1NZEA

Crystal structure of psbq polypeptide of photosystem ii from higher plants
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
112
structure length
112
Chain Sequence
FYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Oxygen-evolving enhancer protein 3
publication title Crystal structure of the PsbQ protein of photosystem II from higher plants
pubmed doi rcsb
total genus 43
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2003-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1nzeA00
3JCUQ 2MWQA 3ZSUA 1NZEA 3LS0A 3LS1A 3RFYA 1VYKA
chains in the Genus database with same CATH superfamily
2KK1A 4MS2A 1OKKA 3K1HA 4U5HA 2PBEA 2XLMA 2YVKA 4KNWA 3GM1A 4MVUA 4XEVA 1WGWA 3WODF 1JMWA 2XLOA 4N6HA 2TMVP 3MYIA 4L6RA 2YRFA 3DJNB 4U5GA 2VC9A 3PCVA 2ZXRA 4O6YA 5L0FA 1WATA 4B6IA 2R03A 1UFBA 4YL1A 2VASA 1MMGA 2KGOA 3G50A 3POVA 2R7WA 1YDIA 5FZTA 4CS8A 3GEEA 1FR0A 1T5OA 2KNHA 1FTSA 2C03A 2J0WA 2WVOA 3RW0A 5DS6A 3TQOA 2EIJC 1V55C 1Z7Qc 2YL1A 4ZLDA 3OEOA 3Q6MA 3RQGA 1RJ9A 3NRHA 4QI0A 1I4ZA 4BJTA 4EHPA 2NG1A 2AP3A 1Q0DA 1WTYA 4MQ9F 4ULVA 3LLIA 3ZIBA 1HMDA 4I44A 4JTCB 1VK5A 1AVOB 1V74B 4AX2A 3PDMP 4XLNF 1FMWA 3C62A 4DJ9A 5B3SC 4NTBA 1OCZC 3NG1A 5JUAA 3HKKA 2IBFA 4C3EA 3W2VA 5F5HA 3DE8A 2ZXWC 3M1CB 3UNGC 2YLIA 256BA 3ZDLA 5EGYA 1LI5A 4GQHA 1D1CA 3UGOA 5E2QA 3E9VA 1YA7O 2LP4A 3TOLA 3WHNA 5JS5A 2FFHA 1QQ3A 3BRJA 3FOPA 3B9QA 2V3CC 5KYWB 4DBQA 3ZWIA 1APCA 2XSEA 3MYFA 3TJ5A 2WL8A 4Z9IA 2OKUA 3S0XA 1OQCA 3JSEO 5T3WA 5L3QA 1FFHA 1Q0KA 4YL3A 2Q9CA 2VCCA 3AGTA 1Q0MA 3QZCA 3CQZA 4Q4ZF 4J32B 2J8WA 4K0DA 2OCCC 4G7OF 3W8HA 2IXOA 1G8XA 4XPWA 3UMHA 4E0HA 5DS4A 4J30B 1ST6A 2KYHA 4IB4A 2HS5A 2J9WA 4E7ZA 3RVZA 4JJGA 3LEVA 2R7VA 3EGXB 5JSLA 4JCZA 1HE9A 2ZXOA 4DBRA 2L9JA 3EQLF 1MMDA 2XLWA 2G62A 4A2NB 1XZQA 2A0BA 1H7IA 1B68A 3S27A 2M64A 3GEIA 4BJ5C 3QW0A 3TULA 1HE1A 3KL4A 4DRHB 2DB4A 2I8BA 3VAYA 2PX3A 2XLVA 4JTDB 2R7SA 2EPLX 3EZIA 1OXKA 4BEJA 1VTMP 1A7DA 1VOMA 1ZHTA 2C04A 3TD7A 1KU2A 1TFOB 3JTLO 5A6BA 1BDJB 2MHRA 2YQYA 4I3MA 2X51A 1CPQA 3IPMO 3ITFA 3V5YA 5KYXB 3C63A 3IHUA 3DAFA 4IAQA 1T01A 4OIPF 4P9FA 4YT8A 2YLDA 2G3KA 2VB6A 1HY5A 3AOUA 3Q7GA 2NUTA 1SYQA 3LESA 1OW7A 4PFOA 4JE9A 3V5ZA 2J9VA 3FAPB 1D1BA 3A11A 3IQTA 1UG7A 4I1MA 4CX9A 3K1IC 1Y6DA 2L6GA 3DE9A 4PJNA 3U8PA 5F5FA 1VLTA 3DMDA 3JT1A 5K0IA 1L7CA 3KYIA 2YWAA 2NUPA 4R32A 4ULWA 4MW3A 5L0DA 4QDLA 2D5RB 4C3BA 5B1AC 4JC7A 1RKEA 1D0YA 3DD7A 1MNEA 2NPUA 2YL3A 3L1MA 2J7PA 3O39A 4QI2A 3E70C 2L6HA 2R05A 3U5SA 4CIHA 5KYUB 3FHDA 4HEAJ 3SP1A 5CIVA 2QLAA 4JZAA 1TWCA 2GFHA 1A41A 4FAPB 5A69A 1GGQA 3S90A 2R7QA 2R02A 4JEBA 1BR4A 3C7JA 4EIYA 2XLHA 5IY5C 1ORJA 2W4BA 2R7TA 4JW1A 2ICWG 3FMSA 4FESA 3ABLC 1T9KA 3EH2A 3VF0A 4W8PA 3H2VA 4WABA 4CS9A 5L0IA 1HW1A 4LDQA 3T6BA 3KH2A 4OIQF 2Q9BA 2L7AA 4LDRA 3RQEA 1RMVA 2WVNA 4U5FE 2F22A 5DVWA 1RJ9B 1F1MA 2PFDA 1YARO 2Y3HA 5EK0A 3HNJA 1PV3A 4MVZA 4OINF 1MMNA 1EI7A 4D4NA 4EUKB 4XPXA 4Z9HA 2LQGA 2KQ9A 3ZTZA 1JAFA 2QE9A 4JVSA 1ZHZA 2XS1A 3MX3A 2UUIA 5D92A 3U8VA 4EBKA 1ZYRF 3EGDA 4U5CE 3KMIA 1NZEA 2XL8A 4YT4A 2DYRC 2LK4A 1C17M 2Y3GA 1YAUO 2JPUA 4K7BA 3V5XA 3GEHA 3J06A 5BQIA 2R7XA 4HE8D 1T6QA 1CPRA 4KC9A 2QUPA 3TK0A 4XEFA 3ZVRA 2IM8A 4DVYP 3KYJA 1T6IA 2MYSA 3ZSUA 4I1OB 3M4BA 4MW8A 4G7ZF 4AL0A 2H8AA 1I4YA 2A6EF 1R5ID 3LNRA 4NTAA 4MVQA 1RCPA 3G4ZA 3KPHA 2EPNA 2ASRA 1EA8A 2BE5F 1ZW3A 2Y39A 2Z15A 1E2XA 1HMOA 1BBHA 5L3VA 2GWWA 4YL0A 3HNIA 3HTKC 2HFIA 1WN0A 1FFTC 1J8MF 2LFFA 1OKKD 3VRCA 4G7HF 2FGYA 2A1DD 2YLGA 2VCAA 