1NZEA

Crystal structure of psbq polypeptide of photosystem ii from higher plants
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
112
structure length
112
Chain Sequence
FYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxygen-evolving enhancer protein 3
publication title Crystal structure of the PsbQ protein of photosystem II from higher plants
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 43
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2003-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1nzeA00
2MWQA 3RFYA 3ZSUA 1NZEA 3LS0A 1VYKA 3LS1A 3JCUQ
chains in the Genus database with same CATH superfamily
1VMAA 4JTCB 3E70C 2AVKA 2XLMA 1WOLA 2XS8A 4ER9A 1WATA 4U5FE 2Y3BA 1TQGA 1J8YF 2L81A 2PNOA 3I5QA 1U0BB 1Q0MA 1RMVA 3K7DA 4E0HA 4JKVA 1JRAA 3UR3C 2CDQA 4YT2A 1LS1A 2OJQA 3ZQYA 2YL7A 5AC5A 4P9TA 4PACA 2HSBA 1M2OA 3JSZA 3FXHA 5L0FA 1OKKA 2ZXOA 2KK1A 3L8JA 1QQ3A 2Q9BA 4CDAA 2KYHA 4Q7CA 3AG1C 5E3AA 3U2LA 4E0IA 2YL1A 4XPWA 5DS4A 4D4XA 2R7QA 3U3BA 1FMVA 1OXBA 1JAFA 3JT1A 4O6MA 1YVIA 3IQCA 4CS8A 4DVYP 5A6BA 1Z7Qc 4YK5A 2R03A 1T6QA 2OQMA 3GM1A 5A69A 3AG3C 1S05A 3M79A 3W4YA 2R7OA 5KYWB 1QZXA 2OG2A 2YQYA 1ORYA 4Z9IA 4YT5A 3WAQA 3NMIA 4WGZA 2XL8A 2BC5A 5JLIA 1EKYA 1RCPA 3FHDA 1IW7F 3DI5A 3ATPA 3S28A 2W4BA 1HE9A 3SXKA 1MNDA 1TWAA 2KGOA 5KYUB 5KYUA 1OR3A 3GEHA 3IPMO 4YT4A 3POVA 4HE8D 5KYXB 2WVQA 3LLIA 5L0DA 5KYXA 2Y39A 2J9VA 5EHHA 2J9UA 1V54C 3EFOB 2EPOA 3ASNC 1E86A 1V74B 3JYHA 3V7OA 1EQ1A 3RVYA 4MW3A 4KBLA 2HMZA 3I5PA 2Y3GA 2A0UA 5HV9A 4LDRA 1VOMA 2YRFA 1E83A 2C04A 1A0BA 1Q0KA 2DB4A 1YJGA 2D5RB 2L9JA 3CAXA 3CSKA 4IAQA 2JX0A 4AK9A 3C8GD 4JEAA 2WB7A 4MTGA 3SYNA 1ZHWA 3K33A 5KYNA 1YZCA 3EGXA 1KNYA 2RSEB 3K1IC 4WABA 4XWJA 5COMA 1OCOC 5FZTA 2W9YA 4NCQA 3FAPB 3S90A 3DMDA 1C02A 2LSEA 2EPKX 2OOCA 4JURI 2H7OA 3RQEA 3TJ6A 3NMKA 2YHSA 1RJ9B 2WVNA 2L6GA 2PFDA 3EG9B 3HNJA 1AEPA 2C03A 3EG9A 3M1CB 4MS2A 4U5BE 3U3FA 3UMIA 2WZGA 4EWCA 3FDQA 1Z23A 2XLWA 2BE5F 3N0TA 1A7VA 3X1OA 1T6IA 3HTKC 2CYDA 256BA 3GWLA 3IQ6A 4MNDA 1ZU5A 4JRZA 1KTMA 5T3TA 3SP1A 3DM5A 3FAJA 1PV3A 4XTKA 4AL0A 2DI3A 4J32B 2IXOA 1RKEB 4G7ZF 5JS5A 2R25A 1RKEA 1YDIA 4G0HA 1VYIA 2YLDA 1AVOB 4DRHB 2V3CC 3B9QA 1V4AA 2IM8A 2J8WA 4MVOA 1F1MA 4K7BA 5KYYA 4OIPF 2HFIA 2JPUA 2GDCA 1BR1A 2NUTA 3RW0A 2YLGA 4BJ6C 5L3VA 5JP7A 3EH2A 1JR8A 1LE2A 3N24A 2GFHA 3TQOA 4PJNA 4JE9A 4U9DA 3MYFA 5FCLA 4N6CA 3IQTA 2V26A 3H2VA 1E85A 2PX0A 2HJ3A 2L6FA 5T3WA 3JZ0A 2WVOA 3KYIA 3ZSUA 2A6HF 2LFDA 4MW8A 1JPJA 1N1CA 1ZU4A 2QY9A 4Z9HA 3ZWIA 1H7IA 2HJMA 3EZHA 3ASOC 1Z6AA 1Z63A 2UUHA 3VYWA 3IQ5A 3A9CA 3KH2A 2XLHA 4PFPA 4PJJA 2KSFA 1GGQA 2EIMC 2HV7A 2VCAA 3UGPA 2AWCA 2PP4A 4XPYA 3GANA 3PMRA 4CS7A 5F28E 2OU6A 1A41A 2NUPB 2X51A 2XLDA 2HS5A 2VH3A 2MYSA 2NUPA 1MMDA 5AGFA 2WZLA 2QE9A 2Q4FA 2L6HA 5COFA 3O39A 4BJ1A 1OCRC 1TWHA 5B3IA 2XXAB 2OCCC 3RQGA 2XXAA 4JJFA 3MFNA 2GAQA 1ORJA 1TWGA 1BR2A 2VCBA 1C03A 4JEBA 1FR0A 4NTBA 1S7ZA 2W4MA 4LDKA 3HKKA 1M56C 3WODF 1I5NA 3L1MA 4HFKB 4CDVA 3S0XA 2J9BA 4Z9JA 3DD7A 3JRMO 2VCCA 3A11A 4KNVA 4O6NA 1GM5A 1LKXA 3ABKC 2YVKA 3DAFA 3HJCA 3K1IA 5A6AA 5BQGA 5E2QA 1SYQA 2P0NA 3K6BA 1D0XA 1O87A 2M4EA 2ZXRA 4LACB 5CI9A 4DRJB 5CIVA 5KYWA 2CGEA 3JCUQ 1E2XA 4YJWA 4YN0B 5JRAA 3ZC4A 2YL3A 3ABMC 1NBBA 4YL0A 3GM3A 2OJED 4O6YA 4YL3A 1JPNA 2PF4E 2EILC 2GA0A 3DXJF 4E7ZA 1H9GA 5JSLA 3VM6A 3F46A 3AG2C 2Q7RA 4E7SA 5EGYA 1W2WA 1U89A 5AC4A 3SZRA 3U5SA 1G4US 1HMDA 3EZIA 1A7DA 1G5ZA 1L3PA 1WGWA 1ZHZA 2KC3A 3ITFA 4HEAJ 2B0JA 3JYYA 