4O7GA 4QI0A 4FESA 4IRUA 2Y3HA 4O6MA 2W4MA 3GODA 2CW0F 1ZU5A 1MMNA 4CS9C 5DQTA 1W2WA 3FAJA 5KYNA 2XSEA 4ANJA 1Z63A 1PCXA 3ZC4A 1LS1A 4IJJA 3Q6NA 4OINF 5E2QA 2X51A 3EGXB 4U5FE 2Y69C 2FFHA 3VYWA 2A6EF 4JJGA 1VYIA 3K66A 2GFHA 1TR2A 4K7BA 2A1DD 3S27A 5EHHA 2J9UA 3QMKA 5F5FA 2J7PA 3JYHA 2EIMC 4ZLCA 2EILC 5KYXB 3EH2A 3IEEA 2A6HF 4PFOA 1LKXA 4OIOF 2J46A 1ZHXA 4B6IA 1ZHYA 1OKKA 3ASOC 4YT5A 2YZSA 3LESA 2E87A 1V54C 2G62A 4E7SA 1SZIA 3RH3A 3O6XA 2PF4E 3AG4C 4EWCA 3W8IA 2R7SA 4PJNA 3LLIA 3DXJF 2NG1A 2EINC 2ZPAA 3JRTA 4LLCA 1RJ9B 4JZAA 3UMHA 1FMWA 2P7VA 2XRHA 4BJ6C 4KBLA 5HSWA 1D0YA 3K1HA 2L9JA 3LJBA 1ST6A 3HLZA 4MQ9F 4CSAC 4BJTA 2PX3A 1TKNA 3EGXA 5DS6A 2J45A 2EIKC 3T6BA 3LLKA 2MWQA 4U5DE 3FHDA 1S7ZA 3SEOA 4BJ1A 3GANA 4CS7A 3M1CB 5KYXA 2H7VC 2Q3TA 2BE5F 1QLEC 1M57C 4QDLA 4I1MA 4KNVA 4PJJA 3OA1A 3I5PA 3UGPA 1MMAA 2V3CC 2ZXOA 3CQZA 2YEVA 2B0JA 3FDQA 4PJMA 1ZHWA 3HTKC 3LS1A 3EFOB 1OCOC 3KMIA 4PFPA 3NDBB 4Q5SF 1RJ9A 1MMGA 4LACB 4G7ZF 5BUOA 4YJWA 5L3VA 5CI8A 2EIJC 5DVWA 1VMAA 4HFFB 2J0WA 4AE4B 4YT8A 5E3AA 2WVOA 1M2VB 4W8KA 2VASA 1NG1A 3ABKC 3JCUQ 3ZIBA 4EBBA 2C04A 2A69F 2VH3A 4OD4A 3I4UA 2DYRC 2CGEA 2WZFA 3MX3A 3ZG1A 2H7OA 2I8BA 3ASNC 3O39A 4U5HA 4BG0A 4HE8D 4OIQF 3NG1A 3W2VA 4I1OB 2CDQA 3KL4A 2R7QA 1IZMA 2R7OA 3V7OA 3UMIA 3X1OA 1VYKA 4M63A 3AG3C 4H4KC 3EGDB 3Q6MA 2Y3BA 3E9VA 4JVSA 5DS5A 4DBQA 2W4BA 2WVNA 4LLEA 2Y3GA 3CZ6A 1Z6AA 3NYMA 3H65A 4U5EE 3EFOA 1ZHZA 2NUTA 2JD3A 3ECSA 4G7OF 5B1BC 3SP1A 2WB7A 2Z15A 2PP4A 4P6IC 1TWCA 2HV6A 1D1AA 2PFDA 4CS9A 1ZYRF 5B3SC 1TWAA 2YHSA 4AE4A 3DD7A 1KU2A 2G3VA 3EPVA 1M2VA 4XLPF 2HV7A 1PD1A 2R7VA 2R7TA 1IW7F 2R7RA 2MYSA 4BJ5C 2FGYA 3UMKA 3SNHA 4XTKA 1ZHTA 1J8YF 2CNWD 2Q9CA 4OD5A 5D91A 3K7DA 4CIHA 3L0IA 3CSKA 3EH1A 3MLGA 4AX2A 3UNGC 1TWHA 3FVYA 4Q7CA 5DS4A 5B1AC 3LNRA 5T1DB 1NZEA 4I3MA 4C7OB 3EGDA 3LS0A 4O79A 2XXAB 4A2NB 2QTVA 4N06A 2Q9BA 2OCCC 2R7UA 3F47A 5DQZA 3NKDA 3B9QA 3E70C 3LEVA 1M56C 4KNWA 3W2WA 2WL8A 3ZVRA 4CS8A 3I5QA 3PMRA 5IY5C 2DYSC 2KW3C 2OG2A 5FCLA 4BJ6A 2PX0A 2IXOA 1MNDA 4CSAA 2IOQA 4DOZA 3B0UX 2IXPA 3EZHA 4DVYP 1NU7D 4AK9A 4JW1A 3WG7C 2NUTB 4CBEA 4IAOA 4O6NA 3ABLC 3SYNA 2KGOA 2WVQA 3DMDA 4WJ0A 1D1CA 4DVZA 4JURI 4XWJA 5KYYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MWQ A;  3JCU Q;  1NZE A;  1VYK A;  3RFY A;  3LS0 A;  3LS1 A;  3ZSU A; 