3ASNC 4A4AA 1AUEA 2J45A 1M57C 3EHMA 1NU7D 3RKOF 5AC4A 3C8ZA 3W4YA 4E18A 3IQ6A 4U5DE 1MQVA 1N1CA 3R7CA 1KTMA 3GANA 3VM6A 4K1OA 4MVMA 3EG9B 4LDKA 4PJMA 1NSGB 1OCRC 3OWTA 3NYLA 4HFKB 4IJJA 1C02A 4AE4A 1Z63A 1YYXA 3IQ5A 1S7ZA 2XLDA 2ZPAA 2LIGA 4G78A 5A6AA 4DVZA 1K04A 1FMVA 1M6TA 3FOOA 2DGJA 3OA1A 2ZD9A 3N0TA 1QVXA 4LLCA 2NUTB 2E87A 3SYNA 2HUJA 2OJED 2KC3A 2W9YA 3VYWA 3DM5A 1E84A 4C7OA 4X0RA 1Z23A 2VH3A 1Z3IX 3JRMO 3B29A 3EH1A 1NFOA 5L0CA 2Y3DA 1SZIA 3U9JA 4LACB 5KYYA 2L81A 2DI3A 2UUHA 3X2QC 2H7BA 3FAJA 2LSEA 1VLSA 1PCXA 3MFNA 1T6UA 2JD3A 3DM9B 5CI9A 1RKEB 1OCCC 4CSAC 4MVSA 2OEXA 5F28E 1O87A 3C18A 4WJ0A 4HFFB 3NYJA 4MVRA 4EBBA 5FCLA 5L0GA 1M2OA 3WAQA 2IXPA 1U6HA 4IWBA 1U89A 4BPMA 3JZ0A 2L6FA 4C3DA 4DOZA 4ER9A 4FWVA 2BL2A 5DQTA 2HMZA 3ZC4A 1W2WA 5T1DB 2GA0A 3CSKA 1OW6A 5DS5A 1YZCA 3U9MA 1LVKA 3AG1C 3W8IA 2Y3BA 3FDQA 4N4WA 3HNLA 3SEOA 2CNWA 5HSWA 1GQAA 4PACA 4WGYA 4IGGA 3GODA 4PJLA 4WGZA 4BJ6C 2LD6A 3GM3A 1VYKA 2GAQA 2ETSA 4NCQA 1H9GA 1G4WR 3RIPA 3S29A 2AWCA 2YHSA 1ZW2A 3NDBB 3AGUA 2R7UA 1OR2A 3CZ6A 4JCHA 4P9TA 3EFOB 4H54A 4MTGA 3MLGA 3A9CA 3PHF2 3AQCA 1L3PA 4IRUA 1AEPA 1OCOC 2J9UA 3EGDB 4JRZA 5CI8A 2R7RA 2BC5A 4EBJA 1QPUA 2I15A 3I5QA 1TR2A 1NBBA 3HNKA 3DXJF 2VCBA 3C8GA 1LIHA 3SXYA 3U2MA 3V7OA 5A6BD 3LS0A 3RFYA 4KBLA 1SF8A 3NMKA 5HV9A 3ABMC 3GORA 1JPJA 3JCUQ 1DOWA 1OXBA 5COGA 4BEMJ 3US6A 3S28A 3EZHA 4H4KC 4BJ5A 4IARA 3EGXA 4YT2A 1JPNA 3DI5A 2A6HF 1E86A 3L8JA 3U3BA 2PF4E 3Q6NA 5DLJA 1J8YF 2KW3C 3SXZA 1TWHA 3LEOA 2XXAA 3K7DA 4RDAA 1TQGA 3RVYA 3DKAA 3M4CA 3JYYA 4JKVA 4CS8C 1LKXA 4XTKA 3O55A 3NYMA 4JURI 2J7PD 1C03A 2QY9A 4EWCA 3EJNA 2EIMC 1BR2A 1FAPB 1YA9A 2B0JA 4JJFA 2W4MA 1ORSC 1CGOA 2AVKA 2Q00A 3QVYA 1PD0A 3H2UA 3K1IA 4GEHA 5TJ5E 4YJWA 1M2VA 3L8IA 2XL4A 5KYXA 3WG7C 1YYJA 1ZZPA 4MTOA 5AC5A 4M63A 4OD4A 1NFNA 5KYNA 1NU9C 1LPEA 1OW8A 3ATPA 5COMA 1G5ZA 3SZRA 3UMKA 3N2ZB 2FAPB 1ZHWA 4PJJA 4N06A 2WB7A 2EILC 4NTFA 1YZAA 1JOGA 2P6VA 5D91A 3T4RA 3AG2C 3TOMA 3K6BA 4AE4B 1M56C 3AJMA 3ASOC 3JYHA 2H7OA 2HSQA 1O5HA 2J46A 4AK9A 2HKVA 3I4UA 4AL1A 1GM5A 3Q7LA 4PK4A 4CDAA 2M4EA 1K05A 4BJ1A 1GS9A 2YKZA 4OD5A 2QNLA 3MBGA 2AWYA 5KYUA 2R7OA 5A6JA 3IQCA 3LUTB 1RKCA 2QTVA 2YL7A 4XWJA 3QTHA 5AGFA 4C7OB 1D1AA 1PD1A 4Z9JA 4E17A 4P6IC 5KYYB 1H9TA 3RH3A 1SMYF 2D4UA 1BR1A 1BZ4A 4ZLCA 1YJGA 2O9XA 3M15A 2HJ3A 3B71A 1WOLA 3DAGA 4O6MA 5L0HA 1K40A 4NC3A 3UR3C 4LLEA 1LI7A 2EPOA 1CGNA 4PFPA 3CEXA 1U0BB 4O7GA 4JTAB 3GWLA 4MTFA 4E0IA 3LJBA 2JX0A 1I5NA 1O3UA 3I5PA 4OIRF 3LNMB 1VYIA 4CIPA 4Q5SF 3FVYA 2WZLA 3QVZA 1LE2A 3L0IA 3T9OA 3UMIA 1R4TA 4KI2A 3UGPA 4NQFA 2J0XA 4IAOA 1TFKB 3SNHA 2GDCA 4U5EE 3SXMA 1Z5ZA 4O79A 1FNTc 4XLPF 1TWGA 3FXHA 2PP4A 2CYDA 1LE4A 3RQFA 2WZGA 1MNDA 3QW1A 5BUOA 1V4AA 2OEVA 1A0BA 1VB5A 5JRAA 1JRAA 3B0VC 5DQZA 2NUPB 4J7TA 2CDQA 4KNVA 2OU6A 4DRJB 1G4US 2G3VA 1IZMA 1ZU4A 1ZU5A 2XS8A 2RD9A 3K33A 3F47A 3HLZA 3B0PA 5E3CA 4NY3A 2J9BA 4U9DA 5JP7A 4XEKA 3X1OA 1LM3B 3C8GB 1DOVA 2PNOA 1ZHXA 1LS1A 4FX5A 5BQGA 1OR3A 2WVQA 4JIOA 4MNDA 5B1BC 1ZVZA 1EKYA 3DZAA 3ZTMA 4CDVA 2KSFA 2CW0F 1NLXA 5B3IA 3SXKA 2XM0A 3F46A 2LFDA 3JRTA 4UDVA 3NKEA 1YVIA 4J7YA 2Q3TA 3W2WA 3T6GB 1D0XA 4JEAA 1CGME 3DWWA 4YK5A 1XZPA 5E3AA 3NMJA 1ZHYA 2XXAB 3B0UX 3K66A 1WASA 3ZQYA 4CS9C 2EIKC 1EQ1A 4CBEA 5JLIA 2AU5A 1Z6AA 2IXNA 3T6JA 4Q7CA 5T3TA 2EINC 2IOQA 2XM4A 3L34A 4W8KA 5KYWA 1TWAA 3EG9A 2WZFA 2HJMA 2IXMA 4EKWA 2B0HA 3DJUB 2PX0A 2YEVA 4YN0B 4BG0A 1ORYA 3U2LA 4CDYA 1M2VB 2IYLD 4ANJA 3U0CA 2NSGA 2EPKX 3KKBA 4LERA 3LS1A 1KNYA 