1YA9A

Crystal structure of the 22kda n-terminal fragment of mouse apolipoprotein e
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
174
structure length
168
Chain Sequence
PEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAGVSAIRERLGPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apolipoprotein E
publication title Engineering conformational destabilization into mouse apolipoprotein E. A model for a unique property of human apolipoprotein E4
pubmed doi rcsb
source organism Mus musculus
molecule tags Lipid transport
total genus 71
structure length 168
sequence length 174
ec nomenclature
pdb deposition date 2004-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1ya9A00
1LPEA 1BZ4A 1LS4A 1EA8A 1GS9A 3R2PA 1YA9A 3S84A 1OR2A 1B68A 1NFOA 1LE4A 1AEPA 1LE2A 1EQ1A 1OR3A 2KC3A 1NFNA 1H7IA
chains in the Genus database with same CATH superfamily
3NG1A 3LEVA 2AP3A 2VC9A 2QE9A 2L6FA 1M2VA 2JX0A 1RKCA 2JPUA 4LERA 4U9DA 3QTHA 3C63A 2O9XA 1CGME 3TK0A 1QZXA 3SXYA 1FAPB 1HW2A 2GFHA 1Q0GA 5T1DB 3G4XA 1U6HA 2EIKC 3E70C 2NUPB 1T6IA 1O5HA 1RJ9B 4EHPA 1LKXA 3A9CA 3ZSUA 1JR8A 2X0CA 1A7DA 3EPVA 3C8ZA 5TJ5E 1YZCA 3FMSA 5KYUB 3O55A 3I5QA 1VLSA 2HSBA 3EFOA 3HNLA 3B0UX 2HV6A 3S90A 2J7PA 4JTDB 1A41A 4CBEA 2R7XA 1NSGB 4IAQA 2CW0F 3JCUQ 1HMDA 4CX9A 5A69A 4F4BA 3CZ6A 1XZQA 4I1MA 4K7BA 4MVQA 2FAPB 5EK0A 2CGEA 4XPYA 3RFYA 1YYXA 2HJMA 1QQ3A 1W2WA 2QTVA 4EBJA 2XXAA 3U9MA 4IARA 3ATPA 2L9JA 2L6HA 3IQ5A 4JJFA 4PK4A 3SP1A 1SMYF 3ZC4A 4ER9A 3AJMA 3TD7A 1L7CA 2OKUA 3LS0A 4R32A 4OIPF 4IRUA 2V3CC 1ZZPA 3NMKA 3PCVA 1OR2A 4E7SA 4MVSA 2J9WA 1D0YA 3AG4C 4O6MA 3ZTZA 5FCLA 3FOPA 2HZ8A 1WTYA 2Q7RA 4C3DA 1SYQA 2P1AA 3X2QC 5B1BC 5JP7A 4Q7CA 3DAGA 2OJED 1MMDA 1EQ1A 5DVWA 4ONSA 4D4XA 4KNWA 1VYIA 3DJNB 2MWQA 2R25A 1NLXA 2P6VA 2EPNA 2R7WA 5E33A 3US6A 3ZQYA 1BDJB 2HFIA 3RKOF 1A7VA 2XM0A 3UMIA 3W2WA 2XS8A 2P61A 2R02A 3C18A 2W9YA 3HLZA 2CNWD 4OIOF 3IQ6A 3W8IA 4Q5SF 3V5ZA 2EPMX 3RIPA 3AGTA 3IQCA 3Q6MA 1D0XA 3NDBB 2J0XA 3NYLA 4W8KA 1QKRA 3C7JA 3LUTB 2LFFA 3NYJA 4I1OB 1G4US 4ULWA 3QW0A 1OW8A 5L0GA 5L3QA 3AQCA 1NG1A 3O39A 5L0CA 2RD9A 3EGDB 1RKEA 4CSAC 2IXOA 2CCYA 2Y39A 2XLDA 4JVSA 2EPKX 3LNRA 4I44A 4JRZA 3DI5A 5A6AA 3L0IA 4CDYA 4J32B 4DVZA 5AC5A 3N24A 5FZTA 4YT4A 1WN0A 2J45A 3CEXA 2A69F 4PR9A 1UFBA 1YARO 1PD1A 5JS5A 2NUTA 1BR1A 1FNTc 3UNGC 1RMVA 2EIJC 2LD6A 2KNHA 3K33A 3PMRA 3ZG1A 1FMWA 3FXHA 1OCZC 2Q00A 1Q0MA 2ZD9A 3L8JA 2DYRC 1LI5A 1CGNA 1VB5A 