4BJ5A

Crystal structure of rif2 in complex with the c-terminal domain of rap1 (rap1-rct)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
328
structure length
292
Chain Sequence
PVKERVDHVFYQKFKSMALQELGTNYLSISYVPSLSKFLSKNLRSMKNCIVFFDKVEHIHQYAGIDRAVSETLSLVDINVVIIEMNDYLMKSDLMMMVMRKINNDESIDHIVYFKFEQLDKLSTSTIIEPSKLTEFINVLSVLEKSNNIAFKVLIYSNNVSISSLLSTSLKKKLNTKYTVFEMPILTCAQEQEYLKKMIKFTFDSGSKLLQSYNSLVTCQLNNKESNLAIFFEFLKVFPHPFTYLFNAYTEIIVQSRTFDELLDKIRNRLTIKNYPHSAYNFKKNQRLPLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PROTEIN RIF2
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 103
structure length 292
sequence length 328
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1650 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj5A01
3.40.50.12060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bj5A02
4BJ5A 4BJ1A 4BJ6A
chains in the Genus database with same CATH superfamily
4DG9A 2ZQ5A 2RH5A 3O4JA 5HIJA 2PZ8A 4W5NA 4K9RA 4JP2A 3OZUA 2OGTA 5E8JA 3M6WA 4ULWA 5D7BA 1FRNA 4YMTA 3IAFA 4MGHA 5G1NA 2YL0A 2PRSA 4U2BA 5CFPA 4QYSA 2EAUA 1UFOA 3COWA 3HN6A 3CTMA 2BFNA 2OEPA 1EDOA 4H0NA 3ZY6A 4FE7A 4C6SA 3W9BA 4J91A 4BX3A 1CG6A 4DQVA 1AKVA 1P2BA 3A6GA 3ZIAA 3OIUA 2FX3A 3G49A 1WHSB 1TK3A 4M7PA 2OBNA 1N2SA 1RYYA 4JEIA 1A8QA 2ZWAA 1XIVA 1D1CA 1Q19A 3DFZA 1E92A 2R62A 3ANSA 4UNRA 4QX6A 4P9TA 4BZQA 1X39A 4O7GA 1P5HA 4G9BA 4RZXA 3U0CA 2XTZA 2XA9A 5KTPA 3VVMA 4LOKA 4IIUA 4MB0A 1N57A 5GONA 5LMNB 4KDEA 1TWAA 3HUTA 3WZMA 3H83A 5KX5B 4EX6A 1Q22A 3GEMA 4AZWA 1MTZA 1N2CB 2XAAA 2P9GA 2J31A 5D5PA 4HAIA 1M6YA 2O1EA 3DV9A 2WB4A 2C0QA 2C4NA 3ZGXA 3AF0A 3E22A 4I1RA 3UICA 1H6CA 4RK1A 1L7BA 2RE8A 5ADHA 2HPAA 3EWIA 5EUMA 2I6UA 1ODJA 2XQFA 2ZEJA 4B87A 3HCEA 3DDZX 1KS2A 4N54A 3NJRA 3CXRA 3OIYA 1UFKA 3C7TA 3ZI4A 2O50A 4D26A 2J6BA 2IOFK 3B82A 1PQ4A 2C9CA 4GXNA 1RD4A 3Q2IA 4MVWA 2O8NA 1W9MA 1YDMA 2CBZA 1WZEA 1XMJA 2I8AA 2XH8A 1ZUHA 4EW3A 4UATA 4N82A 3Q9SA 1ZJZA 4R2JA 5DM0A 2R48A 1AMUA 1I3OA 4XYEA 2PSFA 1N9ZA 4CT4B 4K46A 221PA 1XD2B 3LV8A 3R3YA 4R51A 1AZLA 4YBZA 1GAJA 1S8NA 5ICEA 1WY5A 1PNQA 2WP8J 2VJCA 3QRWA 1O89A 1JP7A 1SZPA 2WT4A 5EIWA 1BXGA 3DEHA 4QFBA 2EZTA 4UOQA 1JFFA 4WADA 2AOWA 2HT1A 1UBUS 2DRIA 4XD2A 5E6RB 4X6YA 5DZSA 4OIOF 2RG1A 2HY7A 4K2AA 3T41A 3QHAA 1Z7GA 4IXMA 3OEEA 1Z0IA 2J0QA 2AR9A 2IPXA 4XZ3A 2L6GA 1SC6A 3ZJ5A 5GAJA 1IIBA 3IRVA 2VTBB 3DHWC 1QS0A 5F2OA 2Q3HA 3DDHA 1XRPA 3LT2A 4EO4A 4I3FA 5CG2A 2FUG1 1ZNXA 4EGCB 3LOUA 3FAJA 4LYFA 4M7WA 5L3VA 1E1LA 3IEMA 3LBIA 3CRQA 5EL0A 3H18A 4ZFNA 3KZOA 1HR0B 3BSWA 1HA3A 3DE6X 5I9SA 2H8AA 3GBSA 1GPLA 3FWZA 5CT9A 5KSOA 2TYSB 4G1MB 1KJZA 1KORA 2HFIA 3GNSA 5DNCA 4DPMA 2Q3TA 3STTA 5EK0A 3KLNA 1A9TA 3UEOA 3A2KA 3MT0A 2HJGA 2IHBA 1IG3A 3OE7A 3CVOA 1DIOB 5IM5A 3W8IA 4CN9A 4FIZA 1VHWA 1OU4A 2FWRA 2YMQA 3THWA 2XRFA 3EYWA 1J24A 3EARA 2FR0A 2LTAA 4BP9A 3S2IA 1DBRA 4PX3A 5T64A 4AKSA 3BQ9A 1PNRA 2JZOA 1Z4NA 5D3ZA 3GA7A 4JD5A 3BHMA 4IWBA 4YJ2F 3QI2A 2ZYIA 1HI9A 4XASA 3N3AC 3IIEA 2HQOA 4F5DA 4KFUA 4CHTA 1X7YA 4E46A 5KYTA 3UBTA 4OFBA 4M21A 4ZHQF 4N3AA 3IUEA 3MS4A 2CF5A 4EBFA 4IJMA 3VJKA 1VRCA 4LGMA 1PFYA 4ZK6A 4CDNA 2ZVQX 1IEWA 3RQGA 3T34A 1Q3KA 3GUZA 2R03A 1KR2A 4AJKA 1A3CA 3QJGA 3PFGA 2QDXA 2ZT8A 5JNLA 1PKEA 3PCTA 4FHGA 2DTEA 3BZBA 3HV0A 1RAAA 3PTAA 1CB0A 1XFAA 3AUFA 4EMSA 2EPMX 4OHXA 1UM9B 2A59A 3W2GA 4FUTA 1WKVA 4UE2A 4X7RA 4GG1A 5JROA 2VDQB 4H15A 3GJYA 4Y30A 3WLIA 3AOUA 1TPYA 2WAXA 1QXSA 2G3VA 2VYFA 4II2A 1U7HA 4AXXA 2FK8A 5JAMA 3RFVA 1WXFA 4AJ1A 4WZ6A 4ZCTA 1PR4A 1IVNA 1ONOA 3BWBA 3SICE 2QNLA 5DBOA 1JHRA 4U7TB 1GL3A 1YUMA 1YAUO 5ELXA 2PJUA 4BO5A 4L73A 3DMDA 