#chains in the Genus database with same CATH topology
 2L81 A;  1FFH A;  1G4W R;  4XEV A;  1UG7 A;  3S0X A;  3ITF A;  3AQC A;  2AP3 A;  3JZ0 A;  3ZDL A;  2ICW G;  5T3T A;  4FAP B;  3PHF 2;  3JSZ A;  2NSG A;  2KNH A;  4C7O A;  3S90 A;  2A68 F;  3Q7L A;  3K33 A;  4XLN F;  3N0T A;  5A69 A;  2J9V A;  3VM6 A;  2XXA A;  2HFI A;  3NYJ A;  4E7Z A;  2J9W A;  4CX9 A;  1WGW A;  2LSE A;  5JSL A;  4IB4 A;  3U2L A;  1QZX A;  3DJU B;  2J8W A;  1NSG B;  2J0X A;  4YL1 A;  1A0B A;  3WAQ A;  3WHN A;  4IGG A;  3O10 A;  4NC3 A;  4P9F A;  4N4W A;  4GYT A;  4QI2 A;  1I4Y A;  1FR0 A;  3AG1 C;  2HS5 A;  256B A;  2YRF A;  4MVS A;  1TQG A;  4JIO A;  4C3E A;  2IYL D;  4DRJ B;  2VB6 A;  4FX5 A;  4MVO A;  2HJ3 A;  2M64 A;  1Z5Z A;  2VCB A;  4IAR A;  1GGQ A;  1ORY A;  2P61 A;  1V74 B;  1DOV A;  5D92 A;  2KJG A;  3H2V A;  2R7X A;  3OEO A;  4J7T A;  2Q4F A;  3NKE A;  2VC9 A;  4U5C E;  4JJF A;  5KYW B;  2Y3D A;  4F4B A;  1HW2 A;  3K6B A;  5DLJ A;  5JRA A;  4JCZ A;  1OCZ C;  2VCA A;  3EQL F;  4YN0 B;  4PR9 A;  1MMD A;  4HEA J;  4N6H A;  2P6V A;  3LAY A;  3IPM O;  1UFB A;  4I44 A;  2CNW A;  2IBF A;  2EPL X;  4ULW A;  1D0X A;  2NUP B;  1VOM A;  3DZA A;  3POV A;  4H54 A;  3B0V C;  3BRJ A;  4BPM A;  5JP7 A;  2H7B A;  3H2U A;  3AJM A;  2YLI A;  2ZXW C;  4YWQ A;  4KI2 A;  4C3B A;  3AQB A;  5T3W A;  1JAF A;  2XLH A;  1WN0 A;  2GAQ A;  1N1C A;  2L6H A;  3CAX A;  3NYL A;  3EZI A;  4JC7 A;  5KYY A;  4PJL A;  1E2X A;  1L7C A;  1Q0K A;  3DM5 A;  4RDA A;  1O5H A;  3KPH A;  3QMK A;  4MND A;  4G78 A;  4PK4 A;  3T6G B;  3HJC A;  3KKB A;  3SXZ A;  1VK5 A;  3UGO A;  3HNL A;  1R4T A;  4RD9 A;  2O9X A;  3DE9 A;  4OIR F;  5KYU B;  1Y6D A;  5BQH A;  1XWJ A;  2A0U A;  2B0H A;  2G3K A;  4YT4 A;  3C62 A;  1GS9 A;  5F28 E;  1B68 A;  3HNK A;  4IAQ A;  2DGJ A;  1BR1 A;  2AVK A;  3JT1 A;  1OXB A;  4JTC B;  4YT2 A;  2IXN A;  2QY9 A;  3C18 A;  3FAP B;  4K0D A;  4NY3 A;  4ZLD A;  2OEX A;  2W9Y A;  1OXK A;  3C63 A;  1ORJ A;  2R02 A;  4HFK B;  2MHR A;  2D5R B;  4WAB A;  3NMK A;  2J7P D;  1E86 A;  4J30 B;  2XLW A;  4DBR A;  2R03 A;  3RIP A;  2WZL A;  2L6G A;  2HKV A;  1D1B A;  4P9T A;  4YL0 A;  1VTM P;  3EJN A;  1H9T A;  2V26 A;  5CI9 A;  3TUL A;  4XEK A;  3EHN A;  3EHM A;  3TJ5 A;  4CS8 C;  4X0R A;  4JEB A;  2ZXR A;  1WOL A;  1VLS A;  5COG A;  