1YA9A

Crystal structure of the 22kda n-terminal fragment of mouse apolipoprotein e
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
174
structure length
168
Chain Sequence
PEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAGVSAIRERLGPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering conformational destabilization into mouse apolipoprotein E. A model for a unique property of human apolipoprotein E4
pubmed doi rcsb
source organism Mus musculus
molecule tags Lipid transport
molecule keywords Apolipoprotein E
total genus 71
structure length 168
sequence length 174
ec nomenclature
pdb deposition date 2004-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1ya9A00
1LE4A 1LPEA 1AEPA 1EA8A 1OR3A 3S84A 1NFNA 1B68A 1EQ1A 1LS4A 2KC3A 1YA9A 3R2PA 1BZ4A 1NFOA 1LE2A 1GS9A 1OR2A 1H7IA
chains in the Genus database with same CATH superfamily
2CYDA 5B1AC 4JURI 2GWWA 2ZD9A 3C7JA 3LEVA 2XL6A 1Z23A 1NU9C 4MW8A 3KMIA 2YL1A 2AU5A 3LJBA 3PDMP 1V74B 2AP3A 4PACA 1QVXA 3SXYA 3RH3A 2HJ3A 2P1AA 1QLEC 3B29A 3M1CB 2FAPB 1I4YA 4CS7A 5FCLA 5B1BC 2LFFA 1GM5A 1DOWA 3FVYA 4BJ6A 1OKKA 2PX0A 1E86A 2Y3HA 3UMKA 3Q6NA 2Q3TA 2GA0A 1LVKA 4FESA 3UNGC 2P61A 3U3FA 4I1MA 2XSEA 3EFOB 1W2WA 1CPQA 1Z7Qc 1DOVA 4KC9A 4M63A 1T6UA 1TWGA 4OIRF 4KI2A 2KQ9A 3G50A 1RCPA 1VYIA 1QSPA 1WN0A 1Y6DA 2A68F 2YZSA 3DZAA 3W8IA 4BJ1A 1SF8A 3U8VA 1PCXA 1TR2A 1HMDA 1Z3IX 4PFOA 4U5FE 1LPEA 2CW0F 2J9VA 3HNIA 3DMDA 3GORA 3S9OA 2WB7A 4MTGA 4O6MA 4JTCB 4OIOF 3U0CA 5IY5C 2EIKC 1D0YA 3QMKA 5KYUA 3Q7LA 2HZ8A 3FOOA 3AG4C 3QW0A 4E0HA 1FMWA 2D4UA 3DAFA 4BJ5A 4U9EA 2LIGA 3TJ6A 1R4TA 3ZIBA 3MLGA 4CS8A 3SEOA 2KW3C 3NKEA 2PFDA 4RBNA 2Q7RA 4PK4A 3RIPA 4HFFB 3SXKA 3ZDLA 4MNDA 2OU6A 2HMQA 2R7UA 3HNKA 4YT5A 5AGFA 2MYSA 3POVA 3TQOA 1TFOB 2IM8A 2HSBA 2P7VA 3EQLF 4HEAJ 1LI5A 1TKNA 2V26A 4MTOA 1V54C 3ITFA 1XWJA 3K6BA 1BR4A 1SZIA 1YZAA 4G7HF 3CEXA 1HW2A 3W4YA 1GGQA 3AJMA 4YT4A 3NMKA 3UMHA 2HJMA 3GWNA 3K1IA 3L0IA 4EKWA 2DGJA 1OKKD 4Z9JA 3GM3A 4JIOA 2OEVA 4U5BE 3WHNA 4NC3A 1H9TA 1LE4A 4D4NA 1E84A 4EIYA 1HMOA 2H7OA 2Y3BA 2KJGA 3B0VC 2X0CA 5F28E 3VM6A 4CBEA 1Q0GA 1LI7A 1M6TA 1VOMA 3FHDA 4JW1A 5E2QA 1A0BA 3EGDA 2CNWD 3N24A 3H2VA 3QZCA 1O5HA 3C8GD 1TQGA 2Z15A 3FDQA 1JR8A 2OJQA 1SR2A 5L0GA 4XPXA 4C7OB 3HNJA 1IW7F 2C04A 3L34A 4E7ZA 2YKZA 1C02A 3IQ6A 2XLOA 1I5NA 2XM0A 2YWAA 1D1BA 1OXKA 4YL0A 4I1OB 1J8YF 2EIMC 3FMSA 4O7GA 2KYHA 1K05A 4QI0A 3CSKA 4E18A 4D4XA 1TWHA 3LAYA 5A6BD 2XLWA 