3M79A 4D4XA 1A7EA 2DYSC 4XQ1A 5GPGB 3S84A 4OIOF 1RXQA 2HZ8A 2OOCA 3GWNA 3QMKA 1IW7F 2LCHA 3CAXA 3RF3A 2CNWD 3ECSA 4CSAA 5JVEA 5BQHA 5EHHA 5JT4A 1HW2A 4PR9A 4O6NA 2XLEA 4G0HA 2Q7RA 4XPYA 4YWQA 1V54C 2CCYA 3N24A 2OQMA 1QLEC 1QKRA 1XWJA 1Y4CA 2P0NA 2RSEB 3AQBA 1TKNA 1YLMA 2V26A 3IEEA 4DRIB 3TJ6A 4F4BA 1D0ZA 5L0JA 3O10A 2HV7A 5COFA 3AG4C 1NG1A 2R25A 3G4XA 4CJGA 1VMAA 1Q0FA 3H65A 1QZXA 2YL0A 3RYLA 4DXWA 4BJ6A 2W45A 2A0UA 2MWQA 2HSBA 2HV6A 3NKDA 4ONSA 1JR8A 4RD9A 3C8GD 2HMQA 4RBNA 2X0CA 3S9OA 3ZQVA 1SR2A 1E83A 2R9RB 2Q4FA 2ZXPA 3HJCA 3NMIA 2CGEA 3U3FA 2YZSA 3EPVA 3PMRA 3R2PA 4U5BE 2OG2A 2P61A 2XRHA 3AG3C 3JSZA 1MMAA 2A68F 4E7SA 2Y69C 4CS7A 1LS4A 5E33A 3ABKC 1A7VA 1QSPA 3ZG1A 3LLKA 4YT5A 1H6GA 4CJOA 1S05A 2Q9AA 4MVOA 2P1AA 1E85A 2XL6A 2OJQA 2P7VA 3O6XA 5A6KA 3EHNA 1Q0GA 4GYTA 4U9EA 1WWPA 3EFOA 3BEHA 2NSFA 2A69F 2EPMX 2H7VC 2KJGA 3LAYA 3GM2A 4N6CA
chains in the Genus database with same CATH topology
1OKKA 3K1HA 4U5HA 4KNWA 1WGWA 3WODF 3DJNB 4U5GA 2ZXRA 4O6YA 4B6IA 2VASA 1MMGA 2KGOA 3POVA 2R7WA 4CS8A 2KNHA 1FTSA 2C03A 2J0WA 2WVOA 5DS6A 4ZLDA 2EIJC 1V55C 3OEOA 3Q6MA 4BJTA 1RJ9A 3NRHA 4QI0A 2NG1A 4MQ9F 3ZIBA 3LLIA 4I44A 1VK5A 4XLNF 1FMWA 5B3SC 1OCZC 3NG1A 4C3EA 3W2VA 5F5HA 2ZXWC 3M1CB 3UNGC 5EGYA 1D1CA 3UGOA 5E2QA 3E9VA 2FFHA 3B9QA 2V3CC 5KYWB 4DBQA 2XSEA 2WL8A 3S0XA 5T3WA 5L3QA 1FFHA 2Q9CA 3QZCA 3CQZA 4Q4ZF 4J32B 4K0DA 2OCCC 4G7OF 3W8HA 2IXOA 1G8XA 3UMHA 5DS4A 4J30B 1ST6A 2J9WA 4E7ZA 4JJGA 3LEVA 2R7VA 3EGXB 2ZXOA 4DBRA 2L9JA 3EQLF 1MMDA 2G62A 4A2NB 3S27A 4BJ5C 3KL4A 2I8BA 3VAYA 2PX3A 2R7SA 3EZIA 4BEJA 1VOMA 1ZHTA 2C04A 3TD7A 1KU2A 4I3MA 2X51A 3ITFA 5KYXB 3DAFA 4OIPF 4YT8A 2G3KA 2VB6A 3Q7GA 2NUTA 3LESA 4PFOA 4AX2A 5IY5C 2J9VA 1D1BA 4I1MA 3K1IC 4PJNA 5F5FA 3DMDA 3JT1A 2NUPA 4ULWA 4QDLA 2D5RB 4C3BA 5B1AC 1D0YA 3DD7A 1MNEA 2J7PA 3O39A 4QI2A 3E70C 4CIHA 5KYUB 3FHDA 4HEAJ 3SP1A 4JZAA 1TWCA 2GFHA 2R7QA 1BR4A 2W4BA 2R7TA 4JW1A 4FESA 3ABLC 3EH2A 4CS9A 3T6BA 3KH2A 4OIQF 2Q9BA 2WVNA 4U5FE 5DVWA 1RJ9B 2PFDA 2Y3HA 4OINF 1MMNA 2KQ9A 4JVSA 1ZHZA 3MX3A 5D92A 1ZYRF 3EGDA 4U5CE 3KMIA 1NZEA 4YT4A 2DYRC 2Y3GA 4K7BA 2R7XA 4HE8D 4KC9A 3ZVRA 4DVYP 2MYSA 3ZSUA 4I1OB 4G7ZF 2A6EF 3LNRA 3OA1A 2BE5F 2Z15A 4G0HA 2Y39A 5L3VA 3HTKC 1FFTC 1J8MF 4G7HF 1OKKD 2FGYA 2A1DD 3ASNC 2J45A 3EHMA 1M57C 1NU7D 3RKOF 4U5DE 1N1CA 3GANA 3EG9B 4PJMA 4IJJA 1OCRC 3OWTA 3NYLA 4HFKB 4AE4A 1Z63A 1S7ZA 2ZPAA 4DVZA 1FMVA 2DGJA 3SYNA 3N0TA 4LLCA 2NUTB 2E87A 2W9YA 3VYWA 3DM5A 4C7OA 4X0RA 1Z23A 2VH3A 1Z3IX 3EH1A 5KYYA 2Y3DA 1SZIA 4LACB 2L81A 3X2QC 2H7BA 3FAJA 2LSEA 1PCXA 2JD3A 3DM9B 5CI9A 1OCCC 4CSAC 1O87A 4WJ0A 4HFFB 3NYJA 4EBBA 5FCLA 1M2OA 2IXPA 4IWBA 4DOZA 4C3DA 4FWVA 5DQTA 3ZC4A 1W2WA 5T1DB 3CSKA 5DS5A 1LVKA 3AG1C 3W8IA 2Y3BA 3FDQA 3SEOA 2CNWA 5HSWA 4BJ6C 3GODA 4PJLA 1VYKA 3RIPA 3S29A 2YHSA 3NDBB 2R7UA 3CZ6A 4JCHA 3EFOB 3MLGA 3PHF2 3AQCA 5CI8A 4IRUA 1OCOC 2J9UA 3EGDB 2R7RA 3I5QA 1TR2A 3DXJF 3V7OA 3LS0A 3RFYA 1SF8A 3ABMC 1JPJA 3JCUQ 3S28A 3EZHA 4H4KC 4BJ5A 3EGXA 4YT2A 1JPNA 2A6HF 5DLJA 2PF4E 3Q6NA 1J8YF 2KW3C 1TWHA 2XXAA 3K7DA 4RDAA 4CS8C 1LKXA 4XTKA 3NYMA 4JURI 2J7PD 2QY9A 4EWCA 3EJNA 2EIMC 1BR2A 2B0JA 4JJFA 2W4MA 4GEHA 1PD0A 5KYXA 4YJWA 1M2VA 2XL4A 3WG7C 4M63A 4OD4A 5KYNA 1NU9C 3UMKA 3SZRA 3N2ZB 4PJJA 1ZHWA 4N06A 2WB7A 2EILC 2P6VA 5D91A 3T4RA 3AG2C 3K6BA 4AE4B 1M56C 3ASOC 3JYHA 2H7OA 2J46A 1O5HA 4AK9A 3I4UA 3Q7LA 4PK4A 2M4EA 4BJ1A 4OD5A 5KYUA 2R7OA 2QTVA 4XWJA 4C7OB 1D1AA 1PD1A 5KYYB 4P6IC 3RH3A 1SMYF 1BR1A 4ZLCA 