1YA9A

Crystal structure of the 22kda n-terminal fragment of mouse apolipoprotein e
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
174
structure length
168
Chain Sequence
PEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAGVSAIRERLGPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Apolipoprotein E
publication title Engineering conformational destabilization into mouse apolipoprotein E. A model for a unique property of human apolipoprotein E4
pubmed doi rcsb
source organism Mus musculus
total genus 71
structure length 168
sequence length 174
ec nomenclature
pdb deposition date 2004-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1ya9A00
1NFNA 1OR2A 3S84A 1NFOA 1AEPA 1EA8A 1YA9A 1EQ1A 1LS4A 1GS9A 2KC3A 1OR3A 1B68A 1LPEA 3R2PA 1BZ4A 1LE4A 1LE2A 1H7IA
chains in the Genus database with same CATH superfamily
2ICWG 1LI7A 3KH2A 3GM2A 2Q9AA 4C7OB 1ORSC 5E3AA 5T3TA 2QNLA 3FXHA 3MLGA 1Q0GA 4K1OA 3S84A 1AEPA 4JJGA 1APCA 4J30B 1VOMA 1BR2A 1JPJA 4BJTA 3G4ZA 1D1CA 1H6GA 1NZEA 1Z6AA 3G50A 1S7ZA 2YL7A 4MVQA 4XPXA 1OQCA 2ZXPA 3PCVA 4YN0B 3UMIA 4CS8A 4F4BA 3K6BA 1Z23A 5B3IA 4U5DE 4MTOA 2WVQA 2GFHA 2MYSA 1D1BA 1CGOA 4FWVA 4OIRF 1JAFA 3ZDLA 3W8HA 2W4BA 3LJBA 4AK9A 1GM5A 1YYXA 1F1MA 3M15A 3K7DA 3FAPB 4X0RA 1M57C 1FMVA 3T6BA 1LE4A 3GEEA 5DVWA 3U2LA 2L6FA 1RMVA 2EILC 4HFKB 2EIJC 2OG2A 2NUPA 1FNTc 2PBEA 5DQTA 4ZLDA 4IAOA 1OCZC 3T6JA 2EINC 2J9VA 2JPUA 3W4YA 4PJNA 2IBFA 1MNDA 1WN0A 2HSQA 4JURI 1QSPA 4XEVA 3T6GB 3EGDB 1ZU4A 2GA0A 1WWPA 1TWGA 2HSBA 3B0UX 2KC3A 1KTMA 1G8XA 1SZIA 4OD5A 5E3CA 3TD7A 2LK4A 5A6KA 2LD6A 1D1AA 4WABA 4BEJA 3EZIA 3S28A 1ZHXA 3EQLF 3JCUQ 4NTBA 3ABMC 3Q7LA 1HE1A 2EPNA 1BR4A 3C8ZA 4YT4A 1SR2A 3GM3A 4MVOA 1V54C 2EPOA 3TULA 1YA7O 3GORA 3JSZA 1NU9C 3MX3A 4IARA 3VM6A 2WL8A 1EI7A 2XRHA 3SZRA 1G4US 3KPHA 4DJ9A 1Z3IX 1H7IA 5L0JA 1RJ9B 1D0YA 4MNDA 2A6EF 4U5FE 1E2XA 3W2VA 2VASA 1QZXA 2DGJA 2G62A 2CCYA 4U9EA 4CS7A 3QVYA 2HJMA 1C02A 2KK1A 3LUTB 5L0HA 1E86A 4KI2A 2L6HA 3TJ6A 4G7ZF 4ULVA 4PACA 5EHHA 4O6YA 2HUJA 2IXOA 4XPYA 2XLEA 4N06A 2XXAA 3NMJA 1LI5A 4Q4ZF 3C18A 2R7RA 5BQHA 4JTCB 4ER9A 1YYJA 1M6TA 1HMOA 1YJGA 2I15A 5COFA 3LNMB 3SYNA 2B0JA 4U5HA 5KYUA 4DRJB 4EUKB 3G4XA 3HNJA 3NDBB 5B1BC 4JTDB 2WB7A 2IOQA 1ORYA 4KBLA 1LM3B 2VCCA 4MW8A 1JOGA 2A68F 1ZHWA 1E85A 3WHNA 4C3DA 3AGTA 1HY5A 1OR2A 3S9OA 4YL1A 2PX3A 2WZFA 2YL1A 3DKAA 3K1IA 3H65A 4I1MA 5DQZA 2H7BA 1OW7A 4H54A 3S27A 4C3BA 3FVYA 2KNHA 3RQFA 2HS5A 