4JIOA 4LLCA 5COMA 2HV7A 5L3VA 3IEEA 1G4WR 2ZXWC 4IJJA 2GA0A 4MW8A 4EUKB 1LE2A 1HE9A 1OKKA 4NTBA 4RD9A 2OQMA 2WL8A 2IBFA 3O10A 1NU7D 2KC3A 5DS6A 2Y69C 1AUEA 2XLHA 2LSEA 3X1OA 1O87A 1PCXA 1BR2A 2I15A 4K0DA 2R7TA 1YVIA 2M4EA 2YKZA 5COGA 1ST6A 3EHMA 2A1DD 3UGOA 1FMVA 4U5GA 5HSWA 3U3BA 5F28E 3SNHA 1Z63A 2YHSA 3KH2A 3M1CB 4IAOA 5KYXA 3AG2C 2KSFA 1GQAA 5BQHA 2BE5F 1O3UA 1OCCC 2W45A 3DD7A 3EGXA 4NQFA 3S84A 4IB4A 1QLEC 1H9GA 1TWGA 2RSEB 4WJ0A 5L0IA 2R03A 1JAFA 1AEPA 3BRJA 3OWTA 4JZAA 3S0XA 4OD5A 3FDQA 2DYSC 3U2LA 2LQGA 1YAUO 1G8XA 3BEHA 3G50A 3JRMO 4MQ9F 3S9OA 4JE9A 1I4ZA 1ZU4A 1H7IA 2A0BA 4XPXA 3DM5A 4BJ1A 4Q4ZF 2WVOA 4MVRA 3T9OA 3V5YA 3MFNA 2LFDA 4DXWA 2J0WA 1Y6DA 3RF3A 1E2XA 2XSEA 3RVYA 3WG7C 2Y3DA 2KJGA 4DJ9A 1EA8A 3GORA 1KTMA 2AVKA 3T4RA 3HKKA 3VYWA 1APCA 1V4AA 2HJ3A 2VASA 2EINC 3W4YA 3EQLF 3LNMB 1K04A 2W4BA 4CS8A 5L0HA 5D92A 1NFOA 4KNVA 2IXPA 4JKVA 4DRIB 1EKYA 4IGGA 3JSZA 3OA1A 1J8YF 5BQIA 1VMAA 1Z7Qc 3B0VC 3C8GD 3POVA 4LDRA 1V74B 2WZGA 2MHRA 3DXJF 1WWPA 1XWJA 5HV9A 3G4ZA 3SYNA 5K0IA 4W8PA 2NSGA 3MLGA 3NRHA 3DM9B 1CPRA 2PX0A 4M63A 2YZSA 2AU5A 3ZWIA 3FHDA 3JYYA 5A6BA 1BZ4A 2VB6A 3JYHA 4N6CA 2AWCA 2YEVA 4CIHA 3S28A 1TQGA 3L1MA 1T6UA 1NBBA 2R7QA 2R05A 3Q6NA 3DWWA 3T6GB 3C8GB 1L3PA 3DJUB 2OEXA 1GGQA 2ZXOA 2C03A 3H2UA 3EH1A 3MBGA 1HW1A 1YA9A 2ETSA 1DOVA 1NU9C 2NUPA 1RJ9A 2YWAA 3ITFA 1G5ZA 3MYFA 3UGPA 2PBEA 4P6IC 4WGZA 2P7VA 3CQZA 4J7YA 2ZXPA 1MMAA 4N06A 4XPWA 5AGFA 4AE4A 1WATA 2YLIA 4J7TA 1M56C 1LI7A 4HFKB 4U5CE 1D1AA 3K66A 4PJJA 3DKAA 1D1CA 1LS1A 1OR3A 1QVXA 1NZEA 4DBRA 1GM5A 4O7GA 1XZPA 2QNLA 1Q0DA 2H8AA 3M4CA 3QVZA 5JRAA 4NC3A 2G62A 4CSAA 4FESA 4G78A 1VTMP 1EI7A 4L6RA 2XM4A 2VCCA 3ASOC 3MX3A 2HSQA 1J8MF 3TJ5A 1OW7A 1YA7O 3JSEO 1KNYA 3B71A 4MNDA 3GM3A 3W2VA 4U5EE 4G7ZF 3Q7GA 2YL3A 3VAYA 4J30B 2NG1A 3U8VA 2V26A 3ZIBA 5L0JA 3U5SA 3GODA 2A68F 3DZAA 2EPOA 1OW6A 3S27A 2VH3A 2L81A 4G7OF 5L0DA 4RBNA 2XLMA 3ASNC 1C02A 5B3SC 5EGYA 3WODF 4FWVA 4NTAA 1U89A 1YJGA 2ASRA 3R7CA 1A7EA 3IPMO 1BR4A 3FVYA 1HE1A 4GEHA 5DLJA 2XL4A 2UUHA 4U5DE 4EBKA 2XLOA 2PF4E 2YLDA 4BJ6A 2WVNA 2NUTB 4K1OA 1ZHZA 1LS4A 2HMZA 1JOGA 2IYLD 1R5ID 4IWBA 5GPGB 3TOLA 1TKNA 2KYHA 3GANA 4YL3A 4AL1A 4D4NA 3ABMC 2BL2A 5D91A 2XLWA 2DI3A 4DVYP 1R4TA 256BA 2YRFA 4XLPF 2LCHA 4QI2A 1PV3A 3AG3C 5CIVA 4WGYA 2LP4A 3JTLO 5F5FA 1LE4A 2L7AA 3OEOA 4LDKA 3ZDLA 4B6IA 5KYYA 5KYWB 4U5BE 5B1AC 3K1IA 2R9RB 4BJ6C 4YL1A 4E18A 1WGWA 3I4UA 2F22A 3TOMA 1Z3IX 3GEEA 1OXBA 1C17M 3LAYA 