2O9XA 3DAGA 4O6MA 3UR3C 4LLEA 4PFPA 4O7GA 3LJBA 3I5PA 4OIRF 1VYIA 4Q5SF 3FVYA 2WZLA 3L0IA 3UMIA 4KI2A 3UGPA 2J0XA 4IAOA 3SNHA 4U5EE 1Z5ZA 4O79A 4XLPF 1TWGA 2PP4A 2WZGA 1MNDA 5BUOA 3B0VC 5DQZA 2NUPB 2CDQA 4KNVA 2G3VA 1IZMA 1ZU4A 1ZU5A 3K33A 3F47A 3HLZA 3B0PA 5E3CA 4NY3A 3X1OA 1ZHXA 1LS1A 4FX5A 2WVQA 4MNDA 5B1BC 3DZAA 2CW0F 3F46A 3JRTA 3NKEA 2Q3TA 3W2WA 1D0XA 5E3AA 1ZHYA 2XXAB 3B0UX 3K66A 4CS9C 2EIKC 4CBEA 1Z6AA 2IXNA 3T6JA 4Q7CA 5T3TA 2EINC 2IOQA 3L34A 4W8KA 5KYWA 1TWAA 3EG9A 2WZFA 2IXMA 3DJUB 2PX0A 2YEVA 4YN0B 4BG0A 1M2VB 2IYLD 4ANJA 3KKBA 4LERA 3LS1A 2DYSC 4OIOF 3QMKA 1IW7F 2CNWD 3ECSA 4CSAA 5EHHA 4O6NA 4YWQA 1V54C 3N24A 1QLEC 3AQBA 3IEEA 1TKNA 2V26A 4F4BA 1D0ZA 2HV7A 3AG4C 1NG1A 1VMAA 3H65A 1QZXA 3RYLA 2W45A 2MWQA 2HV6A 4RD9A 3NKDA 4BJ6A 4RBNA 3HJCA 2ZXPA 2CGEA 2YZSA 3EPVA 3PMRA 4U5BE 2OG2A 2XRHA 3AG3C 3JSZA 1MMAA 2A68F 4E7SA 2Y69C 4CS7A 5E33A 3ABKC 3ZG1A 3LLKA 4YT5A 2Q9AA 2P7VA 3O6XA 3EHNA 4GYTA 3EFOA 3LAYA 2A69F 2KJGA 2H7VC 4KBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCU Q;  2MWQ A;  3ZSU A;  1NZE A;  3LS0 A;  3LS1 A;  3RFY A;  1VYK A; 
#chains in the Genus database with same CATH topology
 2KK1 A;  4MS2 A;  1OKK A;  3K1H A;  4U5H A;  2PBE A;  2XLM A;  2YVK A;  4KNW A;  3GM1 A;  4MVU A;  4XEV A;  1WGW A;  3WOD F;  1JMW A;  2XLO A;  4N6H A;  2TMV P;  3MYI A;  4L6R A;  2YRF A;  3DJN B;  4U5G A;  2VC9 A;  3PCV A;  2ZXR A;  4O6Y A;  5L0F A;  1WAT A;  4B6I A;  2R03 A;  1UFB A;  4YL1 A;  2VAS A;  1MMG A;  2KGO A;  3G50 A;  3POV A;  2R7W A;  1YDI A;  5FZT A;  4CS8 A;  3GEE A;  1FR0 A;  1T5O A;  2KNH A;  1FTS A;  2C03 A;  2J0W A;  2WVO A;  3RW0 A;  5DS6 A;  3TQO A;  2EIJ C;  1V55 C;  1Z7Q c;  2YL1 A;  4ZLD A;  3OEO A;  3Q6M A;  3RQG A;  1RJ9 A;  3NRH A;  4QI0 A;  1I4Z A;  4BJT A;  4EHP A;  2NG1 A;  2AP3 A;  1Q0D A;  1WTY A;  4MQ9 F;  4ULV A;  3LLI A;  3ZIB A;  1HMD A;  4I44 A;  4JTC B;  1VK5 A;  1AVO B;  1V74 B;  4AX2 A;  3PDM P;  4XLN F;  1FMW A;  3C62 A;  4DJ9 A;  5B3S C;  4NTB A;  1OCZ C;  3NG1 A;  5JUA A;  3HKK A;  2IBF A;  4C3E A;  3W2V A;  5F5H A;  3DE8 A;  2ZXW C;  3M1C B;  3UNG C;  2YLI A;  256B A;  3ZDL A;  5EGY A;  1LI5 A;  4GQH A;  1D1C A;  3UGO A;  5E2Q A;  3E9V A;  1YA7 O;  2LP4 A;  3TOL A;  3WHN A;  5JS5 A;  2FFH A;  1QQ3 A;  3BRJ A;  3FOP A;  3B9Q A;  2V3C C;  5KYW B;  4DBQ A;  3ZWI A;  1APC A;  2XSE A;  3MYF A;  3TJ5 A;  2WL8 A;  4Z9I A;  2OKU A;  3S0X A;  1OQC A;  3JSE O;  5T3W A;  5L3Q A;  1FFH A;  1Q0K A;  4YL3 A;  2Q9C A;  2VCC A;  3AGT A;  1Q0M A;  3QZC A;  3CQZ A;  4Q4Z F;  4J32 B;  2J8W A;  4K0D A;  2OCC C;  4G7O F;  3W8H A;  2IXO A;  1G8X A;  4XPW A;  3UMH A;  4E0H A;  5DS4 A;  4J30 B;  1ST6 A;  2KYH A;  4IB4 A;  2HS5 A;  2J9W A;  4E7Z A;  3RVZ A;  4JJG A;  3LEV A;  2R7V A;  3EGX B;  5JSL A;  4JCZ A;  1HE9 A;  2ZXO A;  4DBR A;  2L9J A;  3EQL F;  1MMD A;  2XLW A;  2G62 A;  4A2N B;  1XZQ A;  2A0B A;  1H7I A;  1B68 A;  3S27 A;  2M64 A;  3GEI A;  4BJ5 C;  3QW0 A;  3TUL A;  1HE1 A;  3KL4 A;  4DRH B;  2DB4 A;  2I8B A;  3VAY A;  2PX3 A;  2XLV A;  4JTD B;  2R7S A;  2EPL X;  3EZI A;  1OXK A;  4BEJ A;  1VTM P;  1A7D A;  1VOM A;  1ZHT A;  2C04 A;  3TD7 A;  1KU2 A;  1TFO B;  3JTL O;  5A6B A;  1BDJ B;  2MHR A;  2YQY A;  4I3M A;  2X51 A;  1CPQ A;  3IPM O;  3ITF A;  3V5Y A;  5KYX B;  3C63 A;  3IHU A;  3DAF A;  4IAQ A;  1T01 A;  4OIP F;  4P9F A;  4YT8 A;  2YLD A;  2G3K A;  2VB6 A;  1HY5 A;  3AOU A;  3Q7G A;  2NUT A;  1SYQ A;  3LES A;  