4YK5A 5KYYA 5F5FA 3GWNA 1SF8A 2J7PA 5JUAA 2NSFA 1YLMA 3N2ZB 4C7OA 3M4CA 2I8BA 4BG0A 2GAQA 4U9DA 3ZG1A 3SP1A 1Y4CA 1QQ3A 1JPNA 5TJ5E 1TFKB 2LIGA 3DJNB 3AG3C 4JZAA 1HW2A 3JRTA 1PV3A 1YARO 1ZHZA 2KYHA 2Y3BA 4O6NA 3W2WA 4C3EA 1H9TA 2J8WA 1TQGA 3VF0A 1TFOB 2Q4FA 3IQ6A 3ITFA 3K1IC 1IZMA 3PMRA 4LACB 4PJJA 4R32A 3M1CB 2AVKA 3C63A 3HNLA 2H8AA 4CDYA 4PR9A 5HSWA 5COMA 3MYIA 3L34A 4KC9A 5BQIA 4CSAA 1ZZPA 2R7QA 1XZQA 5CI9A 1AVOB 3WAQA 1JR8A 1S05A 2R7OA 3F46A 1T6QA 3WODF 4JEAA 1OCOC 4BEMJ 3HTKC 2HV6A 1M2VB 3K66A 2J9BA 3QW1A 3R2PA 4FESA 2AWCA 4YL3A 4ULWA 4XLPF 1FMWA 2L7AA 1FFHA 2MWQA 2QUPA 3K33A 2YRFA 3U3FA 3AJMA 4BJ6A 3U5SA 1U0BB 2W45A 3EGDA 4J7YA 4BJ1A 3V5XA 2Q9CA 1K40A 1MMDA 4ZLCA 2HJ3A 2V3CC 5KYXA 1A0BA 4RBNA 2NG1A 4N6HA 3CAXA 1JMWA 4MVMA 2R7SA 1O87A 5A6BA 2L9JA 1HE9A 4XLNF 4O6MA 2P1AA 4YL0A 2W9YA 3EGXA 5JRAA 3RQGA 1TWAA 3RVZA 2LSEA 1OW8A 2OQMA 3AG1C 2R7XA 2Q00A 1NSGB 3KL4A 2IXMA 3HKKA 3NKEA 1Z7Qc 5B3SC 5IY5C 5DS5A 1TR2A 2XLVA 3NRHA 4MS2A 4AE4B 5E2QA 4QI2A 2H7OA 2PF4E 3M79A 5JVEA 4PJMA 4YT5A 1D0ZA 2AU5A 2AP3A 3R7CA 4YJWA 1ZHTA 2P6VA 3NKDA 3QTHA 4BJ6C 3CQZA 1FR0A 2YLIA 3EFOA 4GYTA 4EBBA 1CPQA 1Q0FA 4E0IA 3V5ZA 5HV9A 3QZCA 3FHDA 2W4MA 3US6A 3DD7A 3ECSA 1ZVZA 3TOMA 3PHF2 4AL0A 2HMQA 3S29A 2XLMA 1NFNA 1Z5ZA 2OJED 3VRCA 5A6AA 5JT4A 1LVKA 3DM5A 1TWCA 5A6JA 4BJ5A 5T3WA 4J32B 2VCAA 4WGZA 4CS8C 4Q5SF 3FAJA 3C62A 3L8IA 3OWTA 5L0GA 1A7EA 3ZQVA 2C03A 2FGYA 3KKBA 1PD1A 2PFDA 2YWAA 4CIPA 4UDVA 4W8KA 2A0BA 1MNEA 2OEVA 2WVNA 2J9UA 3POVA 4K7BA 4DVZA 1WTYA 3CSKA 1KU2A 3E9VA 1NU7D 3AQBA 2EIKC 4QDLA 2CYDA 2FAPB 4DRHB 1V55C 2DB4A 1TWHA 1Q0KA 1YDIA 2GWWA 1VYKA 4W8PA 1QVXA 2DI3A 3LNRA 2LQGA 4Z9JA 1VYIA 2J9WA 2M64A 2YL0A 5DLJA 4EBJA 3OEOA 5KYWB 4CS9A 2J0WA 3HLZA 4EHPA 4JJFA 5L3VA 2R7VA 3LESA 3B0PA 2CGEA 2YLDA 3SXZA 3VYWA 3AQCA 2OEXA 4B6IA 3I5PA 3IQ5A 2J45A 1EA8A 1U6HA 2P7VA 4G0HA 3UGOA 3C8GD 4LERA 3RQEA 2JD3A 3N0TA 1FAPB 2XLOA 5B1AC 3U2MA 5COGA 1M56C 2XM4A 1OR3A 2R7WA 4OIQF 4CDVA 2TMVP 1EQ1A 1T5OA 2NUTA 5D91A 1OXBA 3FMSA 1BDJB 5GPGB 1E83A 1Q0DA 3ZSUA 4OD4A 1BZ4A 1O5HA 1R4TA 2NPUA 2IXPA 1OXKA 2ZXOA 1Y6DA 4E17A 4MVRA 3SNHA 3HNIA 4K0DA 5FCLA 1LE2A 5FZTA 1BR1A 2Y3HA 2YVKA 4CS9C 1OKKA 3LLIA 5BUOA 1LS1A 1HMDA 1V74B 3O6XA 3GODA 2L81A 1T6IA 1Q0MA 1XWJA 2HV7A 4JW1A 5KYNA 2CDQA 4DOZA 3IQCA 4MVUA 3LEOA 5JSLA 4XPWA 2NUPB 4CIHA 5EGYA 4I3MA 3KMIA 1RKEA 2E87A 2PX0A 1MMGA 5L3QA 2NSGA 3NMIA 1GQAA 3X2QC 2B0HA 2HZ8A 4G78A 4HE8D 3L8JA 2O9XA 2PNOA 4G7HF 