1Z23 A;  3Q7G A;  1JPJ A;  5L3Q A;  2R7W A;  1LI5 A;  4LLE A;  3U3B A;  5KYW A;  1OKK D;  1BR2 A;  1Q0M A;  4LER A;  3DI5 A;  4O6Y A;  2Q7R A;  2HSQ A;  1YAR O;  1G5Z A;  4PAC A;  4U5G A;  3AG2 C;  4BJ5 A;  1G8X A;  1JPN A;  1LVK A;  1SF8 A;  4BEM J;  2XLV A;  2BC5 A;  1M2O A;  2NUP A;  2Q9A A;  2XL4 A;  3EG9 B;  1S05 A;  3QZC A;  1LI7 A;  3R2P A;  4GEH A;  3TJ6 A;  1C17 M;  4MS2 A;  3OWT A;  1YAU O;  1SMY F;  1ZZP A;  4G7H F;  3S28 A;  1FFT C;  1EQ1 A;  4JEA A;  4L6R A;  3V5X A;  1CGN A;  3G4X A;  1LM3 B;  2EPK X;  2HSB A;  3JRM O;  2QLA A;  1APC A;  3FOO A;  3K1I C;  3N2Z B;  3RFY A;  3RKO F;  3NRH A;  3U5S A;  2WZG A;  3HNJ A;  3SZR A;  5L0H A;  1HY5 A;  3ZTM A;  4YL3 A;  5AC5 A;  1D0Z A;  5KYU A;  5EGY A;  3QVZ A;  2ZXP A;  3S29 A;  4Q4Z F;  4JCH A;  4G0H A;  2I15 A;  4WGZ A;  3FXH A;  1NU9 C;  3T4R A;  4U5B E;  3UR3 C;  1TWG A;  3B29 A;  3KH2 A;  3WOD F;  1O87 A;  3RQG A;  4EBK A;  1FAP B;  2YLD A;  3F46 A;  5A6K A;  4D4X A;  1ZU4 A;  4EHP A;  1HE1 A;  1PD0 A;  3ZSU A;  4RBN A;  3DM9 B;  5E33 A;  1QPU A;  2C03 A;  2R9R B;  1QQ3 A;  3DAG A;  4FWV A;  3X2Q C;  5JUA A;  2NSF A;  3L34 A;  4IWB A;  5F5H A;  3O55 A;  1MNE A;  3DJN B;  2A0B A;  1OCC C;  1VB5 A;  3JSE O;  4KC9 A;  1J8M F;  1BR4 A;  2HMQ A;  4XQ1 A;  3B0P A;  2AU5 A;  4BEJ A;  5L0I A;  1FMV A;  1WAS A;  3U3F A;  1OW6 A;  3TD7 A;  3GEE A;  4JRZ A;  1WTY A;  2X0C A;  1T9K A;  3RYL A;  1EKY A;  3ABM C;  4AL0 A;  3W8H A;  2W45 A;  1Z3I X;  4DXW A;  3MFN A;  2XL8 A;  1AVO B;  4NTA A;  4C3D A;  2UUI A;  3N24 A;  3GEI A;  3V5Z A;  2JPU A;  1FTS A;  2XM4 A;  3C7J A;  5E3C A;  2KQ9 A;  3M4C A;  4J32 B;  3VAY A;  1V55 C;  2M4E A;  3T6J A;  2IXM A;  2Y39 A;  5GPG B;  5A6B D;  4NTF A;  1NFO A;  3DAF A;  2XL6 A;  3VF0 A;  4OIP F;  1OCR C;  3EG9 A;  4O7G A;  4QI0 A;  4XEF A;  4FES A;  3SXY A;  4IRU A;  3VRC A;  1E85 A;  2DI3 A;  2KYH A;  2Y3H A;  4O6M A;  3JTL O;  2R05 A;  2W4M A;  3GOD A;  3TQO A;  2CW0 F;  4NCQ A;  3V5Y A;  1ZU5 A;  2EPO A;  1MMN A;  1U6H A;  4CS9 C;  5DQT A;  4CJG A;  3LUT B;  1W2W A;  1EI7 A;  3FAJ A;  4AL1 A;  5KYN A;  2XSE A;  4ANJ A;  1Z63 A;  2ZD9 A;  2YVK A;  1PCX A;  2DB4 A;  2OOC A;  3GM2 A;  3ZC4 A;  1LS1 A;  2JX0 A;  4IJJ A;  5CIV A;  2OQM A;  3Q6N A;  5E2Q A;  4OIN F;  4MVM A;  2X51 A;  3AGT