1L8QA 2GD2A 1BEZA 1Q12A 2XCIA 1SBHA 1G8JA 4ZCLA 3Q9NA 2GTPA 5TY0A 4UFNA 4XWJA 3L1UA 1VL2A 3RUFA 3A1SA 3C7CB 3NJ8A 3AUSA 4RGVA 5A03A 2GJAA 1ES9A 1Z8FA 5A4AA 1WTCA 5K2OA 3OTOB 1FVHA 3JW8A 2NTYC 3AFGA 3ZVRA 3KP1A 4P0PB 1VDMA 2HSZA 4ZT6A 1N2IA 3CH5A 1Q0DA 3DW3X 4LXGA 1UP6A 4K7BA 1QCYA 3L0IB 5B7QA 2ETXA 1NC3A 3ONVA 3LVQE 3EXFA 1YA7O 3PNBA 3RC8A 5FWXA 4ZI7F 4DR1B 3ZCXA 5GJVC 4JA0A 3KKMA 3TDKA 2PKRA 4EVRA 5C46F 4LYYA 4RPLA 1W85A 3OJXA 1MIOB 1ZIOA 3K05A 3D8HA 1CU1A 4EYGA 2Q1TA 1T6BY 4V0NA 4H6PA 5A9SA 2AFHE 2QTFA 1CTQA 3D2CA 4JVMA 1NRIA 3GCDA 5KCZA 1YL7A 2H3EA 4ZZ1A 5LLTA 4MW7A 2CUKA 4OJTA 2HIHA 3IBTA 3BYZA 5GADl 2X22A 3BBLA 1E9BA 2BYTA 3UB3A 1V95A 5GIOE 3WYDA 3ICVA 1ZHZA 3FG9A 2UUIA 3W2VA 1OBVA 3RAPR 1QLEC 3QJYA 2FZWA 4DLUA 3ER6A 4FFPA 3GDWA 4NSNA 5BUZA 5KKNB 1U1GA 1G8YA 1V3TA 1KFBB 1TDJA 1B14A 3CXUA 2YQ4A 4BTLA 1IM8A 1R4AA 3AYZB 2PL3A 2ZUUA 3LLUA 5EHNA 4OHOA 3DEZA 1GTMA 1YUBA 4G9GA 5JXIA 5KTRA 3DVAA 2OG1A 4BQEA 4R6XA 1MT0A 5BRAA 1V5FA 5IX8A 4QJBA 1ILWA 1AKWA 4K05A 5C4GB 3ZW8A 3DPIA 4AC9A 5L6MB 1SVIA 2YZKA 5D00A 3G7SA 4QGHA 5AM4A 4G5FA 4IO0A 1XGKA 3ZWNA 5CIYA 3H0CA 2ZXRA 2YRXA 3LC1O 4XDGA 2WZFA 3WQQA 1P7YA 1SIWA 2JFWA 2A0XA 4D0RA 4L8WB 3HRKA 3RVDA 4UBNA 3TW8B 5C52B 1RWWA 3R9IA 4RF2A 4R9VA 1Y1QA 5JAHA 4DBLE 1SPBS 2JD1A 4JYAB 1OV4A 3KVRA 1NSTA 4YCMA 3NBQA 4OG2A 2CEKA 3M6IA 1NJFA 2V5UA 2QDKA 2EIXA 2CDRA 1NBBA 4NBRA 1NW3A 1Z15A 2AG1A 4RDHA 4JJ7A 2DTXA 3NDPA 1KAEA 3OU6A 3WMFA 2PA3A 2EKPA 2YV2A 2IXTA 2JIRA 1Z0AA 1ZYRF 4NECA 3QUQA 2WOJA 3MYFA 3IMEA 1ODKA 2BMDA 3KR0A 2BZ1A 2O2JA 1KMCA 3RCBA 4TXNA 2IYUA 4CODB 3UXMA 3UC9A 1KKMA 1K1EA 1VXRA 1FSZA 4MW0A 4MV8A 2VPWA 2BJVA 1H93A 3VR4D 4J49A 1ZIPA 3KZKA 3CLKA 4MXDA 1O0BA 3T6JA 3L6UA 4D4LA 5D3KA 3I73A 5B1BC 4ZU6X 2O2DA 4KQKA 4LSMA 1HORA 1OMOA 4K9SA 4MV3A 4IG4A 4C2TA 1DDIA 4HT3B 1Q0QA 3TOZA 2M6SA 4DCUA 1JKIA 3T61A 3FBTA 5CDFA 1R5ID 2RKBA 3PSAA 2X1MA 3U09A 2F1RA 5C51B 1GZSA 3RT9A 3WK9A 3PXBA 1L7PA 4NOKA 3N58A 3PPIA 1CUIA 2Z5LA 3EUWA 2A57A 4WBSA 1WHSA 2G7MC 3P2JA 2ILVA 1EU1A 2OBYA 5EWJB 2PVPA 2SCUB 4AB1A 4PE5B 3LPDA 2Q1WA 2B98A 2WMDA 4YI3A 4X91A 3C1TA 2C2WA 2HWKA 1UT6A 3PD7A 3ESYA 5KU1A 2VZEA 1W4BA 3QWBA 4HBZA 3C87A 2N9UA 1ST2A 2EW1A 4RZHA 2B82A 2A6PA 4DMFA 5KX5A 3S7TA 1XRMA 4I4TB 1N2CA 4UTZA 3LM8A 4MUIA 4A8HA 5IULC 1RJDA 3CF4A 2ACWA 3LW8A 2CJWB 3JWHA 2GXQA 3V7NA 5LBTA 2VSXA 3RBXA 1VGQA 3U40A 1YBVA 2OLKA 3FPHA 5JO0A 5A6BA 3GPDG 1XZCA 2HU2A 2VSQA 4I55F 1P9OA 2VDPB 5JY1A 1CC1S 4I9FA 5DTQA 2D5RB 1U6HA 4B3HA 1XVLA 3WIUA 1FJGB 1YNOA 1L3IA 2FUNB 1D2RA 2AW3A 5ERGB 1LF0A 1FUKA 1P19A 4EFMA 1I3LA 3GANA 3GLGE 3WRWA 1VE7A 5HFNA 3WNZA 1RRCA 1XD2A 1NFQA 1ZD2P 3B71A 1JKJB 2FPXA 4L50A 2V4MA 2JK0A 4DMKA 1M67A 4EW2A 3T7AA 2LR0A 1AK9A 4EY6A 4LF6B 1V7CA 3WL5A 1S6YA 1RWVA 2P0YA 1FU7A 2X1HA 1P2DA 3PIIA 4Q47A 2EIKC 1N8NA 3A7DA 5E6RA 4L8GA 1SUAA 4F96A 1V6SA 3W2TA 4PN7A 1B93A 3HKEB 2I4NA 4YK5A 4M54A 4EG7A 1W2GA 4G0XA 3RPEA 1AV7A 5BMVF 1N4DA 4Y2RA 2EKDA 3EHMA 2HDWA 4F91B 4WERA 2QVXX 2GVZC 3HYNA 1CUHA 3B3GA 3KZ1E 4NF2A 1HOTA 1KZ1A 3JRNA 2VTBA 3FTEA 1Y4AE 3JR7A 1BNCA 1SD2A 4ZQFA 3FDXA 4NEQA 4C88A 1NXOA 4JVSB 4OHVA 3LKBA 4YRSA 3VZQA 3U4CA 1KRXA 2VEOA 4U2KA 4LJYA 1LNZA 3GLKA 4GICA 5EEHA 1IK4A 4XB1A 2PT5A 4NATA 4OHRA 3P32A 1MEOA 4AMUA 2QVYX 4Y6SA 4A2QA 4RHEA 3GUCA 1ESNA 1JEJA 2IYEA 1EBFA 2C31A 5K0NA 1DFHA 8ABPA 1JR3D 3DQZA 3SQLA 2ZBRA 3D7SA 1MQAA 4UHBA 1V37A 5FT9A 3UAZA 3LXMA 4F1KA 5J4YA 5BQ5A 2ZSDA 4TRMA 4O25A 4LI3X 3MQFA 1A95A 2NUPB 4LXUA 1ZVKA 1I8TA 5HKKD 5MDHA 4D9IA 2NIPA 3EF3A 3GRAA 1SC4A 3I32A 2CFTA 4OH1A 3FNQA 2QQ5A 2RHTA 3K96A 3ZHRA 5I47A 3DDSA 4H3SA 2Q00A 5A2GA 1JHOA 