3NMJA 4K1OA 3X2QC 3DJUB 3CZ6A 4CS9C 2Y3DA 3NYJA 4MVRA 3US6A 2L7AA 2P61A 1OW8A 1R4TA 3WHNA 2YLIA 1CGOA 4IWBA 4BJ6A 3RYLA 2R7VA 2HKVA 1ST6A 3DZAA 1BR4A 2CW0F 3G4XA 3T9OA 4NY3A 2YZSA 3EH1A 4XPXA 4CSAC 2R05A 4ANJA 4RBNA 1MMGA 3AJMA 1SF8A 1J8MF 3KL4A 4U5EE 3TK0A 1WN0A 1YA9A 1O3UA 2A1DD 1OQCA 2JD3A 1D1BA 1NLXA 3GEIA 1FAPB 3NG1A 3EHMA 4IARA 2YEVA 1D1AA 3LNRA 1K40A 3ABLC 1ZHYA 2KNHA 3Q7LA 2FFHA 2XM0A 4IRUA 3W2WA 3ZTMA 3NDBB 2LFFA 1V55C 1SZIA 3U9MA 3T6JA 1GQAA 3EJNA 3GODA 2XL6A 4RD9A 1I4YA 1TFKB 2XLOA 1M6TA 5A6KA 3GWNA 1EI7A 1NG1A 4FESA 4GQHA 4EBJA 1Z5ZA 4PJLA 2QNLA 3S29A 3TD7A 2EPLX 5GPGB 3C18A 2IBFA 1ZZPA 1FTSA 3EGXB 1YAUO 4DBRA 4OIOF 1T6UA 2F22A 2KW3C 3W2VA 1CPRA 1MMNA 4H4KC 3DM9B 3CQZA 1FFHA 2R7RA 4DBQA 3M4CA 3RF3A 1NU7D 2KJGA 1XWJA 2AWYA 3SXYA 4XEVA 5L0GA 4H54A 4G7HF 2DYRC 1LIHA 3B0PA 1PD1A 2EIJC 4C7OA 1Q0FA 2H7BA 3LS0A 1VK5A 5L0IA 1XZQA 3KKBA 4XLPF 1RKCA 2A68F 2ZXWC 1OCZC 1K05A 2A6EF 1M2VA 2J0WA 4U5GA 3U8VA 4C3BA 2HUJA 4I3MA 4KNWA 3W8HA 2W45A 4IB4A 4LERA 3OEOA 3DJNB 2J7PD 3UGOA 4XQ1A 1FFTC 1DOWA 2H7VC 1LS4A 3N2ZB 5KYYB 2HMQA 1A7EA 2NUTB 2QUPA 2HSQA 3NYMA 4W8PA 1PCXA 3TJ5A 3EGDA 1VLTA 4CDYA 4ULWA 1YARO 2XLVA 2Q9AA 3VF0A 4NQFA 2XM4A 1SMYF 3PDMP 1R5ID 1WASA 2WL8A 4CS9A 4MVQA 2G62A 4GEHA 1Y6DA 4JCHA 3S84A 5D92A 4MQ9F 4BG0A 1FNTc 1CGME 1ORSC 5L0HA 1NFNA 2PX3A 3QTHA 3U8PA 4U5HA 2UUIA 3Q6NA 3RIPA 4CSAA 4JIOA 2J9WA 1QVXA 1D0ZA 4JZAA 4QI2A 1ZYRF 2CNWD 3LEVA 2LK4A 1BBHA 3FOPA 4MTFA 3JSEO 4ULVA 3O6XA 3R7CA 3RKOF 4BEMJ 2NSFA 4CJOA 4OIRF 3JRTA 2R02A 3GM2A 5K0IA 3U9JA 1MQVA 4A2NB 4BJ5C 4ONSA 4AE4A 4NTFA 5A6JA 1ZW3A 4JVSA 4IAOA 5HSWA 2LCHA 2NSGA 3GORA 3NKDA 2PBEA 4IJJA 4MVMA 3J06A 4I44A 3H65A 2E87A 2HV6A 3EHNA 2AP3A 5L0CA 5JT4A 3OA1A 1PD0A 3AQBA 3U2MA 3C8GB 3RVZA 3ZVRA 5F5HA 3AG4C 3C8GA 4B6IA 3V5YA 3TULA 2BL2A 3AOUA 5B1AC 1LVKA 1ZHXA 2Z15A 4BJTA 2IXNA 4BPMA 3HNLA 4OIQF 2FGYA 1LI5A 1VB5A 1OW7A 3MBGA 5EK0A 2MHRA 1Q0DA 4DXWA 3NKEA 2VB6A 2VC9A 1ZVZA 2DYSC 5DQZA 2AU5A 2IXMA 3LAYA 4MTOA 1MNEA 2R9RB 5T1DB 2EPMX 3K66A 2NG1A 3VRCA 1OW6A 1RXQA 4PFOA 4N06A 4DRIB 2B0HA 2P1AA 1YZAA 3L0IA 4I1MA 1AUEA 1OCCC 1Q0GA 1VTMP 2Q00A 2CCYA 3JTLO 2G3KA 1O5HA 2A0BA 3HNIA 4O79A 1APCA 1NU9C 1OR2A 1SR2A 2IYLD 2ZD9A 3FMSA 5DVWA 4CBEA 1LPEA 4K0DA 3W8IA 1VYKA 2LIGA 4L6RA 2G3VA 3MLGA 4YT8A 2O9XA 2Q9CA 4G78A 4U9EA 2J7PA 4OD4A 4A4AA 1YYJA 3S27A 3G50A 3EQLF 1WWPA 4EBKA 4DOZA 2M64A 3T6BA 2LQGA 5E33A 1IZMA 2H8AA 5DS6A 5IY5C 1G4WR 1CGNA 1TFOB 3S9OA 3ZTZA 3SXMA 4AX2A 3H2UA 2I15A 2Y69C 1TKNA 3ZDLA 3QMKA 3FVYA 5L3QA 1H9TA 2HZ8A 1H6GA 3DWWA 4OD5A 1MMAA 4LLEA 3G4ZA 2FAPB 3DE9A 5COGA 1DOVA 3V5XA 3OWTA 1LM3B 4LLCA 2IOQA 5F5FA 4FX5A 4FWVA 3LESA 4JCZA 4C3DA 4HFFB 4CIHA 1TWCA 1NSGB 1D0YA 4R32A 3SEOA 2CNWA 4CJGA 3SXZA 3NRHA 4C3EA 3HNKA 4BJ5A 4EIYA 3B29A 4PK4A 4P6IC 3AQCA 5DS5A 4N6HA 4ZLDA 1GS9A 2X0CA 5L0JA 3I4UA 4JTDB 4JTAB 3O10A 3QVZA 4EKWA 3LNMB 1D1CA 1HW2A 2VASA 5BQIA 3M15A 1BZ4A 2Q3TA 3E9VA 3EFOA 3VAYA 2EIKC 3BEHA 3CEXA 3T6GB 4C7OB 5B1BC 4GYTA 4KI2A 2KQ9A 5D91A 4N4WA 3Q6MA 3QW0A 4QDLA 2XS1A 4I1OB 1LE4A 1M2VB 1OXKA 2XRHA 3DAGA 4M63A 3UNGC 2I8BA 1E84A 3PHF2 2J45A 3KMIA 1QPUA 2ZXPA 4KC9A 3B0VC 3F47A 3SNHA 1QSPA 2XLEA 3O55A 1TR2A 3NYLA 2R7TA 4MVZA 1T9KA 3U0CA 4F4BA 1K04A 1JMWA 2R7SA 4LDQA 4JC7A 3ZIBA 4E18A 3B0UX 1M57C 3ZQVA 3KPHA 3QVYA 2EINC 2OEVA 1RJ9A 2MWQA 3EGDB 1NZEA 3UMHA 1EA8A 1OKKD 2J0XA 3L8IA 1UG7A 1YLMA 2IXPA 3GEEA 3LJBA 4X0RA 3T4RA 5E3CA 2D4UA 1U6HA 3K1HA 4ZLCA 4MVSA 4CX9A 1QLEC 1I4ZA 1HMOA 2EPNA 4W8KA 4NC3A 2ZPAA 