A;  3EGX B;  4LDQ A;  2Y69 C;  4U5F E;  2FFH A;  3SXK A;  2VCC A;  3VYW A;  1K05 A;  2A6E F;  4JJG A;  1VYI A;  3K66 A;  1R5I D;  2GFH A;  1TR2 A;  4K7B A;  2A1D D;  3S27 A;  5EHH A;  2J9U A;  2ASR A;  1HW1 A;  2HUJ A;  2XLD A;  2J7P A;  3GWL A;  3JYH A;  2EIM C;  3GM1 A;  5F5F A;  5L0C A;  3U8P A;  4ZLC A;  3CEX A;  1E83 A;  2EIL C;  2TMV P;  3AGU A;  4XPY A;  5KYX B;  3EH2 A;  3IEE A;  2HMZ A;  1WWP A;  2A6H F;  4CJO A;  4PFO A;  1LKX A;  1EA8 A;  3A9C A;  4OIO F;  2J46 A;  1BDJ B;  1ZHX A;  2Q00 A;  3RVY A;  1ZHY A;  4B6I A;  1T5O A;  1OKK A;  3ASO C;  4YT5 A;  4D4N A;  1XZQ A;  3ZQV A;  1BZ4 A;  5JLI A;  2YZS A;  3LES A;  4CDY A;  2E87 A;  2G62 A;  1V54 C;  2XS1 A;  3U2M A;  1SZI A;  3RH3 A;  4E7S A;  1SR2 A;  5JS5 A;  3O6X A;  2PF4 E;  3AG4 C;  3S84 A;  4MTO A;  1ZW2 A;  4EWC A;  2EPM X;  1JR8 A;  3GOR A;  2EPN A;  2CCY A;  1OW8 A;  3MYF A;  4Z9I A;  3W8I A;  1A7V A;  1BBH A;  1I4Z A;  4PJN A;  2R7S A;  3LLI A;  2P1A A;  2XLE A;  3DXJ F;  2NG1 A;  1RMV A;  2EIN C;  2ZPA A;  3JRT A;  4LLC A;  4JTD B;  1RJ9 B;  4JZA A;  1Q0D A;  1NLX A;  4R32 A;  3UMH A;  3ZTZ A;  1DOW A;  5HV9 A;  1FMW A;  1RXQ A;  3FOP A;  2P7V A;  2XRH A;  2QNL A;  4KBL A;  4BJ6 C;  1YDI A;  2YL0 A;  5HSW A;  1D0Y A;  1OW7 A;  3K1H A;  2L9J A;  3LJB A;  1ST6 A;  3HLZ A;  4JKV A;  2LD6 A;  4MQ9 F;  1ZVZ A;  1SYQ A;  2R25 A;  4MVZ A;  4BJT A;  4CSA C;  2PX3 A;  3IQ5 A;  4EBJ A;  1JMW A;  1ORS C;  1CGM E;  3RQE A;  1FNT c;  1RCP A;  1TKN A;  1OR3 A;  5JVE A;  3EGX A;  4A4A A;  1VLT A;  5DS6 A;  1C02 A;  2J45 A;  4ER9 A;  2EIK C;  4LDK A;  3T6B A;  3LLK A;  2MWQ A;  4U5D E;  3J06 A;  3RVZ A;  1TFO B;  3FHD A;  1S7Z A;  1YZA A;  3ZWI A;  2RD9 A;  2RSE B;  4XPW A;  3SEO A;  4BJ1 A;  3GAN A;  4CS7 A;  3NMJ A;  2LIG A;  3M1C B;  1T01 A;  5KYX A;  2GWW A;  2OU6 A;  2H7V C;  2Q3T A;  1HE9 A;  2BE5 F;  1JOG A;  4EIY A;  4N6C A;  3M15 A;  1QLE C;  2XLM A;  3LEO A;  2YLG A;  2YWA A;  4UDV A;  1M57 C;  4QDL A;  5L0D A;  4I1M A;  4KNV A;  3GEH A;  4PJJ A;  4WGY A;  1RKC A;  2F22 A;  3OA1 A;  2AWC A;  3IQT A;  2LFD A;  5BQI A;  4MW3 A;  3I5P A;  3IQ6 A;  1V4A A;  4EKW A;  3UGP A;  1MMA A;  3L8I A;  5A6B A;  5AC4 A;  2ZXO A;  3CQZ A;  4ONS A;  2V3C C;  4MVU A;  5JT4 A;  2YEV A;  5COF A;  2B0J A;  2YL3 A;  3QVY A;  5EK0 