4MQBA 3VRCA 3EGOA 2Z8ZA 4F3NA 3CVJA 4LZWA 1ECGA 2WYOA 4J9UE 4P7FA 4YT4A 5IC4A 1UKCA 3BXPA 3Q7IA 1M5TA 2OO5C 4G0YA 2ZATA 3V7OA 3NASA 4PYOA 3UHJA 1XTZA 4M1KA 4LXXA 1PN3A 5CFLA 3EEOA 5KDLA 3EXG2 4MTOA 4G7HF 3WGNA 1VL0A 1GIAA 1ZX1A 1M7HA 3VKUA 2FUG6 2DPYA 2GJSA 3B3FA 4J90A 4D99A 5HCUA 4GM1A 3D64A 4ENPA 5IT4A 1T1JA 1SQ5A 2QI9C 2P11A 2HSQA 3HCPA 2CDCA 4L6IA 2ISCA 3ZK8A 1NZJA 1T0UA 4RMNA 1JSRA 3C7KA 4PYIA 2GQ0A 5FFMA 3E9ZA 3T52A 3E6AA 1UM9A 4CS8A 2DBQA 3FWHA 3UQYS 1WNTA 2AFIB 1JWBB 3M6UA 4Q4AB 2WHYA 5E9JA 4R05A 1HTWA 1NVBA 1KZ7B 4JYMA 4CV1A 3CX7A 2EFGA 2BGRA 2IRWA 2VRCD 1P6QA 5F21A 4FEGA 3IAXA 5BR8B 1P17A 2QN1A 2YCBA 3EIEA 1OUMA 5IAKA 1MNAA 3TZKA 2YXDA 5KCMA 3MUOA 3O82A 2Z57A 2A30A 4E22A 4RH1A 2WHRA 3O03A 4EJSC 4BNFA 1Z45A 2JCGA 5A6JA 1U8CB 4POAA 3TZ6A 1AS0A 1WABA 4L4XA 1K4KA 4D0GA 4CF7A 5HG0A 3Q10A 4OYYA 3PQ4A 3OUZA 1WOMA 3ZU5A 3ZZTA 1NTRA 4L78A 2BMWA 1QAQA 3K0CC 1A98A 3E3MA 1BKSB 1CUWA 2FPIB 2NVUB 2OZKA 4Q48A 5HXAA 4XSHA 3UMYA 4QTTB 3RRBA 2QM3A 5AXDA 3AF6A 4RVSA 3D4OA 4DNXA 3EMVA 1S4MA 3F4LA 1Y1RA 5DMHA 3TECE 3L0IA 1VMIA 4JJ6A 4I8IA 1ZMRA 5B30A 3NX4A 4A8JB 5EERA 2BEUB 2WYHA 4AYTA 2KNHA 3PHGA 1GNSA 2B20A 1Q0ZA 1KAGA 3U3MA 5AJTA 2PSHA 1RXYA 3PC8A 2QEQA 5J4LA 2XBLA 5AC4A 1MIOA 3GP8A 2GA9A 4N3GA 5TJHA 1HC7A 1U2DC 3ZLVA 3OIFA 3PQ7A 3WHIA 4DCMA 2OD7A 2XGJA 1YKSA 2E48A 4HNGA 4WVFA 3ZXUB 2YH2A 3PEWA 2D1FA 4MVJG 5T5QA 3EHDA 4BLSA 3PV0A 2VBIA 1VCMA 2OHHA 3GF4A 4JE9A 4KUHA 1T5OA 4Z5XA 1N9GB 1TKAA 4AX8A 2BEWB 1SKQA 1TQ6A 4RQTA 3VC3A 4ACAA 2RI6A 2J0EA 3KCNA 5AHKA 1EA7A 3D1VA 1YVUA 2LCIA 1NDQA 3QWAA 1KI9A 3PUXA 2C2BA 4ATNA 4UTVA 1PJBA 4OAPA 1R6TA 4PO3X 3EAFA 3QK7A 3IP8A 2GN8A 2ZS9A 2WZLA 2AYZA 2BRUC 4ZHSA 2P2YA 4JOQA 2ZSUA 3GLFB 4R3WA 4M8IA 4GZLA 5EI5A 2P2LA 5LC1A 2ATVA 4FYKA 1BMTA 4DCCA 1YFKA 4ZEVA 2HDNB 4U5XA 1K2VN 1EEHA 3O8OB 2QLBA 1Z6YA 4XWGA 5ICCA 4LDPA 1I4WA 5DTEA 4WINA 4XJSA 4QTYA 2HCFA 2GBCA 1TEXA 3LQ4A 1RLOA 3NGLA 3LK7A 3TD7A 4B79A 3LRTA 2IH2A 2CVPA 1NI4B 3BKXA 2IS2A 3L8ZA 3HI4A 3TW4A 2GKGA 3DLTA 3R9XB 4IS3A 3TTWA 1A88A 3GORA 5K8TA 3V1UA 4BB5A 2OV8A 1GKUB 3W5CA 3TW8A 1HETA 3ZG1A 1WVMA 2OK7A 4QOFA 4JB2A 3VHLB 5FTNA 3FYTA 1RRFA 4RY9A 1JHXA 5A06A 5IABA 1VPWA 2R66A 3F8WA 4L72A 3D7LA 3H8WA 2OM2A 4IUCS 2WJWA 1XTPA 5AKXA 2BBOA 2P7IA 4IJKA 1ZI6A 1XG5A 3CSSA 4ZDKA 1X2BA 3SQOA 2G1PA 4DR4B 3E61A 2A84A 4S35A 4AAYA 3K0HA 2MYUA 5A3RA 1PR3A 4FGLA 3HGMA 4MS4B 4KDRA 2UYHA 3AVUA 3MN1A 2DUUA 2LGJA 4X94A 4BKPA 4JUIA 5J4HA 2BZ0A 5L0FA 2WAYA 3KG2A 4RQUA 3FN4A 2JH3A 4YRNA 2HNAA 3PA6A 2H1WA 4FGWA 1NG9A 1ZK1A 5KAMA 3CIOA 2AR7A 4Q1CA 4HEAJ 3H04A 1GNVA 4OGGA 4JR0A 3ETLA 2Q6IA 4JI4B 3WGVA 3C41J 2GVDC 2YFYA 3ZEIA 1WPXA 4IWXA 4PEVA 2ZG6A 2ODQA 3H87A 1XU4A 4FR0A 4XOUA 3BXFA 3CR8A 5IT0A 2NO9A 3KTDA 1JHPA 4YUVA 5C5CA 1WA5A 3SJAA 1KBOA 1YZ3A 1L5YA 1M2GA 1V74B 5JNSA 1Q14A 3N24A 3GVCA 2AG5A 3NEAA 5DNEA 2EGHA 4EBKA 5GPGB 2WE8A 3G59A 1FDIA 5EWJA 6AT1A 2SCUA 3OD1A 5L0CA 1H9BA 1T0PA 3EHNA 2V6JA 4F9GA 1L5KA 1U3GA 4Z9JA 3DD7A 5LOVB 2BKXA 1R8QA 4D1YA 2BGKA 5DM4A 3CSKA 2JPUA 1EK5A 3FJYA 1QTQA 3ZTZA 4I4TA 4XGQA 3UMJA 2O2IA 1EWRA 4U2GA 4J29A 2OCXA 1ENYA 2FFAA 4KNWA 1IWOA 2CJWA 1P8JA 1WETA 2F3QA 2WD9A 4YRJA 2CXRA 2VF4X 4WY5A 2B99A 3BL8A 3VHQA 1Z5WA 1NT2A 3ABZA 4QHTA 3QFFA 1CUBA 3A1EA 1P9WA 1E1QA 2KS6A 1IEQA 3H97A 2D4UA 3OT4A 3PVZA 1N75A 2Q9UA 3WTCA 1Y5LA 5EZSA 2G40A 2BI7A 5DNUA 2ESRA 1OC2A 3TQFA 1GUFA 2LV8A 4YL0A 1L7RA 1JG1A 4OI1A 4B6RA 5A4KA 4E1AA 4L5BA 3MK31 4WK4B 1JKJA 1MC4A 3CJRA 3PLRA 2G5GX 4JEBA 2VZ0A 4NY3A 3C74A 1UC4B 5FHQA 3U80A 4YGXB 1AV6A 1ZZPA 5KPJA 3ML1A 3ZBUA 2QYHA 4KAFA 1T29A 2A94A 1NVDA 4DA7A 4B4KA 3ZJTA 1GZ4A 