1OW7 A;  4PFO A;  4JE9 A;  3V5Z A;  2J9V A;  3FAP B;  1D1B A;  3A11 A;  3IQT A;  1UG7 A;  4I1M A;  4CX9 A;  3K1I C;  1Y6D A;  2L6G A;  3DE9 A;  4PJN A;  3U8P A;  5F5F A;  1VLT A;  3DMD A;  3JT1 A;  5K0I A;  1L7C A;  3KYI A;  2YWA A;  2NUP A;  4R32 A;  4ULW A;  4MW3 A;  5L0D A;  4QDL A;  2D5R B;  4C3B A;  5B1A C;  4JC7 A;  1RKE A;  1D0Y A;  3DD7 A;  1MNE A;  2NPU A;  2YL3 A;  3L1M A;  2J7P A;  3O39 A;  4QI2 A;  3E70 C;  2L6H A;  2R05 A;  3U5S A;  4CIH A;  5KYU B;  3FHD A;  4HEA J;  3SP1 A;  5CIV A;  2QLA A;  4JZA A;  1TWC A;  2GFH A;  1A41 A;  4FAP B;  5A69 A;  1GGQ A;  3S90 A;  2R7Q A;  2R02 A;  4JEB A;  1BR4 A;  3C7J A;  4EIY A;  2XLH A;  5IY5 C;  1ORJ A;  2W4B A;  2R7T A;  4JW1 A;  2ICW G;  3FMS A;  4FES A;  3ABL C;  1T9K A;  3EH2 A;  3VF0 A;  4W8P A;  3H2V A;  4WAB A;  4CS9 A;  5L0I A;  1HW1 A;  4LDQ A;  3T6B A;  3KH2 A;  4OIQ F;  2Q9B A;  2L7A A;  4LDR A;  3RQE A;  1RMV A;  2WVN A;  4U5F E;  2F22 A;  5DVW A;  1RJ9 B;  1F1M A;  2PFD A;  1YAR O;  2Y3H A;  5EK0 A;  3HNJ A;  1PV3 A;  4MVZ A;  4OIN F;  1MMN A;  1EI7 A;  4D4N A;  4EUK B;  4XPX A;  4Z9H A;  2LQG A;  2KQ9 A;  3ZTZ A;  1JAF A;  2QE9 A;  4JVS A;  1ZHZ A;  2XS1 A;  3MX3 A;  2UUI A;  5D92 A;  3U8V A;  4EBK A;  1ZYR F;  3EGD A;  4U5C E;  3KMI A;  1NZE A;  2XL8 A;  4YT4 A;  2DYR C;  2LK4 A;  1C17 M;  2Y3G A;  1YAU O;  2JPU A;  4K7B A;  3V5X A;  3GEH A;  3J06 A;  5BQI A;  2R7X A;  4HE8 D;  1T6Q A;  1CPR A;  4KC9 A;  2QUP A;  3TK0 A;  4XEF A;  3ZVR A;  2IM8 A;  4DVY P;  3KYJ A;  1T6I A;  2MYS A;  3ZSU A;  4I1O B;  3M4B A;  4MW8 A;  4G7Z F;  4AL0 A;  2H8A A;  1I4Y A;  2A6E F;  1R5I D;  3LNR A;  4NTA A;  4MVQ A;  1RCP A;  3G4Z A;  3KPH A;  2EPN A;  2ASR A;  1EA8 A;  2BE5 F;  1ZW3 A;  2Y39 A;  2Z15 A;  1E2X A;  1HMO A;  1BBH A;  5L3V A;  2GWW A;  4YL0 A;  3HNI A;  3HTK C;  2HFI A;  1WN0 A;  1FFT C;  1J8M F;  2LFF A;  1OKK D;  3VRC A;  4G7H F;  2FGY A;  2A1D D;  2YLG A;  2VCA A;  3ASN C;  4A4A A;  1AUE A;  2J45 A;  1M57 C;  3EHM A;  1NU7 D;  3RKO F;  5AC4 A;  3C8Z A;  3W4Y A;  4E18 A;  3IQ6 A;  4U5D E;  1MQV A;  1N1C A;  3R7C A;  1KTM A;  3GAN A;  3VM6 A;  4K1O A;  4MVM A;  3EG9 B;  4LDK A;  4PJM A;  1NSG B;  1OCR C;  3OWT A;  3NYL A;  4HFK B;  4IJJ A;  1C02 A;  4AE4 A;  1Z63 A;  1YYX A;  3IQ5 A;  1S7Z A;  2XLD A;  2ZPA A;  2LIG A;  4G78 A;  5A6A A;  4DVZ A;  1K04 A;  1FMV A;  1M6T A;  3FOO A;  2DGJ A;  3OA1 A;  2ZD9 A;  3N0T A;  1QVX A;  4LLC A;  2NUT B;  2E87 A;  3SYN A;  2HUJ A;  2OJE D;  2KC3 A;  2W9Y A;  3VYW A;  3DM5 A;  1E84 A;  4C7O A;  4X0R A;  1Z23 A;  2VH3 A;  1Z3I X;  3JRM O;  3B29 A;  3EH1 A;  1NFO A;  5L0C A;  2Y3D A;  1SZI A;  3U9J A;  4LAC B;  5KYY A;  2L81 A;  2DI3 A;  2UUH A;  3X2Q C;  2H7B A;  3FAJ A;  2LSE A;  1VLS A;  1PCX A;  3MFN A;  1T6U A;  2JD3 A;  3DM9 B;  5CI9 A;  1RKE B;  1OCC C;  4CSA C;  4MVS A;  2OEX A;  5F28 E;  1O87 A;  3C18 A;  4WJ0 A;  4HFF B;  3NYJ A;  4MVR A;  4EBB A;  5FCL A;  5L0G A;  1M2O A;  3WAQ A;  2IXP A;  1U6H A;  4IWB A;  1U89 A;  4BPM A;  3JZ0 A;  2L6F A;  4C3D A;  4DOZ A;  4ER9 A;  4FWV A;  2BL2 A;  5DQT A;  2HMZ A;  3ZC4 A;  1W2W A;  5T1D B;  2GA0 A;  3CSK A;  1OW6 A;  5DS5 A;  1YZC A;  3U9M A;  1LVK A;  3AG1 C;  3W8I A;  2Y3B A;  3FDQ A;  4N4W A;  3HNL A;  3SEO A;  2CNW A;  5HSW A;  1GQA A;  4PAC A;  4WGY A;  4IGG A;  3GOD A;  4PJL A;  4WGZ A;  4BJ6 C;  2LD6 A;  3GM3 A;  1VYK A;  2GAQ A;  2ETS A;  4NCQ A;  1H9G A;  1G4W R;  3RIP A;  3S29 A;  2AWC A;  