A;  3FDQ A;  1NFN A;  3IQC A;  2XS8 A;  1ZHW A;  2OJE D;  3DKA A;  3HTK C;  3LS1 A;  4LDR A;  4PJM A;  3EFO B;  1OCO C;  3DE8 A;  2H8A A;  3KMI A;  4MTG A;  4PFP A;  3NDB B;  4Q5S F;  3S9O A;  1RJ9 A;  1T6U A;  5K0I A;  1MMG A;  1XZP A;  3QW0 A;  4LAC B;  4G7Z F;  1YYX A;  5BUO A;  4YJW A;  1LPE A;  5L3V A;  5CI8 A;  2EIJ C;  5DVW A;  2QUP A;  4DRH B;  1VMA A;  4HFF B;  5AGF A;  2J0W A;  3K1I A;  1T6Q A;  1LS4 A;  4AE4 B;  4YT8 A;  1GM5 A;  2GDC A;  5E3A A;  1CGO A;  2QE9 A;  2WVO A;  1M2V B;  2OJQ A;  2VAS A;  3M79 A;  4W8K A;  1NG1 A;  3ABK C;  1A41 A;  3JCU Q;  3ZIB A;  3W4Y A;  4EBB A;  1A7E A;  1C03 A;  3ATP A;  1Z7Q c;  2IM8 A;  2C04 A;  3GM3 A;  2A69 F;  3PCV A;  2VH3 A;  4OD4 A;  3I4U A;  5FZT A;  4E0H A;  3AOU A;  5A6A A;  2DYR C;  2CGE A;  2WZF A;  3MX3 A;  3ZG1 A;  2H7O A;  2I8B A;  3ASN C;  1TFK B;  3O39 A;  4K1O A;  4U5H A;  3FMS A;  3KYJ A;  4HE8 D;  1F1M A;  3MYI A;  4BG0 A;  1OQC A;  4XPX A;  4OIQ F;  3NG1 A;  3W2V A;  4I1O B;  2CDQ A;  1YA7 O;  3KL4 A;  3TOM A;  3BEH A;  2CYD A;  2R7Q A;  1IZM A;  3JYY A;  2R7O A;  4CIP A;  1WAT A;  3C8G D;  2KSF A;  3V7O A;  5L0F A;  3UMI A;  3X1O A;  1VYK A;  2AWY A;  4M63 A;  3AG3 C;  3GWN A;  1Y4C A;  1U0B B;  3ZQY A;  4H4K C;  1ZW3 A;  1YLM A;  1A7D A;  3EGD B;  3Q6M A;  4Z9H A;  4DJ9 A;  2Y3B A;  3E9V A;  4JVS A;  1H9G A;  4YK5 A;  2LFF A;  4DBQ A;  5DS5 A;  1M6T A;  2UUH A;  4MTF A;  2W4B A;  1KNY A;  2YL7 A;  1YA9 A;  2GA0 A;  2HZ8 A;  2LQG A;  1RKE B;  2WVN A;  1H6G A;  2Y3G A;  3CZ6 A;  1YVI A;  1Z6A A;  2OEV A;  3NMI A;  3NYM A;  3H65 A;  2L6F A;  2J9B A;  4U5E E;  1MQV A;  1ZHZ A;  3EFO A;  2JD3 A;  2KK1 A;  3ECS A;  2NUT A;  5B1B C;  4G7O F;  1H7I A;  3SP1 A;  1YZC A;  2WB7 A;  2Z15 A;  2PP4 A;  1I5N A;  2L7A A;  1TWC A;  2HV6 A;  3M4B A;  4MW8 A;  4P6I C;  2XM0 A;  2D4U A;  4EUK B;  1D1A A;  2PFD A;  4CS9 A;  1ZYR F;  5B3S C;  1TWA A;  1OR2 A;  2YHS A;  4AE4 A;  2YQY A;  3U9J A;  4E17 A;  3DD7 A;  1KU2 A;  2G3V A;  3EPV A;  2LK4 A;  1M2V A;  1QKR A;  3TK0 A;  4XLP F;  1YYJ A;  1PD1 A;  2HV7 A;  1LE4 A;  2R7V A;  3R7C A;  1AEP A;  1IW7 F;  2R7R A;  2R7T A;  1KTM A;  2MYS A;  3TOL A;  1PV3 A;  4BJ5 C;  1JRA A;  1AUE A;  2FGY A;  2P0N A;  4GQH A;  3UMK A;  1O3U A;  3SNH A;  4XTK A;  3G50 A;  3T9O A;  3IHU A;  3B71 