5EJMA 3HKEA 2OKUA 1TQ4A 2HMVA 4QPZA 2FJ0A 2GFHA 2C4HA 3TRFA 2P7VA 2Q3BA 2C88A 1C7RA 3K0BA 3DLIA 3IEIA 1D2MA 1MNEA 2OZVA 4YROA 3L1HA 4FYPA 4BMVA 3V5YA 1JUDA 4MVYA 5A04A 4S2UA 4JVSA 1T2DA 1ENOA 4H4DA 4HKTA 4GOKA 2GCNA 3QLUA 1IJFA 3Q3EA 1IM2A 3KT8A 3IQCA 2RFLA 4QIHA 3CWCA 3PRHA 1GTSA 4ND4A 2QR2A 3CX6A 4DS3A 2M1ZA 7MHTA 4J16C 1MOPA 3D0QA 1R0YA 2OHFA 3D6MA 3FWYA 1IULA 4PSVA 1ZMBA 4FEEA 1Y8AA 3EYAA 2YUTA 4ARCA 3RDPA 5ICSA 2HU7A 5M7EA 1AVTA 3Q5DA 4RD4A 2HNBA 1CDOA 3ON5A 1Z36A 3OUUA 4CKWB 5HP4A 3SR4A 1X7DA 5LMZA 4ACBA 3R6DA 5TXGA 2NUPA 3PDIB 5AW4A 4D57A 3KVYA 1FSFA 3KJHA 4FC6A 4RULA 5ALPA 3PX2A 4WN9B 2QUBA 4PRLA 3PB3A 2JIMA 4FOOA 3OLYA 4R71A 1Q1NA 1OFUX 3ELWA 2CW5A 2XWQA 3TF5A 1XTJA 2UDPA 3HZRA 1EXDA 2FP3A 5DHQA 5KSYA 1KU6A 2GESA 3PNYA 3EC2A 3VR6H 4EG6A 3K70B 5AJVB 4ZVTA 4PG5A 3OTHA 4NDAA 2H4WA 1CY1A 1O4WA 4MR7B 4FJ1A 4PIMA 1A76A 1N6KA 4OP2A 5EFZA 4W99A 4CCWA 3QOWA 4CDGA 1A82A 1CJVC 2A35A 1Z2AA 2FPLA 2OO7A 4JV5B 1OAOC 2JEOA 3OFVA 1V25A 1Y33E 1OJ7A 3ASYA 4ED9A 4RXUA 1GPH1 1GU0A 5A6AA 4B6IA 5DB4A 3N5KA 1BE0A 3DLPX 3D5TA 1N3BA 1XBTA 1ACJA 1Z0JA 1KKUA 1YHNA 4UUBA 2PKEA 1HG0A 2NO6A 1ADFA 1QYXA 3LBNA 4NU0A 4L22A 3NCTA 2CZCA 4CQMD 3E35A 3V6LA 2AFIA 5B57C 4Q4AA 1B8PA 3B2NA 4YDRA 1GWNA 1U1DA 3SM9A 5IPFA 5T8KC 5B5SA 4UEQA 4CIYA 1W4RA 1Z5VA 3JRTA 1TEVA 2OXIA 1I6LA 4MKXA 1CP3A 5IWCA 5KS2A 1QPBA 4INPA 3PU6A 4YS6A 2ZROA 4ZOAA 3LQKA 2PS0A 1OWNA 3ZPXA 1ZVVA 1JLSA 4R9SA 3TD2A 1PV1A 3T3OA 4IQ4A 4L0CA 1YUNA 1NE7A 3BMNB 3WMXA 1CRQA 3VM6A 2EATA 3DDOA 4R5MA 1NVKA 2P0NA 3QNMA 1V2HE 4L0DA 3KOXA 5AHWA 5BNZA 3LGXA 2A0BA 1Z6GA 5D3QA 2FPIA 2NVUA 1TLLA 1TKBA 1U31A 5E4TA 3LOQA 5F2KA 2NYVA 3FF1A 3SBEA 5F9HA 2O2HA 3KC2A 4G1EB 2DLCX 3QV1A 1Z6PA 1RLIA 1LVKA 2NZVG 4JK3A 1TJYA 3MWJA 2WZGA 3V4PB 3CTPA 1YJ8A 2CCJA 4A8JA 3P27A 2ZRNA 1OHHD 3TPFA 2BEUA 2BFDB 3HNOA 3QEOA 1YHZA 3ODPA 4D9EA 1ZEMA 1O3YA 4YHBA 5TNXA 4AM8A 3LS0A 3HL0A 4I4CA 1FXWF 3ENNA 2BW0A 3FMGA 3KU4A 4OKNA 2PCLA 2OV6A 5HQ3B 3OQVA 4GR4A 3KTFA 1M8KA 1L5NA 3UAXA 4PZLA 1RVV1 1SK8A 2HFKA 1NVEA 1E3JA 4RVUA 4IJJA 1HQKA 1O97C 4B75A 4EEXA 4NMWA 3UUWA 3BL5A 5FLYA 5BYKA 2CVOA 1HE3A 2Q2VA 3E9MA 1Z7BA 5CXQA 2XMDA 4M0DA 1QNFA 1RMYA 1AQUA 2OHGA 3F9CA 1N9GA 3KHSA 4FW8A 2B2NA 2BEWA 3CLRD 2JFOA 4TV8B 3DOCA 4BVBA 4FTWA 1M10A 5G0SA 3GP3A 1OREA 1WW3A 5HS4A 3ZJUA 2JFNA 4Z1MD 1RXVA 5FD8A 1NQTA 3GPIA 3DE2X 4OINF 3JWEA 2ZRBA 1Q7TA 5HCIA 2VEDA 5A5FA 3EIWA 3GLFA 4NXNB 5JC8A 3VPFA 1BXKA 1HLDA 3RS0A 2AQ8A 2P69A 3AR4A 4LC0A 1X13A 2ODTX 4PACA 3HJTA 3HHPA 3PZBA 3O8OA 4E7PA 5CD9A 4K5QA 1TZCA 2OOKA 3PKIA 1Y4SA 5CT6A 1ZJ5A 2EPKX 1E60A 3K94A 4C30A 4CSAA 1JQJC 4PYLA 5JCJA 1NI4A 5MHTA 2HADA 2O9XA 1UMDB 1Y7IA 1OCZC 3U5TA 3VNQA 3FOPA 3R9XA 4PJLA 1RWOA 1S1MA 1UF9A 4NBSA 1JA9A 4ZCMA 3FWKA 5K20A 1YR6A 4NK4A 3CR3C 1X8XA 5HILA 4JURI 4B45A 1IBKB 2EG5A 3K71B 4RVHA 3B38A 2W48A 4DDUA 4LPSA 2ZP1A 3NEPX 3PCXA 4YJFB 2DTDA 1Z47A 4EG3A 3HO8A 2YXBA 4IP0A 1SHJA 2ZZNA 4G3XA 3D4IA 5L6LB 2Q9BA 3B6MA 3WE7A 2F3UA 1IONA 1GUBA 2WI8A 2KYRA 4K40A 4KR7A 5H1YA 2YNMC 2HYDA 3SGLA 3PG5A 1G20B 3ANMA 4QQNA 1HMOA 4MS4A 1J90A 2VJAA 2MU1A 4G8DA 3VH3A 2YQZA 3DZCA 1LS1A 5CA1F 1GUYA 5J47A 5FTLA 1ZM3A 3ANXA 2A7XA 4KXUA 2F7SA 1SVMA 4UTRA 1JYEA 3VNBA 1W34A 2QE6A 4W82A 1YZFA 1DEAA 2I54A 3RU7A 5KYGA 1TB4A 3ESCA 2MJLA 1OU0A 1Q6ZA 3HU3A 1NM5A 2NO5A 1JAFA 3RUAA 4H35A 1HNXB 3R7NA 4I9UA 1TM1E 4QYXA 2IFTA 3FTQA 5LBUA 1D2HA 1QO0A 3UJ7A 3FFWA 3JQFA 3LBHA 2J48A 4NV1A 4PCAA 1PQWA 3G8CA 4HH4A 2P1AA 2R2GA 3ZV5A 4I0WB 3JAKB 5IH7A 4XWYA 4AY5A 1RAFA 2LP4A 2P9EA 2R6DA 5LOVA 4KJZA 3P9ZA 1JZSA 2EYUA 1SVNA 1DBSA 5BYBA 4BQIA 1E3DA 4TYNA 4I5DA 1KDVA 5CJPA 