1S7ZA 2LK4A 1T01A 3C8GB 4MVUA 3RW0A 2V3CC 1KNYA 1WATA 3LNMB 4YN0B 1C03A 4U5CE 4EBJA 2NUTB 1FR0A 2LCHA 2GAQA 3LS1A 3I5QA 2NSGA 1HY5A 4Q5SF 3UGPA 3NYMA 4I44A 4J7TA 4EHPA 4UDVA 4PJJA 1Z5ZA 2JX0A 2LD6A 2A6EF 3L1MA 3VYWA 1G5ZA 2HV6A 4OINF 1HE9A 2HKVA 1YVIA 5KYUB 4JJGA 2PP4A 3GM2A 2WZGA 4J30B 3TD7A 2YEVA 2VCBA 5DQZA 4DRIB 1VB5A 2XLEA 4OIPF 2EPNA 2WVQA 4W8PA 2C03A 3Q7GA 1VLTA 5TJ5E 2ZXPA 3X1OA 2EPMX 2H7BA 4MVRA 4EBKA 1KTMA 1T6IA 3J06A 4G7OF 3FAJA 1YYXA 4YT8A 1T5OA 1V55C 2Q4FA 2NUTA 3GEHA 4AL1A 4N4WA 2UUIA 3S29A 5A6KA 3U9JA 3E9VA 3T9OA 4HE8D 5L0CA 2XS1A 2VH3A 4ULWA 2NSFA 3C8ZA 2NPUA 4U5EE 4ANJA 2OKUA 1H9GA 3JCUQ 1ZU5A 4XEVA 4JRZA 1KU2A 3HKKA 5CI8A 1ORJA 1A41A 1H6GA 4IWBA 4L6RA 3VF0A 2AWCA 1WGWA 5AC5A 4QI2A 2IXNA 5KYNA 4LLEA 2NUPA 2Y3DA 3OEOA 2UUHA 2XS8A 5F5FA 4K1OA 1M2VB 3IQTA 2YL0A 4MS2A 4C3BA 5DS6A 3DJNB 3GEIA 3O6XA 2W45A 4LLCA 3SYNA 5HV9A 3GODA 4X0RA 5FZTA 2OOCA 1ST6A 3M4BA 1PV3A 3KL4A 3ABMC 4EUKB 3C63A 4BEMJ 5BQIA 2QE9A 2L81A 3NMIA 3MBGA 2CDQA 3EFOA 2XM4A 3IPMO 4P6IC 2A1DD 2R03A 3EJNA 4YK5A 3SP1A 3ZG1A 4BJ5C 5A6BA 1N1CA 3AGTA 3QTHA 2Y39A 4XQ1A 1LS1A 1Z6AA 4P9FA 1WTYA 3ZTMA 4EWCA 5JSLA 2WVNA 3QVZA 1NU7D 1OXBA 4JCZA 5EK0A 4JC7A 4XEKA 3DKAA 4IARA 4CIPA 4DRJB 256BA 1Y4CA 2H8AA 1ZHZA 3IEEA 2ASRA 1MMGA 1BR1A 2KSFA 3CZ6A 1RKCA 4KNWA 1BR2A 5T3TA 4KBLA 3DE9A 4BEJA 1UG7A 2G3KA 2MWQA 2Q00A 2QY9A 4KNVA 3WG7C 5HSWA 2XRHA 3RF3A 3SXMA 4N6HA 4ZLCA 2ZXOA 3ASNC 3EHNA 3I5PA 1CPRA 1VMAA 2BE5F 4H4KC 4FX5A 4I3MA 2R7RA 4PFPA 3Q6MA 2J9WA 3IQCA 5JT4A 3RQGA 3ATPA 3S27A 4JTDB 3QVYA 3RKOF 3AOUA 3AQCA 2WVOA 1LM3B 2XL4A 3RQEA 1OCRC 3M4CA 4G7ZF 1NBBA 1WASA 3QW1A 4GYTA 4O79A 2G62A 3B71A 4DRHB 4PJMA 4XPWA 4WGZA 3KKBA 4JJFA 4ER9A 3AGUA 2M4EA 3F47A 1SYQA 2MHRA 3JYHA 4YL1A 1YDIA 3UR3C 1O87A 4CDVA 3KYJA 2JPUA 3I4UA 3NYLA 3V5YA 3HTKC 1E2XA 4PR9A 3ASOC 1V4AA 3DAGA 3SXZA 5K0IA 4C7OA 3S0XA 2VCCA 1Q0FA 4HFKB 3TULA 1PD1A 3U2LA 4CSAA 1JAFA 5D91A 4XTKA 3B0PA 4JE9A 2JD3A 4F4BA 2FFHA 2KC3A 4RD9A 2D5RB 4XLPF 3UGOA 4AE4A 3IHUA 3NKDA 1H7IA 1L3PA 4XEFA 5COFA 3O10A 3EG9A 5DS4A 1NFNA 4Z9HA 2J9UA 4N6CA 1LS4A 5COMA 4CS9C 1YA9A 5A6AA 1FFTC 1AUEA 3EGDB 3OA1A 1NFOA 3U5SA 2DYSC 3C62A 1TWCA 5DS5A 1CGNA 1FNTc 1ZU4A 2R9RB 4K0DA 1YAUO 3EHMA 4J7YA 1ZHYA 2Q9BA 4BJ6C 2A0UA 5A69A 3T6GB 4N06A 2IXMA 3LUTB 3ZQVA 4WJ0A 1QQ3A 4OD4A 3O55A 3TOLA 2L9JA 3K7DA 3V7OA 4AL0A 1RKEB 2PNOA 1AEPA 4LDQA 5L0IA 2EILC 4ZLDA 4A4AA 3T6BA 2EPKX 2CGEA 4C3EA 4K7BA 2QNLA 2W9YA 1T6QA 2O9XA 3A11A 4OIQF 