1JOGA 4U5DE 5A6BD 1ZHTA 4MVUA 3IHUA 2ICWG 2NPUA 3AGUA 3ECSA 1HY5A 5BUOA 2LP4A 4XEKA 5CI8A 3RFYA 3HLZA 5DQTA 2ASRA 1NFOA 4CS8C 2R7UA 1VLSA 4YL1A 1XZPA 4XEFA 2DGJA 4PR9A 4G7OF 3FOOA 2ETSA 3BRJA 2XL4A 3RQFA 5B3SC 4J7YA 4DVZA 1Z3IX 2J46A 4O7GA 1FMWA 4JW1A 2R7WA 2OEXA 4DJ9A 3KYJA 1C17M 4XLNF 3Q7GA 3MX3A 1B68A 4U5CE 4J7TA 4WJ0A 4WGYA 4EHPA 4CIPA 2TMVP 1G8XA 2QLAA 4AE4B 4Q5SF 3PCVA 1UFBA 1YYXA 1Y4CA 1ZW2A 2YWAA 3LEOA 2QTVA 3LUTB 3WG7C 1CPQA 3R2PA 4NTAA 4PJMA 3L34A 4P9FA 1YA7O 1T5OA 2RD9A 2YL0A 5TJ5E 2LD6A 3C62A 2YKZA 2P7VA 1T01A 3AGTA 4J30B 4D4NA 3MYIA 3LLKA 3TOLA 1QKRA 4IGGA 4EUKB 5JUAA 3ZG1A 4BEJA 2OKUA 1BDJB 3RH3A 4FAPB 1KU2A 5JVEA 3QW1A 1HE1A 4E17A 3B71A 3DKAA 4Q4ZF 4OINF 4YWQA 3C7JA 2WZFA 2Y3HA 5DLJA 4JJGA 1WTYA 1LI7A 4RDAA 5BQHA 3IEEA 3UMKA 2GWWA 4AL1A 1L7CA 3EPVA 3C63A 2P6VA 3C8ZA 2R7XA 3QZCA 3DE8A 3TOMA 1HW1A 2XSEA 3M4BA 4UDVA 3V5ZA 3LS1A 4QI0A 2A69F 4EBBA
chains in the Genus database with same CATH topology
1VMAA 3E70C 4U5FE 2Y3BA 1J8YF 2L81A 3I5QA 3K7DA 3UR3C 2CDQA 4YT2A 1LS1A 1M2OA 3JSZA 1OKKA 2ZXOA 2Q9BA 5DS4A 4Q7CA 3AG1C 5E3AA 2R7QA 1FMVA 3JT1A 4O6MA 4CS8A 4DVYP 3AG3C 2R7OA 1QZXA 2OG2A 4YT5A 3FHDA 1IW7F 3S28A 2W4BA 1MNDA 1TWAA 2KGOA 5KYUB 5KYUA 3POVA 4YT4A 4HE8D 5KYXB 2WVQA 3LLIA 5KYXA 2Y39A 2J9VA 5EHHA 2J9UA 1V54C 3EFOB 3ASNC 3V7OA 3JYHA 4KBLA 3I5PA 2Y3GA 1VOMA 2C04A 3CSKA 2D5RB 2L9JA 4AK9A 3SYNA 2WB7A 1ZHWA 3K33A 5KYNA 3K1IC 3EGXA 4XWJA 1OCOC 2W9YA 3DMDA 2LSEA 4JURI 2H7OA 2YHSA 3EG9B 1RJ9B 2WVNA 2PFDA 3M1CB 4U5BE 2C03A 3EG9A 3UMIA 4EWCA 3FDQA 2WZGA 1Z23A 2BE5F 3N0TA 3X1OA 3HTKC 4MNDA 1ZU5A 5T3TA 3SP1A 3DM5A 3FAJA 4XTKA 4J32B 2IXOA 4G7ZF 4G0HA 2V3CC 1VYIA 3B9QA 5KYYA 4OIPF 4K7BA 2NUTA 1BR1A 5L3VA 4BJ6C 3EH2A 3N24A 2GFHA 4PJNA 5FCLA 2V26A 2PX0A 5T3WA 2WVOA 3ZSUA 2A6HF 1JPJA 1N1CA 1ZU4A 2QY9A 3EZHA 3ASOC 1Z6AA 1Z63A 3VYWA 3KH2A 4PFPA 4PJJA 2EIMC 2HV7A 3UGPA 2PP4A 3GANA 3PMRA 4CS7A 2NUPB 4CBEA 2X51A 2VH3A 2MYSA 2NUPA 1MMDA 2WZLA 4BJ1A 3O39A 1OCRC 1TWHA 2XXAB 2OCCC 2XXAA 4JJFA 1TWGA 1BR2A 1S7ZA 2W4MA 1M56C 3WODF 4HFKB 3S0XA 3DD7A 4KNVA 4O6NA 1LKXA 3ABKC 3DAFA 3HJCA 5E2QA 5KYWB 3K6BA 1D0XA 1O87A 2M4EA 2ZXRA 4LACB 5CI9A 5KYWA 2CGEA 3JCUQ 4YJWA 4YN0B 3ZC4A 3ABMC 4O6YA 1JPNA 2PF4E 2EILC 3DXJF 4E7ZA 3F46A 3AG2C 4E7SA 5EGYA 1W2WA 3SZRA 3EZIA 1WGWA 3ITFA 1ZHZA 4HEAJ 2B0JA 3X2QC 3DJUB 3CZ6A 4CS9C 2Y3DA 3NYJA 4IWBA 2R7VA 4BJ6A 3RYLA 3DZAA 1ST6A 1BR4A 2CW0F 4NY3A 2YZSA 3EH1A 4CSAC 4ANJA 4RBNA 1MMGA 1SF8A 1J8MF 3KL4A 4U5EE 2A1DD 2JD3A 1D1BA 3NG1A 3EHMA 3LNRA 2YEVA 1D1AA 3W2WA 3ABLC 1ZHYA 2KNHA 3Q7LA 2FFHA 5DS6A 4IRUA 3NDBB 1V55C 1SZIA 3T6JA 3EJNA 3GODA 4RD9A 1NG1A 4FESA 1Z5ZA 4PJLA 3S29A 3TD7A 1FTSA 3EGXB 4DBRA 4OIOF 2KW3C 3W2VA 1MMNA 4H4KC 3DM9B 3CQZA 1FFHA 2R7RA 4DBQA 1NU7D 2KJGA 4G7HF 2DYRC 3B0PA 1PD1A 2EIJC 4C7OA 2H7BA 3LS0A 1VK5A 3KKBA 4XLPF 2A68F 2ZXWC 1OCZC 2J0WA 2A6EF 1M2VA 4U5GA 4C3BA 4I3MA 4KNWA 3W8HA 2W45A 4LERA 3OEOA 3DJNB 2J7PD 3UGOA 1FFTC 2H7VC 3N2ZB 5KYYB 2NUTB 3NYMA 1PCXA 3EGDA 4ULWA 2Q9AA 1SMYF 2WL8A 4CS9A 2G62A 4GEHA 4JCHA 5D92A 4MQ9F 4BG0A 2PX3A 4U5HA 3Q6NA 3RIPA 4CSAA 2J9WA 4JZAA 1D0ZA 4QI2A 1ZYRF 2CNWD 3LEVA 3O6XA 3RKOF 4OIRF 3JRTA 4A2NB 4BJ5C 4AE4A 4JVSA 4IAOA 5HSWA 3NKDA 4IJJA 4I44A 3H65A 2E87A 2HV6A 3EHNA 3OA1A 1PD0A 3AQBA 3ZVRA 5F5HA 3AG4C 4B6IA 5B1AC 1LVKA 1ZHXA 2Z15A 4BJTA 2IXNA 4OIQF 2FGYA 3NKEA 2VB6A 2DYSC 5DQZA 2IXMA 3LAYA 5T1DB 1MNEA 3K66A 2NG1A 4PFOA 4N06A 3L0IA 4I1MA 1OCCC 2G3KA 1O5HA 4O79A 1NU9C 2IYLD 5DVWA 4K0DA 3W8IA 1VYKA 