5J4KA 1LFDB 4KN8A 4W9MC 3QBEA 2YX1A 5LP1A 4HNRA 2QAGB 2HUPA 1VHDA 1M2HA 2R02A 1DAMA 1Z5UA 4S1PA 1KF0A 4PWZA 4W5QA 4KLRA 4K81B 4DSOA 3AM3A 4ZIRB 2A1DD 1RQPA 2GPTA 1GSAA 2QN7A 1H3FA 1X7WB 3HM2A 4AVYA 4ALJA 3FMOB 3JYLA 4DEXA 3LWDA 1G59A 3AETB 1XQ1A 2Q07A 3L01A 2GS9A 3H2GA 4ZPJA 2ANCA 2IIQA 1TC1A 1G9TA 4LY6A 3DZDA 4MMYB 1G7CA 1ZAYA 1LRLA 1E3QA 4TKMA 2XITA 2QT1A 1XMIA 4MAFA 3OUTA 3QOYA 1T1EA 1OC4A 3WHLA 1GPJA 2WTAA 3JD1A 4MKZA 1NP3A 4ND3A 4O1IA 5ITVA 3JQ9A 3LTNC 1WMEA 4RPIA 3A4MA 2ZRAA 1K5PA 2Y69C 3DTVD 3IA2A 3ILVA 1YK0A 2P1RA 3CZCA 1CY8A 1C9NA 3ZV7A 2F8MA 3CNLA 1CETA 4KC9A 3PHLA 3CWZA 5C81A 2H7VA 1A2QA 3C8GD 4M99A 1CIVA 1OXMA 2QRNA 2HA0A 1JQLB 3KQHA 1DAKA 3PZRA 4XTCS 4NAHA 5G0UA 4B6SA 3DP9A 1DX6A 3BWDD 5IDQA 4DNPA 4ZU3A 4JH0A 3KELA 4MQFB 2CCGA 4U6SA 2ZYTX 1JHDA 3N28A 1P74A 1JDUA 4TLDA 2IDKA 1RHUA 4M49A 3LCCA 2AHOA 3JD3A 2WV9A 3UG7A 3CH4B 3BS4A 4K9LA 1KE1A 1C0LA 4UOEA 3OFSA 1JR6A 2EX4A 4B82A 5EPEA 4MIKA 2ZS7A 2J0XA 4AL1A 1AF4A 3U9SA 4DGSA 2UUOA 2RGRA 2PZLA 2ID4A 4N5HX 1XD8A 1P80A 2Z15A 1INLA 2PKYX 3P0FA 1D7OA 3L8JA 5CU7A 3CS3A 5ARCA 1P1JA 4BS9A 3PWKA 1GRCA 2GM3A 5B1EA 3RSQA 1H65A 4KU4A 1FB5A 2JH9A 2WD7B 2HK8A 4PR9A 4Z7NB 1W0JD 1YU6A 2HPHA 1U1IA 1JNXX 2E5WA 4DLLA 4CL3A 4ILEA 4DB2A 4CKWA 1UFRA 2VHWA 1C3OB 4AL0A 5DLDA 3PPXA 4NU5A 1USVA 5JJIA 1CUDA 2QV7A 3DXFA 1QSGA 3KPJA 5AI8A 3PDIA 1HFJA 2W4QA 3O3OB 4WN9A 4OIRF 1T3LA 3AUUA 4ZQBA 1W2WB 1BEUB 2J0VA 1R6UA 1BYUA 3D9QX 5DLEA 1RI5A 4BGEA 1G6OA 3RC2A 5T41A 2C84A 5B7NA 3JQ8B 2FG6C 2B8TA 4KVFA 1DEXA 3WL7A 3EZIA 1C1HA 1H0HA 1PFKA 1RYDA 2FH5B 3U60B 5DH9A 1RJWA 4B4UA 2IXBA 1ZBQA 1C9KA 2Z8YM 2I2CA 3MTEA 3ZVKA 2V8BA 5B6IA 4MR7A 3KPUA 4FFDA 3ORRA 2X8AA 1MEJA 4YXWA 5EMHA 3SOPA 2AE1A 4QJ4A 3ZDLA 4GWGA 2C4WA 4EY5A 5IJXA 2WWTA 1KZYC 1G5RA 4KVZA 1NR1A 4BLVA 3GWNA 4EY3A 1H9CA 2JD3A 4N06A 4ME6A 2GD0A 1SR2A 1N5LA 4ANJA 3UJCA 2WJAA 4P3KA 2HN9A 2A2ZA 4UU7A 1RQXA 4JDUA 4IKPA 3EODA 4CM9D 1V4NA 2ZCUA 4MCAA 2WINI 4IOKA 2X0EA 1SD5A 1GGEA 5EYPB 5AM5A 3A32A 3JZDA 1XEXB 2C04A 1R0XA 1G1AA 2HLNA 4NC9A 4LF4B 4GL4A 3LAYA 3AZOA 1RXUA 1LTHR 4L8VA 2H92A 1CHNA 3ELUA 1YF3A 3X0DA 1CR4A 3D0OA 1XDBA 4QU9A 2BCGY 3IT1A 2IEDA 1G7RA 2R1UA 3H9CA 1C8BA 4ITUA 4LF8B 3BMNA 4XQ9A 4XEVA 3N05A 3OCYA 5B37A 1Q2XA 4BLQA 4Z4HA 4BWFB 1R0LA 4JGIA 1M9NA 4MI3A 3LDFA 5TQVA 2B5VA 4OOFA 4C5AA 2IHNA 2ECFA 4D6XA 4FESA 1D9ZA 1YRLA 3U49A 3K6KA 4GI1A 4FD2A 1EJ0A 5LSAA 1DEKA 3JQAB 5G0VA 2ZVPX 3IELA 1L4BA 2FN3A 1KK2A 4OMUA 2EG9A 2W0SA 2FZ5A 1XEAA 3FOZA 3JAWB 5DYTA 3HSSA 3T95A 1TUGA 1AD2A 1S2OA 4RV9A 3TEJA 2BFDA 3GG9A 2EL7A 1OV6A 3EZHA 3T6BA 5EHZA 1YC2A 4JIMA 2CZQA 4CXMA 2W2KB 1SXPA 3DOFA 4Z0PA 5JNRA 1W0KA 4ZKDA 5HQ3A 1RWQA 1P62B 4KVGA 4M9SA 1FS5A 1FTGA 3A31A 1D7AA 3TINA 2CNOA 5I4BA 3UPDA 2ZZKA 4RDIA 3WB0A 3EISA 2H06A 2GNOA 4AKHA 4QNNA 1JH8A 2HAEA 4RKYA 4L3OA 4HADA 3PD1A 5LYYA 3RKRA 1KMIY 4R0NA 3A25A 2AXEA 3CUEF 3CE6A 2C7RA 1E0SA 1D4ZA 3PJRA 4AZTA 2J9XB 4GMFA 4FFWA 4TV8A 3M1CB 4DVYP 2ZXOA 1KJ9A 1KZ6A 4EKIA 1GVHA 1GTVA 4RORA 2AG0A 3RKOF 4O59O 2R87A 3DNMA 4QDOA 4A4DA 1KI4A 5ES3A 3TLGB 1Z5PA 1I9GA 5TV2A 2CJXA 3EQ9A 3T5MA 1SOAA 1IQPA 3L0BA 1BMDA 3VUEA 1KYTA 1TF2A 3P9KA 2ADMA 2JF0A 4MUHA 3HABA 3QP9A 2C0PA 4UUNA 5E4FA 3M6FA 2BHSA 2KE5A 1O6FA 3NAQA 4AJIA 2DH6A 3AJ9A 1YR8A 5BPHA 1FPMA 5C7YA 1OWPA 3L0YA 1II8B 1ZVMA 3DO8A 2XL6A 3OM1A 1QIHA 3L07A 1UMDA 4NICA 2BKUA 5EXPA 2EERA 3HB7A 2FY8A 1ZZEA 2I2DA 3RK1A 5FPHA 2GUGA 1QLHA 4S04A 5A5EA 2AN5A 1PLJA 4OLJA 2WRZA 2XKAA 4FVTA 3UAYA 3HADA 5J3JA 4R40A 2I6GA 1ZSYA 1EXNA 4KWIA 4YJFA 1TZ2A 3LKZA 2OGZA 1FJHA 5JSFA 4TSKA 3TDNA 4XYBA 5ALVA 4WDQA 2D5LA 3ZNOA 1A9YA 1JDBB 3OFJA 