3N2ZB 4BG0A 1E83A 4JEBA 4OD5A 1FTSA 4IJJA 4CDYA 2CCYA 3VAYA 5COGA 2IBFA 3M15A 4DJ9A 5JLIA 2P0NA 3DXJF 4G78A 2I8BA 4BPMA 2OEXA 3AG3C 3B9QA 4R32A 3N0TA 3ZQYA 4E7SA 1VTMP 3R7CA 4CSAC 2DI3A 3DJUB 4G0HA 4IAOA 5L3VA 2QTVA 1QKRA 1VLSA 2WZLA 3GEEA 3C8GA 5T1DB 3GANA 2J45A 2WZFA 1YARO 2HMZA 2Y3GA 4NTAA 5E3AA 4CIHA 3W2VA 4Q7CA 4JZAA 3T4RA 3JRMO 3R2PA 4W8KA 4ULVA 5D92A 1FMVA 4JEAA 3L8JA 2J7PA 3EH2A 4AK9A 1R5ID 1Q0DA 4CX9A 2L7AA 3OWTA 4MVSA 1AVOB 1FAPB 2ETSA 4LDRA 4NQFA 4DVYP 1MMAA 2XLHA 1EA8A 4P9TA 4U5DE 2R7XA 2DB4A 2XXAB 1JRAA 1M2VA 4U5HA 4XPYA 2IXOA 3ECSA 3K1IC 3LEOA 3ZC4A 4C3DA 1OR2A 4GQHA 3MFNA 1MQVA 3US6A 3K1HA 4YJWA 2L6FA 2EPOA 1OQCA 2OQMA 1J8MF 4LERA 4MVZA 1RJ9B 1U6HA 1LE2A 1WWPA 4A2NB 5EHHA 4DVZA 2HV7A 2P6VA 2IOQA 2J9BA 2YRFA 3UMIA 1A7VA 2RSEB 2ICWG 2Q9CA 3AQBA 1Q0KA 3DI5A 1LKXA 3KH2A 2W4BA 2B0HA 3A9CA 4WABA 2J46A 3PMRA 3DE8A 1TWAA 4FAPB 2A69F 5A6JA 3DM9B 3RVZA 2IXPA 3JZ0A 4NTBA 1G4WR 3EGXB 2BL2A 4YWQA 3NDBB 3B0UX 1C17M 4FWVA 3L8IA 1QPUA 5KYYB 3S84A 3CQZA 5GPGB 3PCVA 1MNEA 2HSQA 3EGXA 4O6YA 5DLJA 4E17A 2EPLX 1MNDA 1A7EA 2YHSA 1SMYF 2G3VA 3NMJA 1YA7O 1D0XA 1ZHXA 4JCHA 4U9DA 3WODF 4JVSA 3ZWIA 1OW7A 4CDAA 1I4ZA 1G8XA 2XLDA 3KPHA 2YVKA 4AX2A 3JTLO 5CI9A 3AG2C 3U3BA 5DVWA 1ZZPA 2XLVA 4JTAB 1D1AA 5BQGA 4BJTA 3PHF2 2FGYA 1M2OA 4YT2A 3AG1C 4XWJA 1OCOC 3LESA 3LNRA 2LQGA 3MYFA 3NYJA 2X51A 2LFDA 4PJLA 2YL7A 3JSEO 3TK0A 1ZW2A 4IGGA 1M56C 1CGOA 2J0WA 4J32B 4Z9IA 2TMVP 3RYLA 2A6HF 5L3QA 5DQTA 1YLMA 1GQAA 5L0JA 3JRTA 1EI7A 1YYJA 1HE1A 1ORSC 1LIHA 2HS5A 2L6HA 3BEHA 5F5HA 5B3IA 4Q4ZF 5JS5A 1OW8A 1RJ9A 2W4MA 3WAQA 4DOZA 4EBBA 1MMDA 4DBRA 5JVEA 1RKEA 3H2UA 5BQHA 1OW6A 3X2QC 3MYIA 2R02A 3ABLC 4H54A 1QZXA 2KGOA 1A7DA 1PD0A 2GFHA 1MMNA 4E0IA 3TOMA 4MW3A 3EPVA 1FFHA 1L7CA 2CNWA 3EH1A 3MX3A 3RQFA 1NZEA 2YQYA 4QDLA 4XLNF 1APCA 2OCCC 1RXQA 2RD9A 4NTFA 2GDCA 3M79A 1NG1A 1BZ4A 1YZCA 2I15A 5T3WA 4DXWA 1BDJB 3W2WA 3ZTZA 3LLKA 4MTFA 4YL3A 2YLDA 3VRCA 4CJOA 2VB6A 2PX3A 3FXHA 1JOGA 5B3SC 5L0HA 4MQ9F 1K40A 3CAXA 2R7VA 2Q9AA 3JSZA 2F22A 3NRHA 3HJCA 1HW1A 4U5GA 1Z63A 3BRJA 3SZRA 1EQ1A 3FAPB 3E70C 2VCAA 2XLMA 4B6IA 3NG1A 1Q0MA 2Y69C 2R7WA 2R7TA 3C18A 4PJNA 1GS9A 3V5XA 1K04A 1XZQA 5E3CA 5EGYA 1ZYRF 2HUJA 3IQ5A 1XZPA 2R25A 1G4US 4CS8C 2PF4E 2YLIA 3LLIA 2L6GA 1OR3A 2YLGA 4MVOA 3SNHA 2OG2A 4RDAA 5JP7A 3W8HA 5AC4A 3K33A 4CS9A 2XXAA 1OCCC 2J8WA 2E87A 3EG9B 3ABKC 1TFKB 2M64A 3KYIA 4IRUA 3U8PA 4CJGA 3GM1A 3HLZA 4IB4A 1NSGB 4JKVA 3DWWA 3JYYA 4NCQA 