4YT8A 2G3VA 3MLGA 2O9XA 2Q9CA 2J7PA 4OD4A 3S27A 3EQLF 4DOZA 3T6BA 5E33A 1IZMA 5IY5C 4AX2A 2Y69C 1TKNA 3QMKA 3FVYA 5L3QA 4OD5A 1MMAA 4LLEA 3OWTA 4LLCA 2IOQA 5F5FA 4FX5A 4FWVA 3LESA 4C3DA 4HFFB 4CIHA 1TWCA 3SEOA 1D0YA 2CNWA 3NRHA 4C3EA 4BJ5A 4PK4A 4P6IC 3AQCA 5DS5A 4ZLDA 3I4UA 1D1CA 2VASA 2Q3TA 3E9VA 3EFOA 3VAYA 2EIKC 4C7OB 5B1BC 4GYTA 4KI2A 2KQ9A 5D91A 3Q6MA 4QDLA 4I1OB 2XRHA 1M2VB 3DAGA 4M63A 3UNGC 2I8BA 3PHF2 2J45A 3KMIA 4KC9A 2ZXPA 3B0VC 3F47A 3SNHA 1TR2A 3NYLA 2R7TA 4F4BA 2R7SA 3ZIBA 3B0UX 1M57C 2EINC 1RJ9A 2MWQA 3EGDB 1NZEA 3UMHA 2J0XA 1OKKD 2IXPA 3LJBA 4X0RA 3T4RA 3WG7C 4ZLCA 5E3CA 3K1HA 1QLEC 4W8KA 2ZPAA 4U5DE 1ZHTA 3ECSA 5BUOA 5DQTA 5CI8A 3RFYA 3HLZA 4CS8C 2R7UA 2DGJA 4G7OF 2XL4A 5B3SC 4DVZA 1Z3IX 2J46A 4O7GA 1FMWA 4JW1A 2R7WA 4XLNF 3Q7GA 3MX3A 4U5CE 4WJ0A 1G8XA 4AE4B 4Q5SF 2QTVA 4PJMA 3L34A 2P7VA 4J30B 3LLKA 3ZG1A 4BEJA 3RH3A 1KU2A 4Q4ZF 4OINF 4YWQA 2WZFA 2Y3HA 5DLJA 4JJGA 4RDAA 3IEEA 3UMKA 3EPVA 2P6VA 2R7XA 3QZCA 2XSEA 3LS1A 4QI0A 2A69F 4EBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MWQ A;  3RFY A;  3ZSU A;  1NZE A;  3LS0 A;  1VYK A;  3LS1 A;  3JCU Q; 
#chains in the Genus database with same CATH topology
 1VMA A;  4JTC B;  3E70 C;  2AVK A;  2XLM A;  1WOL A;  2XS8 A;  4ER9 A;  1WAT A;  4U5F E;  2Y3B A;  1TQG A;  1J8Y F;  2L81 A;  2PNO A;  3I5Q A;  1U0B B;  1Q0M A;  1RMV A;  3K7D A;  4E0H A;  4JKV A;  1JRA A;  3UR3 C;  2CDQ A;  4YT2 A;  1LS1 A;  2OJQ A;  3ZQY A;  2YL7 A;  5AC5 A;  4P9T A;  4PAC A;  2HSB A;  1M2O A;  3JSZ A;  3FXH A;  5L0F A;  1OKK A;  2ZXO A;  2KK1 A;  3L8J A;  1QQ3 A;  2Q9B A;  4CDA A;  2KYH A;  4Q7C A;  3AG1 C;  5E3A A;  3U2L A;  4E0I A;  2YL1 A;  4XPW A;  5DS4 A;  4D4X A;  2R7Q A;  3U3B A;  1FMV A;  1OXB A;  1JAF A;  3JT1 A;  4O6M A;  1YVI A;  3IQC A;  4CS8 A;  4DVY P;  5A6B A;  1Z7Q c;  4YK5 A;  2R03 A;  1T6Q A;  2OQM A;  3GM1 A;  5A69 A;  3AG3 C;  1S05 A;  3M79 A;  3W4Y A;  2R7O A;  5KYW B;  1QZX A;  2OG2 A;  2YQY A;  1ORY A;  4Z9I A;  4YT5 A;  3WAQ A;  3NMI A;  4WGZ A;  2XL8 A;  2BC5 A;  5JLI A;  1EKY A;  1RCP A;  3FHD A;  1IW7 F;  3DI5 A;  3ATP A;  3S28 A;  2W4B A;  1HE9 A;  3SXK A;  1MND A;  1TWA A;  2KGO A;  5KYU B;  5KYU A;  1OR3 A;  3GEH A;  3IPM O;  4YT4 A;  3POV A;  4HE8 D;  5KYX B;  2WVQ A;  3LLI A;  5L0D A;  5KYX A;  2Y39 A;  2J9V A;  5EHH A;  2J9U A;  1V54 C;  3EFO B;  2EPO A;  3ASN C;  1E86 A;  1V74 B;  3JYH A;  3V7O A;  1EQ1 A;  3RVY A;  4MW3 A;  4KBL A;  2HMZ A;  3I5P A;  2Y3G A;  2A0U A;  5HV9 A;  4LDR A;  1VOM A;  2YRF A;  1E83 A;  2C04 A;  1A0B A;  1Q0K A;  2DB4 A;  1YJG A;  2D5R B;  2L9J A;  3CAX A;  3CSK A;  4IAQ A;  2JX0 A;  4AK9 A;  3C8G D;  4JEA A;  2WB7 A;  4MTG A;  3SYN A;  1ZHW A;  3K33 A;  5KYN A;  1YZC A;  3EGX A;  1KNY A;  2RSE B;  3K1I C;  4WAB A;  4XWJ A;  5COM A;  1OCO C;  5FZT A;  2W9Y A;  4NCQ A;  3FAP B;  3S90 A;  3DMD A;  1C02 A;  2LSE A;  2EPK X;  2OOC A;  4JUR I;  2H7O A;  3RQE A;  3TJ6 A;  3NMK A;  2YHS A;  1RJ9 B;  2WVN A;  2L6G A;  2PFD A;  3EG9 B;  3HNJ A;  1AEP A;  2C03 A;  3EG9 A;  3M1C B;  4MS2 A;  4U5B E;  3U3F A;  3UMI A;  2WZG A;  4EWC A;  3FDQ A;  1Z23 A;  2XLW A;  2BE5 F;  3N0T A;  1A7V A;  3X1O A;  1T6I A;  3HTK C;  2CYD A;  256B A;  3GWL A;  3IQ6 A;  4MND A;  1ZU5 A;  4JRZ A;  1KTM A;  5T3T A;  3SP1 A;  3DM5 A;  3FAJ A;  1PV3 A;  4XTK A;  4AL0 A;  2DI3 A;  4J32 B;  2IXO A;  1RKE B;  4G7Z F;  5JS5 A;  2R25 A;  1RKE A;  1YDI A;  4G0H A;  1VYI A;  2YLD A;  1AVO B;  4DRH