A;  4JTA B;  1ZHT A;  1J8Y F;  4CDA A;  4Z9J A;  2CNW D;  2Q9C A;  4OD5 A;  5D91 A;  3K7D A;  4CIH A;  3L0I A;  3HNI A;  3CSK A;  3RW0 A;  3LNM B;  3EH1 A;  3MLG A;  4MVR A;  3C8G B;  4AX2 A;  2NPU A;  4NQF A;  2YKZ A;  3UNG C;  1TWH A;  3FVY A;  1U89 A;  4E0I A;  4Q7C A;  3L1M A;  5DS4 A;  5B1A C;  3G4Z A;  1K40 A;  4CDV A;  3LNR A;  1NBB A;  2PNO A;  1GQA A;  5T1D B;  1NZE A;  4I3M A;  4C7O B;  3EGD A;  5BQG A;  2KC3 A;  2PBE A;  3LS0 A;  4U9E A;  4O79 A;  2XXA B;  4A2N B;  1HMO A;  3QW1 A;  2QTV A;  1G4U S;  3QTH A;  4N06 A;  2Q9B A;  2OCC C;  1RKE A;  2R7U A;  3US6 A;  3F47 A;  5DQZ A;  3NKD A;  4MVQ A;  5TJ5 E;  3B9Q A;  3C8Z A;  3E70 C;  3LEV A;  1M56 C;  4KNW A;  3W2W A;  4U9D A;  2XLO A;  2WL8 A;  3L8J A;  3ZVR A;  4CS8 A;  2LCH A;  3I5Q A;  3PMR A;  5COM A;  5IY5 C;  1Q0F A;  2DYS C;  5L0G A;  5L0J A;  2KW3 C;  2OG2 A;  2OKU A;  4BJ6 A;  1CPQ A;  5FCL A;  3HKK A;  2YL1 A;  2PX0 A;  2IXO A;  3RF3 A;  1MND A;  1QVX A;  2IOQ A;  3U9M A;  4E18 A;  4DOZ A;  4CSA A;  3KYI A;  3B0U X;  2IXP A;  3EZH A;  4ULV A;  3U8V A;  4DRI B;  4DVY P;  1YJG A;  4W8P A;  3PDM P;  1NU7 D;  4AK9 A;  4JW1 A;  2LP4 A;  3MBG A;  3WG7 C;  3U0C A;  2NUT B;  1LE2 A;  4CBE A;  4IAO A;  4JE9 A;  1CPR A;  2FAP B;  4O6N A;  1E84 A;  3RQF A;  5B3I A;  1QSP A;  3ABL C;  2BL2 A;  2HJM A;  2KGO A;  3SYN A;  5A6J A;  2WVQ A;  4NTB A;  3DMD A;  3DWW A;  4WJ0 A;  1Q0G A;  1L3P A;  1LIH A;  1D1C A;  1T6I A;  2ETS A;  3A11 A;  4DVZ A;  4JUR I;  4XWJ A;  4J7Y A;  1K04 A;  1HMD A;  3C8G A;  3SXM A;  5KYY B; 
#chains in the Genus database with same CATH homology
 2L81 A;  1FFH A;  3S0X A;  3ITF A;  3AQC A;  3PHF 2;  5T3T A;  3JSZ A;  2KNH A;  4C7O A;  2A68 F;  3Q7L A;  3K33 A;  4XLN F;  3N0T A;  2J9V A;  2XXA A;  3NYJ A;  4E7Z A;  2J9W A;  1WGW A;  2LSE A;  1QZX A;  3DJU B;  2J0X A;  4GYT A;  4QI2 A;  3AG1 C;  4C3E A;  2IYL D;  2VB6 A;  4FX5 A;  1Z5Z A;  5D92 A;  2KJG A;  2R7X A;  3OEO A;  3NKE A;  4U5C E;  4JJF A;  5KYW B;  2Y3D A;  4F4B A;  3K6B A;  5DLJ A;  1OCZ C;  3EQL F;  4YN0 B;  1MMD A;  4HEA J;  2P6V A;  3LAY A;  4I44 A;  2CNW A;  4ULW A;  1D0X A;  2NUP B;  1VOM A;  3DZA A;  3POV A;  3B0V C;  2H7B A;  2ZXW C;  4YWQ A;  4KI2 A;  4C3B A;  3AQB A;  5T3W A;  1N1C A;  3NYL A;  3EZI A;  5KYY A;  4PJL A;  