1IZMA 1S05A 1F1MA 3DM5A 2PBEA 3T6JA 3O39A 5KYXA 2HFIA 5KYWA 2VC9A 3TJ5A 1E85A 5JRAA 5CIVA 3FOPA 4WGYA 3U9MA 2H7VC 5BUOA 2ZPAA 2R7SA 3G4XA 1UFBA 3F46A 1D0ZA 2QUPA 4LACB 4NY3A 5E33A 1CGME 3EZHA 1ZHWA 1EKYA 2VASA 3H65A 2AVKA 2LSEA 5L0FA 2LP4A 2R7OA 2A0BA 1U0BB 2NG1A 1YJGA 1JMWA 3V5ZA 4AE4B 3EZIA 3LS0A 3RFYA 2ZXRA 1WOLA 3ZVRA 1NLXA 1T9KA 4ONSA 3GWLA 5KYWB 5KYXB 2QLAA 2R05A 2EINC 2R7QA 4LDKA 1OCZC 1U89A 2XL8A 2ZXWC 4O6NA 3S28A 3ZSUA 2J7PD 2IYLD 5L0DA 2KK1A 2WL8A 2YL3A 2EIJC 1VK5A 2DYRC 3K66A 1RMVA 3S90A 2AWYA 2BC5A 3DD7A 1BBHA 1ZW3A 2J0XA 3U2MA 1VYKA 1ZHTA 4DBQA 4MVMA 1M57C 4GEHA 2OJED 1ZVZA 2NUPB 3G4ZA 1B68A 1JPNA 2KNHA 5JUAA 1O3UA 1D1CA 1ORYA 4IAQA 5KYYA 1JPJA 3HNLA 2B0JA 4MVQA 3RVYA 3JT1A
chains in the Genus database with same CATH topology
1LE4A 1LPEA 1AEPA 1EA8A 1OR3A 3S84A 1NFNA 1B68A 1EQ1A 1LS4A 2KC3A 1YA9A 3R2PA 1BZ4A 1NFOA 1LE2A 1GS9A 1OR2A 1H7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LE4 A;  1LPE A;  1AEP A;  1EA8 A;  1OR3 A;  3S84 A;  1NFN A;  1B68 A;  1EQ1 A;  1LS4 A;  2KC3 A;  1YA9 A;  3R2P A;  1BZ4 A;  1NFO A;  1LE2 A;  1GS9 A;  1OR2 A;  1H7I A; 
#chains in the Genus database with same CATH topology
 2CYD A;  5B1A C;  4JUR I;  2GWW A;  2ZD9 A;  3C7J A;  3LEV A;  2XL6 A;  1Z23 A;  1NU9 C;  4MW8 A;  3KMI A;  2YL1 A;  2AU5 A;  3LJB A;  3PDM P;  1V74 B;  2AP3 A;  4PAC A;  1QVX A;  3SXY A;  3RH3 A;  2HJ3 A;  2P1A A;  1QLE C;  3B29 A;  3M1C B;  2FAP B;  1I4Y A;  4CS7 A;  5FCL A;  5B1B C;  2LFF A;  1GM5 A;  1DOW A;  3FVY A;  4BJ6 A;  1OKK A;  2PX0 A;  1E86 A;  2Y3H A;  3UMK A;  3Q6N A;  2Q3T A;  2GA0 A;  1LVK A;  4FES A;  3UNG C;  2P61 A;  3U3F A;  4I1M A;  2XSE A;  3EFO B;  1W2W A;  1CPQ A;  1Z7Q c;  1DOV A;  4KC9 A;  4M63 A;  1T6U A;  1TWG A;  4OIR F;  4KI2 A;  2KQ9 A;  3G50 A;  1RCP A;  1VYI A;  1QSP A;  1WN0 A;  1Y6D A;  2A68 F;  2YZS A;  3DZA A;  3W8I A;  4BJ1 A;  1SF8 A;  3U8V A;  1PCX A;  1TR2 A;  1HMD A;  1Z3I X;  4PFO A;  4U5F E;  1LPE A;  2CW0 F;  2J9V A;  3HNI A;  3DMD A;  3GOR A;  3S9O A;  2WB7 A;  4MTG A;  4O6M A;  4JTC B;  4OIO F;  3U0C A;  5IY5 C;  2EIK C;  1D0Y A;  3QMK A;  5KYU A;  3Q7L A;  2HZ8 A;  3FOO A;  3AG4 C;  3QW0 A;  4E0H A;  1FMW A;  2D4U A;  3DAF A;  4BJ5 A;  4U9E A;  2LIG A;  3TJ6 A;  1R4T A;  3ZIB A;  3MLG A;  4CS8 A;  3SEO A;  2KW3 C;  3NKE A;  2PFD A;  4RBN A;  2Q7R A;  4PK4 A;  3RIP A;  4HFF B;  3SXK A;  3ZDL A;  4MND A;  2OU6 A;  2HMQ A;  2R7U A;  3HNK