4N6CA 4NC3A 3NMKA 2R7UA 3M4BA 4IJJA 1UG7A 4U5BE 2ZXRA 4GEHA 3H2UA 1PCXA 2D4UA 4U5CE 3ATPA 2KGOA 5F28E 3LAYA 1G5ZA 1CPRA 2D5RB 4JCHA 2MHRA 1NFOA 2OCCC 2RSEB 2BE5F 3RVYA 5A69A 5L0CA 1WGWA 3KYIA 5DS6A 1G4WR 1LS4A 1K05A 1SMYF 2Y3DA 2G3KA 3EH1A 2WVOA 4JIOA 4N4WA 4P9FA 1T6UA 3RKOF 3VAYA 2F22A 3ZQYA 4A2NB 1EKYA 1OW6A 4OINF 1AUEA 4XEKA 5EK0A 4BPMA 1FTSA 4U5EE 4A4AA 3DE9A 3CZ6A 2LP4A 3UNGC 3EZHA 2EPKX 2QLAA 2QE9A 1LKXA 3GANA 3QMKA 3BRJA 1QKRA 1VLTA 2XS1A 4XEFA 5JP7A 3OA1A 2XXAB 4CJOA 4QI0A 4HEAJ 4IAQA 3UGPA 1T01A 3KYJA 4EBKA 1H9GA 3GEHA 3ZIBA 3ZC4A 2LCHA 2KW3C 4JVSA 1ST6A 4MVSA 5KYUB 4ANJA 1L3PA 2OKUA 2J46A 4CX9A 3L1MA 3B0VC 1ZW2A 1NLXA 2C04A 1I5NA 4IWBA 4PFOA 4EKWA 1MQVA 2OU6A 3TK0A 4AX2A 4CSAC 3QW0A 3TJ5A 3ASNC 1RKCA 3JT1A 2FFHA 2QTVA 3DI5A 5KYWA 2X51A 3L0IA 3I5QA 1RJ9A 1VMAA 1L7CA 4NCQA 4JKVA 4DBQA 1DOVA 1OCCC 1ZU5A 2IM8A 2V26A 5CIVA 2LFFA 1QLEC 2VH3A 4OIOF 3SEOA 3LS1A 4IB4A 4WGYA 5KYYB 2VC9A 3DM9B 1MMAA 3SXKA 3U8PA 4H4KC 4HFFB 1JRAA 3DWWA 5AGFA 2H7VC 2P0NA 2UUIA 2A69F 1Z63A 3Q7GA 3DAGA 4YT8A 1NBBA 2YKZA 2XL8A 3DAFA 1RXQA 2Y39A 1YZCA 3U3BA 2WZLA 3LLKA 4PK4A 2XL4A 1BBHA 3C8GB 3JSEO 4JC7A 3SXYA 4P6IC 5CI8A 1PD0A 1I4YA 1ZHYA 1WATA 1OKKD 3EHNA 1U89A 4NTAA 4RD9A 2G3VA 1WASA 2ZXWC 1VTMP 3U8VA 2R03A 3GWLA 3EHMA 2CNWA 4PJLA 256BA 5JLIA 1RCPA 3Q6NA 1LIHA 2XLWA 4IGGA 5K0IA 3FDQA 2HKVA 5AC4A 4NQFA 3ZVRA 4Z9HA 2L6GA 3O39A 5L0FA 4E0HA 2UUHA 1WOLA 2HFIA 5BQGA 2R7TA 1ZW3A 2J7PD 2R02A 3TQOA 1I4ZA 2ZD9A 1YVIA 2YLGA 3EG9B 4J7TA 4GQHA 3U9JA 4U5GA 3O55A 3T4RA 5DS4A 1N1CA 3NG1A 2R05A 3V7OA 4BJ5C 3QVZA 2Q9BA 3F47A 4EIYA 5KYXB 3DJUB 2BC5A 3DE8A 1W2WA 3W8IA 3DZAA 3IEEA 1CGME 3S90A 3HNKA 3ZTMA 2A0UA 4JEBA 2PP4A 4NY3A 3DMDA 1MMNA 3MYFA 4CBEA 4Q7CA 1SYQA 3EGXB 2DYRC 2DYSC 1UFBA 2VCBA 3ASOC 3Q6MA 3K1HA 4XTKA 1OCRC 2YL3A 3ZTZA 2X0CA 1ZYRF 1A41A 4LLCA 3AOUA 3I4UA 3A9CA 3V5YA 4I1OB 1A7VA 1J8YF 2XM0A 3EFOB 3IQTA 4MW3A 4P9TA 4DRIB 2XS8A 1M2VA 2AWYA 3N24A 4KNVA 3RYLA 3JYYA 3IPMO 3EJNA 4XWJA 3UMKA 4D4NA 4D4XA 2R9RB 3AGUA 2GDCA 4KNWA 3RF3A 1B68A 2Z15A 4DXWA 4Z9IA 4JCZA 5A6BD 3WG7C 3AG4C 3MBGA 3O10A 4LLEA 2YHSA 3EH2A 2OJQA 2ETSA 3H2VA 3NYJA 4FAPB 3C7JA 2EPLX 3T9OA 3NYMA 3RFYA 2A6HF 3JZ0A 2A1DD 2P61A 2R25A 4O79A 4M63A 3HJCA 2YZSA 1NG1A 4XQ1A 1VLSA 3ZWIA 4YT2A 1V4AA 1YAUO 4LDKA 2YEVA 3A11A 3CEXA 2LFDA 2CW0F 5D92A 3UMHA 4AL1A 3ABKC 4AE4A 5JS5A 2XSEA 4JE9A 2XLDA 4JTAB 4I44A 1A7DA 2EPMX 4CJGA 3S0XA 1KNYA 1O3UA 1YA9A 1CGNA 2YQYA 4MVZA 1ORJA 