4RDA A;  3DM5 A;  1O5H A;  4MND A;  4PK4 A;  3HJC A;  3KKB A;  1VK5 A;  3UGO A;  4RD9 A;  2O9X A;  5KYU B;  4OIR F;  2G3K A;  4YT4 A;  2DGJ A;  1BR1 A;  3JT1 A;  4YT2 A;  2IXN A;  2QY9 A;  4K0D A;  4NY3 A;  4ZLD A;  2W9Y A;  4HFK B;  2D5R B;  2J7P D;  4J30 B;  4DBR A;  3RIP A;  2WZL A;  1D1B A;  3EJN A;  2V26 A;  5CI9 A;  3EHN A;  3EHM A;  4CS8 C;  4X0R A;  2ZXR A;  2R7W A;  5L3Q A;  1Z23 A;  3Q7G A;  1JPJ A;  5KYW A;  1OKK D;  1BR2 A;  4LER A;  4O6Y A;  4U5G A;  3AG2 C;  4BJ5 A;  1G8X A;  1JPN A;  1LVK A;  1SF8 A;  1M2O A;  2NUP A;  2Q9A A;  2XL4 A;  3EG9 B;  3QZC A;  4GEH A;  3OWT A;  1SMY F;  4G7H F;  3S28 A;  1FFT C;  3K1I C;  3N2Z B;  3RFY A;  3RKO F;  3NRH A;  2WZG A;  3SZR A;  1D0Z A;  5KYU A;  5EGY A;  2ZXP A;  3S29 A;  4Q4Z F;  4JCH A;  4G0H A;  1NU9 C;  3T4R A;  4U5B E;  3UR3 C;  1TWG A;  3KH2 A;  3WOD F;  1O87 A;  3F46 A;  1ZU4 A;  1PD0 A;  3ZSU A;  4RBN A;  3DM9 B;  5E33 A;  2C03 A;  4FWV A;  3X2Q C;  3DAG A;  3L34 A;  4IWB A;  5F5H A;  1MNE A;  3DJN B;  4KC9 A;  1OCC C;  1J8M F;  1BR4 A;  3B0P A;  4BEJ A;  1FMV A;  3TD7 A;  3RYL A;  3ABM C;  3W8H A;  2W45 A;  1Z3I X;  4C3D A;  3N24 A;  1FTS A;  5E3C A;  2KQ9 A;  4J32 B;  3VAY A;  1V55 C;  2M4E A;  3T6J A;  2IXM A;  2Y39 A;  3DAF A;  4OIP F;  1OCR C;  3EG9 A;  4O7G A;  4QI0 A;  4FES A;  4IRU A;  2Y3H A;  4O6M A;  2W4M A;  3GOD A;  2CW0 F;  1ZU5 A;  1MMN A;  4CS9 C;  5DQT A;  1W2W A;  3FAJ A;  5KYN A;  2XSE A;  4ANJ A;  1Z63 A;  1PCX A;  3ZC4 A;  1LS1 A;  4IJJ A;  3Q6N A;  4OIN F;  5E2Q A;  2X51 A;  3EGX B;  4U5F E;  2Y69 C;  2FFH A;  3VYW A;  2A6E F;  4JJG A;  1VYI A;  3K66 A;  2GFH A;  1TR2 A;  4K7B A;  2A1D D;  3S27 A;  5EHH A;  2J9U A;  3QMK A;  5F5F A;  2J7P A;  3JYH A;  2EIM C;  4ZLC A;  2EIL C;  5KYX B;  3EH2 A;  3IEE A;  2A6H F;  4PFO A;  1LKX A;  4OIO F;  2J46 A;  1ZHX A;  4B6I A;  1ZHY A;  1OKK A;  3ASO C;  4YT5 A;  2YZS A;  3LES A;  2E87 A;  1V54 C;  2G62 A;  4E7S A;  1SZI A;  3RH3 A;  3O6X A;  2PF4 E;  3AG4 C;  4EWC A;  3W8I A;  2R7S A;  4PJN A;  3LLI A;  3DXJ F;  2NG1 A;  2EIN C;  2ZPA A;  3JRT A;  4LLC A;  1RJ9 B;  4JZA A;  3UMH A;  1FMW A;  2P7V A;  2XRH A;  4BJ6 C;  4KBL A;  5HSW A;  1D0Y A;  3K1H A;  2L9J A;  3LJB A;  1ST6 A;  3HLZ A;  4MQ9 F;  4CSA C;  4BJT A;  2PX3 A;  1TKN A;  3EGX A;  5DS6 A;  