A;  4YT5 A;  5AGF A;  2MYS A;  3POV A;  3TQO A;  1TFO B;  2IM8 A;  2HSB A;  2P7V A;  3EQL F;  4HEA J;  1LI5 A;  1TKN A;  2V26 A;  4MTO A;  1V54 C;  3ITF A;  1XWJ A;  3K6B A;  1BR4 A;  1SZI A;  1YZA A;  4G7H F;  3CEX A;  1HW2 A;  3W4Y A;  1GGQ A;  3AJM A;  4YT4 A;  3NMK A;  3UMH A;  2HJM A;  3GWN A;  3K1I A;  3L0I A;  4EKW A;  2DGJ A;  1OKK D;  4Z9J A;  3GM3 A;  4JIO A;  2OEV A;  4U5B E;  3WHN A;  4NC3 A;  1H9T A;  1LE4 A;  4D4N A;  1E84 A;  4EIY A;  1HMO A;  2H7O A;  2Y3B A;  2KJG A;  3B0V C;  2X0C A;  5F28 E;  3VM6 A;  4CBE A;  1Q0G A;  1LI7 A;  1M6T A;  1VOM A;  3FHD A;  4JW1 A;  5E2Q A;  1A0B A;  3EGD A;  2CNW D;  3N24 A;  3H2V A;  3QZC A;  1O5H A;  3C8G D;  1TQG A;  2Z15 A;  3FDQ A;  1JR8 A;  2OJQ A;  1SR2 A;  5L0G A;  4XPX A;  4C7O B;  3HNJ A;  1IW7 F;  2C04 A;  3L34 A;  4E7Z A;  2YKZ A;  1C02 A;  3IQ6 A;  2XLO A;  1I5N A;  2XM0 A;  2YWA A;  1D1B A;  1OXK A;  4YL0 A;  4I1O B;  1J8Y F;  2EIM C;  3FMS A;  4O7G A;  2KYH A;  1K05 A;  4QI0 A;  3CSK A;  4E18 A;  4D4X A;  1TWH A;  3LAY A;  5A6B D;  2XLW A;  1S7Z A;  2LK4 A;  1T01 A;  3C8G B;  4MVU A;  3RW0 A;  2V3C C;  1KNY A;  1WAT A;  3LNM B;  4YN0 B;  1C03 A;  4U5C E;  4EBJ A;  2NUT B;  1FR0 A;  2LCH A;  2GAQ A;  3LS1 A;  3I5Q A;  2NSG A;  1HY5 A;  4Q5S F;  3UGP A;  3NYM A;  4I44 A;  4J7T A;  4EHP A;  4UDV A;  4PJJ A;  1Z5Z A;  2JX0 A;  2LD6 A;  2A6E F;  3L1M A;  3VYW A;  1G5Z A;  2HV6 A;  4OIN F;  1HE9 A;  2HKV A;  1YVI A;  5KYU B;  4JJG A;  2PP4 A;  3GM2 A;  2WZG A;  4J30 B;  3TD7 A;  2YEV A;  2VCB A;  5DQZ A;  4DRI B;  1VB5 A;  2XLE A;  4OIP F;  2EPN A;  2WVQ A;  4W8P A;  2C03 A;  3Q7G A;  1VLT A;  5TJ5 E;  2ZXP A;  3X1O A;  2EPM X;  2H7B A;  4MVR A;  4EBK A;  1KTM A;  1T6I A;  3J06 A;  4G7O F;  3FAJ A;  1YYX A;  4YT8 A;  1T5O A;  1V55 C;  2Q4F A;  2NUT A;  3GEH A;  4AL1 A;  4N4W A;  2UUI A;  3S29 A;  5A6K A;  3U9J A;  3E9V A;  3T9O A;  4HE8 D;  5L0C A;  2XS1 A;  2VH3 A;  4ULW A;  2NSF A;  3C8Z A;  2NPU A;  4U5E E;  4ANJ A;  2OKU A;  1H9G A;  3JCU Q;  1ZU5 A;  4XEV A;  4JRZ A;  1KU2 A;  3HKK A;  5CI8 A;  1ORJ A;  1A41 A;  1H6G A;  4IWB A;  4L6R A;  3VF0 A;  2AWC A;  1WGW A;  5AC5 A;  4QI2 A;  2IXN A;  5KYN A;  4LLE A;  2NUP A;  2Y3D A;  3OEO A;  2UUH A;  2XS8 A;  5F5F A;  4K1O A;  1M2V B;  3IQT A;  2YL0 A;  4MS2 A;  4C3B A;  5DS6 A;  3DJN B;  3GEI A;  3O6X A;  2W45 A;  4LLC A;  3SYN A;  5HV9 A;  3GOD A;  4X0R A;  5FZT A;  2OOC A;  1ST6 A;  3M4B A;  