2YHS A;  1ZW2 A;  3NDB B;  3AGU A;  2R7U A;  1OR2 A;  3CZ6 A;  4JCH A;  4P9T A;  3EFO B;  4H54 A;  4MTG A;  3MLG A;  3A9C A;  3PHF 2;  3AQC A;  1L3P A;  4IRU A;  1AEP A;  1OCO C;  2J9U A;  3EGD B;  4JRZ A;  5CI8 A;  2R7R A;  2BC5 A;  4EBJ A;  1QPU A;  2I15 A;  3I5Q A;  1TR2 A;  1NBB A;  3HNK A;  3DXJ F;  2VCB A;  3C8G A;  1LIH A;  3SXY A;  3U2M A;  3V7O A;  5A6B D;  3LS0 A;  3RFY A;  4KBL A;  1SF8 A;  3NMK A;  5HV9 A;  3ABM C;  3GOR A;  1JPJ A;  3JCU Q;  1DOW A;  1OXB A;  5COG A;  4BEM J;  3US6 A;  3S28 A;  3EZH A;  4H4K C;  4BJ5 A;  4IAR A;  3EGX A;  4YT2 A;  1JPN A;  3DI5 A;  2A6H F;  1E86 A;  3L8J A;  3U3B A;  2PF4 E;  3Q6N A;  5DLJ A;  1J8Y F;  2KW3 C;  3SXZ A;  1TWH A;  3LEO A;  2XXA A;  3K7D A;  4RDA A;  1TQG A;  3RVY A;  3DKA A;  3M4C A;  3JYY A;  4JKV A;  4CS8 C;  1LKX A;  4XTK A;  3O55 A;  3NYM A;  4JUR I;  2J7P D;  1C03 A;  2QY9 A;  4EWC A;  3EJN A;  2EIM C;  1BR2 A;  1FAP B;  1YA9 A;  2B0J A;  4JJF A;  2W4M A;  1ORS C;  1CGO A;  2AVK A;  2Q00 A;  3QVY A;  1PD0 A;  3H2U A;  3K1I A;  4GEH A;  5TJ5 E;  4YJW A;  1M2V A;  3L8I A;  2XL4 A;  5KYX A;  3WG7 C;  1YYJ A;  1ZZP A;  4MTO A;  5AC5 A;  4M63 A;  4OD4 A;  1NFN A;  5KYN A;  1NU9 C;  1LPE A;  1OW8 A;  3ATP A;  5COM A;  1G5Z A;  3SZR A;  3UMK A;  3N2Z B;  2FAP B;  1ZHW A;  4PJJ A;  4N06 A;  2WB7 A;  2EIL C;  4NTF A;  1YZA A;  1JOG A;  2P6V A;  5D91 A;  3T4R A;  3AG2 C;  3TOM A;  3K6B A;  4AE4 B;  1M56 C;  3AJM A;  3ASO C;  3JYH A;  2H7O A;  2HSQ A;  1O5H A;  2J46 A;  4AK9 A;  2HKV A;  3I4U A;  4AL1 A;  1GM5 A;  3Q7L A;  4PK4 A;  4CDA A;  2M4E A;  1K05 A;  4BJ1 A;  1GS9 A;  2YKZ A;  4OD5 A;  2QNL A;  3MBG A;  2AWY A;  5KYU A;  2R7O A;  5A6J A;  3IQC A;  3LUT B;  1RKC A;  2QTV A;  2YL7 A;  4XWJ A;  3QTH A;  5AGF A;  4C7O B;  1D1A A;  1PD1 A;  4Z9J A;  4E17 A;  4P6I C;  5KYY B;  1H9T A;  3RH3 A;  1SMY F;  2D4U A;  1BR1 A;  1BZ4 A;  4ZLC A;  1YJG A;  2O9X A;  3M15 A;  2HJ3 A;  3B71 A;  1WOL A;  3DAG A;  4O6M A;  5L0H A;  1K40 A;  4NC3 A;  3UR3 C;  4LLE A;  1LI7 A;  2EPO A;  1CGN A;  4PFP A;  3CEX A;  1U0B B;  4O7G A;  4JTA B;  3GWL A;  4MTF A;  4E0I A;  3LJB A;  2JX0 A;  1I5N A;  1O3U A;  3I5P A;  4OIR F;  3LNM B;  1VYI A;  4CIP A;  4Q5S F;  3FVY A;  2WZL A;  3QVZ A;  1LE2 A;  3L0I A;  3T9O A;  3UMI A;  1R4T A;  4KI2 A;  3UGP A;  4NQF A;  2J0X A;  4IAO A;  1TFK B;  3SNH A;  2GDC A;  4U5E E;  3SXM A;  1Z5Z A;  4O79 A;  1FNT c;  4XLP F;  1TWG A;  3FXH A;  2PP4 A;  2CYD A;  1LE4 A;  3RQF A;  2WZG A;  1MND A;  3QW1 A;  5BUO A;  1V4A A;  2OEV A;  1A0B A;  1VB5 A;  5JRA A;  1JRA A;  3B0V C;  5DQZ A;  2NUP B;  4J7T A;  2CDQ A;  4KNV A;  2OU6 A;  4DRJ B;  1G4U S;  2G3V A;  1IZM A;  1ZU4 A;  1ZU5 A;  2XS8 A;  2RD9 A;  3K33 A;  3F47 A;  3HLZ A;  3B0P A;  5E3C A;  4NY3 A;  2J9B A;  4U9D A;  5JP7 A;  4XEK A;  3X1O A;  1LM3 B;  3C8G B;  1DOV A;  2PNO A;  1ZHX A;  1LS1 A;  4FX5 A;  5BQG A;  1OR3 A;  2WVQ A;  4JIO A;  4MND A;  5B1B C;  1ZVZ A;  1EKY A;  3DZA A;  3ZTM A;  4CDV A;  2KSF A;  2CW0 F;  1NLX A;  5B3I A;  3SXK A;  2XM0 A;  3F46 A;  2LFD A;  3JRT A;  4UDV A;  3NKE A;  1YVI A;  4J7Y A;  2Q3T A;  3W2W A;  3T6G B;  1D0X A;  4JEA A;  1CGM E;  3DWW A;  4YK5 A;  1XZP A;  5E3A A;  3NMJ A;  1ZHY A;  2XXA B;  3B0U X;  3K66 A;  1WAS A;  3ZQY A;  4CS9 C;  2EIK C;  1EQ1 A;  4CBE A;  5JLI A;  2AU5 A;  1Z6A A;  2IXN A;  3T6J A;  4Q7C A;  5T3T A;  2EIN C;  2IOQ A;  2XM4 A;  3L34 A;  4W8K A;  5KYW A;  1TWA A;  3EG9 A;  