3LEVA 3UR3C 1K04A 3PDMP 2XL6A 4E7SA 1DOWA 2J0XA 3B71A 4MQ9F 2VB6A 3BEHA 4E18A 4E7ZA 3GEIA 4ONSA 5L0IA 4WJ0A 1C17M 3AG2C 3FOPA 2RD9A 3ABLC 2WZGA 4FX5A 4OIPF 3JYHA 5F5HA 3B9QA 3IHUA 1J8MF 3C8GA 3TOLA 3DXJF 2NUTB 2BL2A 1R5ID 3U9MA 2KSFA 2OOCA 4MTGA 2CNWD 1TKNA 4NTFA 1HW1A 1FFTC 3X1OA 2KQ9A 2Y3GA 1IW7F 2ZPAA 3B29A 3NYLA 4LDRA 3RH3A 4RDAA 2JX0A 4DBRA 3RW0A 4MTFA 4LDQA 5E33A 1D0XA 4IRUA 4YWQA 1GS9A 2QY9A 4G7OF 4CDAA 1QPUA 4L6RA 4JRZA 2IYLD 1LPEA 1XZPA 2IXNA 2XLHA 3GM1A 3JRMO 1E84A 1C03A 3RIPA 3MFNA 1VK5A 1M2OA 4DVYP 1VB5A 3EPVA 3EG9A 3JTLO 4PFPA 2HMZA 3SXMA 2EIMC 2Q7RA 4EWCA 1T9KA 5AC5A 5L0DA 3U0CA 3J06A 1GGQA 2ASRA 3FOOA 4O7GA 2Y69C 1RKEB 3LS0A 2Q3TA 5T1DB 2KJGA 3E70C 2M4EA 1YZAA
chains in the Genus database with same CATH topology
1NFNA 1OR2A 3S84A 1NFOA 1AEPA 1EA8A 1YA9A 1EQ1A 1LS4A 1GS9A 2KC3A 1OR3A 1B68A 1LPEA 3R2PA 1BZ4A 1LE4A 1LE2A 1H7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NFN A;  1OR2 A;  3S84 A;  1NFO A;  1AEP A;  1EA8 A;  1YA9 A;  1EQ1 A;  1LS4 A;  1GS9 A;  2KC3 A;  1OR3 A;  1B68 A;  1LPE A;  3R2P A;  1BZ4 A;  1LE4 A;  1LE2 A;  1H7I A; 
#chains in the Genus database with same CATH topology
 2ICW G;  1LI7 A;  3KH2 A;  3GM2 A;  2Q9A A;  4C7O B;  1ORS C;  5E3A A;  5T3T A;  2QNL A;  3FXH A;  3MLG A;  1Q0G A;  4K1O A;  3S84 A;  1AEP A;  4JJG A;  1APC A;  4J30 B;  1VOM A;  1BR2 A;  1JPJ A;  4BJT A;  3G4Z A;  1D1C A;  1H6G A;  1NZE A;  1Z6A A;  3G50 A;  1S7Z A;  2YL7 A;  4MVQ A;  4XPX A;  1OQC A;  2ZXP A;  3PCV A;  4YN0 B;  3UMI A;  4CS8 A;  4F4B A;  3K6B A;  1Z23 A;  5B3I A;  4U5D E;  4MTO A;  2WVQ A;  2GFH A;  2MYS A;  1D1B A;  1CGO A;  4FWV A;  4OIR F;  1JAF A;  3ZDL A;  3W8H A;  2W4B A;  3LJB A;  4AK9 A;  1GM5 A;  1YYX A;  1F1M A;  3M15 A;  3K7D A;  3FAP B;  4X0R A;  1M57 C;  1FMV A;  3T6B A;  1LE4 A;  3GEE A;  5DVW A;  3U2L A;  2L6F A;  1RMV A;  2EIL C;  4HFK B;  2EIJ C;  2OG2 A;  2NUP A;  1FNT c;  2PBE A;  5DQT A;  4ZLD A;  4IAO A;  1OCZ C;  3T6J A;  2EIN C;  2J9V A;  2JPU A;  3W4Y A;  4PJN A;  2IBF A;  1MND A;  1WN0 A;  2HSQ A;  4JUR I;  1QSP A;  4XEV A;  3T6G B;  3EGD B;  1ZU4 A;  2GA0 A;  1WWP A;  1TWG A;  2HSB A;  3B0U X;  2KC3 A;  1KTM A;  1G8X A;  1SZI A;  4OD5 A;  5E3C A;  3TD7 A;  2LK4 A;  5A6K A;  2LD6 A;  1D1A A;  4WAB A;  4BEJ A;  3EZI A;  3S28 A;  1ZHX A;  3EQL F;  3JCU Q;  4NTB A;  3ABM C;  3Q7L A;  1HE1 A;  2EPN A;  1BR4 A;  3C8Z A;  4YT4 A;  1SR2 A;  3GM3 A;  4MVO A;  