4NTFA 2W4MA 2HKVA 1HY5A 1YDIA 1PD0A 2HS5A 2OCCC 3QMKA 1IZMA 5AC4A 5IY5C 2Y3GA 1OXKA 1T6QA 2E87A 1MNDA 3B0PA 2G3VA 4U9EA 5KYXB 1ORSC 2YVKA 2VCBA 3EG9B 4PACA 1T9KA 1OCOC 2J8WA 4U5FE 4X0RA 3EJNA 1TFKB 1FR0A 5DQTA 1VLTA 3RQFA 3HNJA 1E85A 1AVOB 2H7BA 3K1IC 4KBLA 4ULVA 1A0BA 4JEBA 4C7OB 3V5XA 5JSLA 2KK1A 1DOWA 3IHUA 2NPUA 3LESA 4QI0A 5T3TA 4N6HA 1H9TA 4CS7A 4YT5A 1ZVZA 2M64A 1LM3B 1MQVA 2J9BA 4OD4A 3U9JA 4CS9C 4EWCA 4DRJB 5A6JA 2B0JA 4XLNF 4CS8C 4Z9HA 1YYJA 3LS1A 4Z9IA 3ABKC 1M2VB 4MTFA 5L0FA 3W8HA 2Q3TA 1ORJA 2IOQA 1JRAA 1GS9A 1HMOA 1YLMA 3ABLC 4I3MA 2BC5A 2QLAA 2H7OA 2XRHA 4BEJA 2C04A 2J7PD 2MYSA 1D1BA 2JD3A 3R2PA 4OIQF 2KQ9A 1RXQA 4N4WA 4CJOA 3KYJA 1IW7F 5DQZA 2LK4A 3C62A 3TQOA 4BJ5C 2IXMA 3RW0A 2A6HF 3N2ZB 5BUOA 2Q9BA 4H4KC 2OEVA 3EFOB 2HMQA 3CSKA 1LIHA 2UUIA 3M4BA 1VK5A 4JTCB 4KC9A 4QDLA 2OU6A 2VCAA 1U0BB 2XLVA 4FX5A 2XL8A 3UMKA 4OINF 5CI9A 1UG7A 3DE9A 1S05A 4HEAJ 3B9QA 4LLEA 2XXAB 3AGUA 3JRTA 2Q9AA 2YL1A 4P9FA 4PFPA 3GM1A 3KYIA 4YJWA 4Z9JA 1ZHXA 4MW3A 5E3CA 2D4UA 4C3BA 4DOZA 4AX2A 3H65A 2J9UA 3JT1A 4JEAA 4XEKA 3T6JA 3WAQA 4DRHB 3PHF2 3S29A 3AOUA 3EHNA 3ZTMA 2J9VA 1WOLA 2YLGA 3RQGA 3SXZA 1M2OA 3PDMP 4G7HF 4O6YA 2PP4A 3GWLA 2XL6A 5KYUA 5T3WA 4AE4B 1Q0FA 3LEOA 1T5OA 3U8PA 2EILC 3Q7LA 4MVMA 1YZAA 2FFHA 3A11A 4MVUA 3VM6A 4DBQA 1E84A 1E86A 2P0NA 4XEVA 5EHHA 2Z15A 3E9VA 2OOCA 2ZXRA 3H2VA 5B3IA 3JZ0A 2KGOA 2R7SA 1CGOA 1CPQA 3M15A 3SXMA 4E0HA 2Q9CA 5JUAA 2GWWA 3CAXA 1QSPA 2IM8A 1VOMA 2Y3BA 3KL4A 3LJBA 4JCZA 5CI8A 3RVZA 3VRCA 4BEMJ 4E0IA 4EKWA 3C8GA 3NYMA 1C03A 2Y3HA 3NMIA 3EH2A 4WABA 4AL0A 1TWAA 2YL0A 2B0HA 2XLEA 1M6TA 2EPLX 2GAQA 4G0HA 4YK5A 4YT2A 5JT4A 4P9TA 3V7OA 3F47A 3GM2A 5E3AA 2AWYA 1ZHYA 4EIYA 4JCHA 1FFHA 1WASA 3L8IA 1ZHWA 2WZLA 4MVOA 4PFOA 5BQGA 3RQEA 2FGYA 4YT8A 1TR2A 1RCPA 1RKEB 3I5PA 3KMIA 2DGJA 2PFDA 3FOOA 4GYTA 4LACB 1SZIA 4AK9A 3U2MA 3TULA 3QZCA 1LVKA 2R7VA 1ORYA 1Y4CA 1LPEA 4A4AA 2ZPAA 4NY3A 4KI2A 4BPMA 1I5NA 3AG1C 3UR3C 2GDCA 3K6BA 4EBBA 4YWQA 1Z6AA 1OKKD 1JPJA 3KPHA 1JMWA 1T01A 3MYIA 5A6KA 4U5HA 3L34A 2R7RA 3SZRA 4MVZA 2H7VC 2DB4A 1MMGA 3TJ6A 1B68A 2D5RB 3GWNA 4YL0A 3KKBA 3N0TA 3QW1A 4JJGA 4C3EA 2CYDA 4HE8D 1SF8A 5KYYB 4FAPB 2QY9A 4XTKA 4MTGA 3U3FA 2CNWA 3EGDA 3HJCA 4NCQA 3LLIA 1MMNA 3K7DA 5JLIA 3U0CA 2ICWG 1TWHA 3GEIA 4E17A 1Q0KA 1QPUA 3RYLA 3UMHA 1V55C 1E83A 3GEHA 3IQTA 1FFTC 2J46A 1SR2A 4PJLA 1TFOB 2CDQA 1F1MA 2WB7A 3ZQVA 1ZU5A 2L6GA 4XEFA 3DE8A 2G3KA 4CS9A 4CIPA 1N1CA 2LIGA 2KW3C 1ZW3A 