B;  2V3C C;  3B9Q A;  1V4A A;  2IM8 A;  2J8W A;  4MVO A;  1F1M A;  4K7B A;  5KYY A;  4OIP F;  2HFI A;  2JPU A;  2GDC A;  1BR1 A;  2NUT A;  3RW0 A;  2YLG A;  4BJ6 C;  5L3V A;  5JP7 A;  3EH2 A;  1JR8 A;  1LE2 A;  3N24 A;  2GFH A;  3TQO A;  4PJN A;  4JE9 A;  4U9D A;  3MYF A;  5FCL A;  4N6C A;  3IQT A;  2V26 A;  3H2V A;  1E85 A;  2PX0 A;  2HJ3 A;  2L6F A;  5T3W A;  3JZ0 A;  2WVO A;  3KYI A;  3ZSU A;  2A6H F;  2LFD A;  4MW8 A;  1JPJ A;  1N1C A;  1ZU4 A;  2QY9 A;  4Z9H A;  3ZWI A;  1H7I A;  2HJM A;  3EZH A;  3ASO C;  1Z6A A;  1Z63 A;  2UUH A;  3VYW A;  3IQ5 A;  3A9C A;  3KH2 A;  2XLH A;  4PFP A;  4PJJ A;  2KSF A;  1GGQ A;  2EIM C;  2HV7 A;  2VCA A;  3UGP A;  2AWC A;  2PP4 A;  4XPY A;  3GAN A;  3PMR A;  4CS7 A;  5F28 E;  2OU6 A;  1A41 A;  2NUP B;  2X51 A;  2XLD A;  2HS5 A;  2VH3 A;  2MYS A;  2NUP A;  1MMD A;  5AGF A;  2WZL A;  2QE9 A;  2Q4F A;  2L6H A;  5COF A;  3O39 A;  4BJ1 A;  1OCR C;  1TWH A;  5B3I A;  2XXA B;  2OCC C;  3RQG A;  2XXA A;  4JJF A;  3MFN A;  2GAQ A;  1ORJ A;  1TWG A;  1BR2 A;  2VCB A;  1C03 A;  4JEB A;  1FR0 A;  4NTB A;  1S7Z A;  2W4M A;  4LDK A;  3HKK A;  1M56 C;  3WOD F;  1I5N A;  3L1M A;  4HFK B;  4CDV A;  3S0X A;  2J9B A;  4Z9J A;  3DD7 A;  3JRM O;  2VCC A;  3A11 A;  4KNV A;  4O6N A;  1GM5 A;  1LKX A;  3ABK C;  2YVK A;  3DAF A;  3HJC A;  3K1I A;  5A6A A;  5BQG A;  5E2Q A;  1SYQ A;  2P0N A;  3K6B A;  1D0X A;  1O87 A;  2M4E A;  2ZXR A;  4LAC B;  5CI9 A;  4DRJ B;  5CIV A;  5KYW A;  2CGE A;  3JCU Q;  1E2X A;  4YJW A;  4YN0 B;  5JRA A;  3ZC4 A;  2YL3 A;  3ABM C;  1NBB A;  4YL0 A;  3GM3 A;  2OJE D;  4O6Y A;  4YL3 A;  1JPN A;  2PF4 E;  2EIL C;  2GA0 A;  3DXJ F;  4E7Z A;  1H9G A;  5JSL A;  3VM6 A;  3F46 A;  3AG2 C;  2Q7R A;  4E7S A;  5EGY A;  1W2W A;  1U89 A;  5AC4 A;  3SZR A;  3U5S A;  1G4U S;  1HMD A;  3EZI A;  1A7D A;  1G5Z A;  1L3P A;  1WGW A;  1ZHZ A;  2KC3 A;  3ITF A;  4HEA J;  2B0J A;  3JYY A;  3NMJ A;  4K1O A;  3X2Q C;  3DJU B;  3CZ6 A;  4CS9 C;  2Y3D A;  3NYJ A;  4MVR A;  3US6 A;  2L7A A;  2P61 A;  1OW8 A;  1R4T A;  3WHN A;  2YLI A;  1CGO A;  4IWB A;  4BJ6 A;  3RYL A;  2R7V A;  2HKV A;  1ST6 A;  3DZA A;  1BR4 A;  2CW0 F;  3G4X A;  3T9O A;  4NY3 A;  2YZS A;  3EH1 A;  4XPX A;  4CSA C;  2R05 A;  4ANJ A;  4RBN A;  1MMG A;  3AJM A;  1SF8 A;  1J8M F;  3KL4 A;  4U5E E;  3TK0 A;  1WN0 A;  1YA9 A;  1O3U A;  2A1D D;  1OQC A;  2JD3 A;  1D1B A;  1NLX A;  3GEI A;  1FAP B;  3NG1 A;  3EHM A;  4IAR A;  2YEV A;  1D1A A;  3LNR A;  1K40 A;  3ABL C;  1ZHY A;  2KNH A;  3Q7L A;  2FFH A;  2XM0 A;  4IRU A;  3W2W A;  3ZTM A;  3NDB B;  2LFF A;  1V55 C;  1SZI A;  3U9M A;  3T6J A;  1GQA A;  3EJN A;  3GOD A;  2XL6 A;  4RD9 A;  1I4Y A;  1TFK B;  2XLO A;  1M6T A;  5A6K A;  3GWN A;  1EI7 A;  1NG1 A;  4FES A;  4GQH A;  4EBJ A;  1Z5Z A;  4PJL A;  2QNL A;  3S29 A;  3TD7 A;  2EPL X;  5GPG B;  3C18 A;  2IBF A;  1ZZP A;  1FTS A;  3EGX B;  1YAU O;  4DBR A;  4OIO F;  1T6U A;  2F22 A;  2KW3 C;  3W2V A;  1CPR A;  1MMN A;  4H4K C;  3DM9 B;  3CQZ A;  1FFH A;  2R7R A;  4DBQ A;  3M4C A;  3RF3 A;  1NU7 D;  2KJG A;  1XWJ A;  2AWY A;  3SXY A;  4XEV A;  5L0G A;  4H54 A;  4G7H F;  2DYR C;  1LIH A;  3B0P A;  1PD1 A;  2EIJ C;  4C7O A;  1Q0F A;  2H7B A;  3LS0 A;  1VK5 A;  5L0I A;  1XZQ A;  3KKB A;  4XLP F;  1RKC A;  2A68 F;  2ZXW C;  1OCZ C;  1K05 A;  2A6E F;  1M2V A;  2J0W A;  4U5G A;  3U8V A;  4C3B A;  2HUJ A;  4I3M A;  4KNW A;  3W8H A;  2W45 A;  4IB4 A;  4LER A;  3OEO A;  3DJN B;  2J7P D;  