1V54 C;  2EPO A;  3TUL A;  1YA7 O;  3GOR A;  3JSZ A;  1NU9 C;  3MX3 A;  4IAR A;  3VM6 A;  2WL8 A;  1EI7 A;  2XRH A;  3SZR A;  1G4U S;  3KPH A;  4DJ9 A;  1Z3I X;  1H7I A;  5L0J A;  1RJ9 B;  1D0Y A;  4MND A;  2A6E F;  4U5F E;  1E2X A;  3W2V A;  2VAS A;  1QZX A;  2DGJ A;  2G62 A;  2CCY A;  4U9E A;  4CS7 A;  3QVY A;  2HJM A;  1C02 A;  2KK1 A;  3LUT B;  5L0H A;  1E86 A;  4KI2 A;  2L6H A;  3TJ6 A;  4G7Z F;  4ULV A;  4PAC A;  5EHH A;  4O6Y A;  2HUJ A;  2IXO A;  4XPY A;  2XLE A;  4N06 A;  2XXA A;  3NMJ A;  1LI5 A;  4Q4Z F;  3C18 A;  2R7R A;  5BQH A;  4JTC B;  4ER9 A;  1YYJ A;  1M6T A;  1HMO A;  1YJG A;  2I15 A;  5COF A;  3LNM B;  3SYN A;  2B0J A;  4U5H A;  5KYU A;  4DRJ B;  4EUK B;  3G4X A;  3HNJ A;  3NDB B;  5B1B C;  4JTD B;  2WB7 A;  2IOQ A;  1ORY A;  4KBL A;  1LM3 B;  2VCC A;  4MW8 A;  1JOG A;  2A68 F;  1ZHW A;  1E85 A;  3WHN A;  4C3D A;  3AGT A;  1HY5 A;  1OR2 A;  3S9O A;  4YL1 A;  2PX3 A;  2WZF A;  2YL1 A;  3DKA A;  3K1I A;  3H65 A;  4I1M A;  5DQZ A;  2H7B A;  1OW7 A;  4H54 A;  3S27 A;  4C3B A;  3FVY A;  2KNH A;  3RQF A;  2HS5 A;  4YK5 A;  5KYY A;  5F5F A;  3GWN A;  1SF8 A;  2J7P A;  5JUA A;  2NSF A;  1YLM A;  3N2Z B;  4C7O A;  3M4C A;  2I8B A;  4BG0 A;  2GAQ A;  4U9D A;  3ZG1 A;  3SP1 A;  1Y4C A;  1QQ3 A;  1JPN A;  5TJ5 E;  1TFK B;  2LIG A;  3DJN B;  3AG3 C;  4JZA A;  1HW2 A;  3JRT A;  1PV3 A;  1YAR O;  1ZHZ A;  2KYH A;  2Y3B A;  4O6N A;  3W2W A;  4C3E A;  1H9T A;  2J8W A;  1TQG A;  3VF0 A;  1TFO B;  2Q4F A;  3IQ6 A;  3ITF A;  3K1I C;  1IZM A;  3PMR A;  4LAC B;  4PJJ A;  4R32 A;  3M1C B;  2AVK A;  3C63 A;  3HNL A;  2H8A A;  4CDY A;  4PR9 A;  5HSW A;  5COM A;  3MYI A;  3L34 A;  4KC9 A;  5BQI A;  4CSA A;  1ZZP A;  2R7Q A;  1XZQ A;  5CI9 A;  1AVO B;  3WAQ A;  1JR8 A;  1S05 A;  2R7O A;  3F46 A;  1T6Q A;  3WOD F;  4JEA A;  1OCO C;  4BEM J;  3HTK C;  2HV6 A;  1M2V B;  3K66 A;  2J9B A;  3QW1 A;  3R2P A;  4FES A;  2AWC A;  4YL3 A;  4ULW A;  4XLP F;  1FMW A;  2L7A A;  1FFH A;  2MWQ A;  2QUP A;  3K33 A;  2YRF A;  3U3F A;  3AJM A;  4BJ6 A;  3U5S A;  1U0B B;  2W45 A;  3EGD A;  4J7Y A;  4BJ1 A;  3V5X A;  2Q9C A;  1K40 A;  1MMD A;  4ZLC A;  2HJ3 A;  2V3C C;  5KYX A;  1A0B A;  4RBN A;  2NG1 A;  4N6H A;  3CAX A;  1JMW A;  4MVM A;  2R7S A;  1O87 A;  5A6B A;  2L9J A;  1HE9 A;  4XLN F;  4O6M A;  2P1A A;  4YL0 A;  2W9Y A;  3EGX A;  5JRA A;  3RQG A;  1TWA A;  3RVZ A;  2LSE A;  1OW8 A;  2OQM A;  3AG1 C;  2R7X A;  2Q00 A;  