3QVYA 3J06A 2QUPA 3K1HA 3LLKA 2EIMC 3EGXB 3NKDA 4JTAB 5DS4A 1ZHTA 1VYKA 2OG2A 3VF0A 3NKEA 4LDQA 3WHNA 4E7ZA 3AQBA 2NSFA 2XS1A 5KYWA 4JURI 3HNIA 3B29A 4MTOA 3RH3A 4BG0A 4CJGA 2PX3A 2PNOA 2YL7A 5KYNA 4YN0B 1OQCA 1D0ZA 1S7ZA 4BJ5A 2R7OA 3ECSA 2HUJA 4PJNA 4O6NA 4JC7A 1JPNA 2R7UA 3FAJA 5F5HA 1Z5ZA 4BJTA 2IXNA 4RDAA 1I4YA 3NMJA 4O79A 1ZW2A 3M79A 1K40A 4PJMA 4CDAA 1TWCA 1K05A 3SEOA 3DMDA 3EG9A 2A0UA 3EZIA 3T6BA 4ZLCA 3O6XA 1Z23A 1KU2A 1BBHA 2Q4FA 2WZFA 4H54A 2WVQA 5E2QA 1H6GA 2X51A 4JW1A 3ZVRA 2OJQA 4CDVA 4XWJA 3HNKA 1V54C 3HTKC 3F46A 3FAPB 5DS5A 5A6BD 4C7OA 4ZLDA 4ANJA 1FTSA 1M57C 1MNEA 2I8BA 1OCRC 3EZHA 2TMVP 5JVEA 2A6EF 5COFA 4HFFB 4MS2A 2YQYA 4OIRF 3SXKA 1NFNA 4A2NB 3DAFA 4XQ1A 4GQHA 4UDVA 1ZYRF
chains in the Genus database with same CATH topology
1LPEA 1BZ4A 1LS4A 1EA8A 1GS9A 3R2PA 1YA9A 3S84A 1OR2A 1B68A 1NFOA 1LE4A 1AEPA 1LE2A 1EQ1A 1OR3A 2KC3A 1NFNA 1H7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LPE A;  1BZ4 A;  1LS4 A;  1EA8 A;  1GS9 A;  3R2P A;  1YA9 A;  3S84 A;  1OR2 A;  1B68 A;  1NFO A;  1LE4 A;  1AEP A;  1LE2 A;  1EQ1 A;  1OR3 A;  2KC3 A;  1NFN A;  1H7I A; 
#chains in the Genus database with same CATH topology
 3NG1 A;  3LEV A;  2AP3 A;  2VC9 A;  2QE9 A;  2L6F A;  1M2V A;  2JX0 A;  1RKC A;  2JPU A;  4LER A;  4U9D A;  3QTH A;  3C63 A;  2O9X A;  1CGM E;  3TK0 A;  1QZX A;  3SXY A;  1FAP B;  1HW2 A;  2GFH A;  1Q0G A;  5T1D B;  3G4X A;  1U6H A;  2EIK C;  3E70 C;  2NUP B;  1T6I A;  1O5H A;  1RJ9 B;  4EHP A;  1LKX A;  3A9C A;  3ZSU A;  1JR8 A;  2X0C A;  1A7D A;  3EPV A;  3C8Z A;  5TJ5 E;  1YZC A;  3FMS A;  5KYU B;  3O55 A;  3I5Q A;  1VLS A;  2HSB A;  3EFO A;  3HNL A;  3B0U X;  2HV6 A;  3S90 A;  2J7P A;  4JTD B;  1A41 A;  4CBE A;  2R7X A;  1NSG B;  4IAQ A;  2CW0 F;  3JCU Q;  1HMD A;  4CX9 A;  5A69 A;  4F4B A;  3CZ6 A;  1XZQ A;  4I1M A;  4K7B A;  4MVQ A;  2FAP B;  5EK0 A;  2CGE A;  4XPY A;  3RFY A;  1YYX A;  2HJM A;  1QQ3 A;  1W2W A;  2QTV A;  4EBJ A;  2XXA A;  3U9M A;  4IAR A;  3ATP A;  2L9J A;  2L6H A;  3IQ5 A;  4JJF A;  4PK4 A;  3SP1 A;  1SMY F;  3ZC4 A;  4ER9 A;  3AJM A;  3TD7 A;  1L7C A;  2OKU A;  3LS0 A;  4R32 A;  4OIP F;  4IRU A;  2V3C C;  1ZZP A;  3NMK A;  3PCV A;  1OR2 A;  4E7S A;  4MVS A;  2J9W A;  1D0Y A;  3AG4 C;  4O6M A;  3ZTZ A;  5FCL A;  3FOP A;  2HZ8 A;  1WTY A;  2Q7R A;  4C3D A;  1SYQ A;  2P1A A;  3X2Q C;  5B1B C;  5JP7 A;  4Q7C A;  3DAG A;  2OJE D;  1MMD A;  1EQ1 A;  5DVW A;  4ONS