1PV3 A;  3KL4 A;  3ABM C;  4EUK B;  3C63 A;  4BEM J;  5BQI A;  2QE9 A;  2L81 A;  3NMI A;  3MBG A;  2CDQ A;  3EFO A;  2XM4 A;  3IPM O;  4P6I C;  2A1D D;  2R03 A;  3EJN A;  4YK5 A;  3SP1 A;  3ZG1 A;  4BJ5 C;  5A6B A;  1N1C A;  3AGT A;  3QTH A;  2Y39 A;  4XQ1 A;  1LS1 A;  1Z6A A;  4P9F A;  1WTY A;  3ZTM A;  4EWC A;  5JSL A;  2WVN A;  3QVZ A;  1NU7 D;  1OXB A;  4JCZ A;  5EK0 A;  4JC7 A;  4XEK A;  3DKA A;  4IAR A;  4CIP A;  4DRJ B;  256B A;  1Y4C A;  2H8A A;  1ZHZ A;  3IEE A;  2ASR A;  1MMG A;  1BR1 A;  2KSF A;  3CZ6 A;  1RKC A;  4KNW A;  1BR2 A;  5T3T A;  4KBL A;  3DE9 A;  4BEJ A;  1UG7 A;  2G3K A;  2MWQ A;  2Q00 A;  2QY9 A;  4KNV A;  3WG7 C;  5HSW A;  2XRH A;  3RF3 A;  3SXM A;  4N6H A;  4ZLC A;  2ZXO A;  3ASN C;  3EHN A;  3I5P A;  1CPR A;  1VMA A;  2BE5 F;  4H4K C;  4FX5 A;  4I3M A;  2R7R A;  4PFP A;  3Q6M A;  2J9W A;  3IQC A;  5JT4 A;  3RQG A;  3ATP A;  3S27 A;  4JTD B;  3QVY A;  3RKO F;  3AOU A;  3AQC A;  2WVO A;  1LM3 B;  2XL4 A;  3RQE A;  1OCR C;  3M4C A;  4G7Z F;  1NBB A;  1WAS A;  3QW1 A;  4GYT A;  4O79 A;  2G62 A;  3B71 A;  4DRH B;  4PJM A;  4XPW A;  4WGZ A;  3KKB A;  4JJF A;  4ER9 A;  3AGU A;  2M4E A;  3F47 A;  1SYQ A;  2MHR A;  3JYH A;  4YL1 A;  1YDI A;  3UR3 C;  1O87 A;  4CDV A;  3KYJ A;  2JPU A;  3I4U A;  3NYL A;  3V5Y A;  3HTK C;  1E2X A;  4PR9 A;  3ASO C;  1V4A A;  3DAG A;  3SXZ A;  5K0I A;  4C7O A;  3S0X A;  2VCC A;  1Q0F A;  4HFK B;  3TUL A;  1PD1 A;  3U2L A;  4CSA A;  1JAF A;  5D91 A;  4XTK A;  3B0P A;  4JE9 A;  2JD3 A;  4F4B A;  2FFH A;  2KC3 A;  4RD9 A;  2D5R B;  4XLP F;  3UGO A;  4AE4 A;  3IHU A;  3NKD A;  1H7I A;  1L3P A;  4XEF A;  5COF A;  3O10 A;  3EG9 A;  5DS4 A;  1NFN A;  4Z9H A;  2J9U A;  4N6C A;  1LS4 A;  5COM A;  4CS9 C;  1YA9 A;  5A6A A;  1FFT C;  1AUE A;  3EGD B;  3OA1 A;  1NFO A;  3U5S A;  2DYS C;  3C62 A;  1TWC A;  5DS5 A;  1CGN A;  1FNT c;  1ZU4 A;  2R9R B;  4K0D A;  1YAU O;  3EHM A;  4J7Y A;  1ZHY A;  2Q9B A;  4BJ6 C;  2A0U A;  5A69 A;  3T6G B;  4N06 A;  2IXM A;  3LUT B;  3ZQV A;  4WJ0 A;  1QQ3 A;  4OD4 A;  3O55 A;  3TOL A;  2L9J A;  3K7D A;  3V7O A;  4AL0 A;  1RKE B;  2PNO A;  1AEP A;  4LDQ A;  5L0I A;  2EIL C;  4ZLD A;  4A4A A;  3T6B A;  2EPK X;  2CGE A;  4C3E A;  4K7B A;  2QNL A;  2W9Y A;  1T6Q A;  2O9X A;  3A11 A;  4OIQ F;  3N2Z B;  4BG0 A;  1E83 A;  4JEB A;  4OD5 A;  1FTS A;  4IJJ A;  4CDY A;  2CCY A;  3VAY A;  5COG A;  2IBF A;  3M15 A;  4DJ9 A;  5JLI A;  2P0N A;  