1NSG B;  3KL4 A;  2IXM A;  3HKK A;  3NKE A;  1Z7Q c;  5B3S C;  5IY5 C;  5DS5 A;  1TR2 A;  2XLV A;  3NRH A;  4MS2 A;  4AE4 B;  5E2Q A;  4QI2 A;  2H7O A;  2PF4 E;  3M79 A;  5JVE A;  4PJM A;  4YT5 A;  1D0Z A;  2AU5 A;  2AP3 A;  3R7C A;  4YJW A;  1ZHT A;  2P6V A;  3NKD A;  3QTH A;  4BJ6 C;  3CQZ A;  1FR0 A;  2YLI A;  3EFO A;  4GYT A;  4EBB A;  1CPQ A;  1Q0F A;  4E0I A;  3V5Z A;  5HV9 A;  3QZC A;  3FHD A;  2W4M A;  3US6 A;  3DD7 A;  3ECS A;  1ZVZ A;  3TOM A;  3PHF 2;  4AL0 A;  2HMQ A;  3S29 A;  2XLM A;  1NFN A;  1Z5Z A;  2OJE D;  3VRC A;  5A6A A;  5JT4 A;  1LVK A;  3DM5 A;  1TWC A;  5A6J A;  4BJ5 A;  5T3W A;  4J32 B;  2VCA A;  4WGZ A;  4CS8 C;  4Q5S F;  3FAJ A;  3C62 A;  3L8I A;  3OWT A;  5L0G A;  1A7E A;  3ZQV A;  2C03 A;  2FGY A;  3KKB A;  1PD1 A;  2PFD A;  2YWA A;  4CIP A;  4UDV A;  4W8K A;  2A0B A;  1MNE A;  2OEV A;  2WVN A;  2J9U A;  3POV A;  4K7B A;  4DVZ A;  1WTY A;  3CSK A;  1KU2 A;  3E9V A;  1NU7 D;  3AQB A;  2EIK C;  4QDL A;  2CYD A;  2FAP B;  4DRH B;  1V55 C;  2DB4 A;  1TWH A;  1Q0K A;  1YDI A;  2GWW A;  1VYK A;  4W8P A;  1QVX A;  2DI3 A;  3LNR A;  2LQG A;  4Z9J A;  1VYI A;  2J9W A;  2M64 A;  2YL0 A;  5DLJ A;  4EBJ A;  3OEO A;  5KYW B;  4CS9 A;  2J0W A;  3HLZ A;  4EHP A;  4JJF A;  5L3V A;  2R7V A;  3LES A;  3B0P A;  2CGE A;  2YLD A;  3SXZ A;  3VYW A;  3AQC A;  2OEX A;  4B6I A;  3I5P A;  3IQ5 A;  2J45 A;  1EA8 A;  1U6H A;  2P7V A;  4G0H A;  3UGO A;  3C8G D;  4LER A;  3RQE A;  2JD3 A;  3N0T A;  1FAP B;  2XLO A;  5B1A C;  3U2M A;  5COG A;  1M56 C;  2XM4 A;  1OR3 A;  2R7W A;  4OIQ F;  4CDV A;  2TMV P;  1EQ1 A;  1T5O A;  2NUT A;  5D91 A;  1OXB A;  3FMS A;  1BDJ B;  5GPG B;  1E83 A;  1Q0D A;  3ZSU A;  4OD4 A;  1BZ4 A;  1O5H A;  1R4T A;  2NPU A;  2IXP A;  1OXK A;  2ZXO A;  1Y6D A;  4E17 A;  4MVR A;  3SNH A;  3HNI A;  4K0D A;  5FCL A;  1LE2 A;  5FZT A;  1BR1 A;  2Y3H A;  2YVK A;  4CS9 C;  1OKK A;  3LLI A;  5BUO A;  1LS1 A;  1HMD A;  1V74 B;  3O6X A;  3GOD A;  2L81 A;  1T6I A;  1Q0M A;  1XWJ A;  2HV7 A;  4JW1 A;  5KYN A;  2CDQ A;  4DOZ A;  3IQC A;  4MVU A;  3LEO A;  5JSL A;  4XPW A;  2NUP B;  4CIH A;  5EGY A;  4I3M A;  3KMI A;  1RKE A;  2E87 A;  2PX0 A;  1MMG A;  5L3Q A;  2NSG A;  3NMI A;  1GQA A;  3X2Q C;  2B0H A;  2HZ8 A;  4G78 A;  4HE8 D;  3L8J A;  2O9X A;  2PNO A;  4G7H F;  4N6C A;  4NC3 A;  3NMK A;  2R7U A;  3M4B A;  4IJJ A;  1UG7 A;  4U5B E;  2ZXR A;  4GEH A;  3H2U A;  1PCX A;  2D4U A;  4U5C E;  