1GT91 3X3HA 4XGKA 4QGAA 3B52X 1BR2A 4YY3B 2HWXA 3OZCA 1Z3IX 4LJRA 3VU1A 5HRUA 2XAUA 5AW1A 1G20A 3AXTA 3LHIA 5DHRA 2QV0A 3I37X 3SXZA 4U5QA 4CLRB 3QU9A 3RH3A 3DD1A 3M33A 5IBPA 5L4LA 3I4LA 4IIVA 4EHFA 3AMVA 1DV2A 3KR9A 1VLZA 3ZDBA 5B36A 4OQFA 3VAAA 3BWYA 3JQPA 3QEJA 3FFTA 3JZ0A 4YL1A 2HUJA 1N7IA 2JCVA 1GILA 2C78A 3ZYCA 3WKBA 2WZQA 3GUUA 3O1IC 3ITKA 3E03A 4BB6A 3BPSA 2WKWA 4D4JA 5JXWA 2WJPA 1MQ8B 4E2XA 4U7JA 1Z06A 1DKNA 3A3PA 1CK4A 4YP9A 3H7IA 1Y9DA 2XUHA 1YA4A 2Z2ZA 4JBXA 3ZNPA 3HZZA 1P44A 1OB2A 3KPHA 4KN9S 2RI0A 1A7VA 3DZAA 3I76A 1QV9A 2PIDA 1C8KA 3BERA 4G78A 3MTDA 3KZVA 4MJXA 4BJ6A 4C29A 1XB2A 4G7ZF 3KNZA 2GN1A 1U9CA 2IIBA 2W83A 3HJRA 1SCQA 3JAKA 3MS2A 1VSUA 4MNDA 4DCSA 1QPUA 5LWQA 3UYLA 5CB8A 1CZNA 2Z3ZA 5FPPA 2DWUA 4RSGA 3O31A 1ZGHA 3H2HA 1DG9A 5JRJA 1JI3A 3ASZA 3LC0A 4Q01A 2GM4A 1UOOA 2MTBA 4GDMA 5DM2A 3KEOA 1B6SA 1H2YA 1VE1A 1ADJA 4FINA 3BJRA 2FSIA 2QAGA 1MLDA 1QB8A 1CYDA 4C87A 3ILHA 3BFKA 1TYZA 3GM1A 4YFYA 1RQNA 4G4GA 1JRAA 1E4YA 4KSCA 2O06A 3RT1A 2QENA 3GJ7A 4ZIRA 3HO6A 2V3VA 4UEOA 1HZZC 5THQA 1YMVA 1IAQA 4AMZA 1VLVA 4B5LA 1X7WA 1T6UA 1Y5NA 3R7CA 3AETA 3F97A 2HHLA 4QUGA 3HEMA 1RBZA 2ON6A 3PKZA 2KMLA 4DBLC 4KITB 2BGMA 4EELA 1GN8A 4N6OA 4UBOA 4KVAA 2BUBA 2DULA 2FI1A 4OI2A 2XLMA 5E33A 3W1EA 1EINA 1DXHA 4UPEA 2P8SA 2FSSA 4PLVA 5GY7A 3A9UA 4WLOA 1MF7A 2WF5A 2WJ3A 1ZY2A 3R0QA 3E8MA 1GL6A 1N7GA 5BT9A 1JEYB 2O48X 2HCRA 2TRSB 2QU8A 2XXJA 2CY0A 2EV9A 2C94A 2EDCA 4KI0A 3EXEB 1E2NA 3T1TA 4PSKA 3L7KA 3M89A 3ZDXB 1GYPA 1NYTA 1YTLA 1YK1A 2D6FA 1DC6A 3SMQA 3C6ZA 5HTKA 1HE2A 4R68A 4DDHA 3THRA 2VDRB 1U0EA 1W5EA 3K5PA 1EWYA 5EJIA 3GRKA 3CT6A 3SJZA 3RVMA 4K8RB 4XYMA 3K0EA 3ER8A 2XWSA 3AG1C 2GYYA 1ESMA 1S5PA 5A5GA 2BFAA 4MQFA 4XR4A 2YVUA 5KX5F 2HT6A 3BTSA 3S4YA 2JRLA 3GP5A 3ENZA 1B2RA 4PXAA 4REQB 4E17A 1KDOA 2HSGA 1EX7A 3HN2A 2CE7A 4DXWA 2B7LA 3VDNB 5LU9A 1FNDA 4L0MA 4NYMR 2FN8A 3E1GA 4X9XA 3V9AA 2JANA 3UBMA 1RS0A 2YJNA 2NLOA 5AYVA 4QU0A 5LZ2A 4NYMQ 3S1AB 3I5QA 4ICIA 3E2PA 1OIXA 1GUZA 4WT7A 2ZBGA 4BO7A 4BVEA 1VI6A 4MW9A 4H1VA 4GKJB 1QVRA 3WQHA 1UJ5A 2ZIEA 5CNJA 2JHGA 3LHFA 2WD7A 3UMKA 1W49A 2E85A 2V8OA 4PVDA 4BATA 5KREA 1C3OA 2IXMA 4IB4A 2Z6QA 1MPXA 3KSBC 4LECA 4QQRA 4E5MA 2QF7A 4CUKA 2ZJ4A 3OLQA 4P6VF 4DQLA 2E5FA 3HP4A 3R2JA 4AP6A 3Q98A 4I6EA 4ZQEA 1W2WA 1PFWA 1EGMB 5K3FB 1AGXA 1GAQA 5C3UA 1DJQA 1TU3A 4ER9A 2AK2A 2APJA 2AQKA 5JS5A 1XUOA 1J0XO 4LQCA 2D3TA 1U04A 2JPDA 1QOQB 2D1QA 5EOVA 2FLKA 3JPYA 1PFVA 3ICOA 2WHPB 3JQ8A 1UPXA 2B1JA 2IP2A 4E6PA 3PWTA 1T5TA 1QORA 4KMRA 1C03A 1LUAA 2H2DA 4DFDA 4AU1A 3IIIA 1LW7A 1SXHA 4NNJA 1WKBA 3VMMA 3AQCA 4GE3A 2BBSA 3CB2A 1Y98A 2AWCA 3KJZA 4DDKA 1XP8A 1P9NA 4ZEMA 2E82A 2B0CA 3Q11A 2DR3A 2DAPA 3IT2A 3K8YA 3LBAA 4P35A 3ZOZA 1G2IA 3RUIA 1SELA 4RF5A 5E9AA 1R5OA 5C1OA 4HNUA 4LWZA 3U17A 2J33A 2Q1SA 5FOWA 2O2ZA 2RGEA 2V7TA 1NVGA 2WKSA 4O8CA 1OLUB 1YL6A 3C6XA 4A6PA 1JR2A 5JAOA 3FNBA 3H9QA 1UIRA 4PAQA 5EYPA 1B4DA 1NOIA 2COUA 2J4DA 1KDRA 1JQ5A 4ZAZA 4Y18A 4P0TA 3OOWA 1XEXA 2IHUA 4ZOCA 2C2YA 1VE6A 2GHIA 4IR7A 3Q7QA 2A69F 3OO1A 1CRPA 4Q7QA 2AMFA 4I1PA 3SX2A 5AM0A 1C4WA 3A37A 5DF1A 5DEIA 1AHPA 1JYFA 4QJ3A 3QPAA 3TKLA 3GCWA 4REMA 2TMYA 2KW5A 1NVXQ 3BJZA 5LQRA 3COPA 2QMOA 3QUAA 4Q39A 4UD6A 1HDXA 3WP1B 1JJIA 3CVVA 2HM7A 1G4UR 3NHSA 4YRQA 3SM3A 1BJTA 1Y82A 4DRHB 4D80A 3HM9A 5E3IA 3TRHA 2XYQA 4LMRA 3JQAA 4RFVA 5JWHA 2CSXA 1OASA 3JAWA 3FLMA 1X1AA 1RACA 4LX0A 4Q9NA 3R7FA 1CDDA 1XHFA 3JSAA 5IEBA 4TT3A 4AJPA 5T57A 1F38A 2W2KA 1WCWA 1XROA 1RM0A 2WF9A 1GEGA 1VKHA 2C54A 5L9AA 2ZI3A 1CZOA 4WNAB 5H81A 4ZJUA 1BDJB 4PNPA 3LMKA 4Z9BA 3O3CA 2PUJA 1B23P 1Z75A 1YDHA 1AGYA 1YZHA 4CLOB 