3DXJ F;  4G78 A;  2I8B A;  4BPM A;  2OEX A;  3AG3 C;  3B9Q A;  4R32 A;  3N0T A;  3ZQY A;  4E7S A;  1VTM P;  3R7C A;  4CSA C;  2DI3 A;  3DJU B;  4G0H A;  4IAO A;  5L3V A;  2QTV A;  1QKR A;  1VLS A;  2WZL A;  3GEE A;  3C8G A;  5T1D B;  3GAN A;  2J45 A;  2WZF A;  1YAR O;  2HMZ A;  2Y3G A;  4NTA A;  5E3A A;  4CIH A;  3W2V A;  4Q7C A;  4JZA A;  3T4R A;  3JRM O;  3R2P A;  4W8K A;  4ULV A;  5D92 A;  1FMV A;  4JEA A;  3L8J A;  2J7P A;  3EH2 A;  4AK9 A;  1R5I D;  1Q0D A;  4CX9 A;  2L7A A;  3OWT A;  4MVS A;  1AVO B;  1FAP B;  2ETS A;  4LDR A;  4NQF A;  4DVY P;  1MMA A;  2XLH A;  1EA8 A;  4P9T A;  4U5D E;  2R7X A;  2DB4 A;  2XXA B;  1JRA A;  1M2V A;  4U5H A;  4XPY A;  2IXO A;  3ECS A;  3K1I C;  3LEO A;  3ZC4 A;  4C3D A;  1OR2 A;  4GQH A;  3MFN A;  1MQV A;  3US6 A;  3K1H A;  4YJW A;  2L6F A;  2EPO A;  1OQC A;  2OQM A;  1J8M F;  4LER A;  4MVZ A;  1RJ9 B;  1U6H A;  1LE2 A;  1WWP A;  4A2N B;  5EHH A;  4DVZ A;  2HV7 A;  2P6V A;  2IOQ A;  2J9B A;  2YRF A;  3UMI A;  1A7V A;  2RSE B;  2ICW G;  2Q9C A;  3AQB A;  1Q0K A;  3DI5 A;  1LKX A;  3KH2 A;  2W4B A;  2B0H A;  3A9C A;  4WAB A;  2J46 A;  3PMR A;  3DE8 A;  1TWA A;  4FAP B;  2A69 F;  5A6J A;  3DM9 B;  3RVZ A;  2IXP A;  3JZ0 A;  4NTB A;  1G4W R;  3EGX B;  2BL2 A;  4YWQ A;  3NDB B;  3B0U X;  1C17 M;  4FWV A;  3L8I A;  1QPU A;  5KYY B;  3S84 A;  3CQZ A;  5GPG B;  3PCV A;  1MNE A;  2HSQ A;  3EGX A;  4O6Y A;  5DLJ A;  4E17 A;  2EPL X;  1MND A;  1A7E A;  2YHS A;  1SMY F;  2G3V A;  3NMJ A;  1YA7 O;  1D0X A;  1ZHX A;  4JCH A;  4U9D A;  3WOD F;  4JVS A;  3ZWI A;  1OW7 A;  4CDA A;  1I4Z A;  1G8X A;  2XLD A;  3KPH A;  2YVK A;  4AX2 A;  3JTL O;  5CI9 A;  3AG2 C;  3U3B A;  5DVW A;  1ZZP A;  2XLV A;  4JTA B;  1D1A A;  5BQG A;  4BJT A;  3PHF 2;  2FGY A;  1M2O A;  4YT2 A;  3AG1 C;  4XWJ A;  1OCO C;  3LES A;  3LNR A;  2LQG A;  3MYF A;  3NYJ A;  2X51 A;  2LFD A;  4PJL A;  2YL7 A;  3JSE O;  3TK0 A;  1ZW2 A;  4IGG A;  1M56 C;  1CGO A;  2J0W A;  4J32 B;  4Z9I A;  2TMV P;  3RYL A;  2A6H F;  5L3Q A;  5DQT A;  1YLM A;  1GQA A;  5L0J A;  3JRT A;  1EI7 A;  1YYJ A;  1HE1 A;  1ORS C;  1LIH A;  2HS5 A;  2L6H A;  3BEH A;  5F5H A;  5B3I A;  4Q4Z F;  5JS5 A;  1OW8 A;  1RJ9 A;  2W4M A;  3WAQ A;  4DOZ A;  4EBB A;  1MMD A;  4DBR A;  5JVE A;  1RKE A;  3H2U A;  5BQH A;  1OW6 A;  3X2Q C;  3MYI A;  2R02 A;  3ABL C;  4H54 A;  1QZX A;  2KGO A;  1A7D A;  1PD0 A;  2GFH A;  1MMN A;  4E0I A;  3TOM A;  4MW3 A;  3EPV