A;  4D4X A;  4KNW A;  1VYI A;  3DJN B;  2MWQ A;  2R25 A;  1NLX A;  2P6V A;  2EPN A;  2R7W A;  5E33 A;  3US6 A;  3ZQY A;  1BDJ B;  2HFI A;  3RKO F;  1A7V A;  2XM0 A;  3UMI A;  3W2W A;  2XS8 A;  2P61 A;  2R02 A;  3C18 A;  2W9Y A;  3HLZ A;  2CNW D;  4OIO F;  3IQ6 A;  3W8I A;  4Q5S F;  3V5Z A;  2EPM X;  3RIP A;  3AGT A;  3IQC A;  3Q6M A;  1D0X A;  3NDB B;  2J0X A;  3NYL A;  4W8K A;  1QKR A;  3C7J A;  3LUT B;  2LFF A;  3NYJ A;  4I1O B;  1G4U S;  4ULW A;  3QW0 A;  1OW8 A;  5L0G A;  5L3Q A;  3AQC A;  1NG1 A;  3O39 A;  5L0C A;  2RD9 A;  3EGD B;  1RKE A;  4CSA C;  2IXO A;  2CCY A;  2Y39 A;  2XLD A;  4JVS A;  2EPK X;  3LNR A;  4I44 A;  4JRZ A;  3DI5 A;  5A6A A;  3L0I A;  4CDY A;  4J32 B;  4DVZ A;  5AC5 A;  3N24 A;  5FZT A;  4YT4 A;  1WN0 A;  2J45 A;  3CEX A;  2A69 F;  4PR9 A;  1UFB A;  1YAR O;  1PD1 A;  5JS5 A;  2NUT A;  1BR1 A;  1FNT c;  3UNG C;  1RMV A;  2EIJ C;  2LD6 A;  2KNH A;  3K33 A;  3PMR A;  3ZG1 A;  1FMW A;  3FXH A;  1OCZ C;  2Q00 A;  1Q0M A;  2ZD9 A;  3L8J A;  2DYR C;  1LI5 A;  1CGN A;  1VB5 A;  4JIO A;  4LLC A;  5COM A;  2HV7 A;  5L3V A;  3IEE A;  1G4W R;  2ZXW C;  4IJJ A;  2GA0 A;  4MW8 A;  4EUK B;  1LE2 A;  1HE9 A;  1OKK A;  4NTB A;  4RD9 A;  2OQM A;  2WL8 A;  2IBF A;  3O10 A;  1NU7 D;  2KC3 A;  5DS6 A;  2Y69 C;  1AUE A;  2XLH A;  2LSE A;  3X1O A;  1O87 A;  1PCX A;  1BR2 A;  2I15 A;  4K0D A;  2R7T A;  1YVI A;  2M4E A;  2YKZ A;  5COG A;  1ST6 A;  3EHM A;  2A1D D;  3UGO A;  1FMV A;  4U5G A;  5HSW A;  3U3B A;  5F28 E;  3SNH A;  1Z63 A;  2YHS A;  3KH2 A;  3M1C B;  4IAO A;  5KYX A;  3AG2 C;  2KSF A;  1GQA A;  5BQH A;  2BE5 F;  1O3U A;  1OCC C;  2W45 A;  3DD7 A;  3EGX A;  4NQF A;  3S84 A;  4IB4 A;  1QLE C;  1H9G A;  1TWG A;  2RSE B;  4WJ0 A;  5L0I A;  2R03 A;  1JAF A;  1AEP A;  3BRJ A;  3OWT A;  4JZA A;  3S0X A;  4OD5 A;  3FDQ A;  2DYS C;  3U2L A;  2LQG A;  1YAU O;  1G8X A;  3BEH A;  3G50 A;  3JRM O;  4MQ9 F;  3S9O A;  4JE9 A;  1I4Z A;  1ZU4 A;  1H7I A;  2A0B A;  4XPX A;  3DM5 A;  4BJ1 A;  4Q4Z F;  2WVO A;  4MVR A;  3T9O A;  3V5Y A;  3MFN A;  2LFD A;  4DXW A;  2J0W A;  1Y6D A;  3RF3 A;  1E2X A;  2XSE A;  3RVY A;  3WG7 C;  2Y3D A;  2KJG A;  4DJ9 A;  1EA8 A;  3GOR A;  1KTM A;  2AVK A;  3T4R A;  3HKK A;  3VYW A;  1APC A;  1V4A A;  2HJ3 A;  2VAS A;  2EIN C;  3W4Y A;  3EQL F;  3LNM B;  1K04 A;  2W4B A;  4CS8 A;  5L0H A;  5D92 A;  1NFO A;  4KNV A;  2IXP A;  4JKV A;  4DRI B;  1EKY A;  4IGG A;  3JSZ A;  3OA1 