2JBAB 1SR8A 4Q3DA 3KETA 3G9ZA 2LSEA 1YAJA 2I9PA 2NPUA 4BEWA 2PH1A 1USUA 1PUXA 3B89A 3GGCA 3QPCA 1JHVA 3D3JA 3FETA 4OYLA 4WUVA 3PVSA 5CW1A 1J06A 5JH7B 3NU1A 5DW0A 3QLJA 2WZBA 2ENWA 4G56A 3DZIA 1T0HB 3ZCRA 5IARA 1OLOA 1DKUA 3NRHA 4NHOA 3V7FA 1H1LB 2JI9A 1PAUA 3FCUB 3TLGA 1CQWA 1EQ2A 1UEXC 4O6VA 1EB9A 1QZUA 3U4QB 1R5NA 3VDMA 4DHEA 4AG5A 1P0MA 2HF8A 1S3FA 3QLVA 3HDGA 2KSFA 2WL8A 1G0NA 4MUGA 3UAVA 4RADA 4CQJA 1I5EA 1IHOA 1Z0ZA 4PIPA 1JMVA 5K3SA 3UFBA 2GCGA 2OUKA 3B20A 2OHJA 3BHIA 4TROA 1IUNA 4R31A 3BN3A 1XRSB 1SBZA 1VYTA 2CWDA 4G65A 1II8A 1RCUA 3IQGX 3PF8A 3DSRA 4DIEA 2OCIA 1E9DA 4WZBB 3O1JC 3WIOA 3VO8A 3S0XA 1X38A 3W6PA 2JCSA 4HQKA 3EZNA 3TG2A 2ZTUA 3M1IA 4WQMA 1SAYA 4C6TB 1G9SA 1SB9A 1JG4A 1WB4A 2B37A 5TMBA 3C3BA 5K0GA 5LUAA 3F6PA 4UEJA 2WP0A 2QTBA 2C1XA 1NPYA 4R83A 1OTHA 3IEVA 256BA 1CIPA 4E2WA 4YUYA 1J22A 4AZ3B 5H8WA 3CZRA 1XKTA 3EA5A 1R74A 3ESAA 4GM0A 1AC5A 3QA9A 5BWOA 2ERCA 1M6VB 1F4PA 1U28C 3ZN2A 8MHTA 1JMWA 4PBSA 3ELBA 5B1YA 1T4DA 3KQWA 3GLVA 1MN6A 1E1MA 2H48A 5AJWA 2PYDA 3SVZA 4OO3A 4K0RA 4OU4A 3JATB 4OHPA 1KI6B 2AE2A 5EY5B 2VASA 3REGA 4YN0B 3GO4A 4CLRA 1J0BA 2FXIA 3ABRB 3UUFA 4FHFA 4C1NA 3U4MA 4PAGA 3CRZA 3DV2A 2H4YA 2J3LA 3W8DA 3H5RA 5JI3E 2FW1A 1E6LA 2O8DB 4E5NA 1A9SA 5A05A 3QI7A 1U8EA 4RF3A 4RMGA 4NK5A 3PTZA 3BIOA 3IQDB 1TIKA 2QZ4A 1J8FA 3ED5A 2HLDA 1BU8A 1GFSA 5CNMA 4L95C 2GO1A 3Q2KA 2Y0CA 1KVUA 3NHRA 4CIAA 4B3JA 2PSJA 4F21A 3I0ZA 2B83A 2PT9A 1P3JA 2C3MA 3ZTYA 1RKCA 5BVHB 1JLHA 1DDOA 2VPIA 4MIOA 3NHYA 3HCDA 2YWXA 2GWWA 2NTNA 2MWQA 3ZGZA 3T4PA 2FEKA 1GZUA 3O6XA 4BX0A 1OX6A 3VC7A 1Q0MA 3M7IA 1R9MA 1AVOB 1Q1BA 2WJJA 1YMUA 5CDYA 4MQEB 2QUPA 4M22A 4KR6A 1TCVA 2DQ4A 2VG8A 1W5BA 4RK6A 3NIDB 1NX6A 2VP6A 3VZDA 4DTCA 4P22A 1Z4QA 3WGGA 4ZARA 2YDYA 2R6R1 1AA9A 1B8OA 2FQWA 5FXMA 4RACA 5EJ5A 4CR6A 3ADKA 4K6CA 3U0BA 1FFAA 2C7GA 5DMXA 5EKDA 2LD4A 3UHOA 3ZWCA 2K2QB 3I1YA 2XA1A 4Q12A 3I2GA 3M4NA 1U7XA 1FMFA 4AIIA 4BV9A 3LT0A 4IF6A 3DJYA 3L82B 4UM9D 2PS3A 1BZ4A 1DC8A 3GIWA 1BVYF 2VAWA 5IKEA 4JB3A 1I4YA 4N8SA 2FPMA 2R84A 2FEPA 2D3WA 3FCYA 3NWEA 4HDOB 4A3SA 4JEAA 4NC3A 3STXA 4RLQA 2QMQA 5KJCA 1Z0SA 3F9IA 2JGAA 8OHMA 2OY0A 1U11A 4NCNA 5T1DB 2ZAIA 1DOHA 4MUYA 2CHUA 2YJZA 4PSUA 4Q3BA 3AQ4A 4L4YA 2IS1A 3V97A 1OW8A 3TEFA 4F72A 1WS6A 2PX3A 4DN6A 3AG6A 4CG1A 1CP2A 4MIEA 2HL6A 4I9HA 2QXUA 1MNDA 3ORFA 2ES4A 4WA8A 1X8LA 4JI1B 4EGJA 1XTKA 2REQB 1JEYA 1KEUA 4ZVLA 3SKYA 3TSWA 2IU3A 4FYWA 3EXEA 2LNDA 1P9RA 3D7RA 3R09A 3QE0A 4O2RA 1B6TA 4CG3A 2MSCB 4MI6A 1FS6A 5AW0A 1JIJA 3EH2A 1BWSA 4Q3KA 4DBZA 3IKJA 3PC3A 1BA3A 2ISSD 5E9WA 3KS9A 5AIBA 1K6JA 2OILA 2HRCA 4M1WA 1ECJA 3PP8A 2IELA 4I4TF 3V1NA 3FHJA 5KWVA 4OSEA 4BO6A 2O2XA 4REQA 2MSEB 1Q83A 3BFPA 3JQGB 1BE6A 3GJRA 3T3DA 3P0IA 4O5OA 1WZIA 2DQSA 4EIYA 1E0JA 3IQWA 1U8YA 1NUPA 1B76A 1QMPA 3S1AA 2W2XA 3KUDA 4DMMA 5AKJA 3CIFA 3ZCSA 1FTYA 2NTEA 4BGDA 1VL8A 3O5AA 4LYGA 1C5KA 3A7EA 5FOTA 3V2UA 3HVKA 3FYCA 4Y6PA 4UXJA 4JMLA 4QDLA 1QG4A 3L0PA 3QY9A 4CW7A 3L2OB 4QPDA 1N2XA 2Z5FA 3R0XA 2GRAA 3O4FA 1TVMA 2BKAA 2W2LD 4WCFB 1ISPA 8ADHA 3LDAA 5JSLA 5CH8A 3OZGA 2JHFA 3A70A 1RZRA 4EJ2A 3HN7A 5LMUB 1E77A 5K3FA 4UNNA 3H9UA 4GEGA 3KWLA 4ZKEA 4PICA 4GMXA 4CMJA 4MVMA 1XDUA 4QNMA 1ZD8A 4YR9A 1JZTA 2WHPA 2HHCA 2JAHA 4TOIA 1Z4LA 2DB3A 4F6RB 4BUZA 1EXVA 5E95A 4FXOA 1ZMOA 3AUYA 4Y2YA 2F00A 1Z8HA 4FDTA 5IASA 2JL1A 2PWAA 1DARA 2BDTA 2A9RA 4YPFA 5F35A 4D6YA 3Q0EA 4DIMA 4P9NA 2X6RA 2J9RA 3E3OA 3EFBA 2UXDB 5E2BA 1YI8A 4JQZA 1DIRA 2GPJA 2PGAA 2GBLA 4M63A 3RYHB 2YHAA 3H2BA 4P6IC 2V6MA 5GZ3A 1XPRA 1PR2A 2YV3A 3ELYA 1RRGA 2C2KA 2HV6A 3P0RA 1B0PA 2AFRA 2I62A 3P4UA 1GA4A 1TFRA 4GAEA 3SX4A 