2WZF A;  2HJM A;  2IXM A;  4EKW A;  2B0H A;  3DJU B;  2PX0 A;  2YEV A;  4YN0 B;  4BG0 A;  1ORY A;  3U2L A;  4CDY A;  1M2V B;  2IYL D;  4ANJ A;  3U0C A;  2NSG A;  2EPK X;  3KKB A;  4LER A;  3LS1 A;  1KNY A;  3M79 A;  4D4X A;  1A7E A;  2DYS C;  4XQ1 A;  5GPG B;  3S84 A;  4OIO F;  1RXQ A;  2HZ8 A;  2OOC A;  3GWN A;  3QMK A;  1IW7 F;  2LCH A;  3CAX A;  3RF3 A;  2CNW D;  3ECS A;  4CSA A;  5JVE A;  5BQH A;  5EHH A;  5JT4 A;  1HW2 A;  4PR9 A;  4O6N A;  2XLE A;  4G0H A;  2Q7R A;  4XPY A;  4YWQ A;  1V54 C;  2CCY A;  3N24 A;  2OQM A;  1QLE C;  1QKR A;  1XWJ A;  1Y4C A;  2P0N A;  2RSE B;  3AQB A;  1TKN A;  1YLM A;  2V26 A;  3IEE A;  4DRI B;  3TJ6 A;  4F4B A;  1D0Z A;  5L0J A;  3O10 A;  2HV7 A;  5COF A;  3AG4 C;  1NG1 A;  2R25 A;  3G4X A;  4CJG A;  1VMA A;  1Q0F A;  3H65 A;  1QZX A;  2YL0 A;  3RYL A;  4DXW A;  4BJ6 A;  2W45 A;  2A0U A;  2MWQ A;  2HSB A;  2HV6 A;  3NKD A;  4ONS A;  1JR8 A;  4RD9 A;  3C8G D;  2HMQ A;  4RBN A;  2X0C A;  3S9O A;  3ZQV A;  1SR2 A;  1E83 A;  2R9R B;  2Q4F A;  2ZXP A;  3HJC A;  3NMI A;  2CGE A;  3U3F A;  2YZS A;  3EPV A;  3PMR A;  3R2P A;  4U5B E;  2OG2 A;  2P61 A;  2XRH A;  3AG3 C;  3JSZ A;  1MMA A;  2A68 F;  4E7S A;  2Y69 C;  4CS7 A;  1LS4 A;  5E33 A;  3ABK C;  1A7V A;  1QSP A;  3ZG1 A;  3LLK A;  4YT5 A;  1H6G A;  4CJO A;  1S05 A;  2Q9A A;  4MVO A;  2P1A A;  1E85 A;  2XL6 A;  2OJQ A;  2P7V A;  3O6X A;  5A6K A;  3EHN A;  1Q0G A;  4GYT A;  4U9E A;  1WWP A;  3EFO A;  3BEH A;  2NSF A;  2A69 F;  2EPM X;  2H7V C;  2KJG A;  3LAY A;  3GM2 A;  4N6C A; 
#chains in the Genus database with same CATH homology
 1OKK A;  3K1H A;  4U5H A;  4KNW A;  1WGW A;  3WOD F;  3DJN B;  4U5G A;  2ZXR A;  4O6Y A;  4B6I A;  2VAS A;  1MMG A;  2KGO A;  3POV A;  2R7W A;  4CS8 A;  2KNH A;  1FTS A;  2C03 A;  2J0W A;  2WVO A;  5DS6 A;  4ZLD A;  2EIJ C;  1V55 C;  3OEO A;  3Q6M A;  4BJT A;  1RJ9 A;  3NRH A;  4QI0 A;  2NG1 A;  4MQ9 F;  3ZIB A;  3LLI A;  4I44 A;  1VK5 A;  4XLN F;  1FMW A;  5B3S C;  1OCZ C;  3NG1 A;  4C3E A;  3W2V A;  5F5H A;  2ZXW C;  3M1C B;  3UNG C;  5EGY A;  1D1C A;  3UGO A;  5E2Q A;  3E9V A;  2FFH A;  3B9Q A;  2V3C C;  5KYW B;  4DBQ A;  2XSE A;  2WL8 A;  3S0X A;  5T3W A;  5L3Q A;  1FFH A;  2Q9C A;  3QZC A;  3CQZ A;  4Q4Z F;  4J32 B;  4K0D A;  2OCC C;  4G7O F;  3W8H A;  2IXO A;  1G8X A;  3UMH A;  5DS4 A;  4J30 B;  1ST6 A;  2J9W A;  4E7Z A;  4JJG A;  3LEV A;  2R7V A;  3EGX B;  2ZXO A;  4DBR A;  2L9J A;  3EQL F;  1MMD A;  2G62 A;  4A2N B;  3S27 A;  4BJ5 C;  3KL4 A;  2I8B A;  3VAY A;  2PX3 A;  2R7S A;  3EZI A;  4BEJ A;  1VOM A;  1ZHT A;  2C04 A;  3TD7 A;  1KU2 A;  4I3M A;  2X51 A;  3ITF A;  5KYX B;  3DAF A;  4OIP F;  4YT8 A;  2G3K A;  2VB6 A;  3Q7G A;  2NUT A;  3LES A;  4PFO A;  4AX2 A;  5IY5 C;  2J9V A;  1D1B A;  4I1M A;  3K1I C;  4PJN A;  5F5F A;  3DMD A;  3JT1 A;  2NUP A;  4ULW A;  4QDL A;  2D5R B;  4C3B A;  5B1A C;  1D0Y A;  3DD7 A;  1MNE A;  2J7P A;  3O39 A;  4QI2 A;  3E70 C;  4CIH A;  5KYU B;  3FHD A;  4HEA J;  3SP1 A;  4JZA A;  1TWC A;  2GFH A;  2R7Q A;  1BR4 A;  2W4B A;  2R7T A;  4JW1 A;  4FES A;  3ABL C;  3EH2 A;  4CS9 A;  3T6B A;  3KH2 A;  4OIQ F;  2Q9B A;  2WVN A;  4U5F E;  5DVW A;  1RJ9 B;  2PFD A;  2Y3H A;  4OIN F;  1MMN A;  2KQ9 A;  4JVS A;  1ZHZ A;  3MX3 A;  5D92 A;  1ZYR F;  3EGD A;  4U5C E;  3KMI A;  1NZE A;  4YT4 A;  2DYR C;  2Y3G A;  4K7B A;  2R7X A;  4HE8 D;  4KC9 A;  3ZVR A;  4DVY P;  2MYS A;  3ZSU A;  4I1O B;  4G7Z F;  2A6E F;  3LNR