A;  1J8Y F;  5BQI A;  1VMA A;  1Z7Q c;  3B0V C;  3C8G D;  3POV A;  4LDR A;  1V74 B;  2WZG A;  2MHR A;  3DXJ F;  1WWP A;  1XWJ A;  5HV9 A;  3G4Z A;  3SYN A;  5K0I A;  4W8P A;  2NSG A;  3MLG A;  3NRH A;  3DM9 B;  1CPR A;  2PX0 A;  4M63 A;  2YZS A;  2AU5 A;  3ZWI A;  3FHD A;  3JYY A;  5A6B A;  1BZ4 A;  2VB6 A;  3JYH A;  4N6C A;  2AWC A;  2YEV A;  4CIH A;  3S28 A;  1TQG A;  3L1M A;  1T6U A;  1NBB A;  2R7Q A;  2R05 A;  3Q6N A;  3DWW A;  3T6G B;  3C8G B;  1L3P A;  3DJU B;  2OEX A;  1GGQ A;  2ZXO A;  2C03 A;  3H2U A;  3EH1 A;  3MBG A;  1HW1 A;  1YA9 A;  2ETS A;  1DOV A;  1NU9 C;  2NUP A;  1RJ9 A;  2YWA A;  3ITF A;  1G5Z A;  3MYF A;  3UGP A;  2PBE A;  4P6I C;  4WGZ A;  2P7V A;  3CQZ A;  4J7Y A;  2ZXP A;  1MMA A;  4N06 A;  4XPW A;  5AGF A;  4AE4 A;  1WAT A;  2YLI A;  4J7T A;  1M56 C;  1LI7 A;  4HFK B;  4U5C E;  1D1A A;  3K66 A;  4PJJ A;  3DKA A;  1D1C A;  1LS1 A;  1OR3 A;  1QVX A;  1NZE A;  4DBR A;  1GM5 A;  4O7G A;  1XZP A;  2QNL A;  1Q0D A;  2H8A A;  3M4C A;  3QVZ A;  5JRA A;  4NC3 A;  2G62 A;  4CSA A;  4FES A;  4G78 A;  1VTM P;  1EI7 A;  4L6R A;  2XM4 A;  2VCC A;  3ASO C;  3MX3 A;  2HSQ A;  1J8M F;  3TJ5 A;  1OW7 A;  1YA7 O;  3JSE O;  1KNY A;  3B71 A;  4MND A;  3GM3 A;  3W2V A;  4U5E E;  4G7Z F;  3Q7G A;  2YL3 A;  3VAY A;  4J30 B;  2NG1 A;  3U8V A;  2V26 A;  3ZIB A;  5L0J A;  3U5S A;  3GOD A;  2A68 F;  3DZA A;  2EPO A;  1OW6 A;  3S27 A;  2VH3 A;  2L81 A;  4G7O F;  5L0D A;  4RBN A;  2XLM A;  3ASN C;  1C02 A;  5B3S C;  5EGY A;  3WOD F;  4FWV A;  4NTA A;  1U89 A;  1YJG A;  2ASR A;  3R7C A;  1A7E A;  3IPM O;  1BR4 A;  3FVY A;  1HE1 A;  4GEH A;  5DLJ A;  2XL4 A;  2UUH A;  4U5D E;  4EBK A;  2XLO A;  2PF4 E;  2YLD A;  4BJ6 A;  2WVN A;  2NUT B;  4K1O A;  1ZHZ A;  1LS4 A;  2HMZ A;  1JOG A;  2IYL D;  1R5I D;  4IWB A;  5GPG B;  3TOL A;  1TKN A;  2KYH A;  3GAN A;  4YL3 A;  4AL1 A;  4D4N A;  3ABM C;  2BL2 A;  5D91 A;  2XLW A;  2DI3 A;  4DVY P;  1R4T A;  256B A;  2YRF A;  4XLP F;  2LCH A;  4QI2 A;  1PV3 A;  3AG3 C;  5CIV A;  4WGY A;  2LP4 A;  3JTL O;  5F5F A;  1LE4 A;  2L7A A;  3OEO A;  4LDK A;  3ZDL A;  4B6I A;  5KYY A;  5KYW B;  4U5B E;  5B1A C;  3K1I A;  2R9R B;  4BJ6 C;  4YL1 A;  4E18 A;  1WGW A;  3I4U A;  2F22 A;  3TOM A;  1Z3I X;  3GEE A;  1OXB A;  1C17 M;  3LAY A;  4NTF A;  2W4M A;  2HKV A;  1HY5 A;  1YDI A;  1PD0 A;  2HS5 A;  2OCC C;  3QMK A;  1IZM A;  5AC4 A;  5IY5 C;  2Y3G A;  1OXK A;  1T6Q A;  2E87 A;  1MND A;  