3UGO A;  4XQ1 A;  1FFT C;  1DOW A;  2H7V C;  1LS4 A;  3N2Z B;  5KYY B;  2HMQ A;  1A7E A;  2NUT B;  2QUP A;  2HSQ A;  3NYM A;  4W8P A;  1PCX A;  3TJ5 A;  3EGD A;  1VLT A;  4CDY A;  4ULW A;  1YAR O;  2XLV A;  2Q9A A;  3VF0 A;  4NQF A;  2XM4 A;  1SMY F;  3PDM P;  1R5I D;  1WAS A;  2WL8 A;  4CS9 A;  4MVQ A;  2G62 A;  4GEH A;  1Y6D A;  4JCH A;  3S84 A;  5D92 A;  4MQ9 F;  4BG0 A;  1FNT c;  1CGM E;  1ORS C;  5L0H A;  1NFN A;  2PX3 A;  3QTH A;  3U8P A;  4U5H A;  2UUI A;  3Q6N A;  3RIP A;  4CSA A;  4JIO A;  2J9W A;  1QVX A;  1D0Z A;  4JZA A;  4QI2 A;  1ZYR F;  2CNW D;  3LEV A;  2LK4 A;  1BBH A;  3FOP A;  4MTF A;  3JSE O;  4ULV A;  3O6X A;  3R7C A;  3RKO F;  4BEM J;  2NSF A;  4CJO A;  4OIR F;  3JRT A;  2R02 A;  3GM2 A;  5K0I A;  3U9J A;  1MQV A;  4A2N B;  4BJ5 C;  4ONS A;  4AE4 A;  4NTF A;  5A6J A;  1ZW3 A;  4JVS A;  4IAO A;  5HSW A;  2LCH A;  2NSG A;  3GOR A;  3NKD A;  2PBE A;  4IJJ A;  4MVM A;  3J06 A;  4I44 A;  3H65 A;  2E87 A;  2HV6 A;  3EHN A;  2AP3 A;  5L0C A;  5JT4 A;  3OA1 A;  1PD0 A;  3AQB A;  3U2M A;  3C8G B;  3RVZ A;  3ZVR A;  5F5H A;  3AG4 C;  3C8G A;  4B6I A;  3V5Y A;  3TUL A;  2BL2 A;  3AOU A;  5B1A C;  1LVK A;  1ZHX A;  2Z15 A;  4BJT A;  2IXN A;  4BPM A;  3HNL A;  4OIQ F;  2FGY A;  1LI5 A;  1VB5 A;  1OW7 A;  3MBG A;  5EK0 A;  2MHR A;  1Q0D A;  4DXW A;  3NKE A;  2VB6 A;  2VC9 A;  1ZVZ A;  2DYS C;  5DQZ A;  2AU5 A;  2IXM A;  3LAY A;  4MTO A;  1MNE A;  2R9R B;  5T1D B;  2EPM X;  3K66 A;  2NG1 A;  3VRC A;  1OW6 A;  1RXQ A;  4PFO A;  4N06 A;  4DRI B;  2B0H A;  2P1A A;  1YZA A;  3L0I A;  4I1M A;  1AUE A;  1OCC C;  1Q0G A;  1VTM P;  2Q00 A;  2CCY A;  3JTL O;  2G3K A;  1O5H A;  2A0B A;  3HNI A;  4O79 A;  1APC A;  1NU9 C;  1OR2 A;  1SR2 A;  2IYL D;  2ZD9 A;  3FMS A;  5DVW A;  4CBE A;  1LPE A;  4K0D A;  3W8I A;  1VYK A;  2LIG A;  4L6R A;  2G3V A;  3MLG A;  4YT8 A;  2O9X A;  2Q9C A;  4G78 A;  4U9E A;  2J7P A;  4OD4 A;  4A4A A;  1YYJ A;  3S27 A;  3G50 A;  3EQL F;  1WWP A;  4EBK A;  4DOZ A;  2M64 A;  3T6B A;  2LQG A;  5E33 A;  1IZM A;  2H8A A;  5DS6 A;  5IY5 C;  1G4W R;  1CGN A;  1TFO B;  3S9O A;  3ZTZ A;  3SXM A;  4AX2 A;  3H2U A;  2I15 A;  2Y69 C;  1TKN A;  3ZDL A;  3QMK A;  3FVY A;  5L3Q A;  1H9T A;  2HZ8 A;  1H6G A;  3DWW A;  4OD5 A;  1MMA A;  4LLE A;  3G4Z A;  2FAP B;  3DE9 A;  5COG A;  1DOV A;  3V5X A;  3OWT A;  1LM3 B;  4LLC A;  2IOQ A;  5F5F A;  4FX5 A;  4FWV A;  3LES A;  4JCZ A;  4C3D A;  4HFF B;  4CIH A;  1TWC A;  1NSG B;  1D0Y A;  4R32 A;  3SEO A;  2CNW A;  4CJG A;  3SXZ A;  3NRH A;  4C3E A;  3HNK A;  4BJ5 A;  4EIY A;  3B29 A;  4PK4 A;  4P6I C;  3AQC A;  5DS5 A;  4N6H A;  4ZLD A;  1GS9 A;  2X0C A;  5L0J A;  3I4U A;  4JTD B;  4JTA B;  3O10 A;  3QVZ A;  4EKW A;  3LNM B;  1D1C A;  1HW2 A;  2VAS A;  5BQI A;  3M15 A;  1BZ4 A;  2Q3T A;  3E9V A;  3EFO A;  3VAY A;  2EIK C;  3BEH A;  3CEX A;  3T6G B;  4C7O B;  5B1B C;  4GYT A;  4KI2 A;  2KQ9 A;  5D91 A;  4N4W A;  3Q6M A;  3QW0 A;  4QDL A;  2XS1 A;  4I1O B;  1LE4 A;  1M2V B;  1OXK A;  2XRH A;  3DAG A;  4M63 A;  3UNG C;  2I8B A;  1E84 A;  3PHF 2;  2J45 A;  3KMI A;  1QPU A;  2ZXP A;  4KC9 A;  3B0V C;  3F47 A;  3SNH A;  1QSP A;  2XLE A;  3O55 A;  1TR2 A;  3NYL A;  2R7T A;  4MVZ A;  1T9K A;  3U0C A;  4F4B A;  1K04 A;  1JMW A;  2R7S A;  4LDQ A;  4JC7 A;  3ZIB A;  4E18 A;  3B0U X;  1M57 C;  3ZQV A;  3KPH A;  3QVY A;  2EIN C;  2OEV A;  1RJ9 A;  2MWQ A;  3EGD B;  1NZE A;  3UMH A;  1EA8 A;  1OKK D;  2J0X A;  3L8I A;  