3ATP A;  2KGO A;  5F28 E;  3LAY A;  1G5Z A;  1CPR A;  2D5R B;  4JCH A;  2MHR A;  1NFO A;  2OCC C;  2RSE B;  2BE5 F;  3RVY A;  5A69 A;  5L0C A;  1WGW A;  3KYI A;  5DS6 A;  1G4W R;  1LS4 A;  1K05 A;  1SMY F;  2Y3D A;  2G3K A;  3EH1 A;  2WVO A;  4JIO A;  4N4W A;  4P9F A;  1T6U A;  3RKO F;  3VAY A;  2F22 A;  3ZQY A;  4A2N B;  1EKY A;  1OW6 A;  4OIN F;  1AUE A;  4XEK A;  5EK0 A;  4BPM A;  1FTS A;  4U5E E;  4A4A A;  3DE9 A;  3CZ6 A;  2LP4 A;  3UNG C;  3EZH A;  2EPK X;  2QLA A;  2QE9 A;  1LKX A;  3GAN A;  3QMK A;  3BRJ A;  1QKR A;  1VLT A;  2XS1 A;  4XEF A;  5JP7 A;  3OA1 A;  2XXA B;  4CJO A;  4QI0 A;  4HEA J;  4IAQ A;  3UGP A;  1T01 A;  3KYJ A;  4EBK A;  1H9G A;  3GEH A;  3ZIB A;  3ZC4 A;  2LCH A;  2KW3 C;  4JVS A;  1ST6 A;  4MVS A;  5KYU B;  4ANJ A;  1L3P A;  2OKU A;  2J46 A;  4CX9 A;  3L1M A;  3B0V C;  1ZW2 A;  1NLX A;  2C04 A;  1I5N A;  4IWB A;  4PFO A;  4EKW A;  1MQV A;  2OU6 A;  3TK0 A;  4AX2 A;  4CSA C;  3QW0 A;  3TJ5 A;  3ASN C;  1RKC A;  3JT1 A;  2FFH A;  2QTV A;  3DI5 A;  5KYW A;  2X51 A;  3L0I A;  3I5Q A;  1RJ9 A;  1VMA A;  1L7C A;  4NCQ A;  4JKV A;  4DBQ A;  1DOV A;  1OCC C;  1ZU5 A;  2IM8 A;  2V26 A;  5CIV A;  2LFF A;  1QLE C;  2VH3 A;  4OIO F;  3SEO A;  3LS1 A;  4IB4 A;  4WGY A;  5KYY B;  2VC9 A;  3DM9 B;  1MMA A;  3SXK A;  3U8P A;  4H4K C;  4HFF B;  1JRA A;  3DWW A;  5AGF A;  2H7V C;  2P0N A;  2UUI A;  2A69 F;  1Z63 A;  3Q7G A;  3DAG A;  4YT8 A;  1NBB A;  2YKZ A;  2XL8 A;  3DAF A;  1RXQ A;  2Y39 A;  1YZC A;  3U3B A;  2WZL A;  3LLK A;  4PK4 A;  2XL4 A;  1BBH A;  3C8G B;  3JSE O;  4JC7 A;  3SXY A;  4P6I C;  5CI8 A;  1PD0 A;  1I4Y A;  1ZHY A;  1WAT A;  1OKK D;  3EHN A;  1U89 A;  4NTA A;  4RD9 A;  2G3V A;  1WAS A;  2ZXW C;  1VTM P;  3U8V A;  2R03 A;  3GWL A;  3EHM A;  2CNW A;  4PJL A;  256B A;  5JLI A;  1RCP A;  3Q6N A;  1LIH A;  2XLW A;  4IGG A;  5K0I A;  3FDQ A;  2HKV A;  5AC4 A;  4NQF A;  3ZVR A;  4Z9H A;  2L6G A;  3O39 A;  5L0F A;  4E0H A;  2UUH A;  1WOL A;  2HFI A;  5BQG A;  2R7T A;  1ZW3 A;  2J7P D;  2R02 A;  3TQO A;  1I4Z A;  2ZD9 A;  1YVI A;  2YLG A;  3EG9 B;  4J7T A;  4GQH A;  3U9J A;  4U5G A;  3O55 A;  3T4R A;  5DS4 A;  1N1C A;  3NG1 A;  2R05 A;  3V7O A;  4BJ5 C;  3QVZ A;  2Q9B A;  3F47 A;  4EIY A;  5KYX B;  3DJU B;  2BC5 A;  3DE8 A;  1W2W A;  3W8I A;  3DZA A;  3IEE A;  1CGM E;  3S90 A;  3HNK A;  3ZTM A;  2A0U A;  4JEB A;  2PP4 A;  4NY3 A;  3DMD A;  1MMN A;  3MYF A;  4CBE A;  4Q7C