3B0P A;  2G3V A;  4U9E A;  5KYX B;  1ORS C;  2YVK A;  2VCB A;  3EG9 B;  4PAC A;  1T9K A;  1OCO C;  2J8W A;  4U5F E;  4X0R A;  3EJN A;  1TFK B;  1FR0 A;  5DQT A;  1VLT A;  3RQF A;  3HNJ A;  1E85 A;  1AVO B;  2H7B A;  3K1I C;  4KBL A;  4ULV A;  1A0B A;  4JEB A;  4C7O B;  3V5X A;  5JSL A;  2KK1 A;  1DOW A;  3IHU A;  2NPU A;  3LES A;  4QI0 A;  5T3T A;  4N6H A;  1H9T A;  4CS7 A;  4YT5 A;  1ZVZ A;  2M64 A;  1LM3 B;  1MQV A;  2J9B A;  4OD4 A;  3U9J A;  4CS9 C;  4EWC A;  4DRJ B;  5A6J A;  2B0J A;  4XLN F;  4CS8 C;  4Z9H A;  1YYJ A;  3LS1 A;  4Z9I A;  3ABK C;  1M2V B;  4MTF A;  5L0F A;  3W8H A;  2Q3T A;  1ORJ A;  2IOQ A;  1JRA A;  1GS9 A;  1HMO A;  1YLM A;  3ABL C;  4I3M A;  2BC5 A;  2QLA A;  2H7O A;  2XRH A;  4BEJ A;  2C04 A;  2J7P D;  2MYS A;  1D1B A;  2JD3 A;  3R2P A;  4OIQ F;  2KQ9 A;  1RXQ A;  4N4W A;  4CJO A;  3KYJ A;  1IW7 F;  5DQZ A;  2LK4 A;  3C62 A;  3TQO A;  4BJ5 C;  2IXM A;  3RW0 A;  2A6H F;  3N2Z B;  5BUO A;  2Q9B A;  4H4K C;  2OEV A;  3EFO B;  2HMQ A;  3CSK A;  1LIH A;  2UUI A;  3M4B A;  1VK5 A;  4JTC B;  4KC9 A;  4QDL A;  2OU6 A;  2VCA A;  1U0B B;  2XLV A;  4FX5 A;  2XL8 A;  3UMK A;  4OIN F;  5CI9 A;  1UG7 A;  3DE9 A;  1S05 A;  4HEA J;  3B9Q A;  4LLE A;  2XXA B;  3AGU A;  3JRT A;  2Q9A A;  2YL1 A;  4P9F A;  4PFP A;  3GM1 A;  3KYI A;  4YJW A;  4Z9J A;  1ZHX A;  4MW3 A;  5E3C A;  2D4U A;  4C3B A;  4DOZ A;  4AX2 A;  3H65 A;  2J9U A;  3JT1 A;  4JEA A;  4XEK A;  3T6J A;  3WAQ A;  4DRH B;  3PHF 2;  3S29 A;  3AOU A;  3EHN A;  3ZTM A;  2J9V A;  1WOL A;  2YLG A;  3RQG A;  3SXZ A;  1M2O A;  3PDM P;  4G7H F;  4O6Y A;  2PP4 A;  3GWL A;  2XL6 A;  5KYU A;  5T3W A;  4AE4 B;  1Q0F A;  3LEO A;  1T5O A;  3U8P A;  2EIL C;  3Q7L A;  4MVM A;  1YZA A;  2FFH A;  3A11 A;  4MVU A;  3VM6 A;  4DBQ A;  1E84 A;  1E86 A;  2P0N A;  4XEV A;  5EHH A;  2Z15 A;  3E9V A;  2OOC A;  2ZXR A;  3H2V A;  5B3I A;  3JZ0 A;  2KGO A;  2R7S A;  1CGO A;  1CPQ A;  3M15 A;  3SXM A;  4E0H A;  2Q9C A;  5JUA A;  2GWW A;  3CAX A;  1QSP A;  2IM8 A;  1VOM A;  2Y3B A;  3KL4 A;  3LJB A;  4JCZ A;  5CI8 A;  3RVZ A;  3VRC A;  4BEM J;  4E0I A;  4EKW A;  3C8G A;  3NYM A;  1C03 A;  2Y3H A;  3NMI A;  3EH2 A;  4WAB A;  4AL0 A;  1TWA A;  2YL0 A;  2B0H A;  2XLE A;  1M6T A;  2EPL X;  2GAQ A;  4G0H A;  4YK5 A;  4YT2 A;  5JT4 A;  4P9T A;  3V7O A;  3F47 A;  3GM2 A;  5E3A A;  2AWY A;  1ZHY A;  4EIY A;  4JCH A;  1FFH A;  1WAS A;  3L8I A;  1ZHW A;  2WZL A;  4MVO A;  4PFO