A;  3OA1 A;  2BE5 F;  2Z15 A;  4G0H A;  2Y39 A;  5L3V A;  3HTK C;  1FFT C;  1J8M F;  4G7H F;  1OKK D;  2FGY A;  2A1D D;  3ASN C;  2J45 A;  3EHM A;  1M57 C;  1NU7 D;  3RKO F;  4U5D E;  1N1C A;  3GAN A;  3EG9 B;  4PJM A;  4IJJ A;  1OCR C;  3OWT A;  3NYL A;  4HFK B;  4AE4 A;  1Z63 A;  1S7Z A;  2ZPA A;  4DVZ A;  1FMV A;  2DGJ A;  3SYN A;  3N0T A;  4LLC A;  2NUT B;  2E87 A;  2W9Y A;  3VYW A;  3DM5 A;  4C7O A;  4X0R A;  1Z23 A;  2VH3 A;  1Z3I X;  3EH1 A;  5KYY A;  2Y3D A;  1SZI A;  4LAC B;  2L81 A;  3X2Q C;  2H7B A;  3FAJ A;  2LSE A;  1PCX A;  2JD3 A;  3DM9 B;  5CI9 A;  1OCC C;  4CSA C;  1O87 A;  4WJ0 A;  4HFF B;  3NYJ A;  4EBB A;  5FCL A;  1M2O A;  2IXP A;  4IWB A;  4DOZ A;  4C3D A;  4FWV A;  5DQT A;  3ZC4 A;  1W2W A;  5T1D B;  3CSK A;  5DS5 A;  1LVK A;  3AG1 C;  3W8I A;  2Y3B A;  3FDQ A;  3SEO A;  2CNW A;  5HSW A;  4BJ6 C;  3GOD A;  4PJL A;  1VYK A;  3RIP A;  3S29 A;  2YHS A;  3NDB B;  2R7U A;  3CZ6 A;  4JCH A;  3EFO B;  3MLG A;  3PHF 2;  3AQC A;  5CI8 A;  4IRU A;  1OCO C;  2J9U A;  3EGD B;  2R7R A;  3I5Q A;  1TR2 A;  3DXJ F;  3V7O A;  3LS0 A;  3RFY A;  1SF8 A;  3ABM C;  1JPJ A;  3JCU Q;  3S28 A;  3EZH A;  4H4K C;  4BJ5 A;  3EGX A;  4YT2 A;  1JPN A;  2A6H F;  5DLJ A;  2PF4 E;  3Q6N A;  1J8Y F;  2KW3 C;  1TWH A;  2XXA A;  3K7D A;  4RDA A;  4CS8 C;  1LKX A;  4XTK A;  3NYM A;  4JUR I;  2J7P D;  2QY9 A;  4EWC A;  3EJN A;  2EIM C;  1BR2 A;  2B0J A;  4JJF A;  2W4M A;  4GEH A;  1PD0 A;  5KYX A;  4YJW A;  1M2V A;  2XL4 A;  3WG7 C;  4M63 A;  4OD4 A;  5KYN A;  1NU9 C;  3UMK A;  3SZR A;  3N2Z B;  4PJJ A;  1ZHW A;  4N06 A;  2WB7 A;  2EIL C;  2P6V A;  5D91 A;  3T4R A;  3AG2 C;  3K6B A;  4AE4 B;  1M56 C;  3ASO C;  3JYH A;  2H7O A;  2J46 A;  1O5H A;  4AK9 A;  3I4U A;  3Q7L A;  4PK4 A;  2M4E A;  4BJ1 A;  4OD5 A;  5KYU A;  2R7O A;  2QTV A;  4XWJ A;  4C7O B;  1D1A A;  1PD1 A;  5KYY B;  4P6I C;  3RH3 A;  1SMY F;  1BR1 A;  4ZLC A;  2O9X A;  3DAG A;  4O6M A;  3UR3 C;  4LLE A;  4PFP A;  4O7G A;  3LJB A;  3I5P A;  4OIR F;  1VYI A;  4Q5S F;  3FVY A;  2WZL A;  3L0I A;  3UMI A;  4KI2 A;  3UGP A;  2J0X A;  4IAO A;  3SNH A;  4U5E E;  1Z5Z A;  4O79 A;  4XLP F;  1TWG A;  2PP4 A;  2WZG A;  1MND A;  5BUO A;  3B0V C;  5DQZ A;  2NUP B;  2CDQ A;  4KNV A;  2G3V A;  1IZM A;  1ZU4 A;  1ZU5 A;  3K33 A;  3F47 A;  3HLZ A;  3B0P A;  5E3C A;  4NY3 A;  3X1O A;  1ZHX A;  1LS1 A;  4FX5 A;  2WVQ A;  4MND A;  5B1B C;  3DZA A;  2CW0 F;  3F46 A;  3JRT A;  3NKE A;  2Q3T A;  3W2W A;  1D0X A;  5E3A A;  1ZHY A;  2XXA B;  3B0U X;  3K66 A;  4CS9 C;  2EIK C;  4CBE A;  1Z6A A;  2IXN A;  3T6J A;  4Q7C A;  5T3T A;  2EIN C;  2IOQ A;  3L34 A;  4W8K A;  5KYW A;  1TWA A;  3EG9 A;  2WZF A;  2IXM A;  3DJU B;  2PX0 A;  2YEV A;  4YN0 B;  4BG0 A;  1M2V B;  2IYL D;  4ANJ A;  3KKB A;  4LER A;  3LS1 A;  2DYS C;  4OIO F;  3QMK A;  1IW7 F;  2CNW D;  3ECS A;  4CSA A;  5EHH A;  4O6N A;  4YWQ A;  1V54 C;  3N24 A;  1QLE C;  3AQB A;  3IEE A;  1TKN A;  2V26 A;  4F4B A;  1D0Z A;  2HV7 A;  3AG4 C;  1NG1 A;  1VMA A;  3H65 A;  1QZX A;  3RYL A;  2W45 A;  2MWQ A;  2HV6 A;  4RD9 A;  3NKD A;  4BJ6 A;  4RBN A;  3HJC A;  2ZXP A;  2CGE A;  2YZS A;  3EPV A;  3PMR A;  4U5B E;  2OG2 A;  2XRH A;  3AG3 C;  3JSZ A;  1MMA A;  2A68 F;  4E7S A;  2Y69 C;  4CS7 A;  5E33 A;  3ABK C;  3ZG1 A;  3LLK A;  4YT5 A;  2Q9A A;  2P7V A;  3O6X A;  3EHN A;  4GYT A;  3EFO A;  3LAY A;  2A69 F;  2KJG A;  2H7V C;  4KBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...