A;  1SYQ A;  3EGX B;  2DYR C;  2DYS C;  1UFB A;  2VCB A;  3ASO C;  3Q6M A;  3K1H A;  4XTK A;  1OCR C;  2YL3 A;  3ZTZ A;  2X0C A;  1ZYR F;  1A41 A;  4LLC A;  3AOU A;  3I4U A;  3A9C A;  3V5Y A;  4I1O B;  1A7V A;  1J8Y F;  2XM0 A;  3EFO B;  3IQT A;  4MW3 A;  4P9T A;  4DRI B;  2XS8 A;  1M2V A;  2AWY A;  3N24 A;  4KNV A;  3RYL A;  3JYY A;  3IPM O;  3EJN A;  4XWJ A;  3UMK A;  4D4N A;  4D4X A;  2R9R B;  3AGU A;  2GDC A;  4KNW A;  3RF3 A;  1B68 A;  2Z15 A;  4DXW A;  4Z9I A;  4JCZ A;  5A6B D;  3WG7 C;  3AG4 C;  3MBG A;  3O10 A;  4LLE A;  2YHS A;  3EH2 A;  2OJQ A;  2ETS A;  3H2V A;  3NYJ A;  4FAP B;  3C7J A;  2EPL X;  3T9O A;  3NYM A;  3RFY A;  2A6H F;  3JZ0 A;  2A1D D;  2P61 A;  2R25 A;  4O79 A;  4M63 A;  3HJC A;  2YZS A;  1NG1 A;  4XQ1 A;  1VLS A;  3ZWI A;  4YT2 A;  1V4A A;  1YAU O;  4LDK A;  2YEV A;  3A11 A;  3CEX A;  2LFD A;  2CW0 F;  5D92 A;  3UMH A;  4AL1 A;  3ABK C;  4AE4 A;  5JS5 A;  2XSE A;  4JE9 A;  2XLD A;  4JTA B;  4I44 A;  1A7D A;  2EPM X;  4CJG A;  3S0X A;  1KNY A;  1O3U A;  1YA9 A;  1CGN A;  2YQY A;  4MVZ A;  1ORJ A;  3LEV A;  3UR3 C;  1K04 A;  3PDM P;  2XL6 A;  4E7S A;  1DOW A;  2J0X A;  3B71 A;  4MQ9 F;  2VB6 A;  3BEH A;  4E18 A;  4E7Z A;  3GEI A;  4ONS A;  5L0I A;  4WJ0 A;  1C17 M;  3AG2 C;  3FOP A;  2RD9 A;  3ABL C;  2WZG A;  4FX5 A;  4OIP F;  3JYH A;  5F5H A;  3B9Q A;  3IHU A;  1J8M F;  3C8G A;  3TOL A;  3DXJ F;  2NUT B;  2BL2 A;  1R5I D;  3U9M A;  2KSF A;  2OOC A;  4MTG A;  2CNW D;  1TKN A;  4NTF A;  1HW1 A;  1FFT C;  3X1O A;  2KQ9 A;  2Y3G A;  1IW7 F;  2ZPA A;  3B29 A;  3NYL A;  4LDR A;  3RH3 A;  4RDA A;  2JX0 A;  4DBR A;  3RW0 A;  4MTF A;  4LDQ A;  5E33 A;  1D0X A;  4IRU A;  4YWQ A;  1GS9 A;  2QY9 A;  4G7O F;  4CDA A;  1QPU A;  4L6R A;  4JRZ A;  2IYL D;  1LPE A;  1XZP A;  2IXN A;  2XLH A;  3GM1 A;  3JRM O;  1E84 A;  1C03 A;  3RIP A;  3MFN A;  1VK5 A;  1M2O A;  4DVY P;  1VB5 A;  3EPV A;  3EG9 A;  3JTL O;  4PFP A;  2HMZ A;  3SXM A;  2EIM C;  2Q7R A;  4EWC A;  1T9K A;  5AC5 A;  5L0D A;  3U0C A;  3J06 A;  1GGQ A;  2ASR A;  3FOO A;  4O7G A;  2Y69 C;  1RKE B;  3LS0 A;  2Q3T A;  5T1D B;  2KJG A;  3E70 C;  2M4E A;  1YZA A; 
#chains in the Genus database with same CATH homology
 1NFN A;  1OR2 A;  3S84 A;  1NFO A;  1AEP A;  1EA8 A;  1YA9 A;  1EQ1 A;  1LS4 A;  1GS9 A;  2KC3 A;  1OR3 A;  1B68 A;  1LPE A;  3R2P A;  1BZ4 A;  1LE4 A;  1LE2 A;  1H7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...