A;  5BQG A;  3RQE A;  2FGY A;  4YT8 A;  1TR2 A;  1RCP A;  1RKE B;  3I5P A;  3KMI A;  2DGJ A;  2PFD A;  3FOO A;  4GYT A;  4LAC B;  1SZI A;  4AK9 A;  3U2M A;  3TUL A;  3QZC A;  1LVK A;  2R7V A;  1ORY A;  1Y4C A;  1LPE A;  4A4A A;  2ZPA A;  4NY3 A;  4KI2 A;  4BPM A;  1I5N A;  3AG1 C;  3UR3 C;  2GDC A;  3K6B A;  4EBB A;  4YWQ A;  1Z6A A;  1OKK D;  1JPJ A;  3KPH A;  1JMW A;  1T01 A;  3MYI A;  5A6K A;  4U5H A;  3L34 A;  2R7R A;  3SZR A;  4MVZ A;  2H7V C;  2DB4 A;  1MMG A;  3TJ6 A;  1B68 A;  2D5R B;  3GWN A;  4YL0 A;  3KKB A;  3N0T A;  3QW1 A;  4JJG A;  4C3E A;  2CYD A;  4HE8 D;  1SF8 A;  5KYY B;  4FAP B;  2QY9 A;  4XTK A;  4MTG A;  3U3F A;  2CNW A;  3EGD A;  3HJC A;  4NCQ A;  3LLI A;  1MMN A;  3K7D A;  5JLI A;  3U0C A;  2ICW G;  1TWH A;  3GEI A;  4E17 A;  1Q0K A;  1QPU A;  3RYL A;  3UMH A;  1V55 C;  1E83 A;  3GEH A;  3IQT A;  1FFT C;  2J46 A;  1SR2 A;  4PJL A;  1TFO B;  2CDQ A;  1F1M A;  2WB7 A;  3ZQV A;  1ZU5 A;  2L6G A;  4XEF A;  3DE8 A;  2G3K A;  4CS9 A;  4CIP A;  1N1C A;  2LIG A;  2KW3 C;  1ZW3 A;  3QVY A;  3J06 A;  2QUP A;  3K1H A;  3LLK A;  2EIM C;  3EGX B;  3NKD A;  4JTA B;  5DS4 A;  1ZHT A;  1VYK A;  2OG2 A;  3VF0 A;  3NKE A;  4LDQ A;  3WHN A;  4E7Z A;  3AQB A;  2NSF A;  2XS1 A;  5KYW A;  4JUR I;  3HNI A;  3B29 A;  4MTO A;  3RH3 A;  4BG0 A;  4CJG A;  2PX3 A;  2PNO A;  2YL7 A;  5KYN A;  4YN0 B;  1OQC A;  1D0Z A;  1S7Z A;  4BJ5 A;  2R7O A;  3ECS A;  2HUJ A;  4PJN A;  4O6N A;  4JC7 A;  1JPN A;  2R7U A;  3FAJ A;  5F5H A;  1Z5Z A;  4BJT A;  2IXN A;  4RDA A;  1I4Y A;  3NMJ A;  4O79 A;  1ZW2 A;  3M79 A;  1K40 A;  4PJM A;  4CDA A;  1TWC A;  1K05 A;  3SEO A;  3DMD A;  3EG9 A;  2A0U A;  3EZI A;  3T6B A;  4ZLC A;  3O6X A;  1Z23 A;  1KU2 A;  1BBH A;  2Q4F A;  2WZF A;  4H54 A;  2WVQ A;  5E2Q A;  1H6G A;  2X51 A;  4JW1 A;  3ZVR A;  2OJQ A;  4CDV A;  4XWJ A;  3HNK A;  1V54 C;  3HTK C;  3F46 A;  3FAP B;  5DS5 A;  5A6B D;  4C7O A;  4ZLD A;  4ANJ A;  1FTS A;  1M57 C;  1MNE A;  2I8B A;  1OCR C;  3EZH A;  2TMV P;  5JVE A;  2A6E F;  5COF A;  4HFF B;  4MS2 A;  2YQY A;  4OIR F;  3SXK A;  1NFN A;  4A2N B;  3DAF A;  4XQ1 A;  4GQH A;  4UDV A;  1ZYR F; 
#chains in the Genus database with same CATH homology
 1LPE A;  1BZ4 A;  1LS4 A;  1EA8 A;  1GS9 A;  3R2P A;  1YA9 A;  3S84 A;  1OR2 A;  1B68 A;  1NFO A;  1LE4 A;  1AEP A;  1LE2 A;  1EQ1 A;  1OR3 A;  2KC3 A;  1NFN A;  1H7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...