A;  1FFH A;  1L7C A;  2CNW A;  3EH1 A;  3MX3 A;  3RQF A;  1NZE A;  2YQY A;  4QDL A;  4XLN F;  1APC A;  2OCC C;  1RXQ A;  2RD9 A;  4NTF A;  2GDC A;  3M79 A;  1NG1 A;  1BZ4 A;  1YZC A;  2I15 A;  5T3W A;  4DXW A;  1BDJ B;  3W2W A;  3ZTZ A;  3LLK A;  4MTF A;  4YL3 A;  2YLD A;  3VRC A;  4CJO A;  2VB6 A;  2PX3 A;  3FXH A;  1JOG A;  5B3S C;  5L0H A;  4MQ9 F;  1K40 A;  3CAX A;  2R7V A;  2Q9A A;  3JSZ A;  2F22 A;  3NRH A;  3HJC A;  1HW1 A;  4U5G A;  1Z63 A;  3BRJ A;  3SZR A;  1EQ1 A;  3FAP B;  3E70 C;  2VCA A;  2XLM A;  4B6I A;  3NG1 A;  1Q0M A;  2Y69 C;  2R7W A;  2R7T A;  3C18 A;  4PJN A;  1GS9 A;  3V5X A;  1K04 A;  1XZQ A;  5E3C A;  5EGY A;  1ZYR F;  2HUJ A;  3IQ5 A;  1XZP A;  2R25 A;  1G4U S;  4CS8 C;  2PF4 E;  2YLI A;  3LLI A;  2L6G A;  1OR3 A;  2YLG A;  4MVO A;  3SNH A;  2OG2 A;  4RDA A;  5JP7 A;  3W8H A;  5AC4 A;  3K33 A;  4CS9 A;  2XXA A;  1OCC C;  2J8W A;  2E87 A;  3EG9 B;  3ABK C;  1TFK B;  2M64 A;  3KYI A;  4IRU A;  3U8P A;  4CJG A;  3GM1 A;  3HLZ A;  4IB4 A;  1NSG B;  4JKV A;  3DWW A;  3JYY A;  4NCQ A;  1IZM A;  1S05 A;  1F1M A;  3DM5 A;  2PBE A;  3T6J A;  3O39 A;  5KYX A;  2HFI A;  5KYW A;  2VC9 A;  3TJ5 A;  1E85 A;  5JRA A;  5CIV A;  3FOP A;  4WGY A;  3U9M A;  2H7V C;  5BUO A;  2ZPA A;  2R7S A;  3G4X A;  1UFB A;  3F46 A;  1D0Z A;  2QUP A;  4LAC B;  4NY3 A;  5E33 A;  1CGM E;  3EZH A;  1ZHW A;  1EKY A;  2VAS A;  3H65 A;  2AVK A;  2LSE A;  5L0F A;  2LP4 A;  2R7O A;  2A0B A;  1U0B B;  2NG1 A;  1YJG A;  1JMW A;  3V5Z A;  4AE4 B;  3EZI A;  3LS0 A;  3RFY A;  2ZXR A;  1WOL A;  3ZVR A;  1NLX A;  1T9K A;  4ONS A;  3GWL A;  5KYW B;  5KYX B;  2QLA A;  2R05 A;  2EIN C;  2R7Q A;  4LDK A;  1OCZ C;  1U89 A;  2XL8 A;  2ZXW C;  4O6N A;  3S28 A;  3ZSU A;  2J7P D;  2IYL D;  5L0D A;  2KK1 A;  2WL8 A;  2YL3 A;  2EIJ C;  1VK5 A;  2DYR C;  3K66 A;  1RMV A;  3S90 A;  2AWY A;  2BC5 A;  3DD7 A;  1BBH A;  1ZW3 A;  2J0X A;  3U2M A;  1VYK A;  1ZHT A;  4DBQ A;  4MVM A;  1M57 C;  4GEH A;  2OJE D;  1ZVZ A;  2NUP B;  3G4Z A;  1B68 A;  1JPN A;  2KNH A;  5JUA A;  1O3U A;  1D1C A;  1ORY A;  4IAQ A;  5KYY A;  1JPJ A;  3HNL A;  2B0J A;  4MVQ A;  3RVY A;  3JT1 A; 
#chains in the Genus database with same CATH homology
 1LE4 A;  1LPE A;  1AEP A;  1EA8 A;  1OR3 A;  3S84 A;  1NFN A;  1B68 A;  1EQ1 A;  1LS4 A;  2KC3 A;  1YA9 A;  3R2P A;  1BZ4 A;  1NFO A;  1LE2 A;  1GS9 A;  1OR2 A;  1H7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...