2J45 A;  2EIK C;  3T6B A;  3LLK A;  2MWQ A;  4U5D E;  3FHD A;  1S7Z A;  3SEO A;  4BJ1 A;  3GAN A;  4CS7 A;  3M1C B;  5KYX A;  2H7V C;  2Q3T A;  2BE5 F;  1QLE C;  1M57 C;  4QDL A;  4I1M A;  4KNV A;  4PJJ A;  3OA1 A;  3I5P A;  3UGP A;  1MMA A;  2V3C C;  2ZXO A;  3CQZ A;  2YEV A;  2B0J A;  3FDQ A;  4PJM A;  1ZHW A;  3HTK C;  3LS1 A;  3EFO B;  1OCO C;  3KMI A;  4PFP A;  3NDB B;  4Q5S F;  1RJ9 A;  1MMG A;  4LAC B;  4G7Z F;  5BUO A;  4YJW A;  5L3V A;  5CI8 A;  2EIJ C;  5DVW A;  1VMA A;  4HFF B;  2J0W A;  4AE4 B;  4YT8 A;  5E3A A;  2WVO A;  1M2V B;  4W8K A;  2VAS A;  1NG1 A;  3ABK C;  3JCU Q;  3ZIB A;  4EBB A;  2C04 A;  2A69 F;  2VH3 A;  4OD4 A;  3I4U A;  2DYR C;  2CGE A;  2WZF A;  3MX3 A;  3ZG1 A;  2H7O A;  2I8B A;  3ASN C;  3O39 A;  4U5H A;  4BG0 A;  4HE8 D;  4OIQ F;  3NG1 A;  3W2V A;  4I1O B;  2CDQ A;  3KL4 A;  2R7Q A;  1IZM A;  2R7O A;  3V7O A;  3UMI A;  3X1O A;  1VYK A;  4M63 A;  3AG3 C;  4H4K C;  3EGD B;  3Q6M A;  2Y3B A;  3E9V A;  4JVS A;  5DS5 A;  4DBQ A;  2W4B A;  2WVN A;  4LLE A;  2Y3G A;  3CZ6 A;  1Z6A A;  3NYM A;  3H65 A;  4U5E E;  3EFO A;  1ZHZ A;  2NUT A;  2JD3 A;  3ECS A;  4G7O F;  5B1B C;  3SP1 A;  2WB7 A;  2Z15 A;  2PP4 A;  4P6I C;  1TWC A;  2HV6 A;  1D1A A;  2PFD A;  4CS9 A;  1ZYR F;  5B3S C;  1TWA A;  2YHS A;  4AE4 A;  3DD7 A;  1KU2 A;  2G3V A;  3EPV A;  1M2V A;  4XLP F;  2HV7 A;  1PD1 A;  2R7V A;  2R7T A;  1IW7 F;  2R7R A;  2MYS A;  4BJ5 C;  2FGY A;  3UMK A;  3SNH A;  4XTK A;  1ZHT A;  1J8Y F;  2CNW D;  2Q9C A;  4OD5 A;  5D91 A;  3K7D A;  4CIH A;  3L0I A;  3CSK A;  3EH1 A;  3MLG A;  4AX2 A;  3UNG C;  1TWH A;  3FVY A;  4Q7C A;  5DS4 A;  5B1A C;  3LNR A;  5T1D B;  1NZE A;  4I3M A;  4C7O B;  3EGD A;  3LS0 A;  4O79 A;  2XXA B;  4A2N B;  2QTV A;  4N06 A;  2Q9B A;  2OCC C;  2R7U A;  3F47 A;  5DQZ A;  3NKD A;  3B9Q A;  3E70 C;  3LEV A;  1M56 C;  4KNW A;  3W2W A;  2WL8 A;  3ZVR A;  4CS8 A;  3I5Q A;  3PMR A;  5IY5 C;  2DYS C;  2KW3 C;  2OG2 A;  5FCL A;  4BJ6 A;  2PX0 A;  2IXO A;  1MND A;  4CSA A;  2IOQ A;  4DOZ A;  3B0U X;  2IXP A;  3EZH A;  4DVY P;  1NU7 D;  4AK9 A;  4JW1 A;  3WG7 C;  2NUT B;  4CBE A;  4IAO A;  4O6N A;  3ABL C;  3SYN A;  2KGO A;  2WVQ A;  3DMD A;  4WJ0 A;  1D1C A;  4DVZ A;  4JUR I;  4XWJ A;  5KYY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...