1UG7 A;  1YLM A;  2IXP A;  3GEE A;  3LJB A;  4X0R A;  3T4R A;  5E3C A;  2D4U A;  1U6H A;  3K1H A;  4ZLC A;  4MVS A;  4CX9 A;  1QLE C;  1I4Z A;  1HMO A;  2EPN A;  4W8K A;  4NC3 A;  2ZPA A;  1JOG A;  4U5D E;  5A6B D;  1ZHT A;  4MVU A;  3IHU A;  2ICW G;  2NPU A;  3AGU A;  3ECS A;  1HY5 A;  5BUO A;  2LP4 A;  4XEK A;  5CI8 A;  3RFY A;  3HLZ A;  5DQT A;  2ASR A;  1NFO A;  4CS8 C;  2R7U A;  1VLS A;  4YL1 A;  1XZP A;  4XEF A;  2DGJ A;  4PR9 A;  4G7O F;  3FOO A;  2ETS A;  3BRJ A;  2XL4 A;  3RQF A;  5B3S C;  4J7Y A;  4DVZ A;  1Z3I X;  2J46 A;  4O7G A;  1FMW A;  4JW1 A;  2R7W A;  2OEX A;  4DJ9 A;  3KYJ A;  1C17 M;  4XLN F;  3Q7G A;  3MX3 A;  1B68 A;  4U5C E;  4J7T A;  4WJ0 A;  4WGY A;  4EHP A;  4CIP A;  2TMV P;  1G8X A;  2QLA A;  4AE4 B;  4Q5S F;  3PCV A;  1UFB A;  1YYX A;  1Y4C A;  1ZW2 A;  2YWA A;  3LEO A;  2QTV A;  3LUT B;  3WG7 C;  1CPQ A;  3R2P A;  4NTA A;  4PJM A;  3L34 A;  4P9F A;  1YA7 O;  1T5O A;  2RD9 A;  2YL0 A;  5TJ5 E;  2LD6 A;  3C62 A;  2YKZ A;  2P7V A;  1T01 A;  3AGT A;  4J30 B;  4D4N A;  3MYI A;  3LLK A;  3TOL A;  1QKR A;  4IGG A;  4EUK B;  5JUA A;  3ZG1 A;  4BEJ A;  2OKU A;  1BDJ B;  3RH3 A;  4FAP B;  1KU2 A;  5JVE A;  3QW1 A;  1HE1 A;  4E17 A;  3B71 A;  3DKA A;  4Q4Z F;  4OIN F;  4YWQ A;  3C7J A;  2WZF A;  2Y3H A;  5DLJ A;  4JJG A;  1WTY A;  1LI7 A;  4RDA A;  5BQH A;  3IEE A;  3UMK A;  2GWW A;  4AL1 A;  1L7C A;  3EPV A;  3C63 A;  2P6V A;  3C8Z A;  2R7X A;  3QZC A;  3DE8 A;  3TOM A;  1HW1 A;  2XSE A;  3M4B A;  4UDV A;  3V5Z A;  3LS1 A;  4QI0 A;  2A69 F;  4EBB A; 
#chains in the Genus database with same CATH homology
 1VMA A;  3E70 C;  4U5F E;  2Y3B A;  1J8Y F;  2L81 A;  3I5Q A;  3K7D A;  3UR3 C;  2CDQ A;  4YT2 A;  1LS1 A;  1M2O A;  3JSZ A;  1OKK A;  2ZXO A;  2Q9B A;  5DS4 A;  4Q7C A;  3AG1 C;  5E3A A;  2R7Q A;  1FMV A;  3JT1 A;  4O6M A;  4CS8 A;  4DVY P;  3AG3 C;  2R7O A;  1QZX A;  2OG2 A;  4YT5 A;  3FHD A;  1IW7 F;  3S28 A;  2W4B A;  1MND A;  1TWA A;  2KGO A;  5KYU B;  5KYU A;  3POV A;  4YT4 A;  4HE8 D;  5KYX B;  2WVQ A;  3LLI A;  5KYX A;  2Y39 A;  2J9V A;  5EHH A;  2J9U A;  1V54 C;  3EFO B;  3ASN C;  3V7O A;  3JYH A;  4KBL A;  3I5P A;  2Y3G A;  1VOM A;  2C04 A;  3CSK A;  2D5R B;  2L9J A;  4AK9 A;  3SYN A;  2WB7 A;  1ZHW A;  3K33 A;  5KYN A;  3K1I C;  3EGX A;  4XWJ A;  1OCO C;  2W9Y A;  3DMD A;  2LSE A;  4JUR I;  2H7O A;  2YHS A;  3EG9 B;  1RJ9 B;  2WVN A;  2PFD A;  3M1C B;  4U5B E;  2C03 A;  3EG9 A;  3UMI A;  4EWC A;  3FDQ A;  2WZG A;  1Z23 A;  2BE5 F;  3N0T A;  3X1O A;  3HTK C;  4MND A;  1ZU5 A;  5T3T A;  3SP1 A;  3DM5 A;  3FAJ A;  4XTK A;  4J32 B;  2IXO A;  4G7Z F;  4G0H A;  2V3C C;  1VYI A;  3B9Q A;  5KYY A;  4OIP F;  4K7B A;  2NUT A;  1BR1 A;  5L3V A;  4BJ6 C;  3EH2 A;  3N24 A;  2GFH A;  4PJN A;  5FCL A;  2V26 A;  2PX0 A;  5T3W A;  2WVO A;  3ZSU A;  2A6H F;  1JPJ A;  1N1C A;  1ZU4 A;  2QY9 A;  3EZH A;  3ASO C;  1Z6A A;  1Z63 A;  3VYW A;  3KH2 A;  4PFP A;  4PJJ A;  2EIM C;  2HV7 A;  3UGP A;  2PP4 A;  3GAN A;  3PMR A;  4CS7 A;  2NUP B;  4CBE A;  2X51 A;  2VH3 A;  2MYS A;  2NUP A;  1MMD A;  2WZL A;  4BJ1 A;  3O39 A;  1OCR C;  1TWH A;  2XXA B;  2OCC C;  2XXA A;  4JJF A;  1TWG A;  1BR2 A;  1S7Z A;  2W4M A;  1M56 C;  3WOD F;  4HFK B;  3S0X A;  3DD7 A;  4KNV A;  4O6N A;  1LKX A;  3ABK C;  3DAF A;  3HJC A;  5E2Q A;  5KYW B;  3K6B A;  1D0X A;  1O87 A;  2M4E A;  2ZXR A;  4LAC B;  5CI9 A;  5KYW A;  2CGE A;  3JCU Q;  4YJW A;  4YN0 B;  3ZC4 A;  3ABM C;  4O6Y A;  1JPN A;  2PF4 E;  2EIL C;  3DXJ F;  4E7Z A;  3F46 A;  3AG2 C;  4E7S A;  5EGY A;  1W2W A;  3SZR A;  3EZI A;  1WGW A;  3ITF A;  1ZHZ A;  4HEA J;  2B0J A;  3X2Q C;  3DJU B;  3CZ6 A;  4CS9 C;  2Y3D A;  3NYJ A;  4IWB A;  2R7V A;  4BJ6 A;  3RYL A;  3DZA A;  1ST6 A;  1BR4 A;  2CW0 F;  4NY3 A;  2YZS A;  3EH1 A;  4CSA C;  4ANJ A;  4RBN A;  1MMG A;  1SF8 A;  1J8M F;  3KL4 A;  4U5E E;  2A1D D;  2JD3 A;  1D1B A;  3NG1 A;  3EHM A;  3LNR A;  2YEV A;  1D1A A;  3W2W A;  3ABL C;  1ZHY A;  2KNH A;  3Q7L A;  2FFH A;  5DS6 A;  4IRU A;  3NDB B;  1V55 C;  1SZI A;  3T6J A;  3EJN A;  3GOD A;  4RD9 A;  1NG1 A;  4FES A;  1Z5Z A;  4PJL A;  3S29 A;  3TD7 A;  1FTS A;  3EGX B;  4DBR A;  4OIO F;  2KW3 C;  3W2V A;  1MMN A;  4H4K C;  3DM9 B;  3CQZ A;  1FFH A;  2R7R A;  4DBQ A;  1NU7 D;  2KJG A;  4G7H F;  2DYR C;  3B0P A;  1PD1 A;  2EIJ C;  4C7O A;  2H7B A;  3LS0 A;  1VK5 A;  3KKB A;  4XLP F;  2A68 F;  2ZXW C;  1OCZ C;  2J0W A;  2A6E F;  1M2V A;  4U5G A;  4C3B A;  4I3M A;  4KNW A;  3W8H A;  2W45 A;  4LER A;  3OEO A;  3DJN B;  2J7P D;  3UGO A;  1FFT C;  2H7V C;  3N2Z B;  5KYY B;  2NUT B;  3NYM A;  1PCX A;  3EGD A;  4ULW A;  2Q9A A;  1SMY F;  2WL8 A;  4CS9 A;  2G62 A;  4GEH A;  4JCH A;  5D92 A;  4MQ9 F;  4BG0 A;  2PX3 A;  4U5H A;  3Q6N A;  3RIP A;  4CSA A;  2J9W A;  4JZA A;  1D0Z A;  4QI2 A;  1ZYR F;  2CNW D;  3LEV A;  3O6X A;  3RKO F;  4OIR F;  3JRT A;  4A2N B;  4BJ5 C;  4AE4 A;  4JVS A;  4IAO A;  5HSW A;  3NKD A;  4IJJ A;  4I44 A;  3H65 A;  2E87 A;  2HV6 A;  3EHN A;  3OA1 A;  1PD0 A;  3AQB A;  3ZVR A;  5F5H A;  3AG4 C;  4B6I A;  5B1A C;  1LVK A;  1ZHX A;  2Z15 A;  4BJT A;  2IXN A;  4OIQ F;  2FGY A;  3NKE A;  2VB6 A;  2DYS C;  5DQZ A;  2IXM A;  3LAY A;  5T1D B;  1MNE A;  3K66 A;  2NG1 A;  4PFO A;  4N06 A;  3L0I A;  4I1M A;  1OCC C;  2G3K A;  1O5H A;  4O79 A;  1NU9 C;  2IYL D;  5DVW A;  4K0D A;  3W8I A;  1VYK A;  4YT8 A;  2G3V A;  3MLG A;  2O9X A;  2Q9C A;  2J7P A;  4OD4 A;  3S27 A;  3EQL F;  4DOZ A;  3T6B A;  5E33 A;  1IZM A;  5IY5 C;  4AX2 A;  2Y69 C;  1TKN A;  3QMK A;  3FVY A;  5L3Q A;  4OD5 A;  1MMA A;  4LLE A;  3OWT A;  4LLC A;  2IOQ A;  5F5F A;  4FX5 A;  4FWV A;  3LES A;  4C3D A;  4HFF B;  4CIH A;  1TWC A;  3SEO A;  1D0Y A;  2CNW A;  3NRH A;  4C3E A;  4BJ5 A;  4PK4 A;  4P6I C;  3AQC A;  5DS5 A;  4ZLD A;  3I4U A;  1D1C A;  2VAS A;  2Q3T A;  3E9V A;  3EFO A;  3VAY A;  2EIK C;  4C7O B;  5B1B C;  4GYT A;  4KI2 A;  2KQ9 A;  5D91 A;  3Q6M A;  4QDL A;  4I1O B;  2XRH A;  1M2V B;  3DAG A;  4M63 A;  3UNG C;  2I8B A;  3PHF 2;  2J45 A;  3KMI A;  4KC9 A;  2ZXP A;  3B0V C;  3F47 A;  3SNH A;  1TR2 A;  3NYL A;  2R7T A;  4F4B A;  2R7S A;  3ZIB A;  3B0U X;  1M57 C;  2EIN C;  1RJ9 A;  2MWQ A;  3EGD B;  1NZE A;  3UMH A;  2J0X A;  1OKK D;  2IXP A;  3LJB A;  4X0R A;  3T4R A;  3WG7 C;  4ZLC A;  5E3C A;  3K1H A;  1QLE C;  4W8K A;  2ZPA A;  4U5D E;  1ZHT A;  3ECS A;  5BUO A;  5DQT A;  5CI8 A;  3RFY A;  3HLZ A;  4CS8 C;  2R7U A;  2DGJ A;  4G7O F;  2XL4 A;  5B3S C;  4DVZ A;  1Z3I X;  2J46 A;  4O7G A;  1FMW A;  4JW1 A;  2R7W A;  4XLN F;  3Q7G A;  3MX3 A;  4U5C E;  4WJ0 A;  1G8X A;  4AE4 B;  4Q5S F;  2QTV A;  4PJM A;  3L34 A;  2P7V A;  4J30 B;  3LLK A;  3ZG1 A;  4BEJ A;  3RH3 A;  1KU2 A;  4Q4Z F;  4OIN F;  4YWQ A;  2WZF A;  2Y3H A;  5DLJ A;  4JJG A;  4RDA A;  3IEE A;  3UMK A;  3EPV A;  2P6V A;  2R7X A;  3QZC A;  2XSE A;  3LS1 A;  4QI0 A;  2A69 F;  4EBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...