3M4BA 1EA5A 1GY8A 4QM7A 2OP0A 3G7NA 3WLAA 3BOSA 3IR5A 1SCDA 2CK3D 4I1IA 2XQKA 4ND1A 1OLUA 1T5IA 1YA8A 1UC9A 3AB8A 4GYWA 5H4GA 3Q3JB 4C3DA 3DT6A 1KY5A 3WNQA 1D3AA 3E84A 1U3CA 4X3OA 1CEYA 2EILC 2G9QA 2YZSA 1ORVA 4P58A 5KTSA 2QNRA 4AN1A 3SC3A 2YVLA 1H2RS 3DE5X 4L9WA 4MQ5A 2CL7X 4H18A 2DT5A 4YUZA 1OFTA 3V8RA 4JLOA 4QUIA 2BCEA 4PO9A 1OR8A 3U61B 1Y1KE 1ZGZA 2QD1A 2BHTA 2XCQA 1BD4A 4HGRA 1HYGA 4Z7OB 1AN0A 2PU5A 2ZCJA 2N42A 4PFJA 3V2IA 2WWHA 3RSOA 2FGYA 1KQFA 1UXJA 4MW5A 1T01A 3V7WA 2OOCA 2WSYB 2MCFA 5GJWC 5KYKA 4IW3B 4PG7A 3INTA 3IBYA 2P30A 2DHEA 3F6BX 3HB9A 4UTPA 3FLBA 4BQSA 3HCCA 3TOSA 3T4RA 3BC1A 3MTAA 3U16A 3DA8A 1L5MA 1G17A 3ADPA 1BKYA 2OTCA 1PSZA 3N0VA 4H77A 1L4NA 4X92A 2AUMA 3SYKA 1U8XX 1R6XA 1G5PA 1K88A 2BFMA 3RKUA 4KIUA 1U0FA 4KPUB 4BP3A 5I45A 2WSSA 1RP1A 2AR0A 5CXXA 3SZOA 1W9HA 4KXYA 1E63A 1PWZA 4N6CA 4IDOA 4KQMA 5ECGC 4Q7JB 4XEUA 1VKOA 1XPUA 3CH6A 4WNAA 1BDJA 1RLTA 4KYUA 3PCVA 1M8JA 2CUTA 4XQEA 1I4LD 3Q8WA 2JLWA 5ENZA 4XSGA 4M0CA 2H1IA 4CLOA 2A1TS 2JBAA 4IIBA 3WLLA 2JAUA 3DUFB 4E0BA 4JI7B 1IFXA 5JUWA 4WGZA 3SLRA 4Q1VA 3T3IA 4X41A 1F6WA 1E7MA 2FK7A 2VWQA 1RAEA 4P84A 1V2GA 4IVPA 5JH7A 2C8JA 4HMOA 3AVQA 4F9EA 3PEFA 2G17A 1E9VA 5L3RA 1YS6A 2Y1LA 5E1DA 5FOXA 1I4TD 2RD9A 2O57A 1KEKA 1PLKA 3DHEA 2YLGA 3FOWA 2PFDA 1H1LA 1MA3A 2AXQA 1O5HA 2NQTA 3QX3A 1TQDA 3H84A 3GFVA 3L4KA 3PPWA 3U4QA 1DXQA 3C45A 3WLKX 2OEVA 4EKYA 2NNWB 2Q4DA 3HDHA 1M66A 1TL7C 1G5QA 1Z18A 3K1HA 5TPWB 5K0LA 3TBHA 1KQNA 3LUDA 3FM9A 1WLSA 2EFCB 4ZICA 3EDCA 5CI9A 1YBAA 4QPJC 1UBSB 4TXMA 4KK4A 1J0AA 3CN7A 1ZM2A 3DO6A 1I7LA 2ORIA 2QPTA 4HQNA 5T6BA 3AI1A 2OT3B 3KBBA 4LYJA 4JENA 2H9AA 4FU0A 2R1VB 3ZQVA 4G25A 5K0FA 4WZBA 1FVFA 4FDUA 2AZ4A 3H5OA 1JHUA 1ZNQO 2VKTA 4C6TA 1AIPA 2FQ1A 2VJKA 2ID8A 1ND6A 3MINB 3T3EA 1XQWA 5KJ6A 1E9EA 3QJ5A 1FFXB 4UPDA 3P0EA 2XVAA 2V97A 4DR6B 3UA4A 2A0YA 1LPEA 2VWPA 2SICE 4JCOA 1OQCA 4NJEB 2R4TA 4OLFA 3ROTA 4GZ5A 2Z9CA 3AY3A 3AU8A 4D9BA 3E9RA 4AZ3A 4MRMB 4D9KA 2HKIA 1TWHA 4K88A 1YBHA 4C78A 1GUDA 4QUKA 2A58A 3HVRA 1M6VA 4V0ME 5FUMA 4YRFA 2H2HA 1H2XA 2UXBB 2QN9A 5JJLA 2H2WA 3OKPA 5E0OA 1QQ6A 1PL6A 3WHNA 3IYLW 4BFXA 4WNCA 4KAXA 3PF9A 4ND2A 4FUQA 3JATA 1KI6A 3FDIA 4O4HB 4UQOA 1E5LA 4BU0A 1SQSA 2VJNA 5ALUA 2SKDA 4FOTA 4CIPA 2P5YA 2V9CA 4HDRB 3AXSA 4AG3A 2LD6A 2DSNA 2GH1A 4NOLA 2XCSB 1E6WA 3PXXA 1R12A 2O8DA 4JU8A 3IUMA 5E6SB 1Y6GA 3KUUA 1LDMA 5AW6A 4C05A 2O8VA 3OA1A 3ITDA 4G0UA 1O03A 3PPYA 3HYSA 2JA1A 5FUQA 3A06A 2FFHA 2M9MA 4GOND 4DNQA 4J03A 3DEIA 3NWPA 4N5IX 1DRWA 4Y0AA 1XWWA 5IY5C 4TS3A 5AGFA 4EJ0A 2A0WA 3FAZA 5BVHA 4TPKA 3FNRA 3PQDA 1ZGCA 2NVWA 3HCRA 4GIBA 2CBGA 2VP4A 4KHPB 1MO2A 4LBZA 5C8XA 4RD0A 2EW2A 3CLSC 2QTLA 1LLFA 2VUIB 2OV2A 4CI9A 5TSDA 4EJSB 2B7CA 4MQEA 4X54A 1HOXA 3GD7A 3RSFA 1H2EA 2PFGA 1UK9A 3C97A 1XYVA 4TMVA 1NW5A 5I7SA 3M4CA 1XR3A 1SVOA 4GUAA 4ZRDA 1Z5ZA 2H6EA 4A1OA 1U98A 4LWQA 4UBKA 4DV6B 4PZAA 4K0DA 2VP3A 3PC7A 1NFRA 3REOA 4YCDA 4F4DA 4G8CA 4LTDA 2VH3A 1U0HC 4GS5A 5F4BA 2Q1YA 2XOKD 1T91A 1UJ2A 1JTFA 3AR8A 2RK6A 3L6OO 1HKUA 3G02A 2W6ID 4DLRA 4CHGA 3K16A 3F9RA 4LEIA 1JQAA 2R7TA 1EM6A 2R7NA 3FTPA 3INNA 3WLJA 1XZPA 1X87A 3FJ1A 2JI7A 3TLXA 2ZJBA 2E4AA 1JAZA 3MNFA 1R66A 1X9GA 5KYUB 3EK2A 1ZKDA 4WFQA 1BU5A 2VNSA 1HF3A 1P5RA 1K7CA 5FI3A 4H7HA 4IJ6A 1JPJA 4Y67A 1Z6XA 4X00A 4YRMA 4BIIA 3MOGA 1FOEB 1PQUA 3Q7RA 2H4FA 4RU1A 3KHUA 4HXEB 2IEAA 3UWDA 3ZCUA 4EMUA 2REQA 4X0EA 3WVNA 3A1TA 3CEAA 3NOOA 1Y4ZA 4J7AA 4M3NA 1HMYA 2OZEA 4G5QA 1UDBA 2FPUA 1SKUA 1WG8A 1QBKC 4YCLA 3E8SA 1X3LA 3OZRA 1IK6A 1WNFA 4WKBA 4E5DA 5LXTB 1UMBB 1KPGA 1GPMA 2M4EA 2UUHA 2XCOA 4IKEA 1E6EA 4YMLA 4J1SA 3IVXA 4QXQA 5EKUA 3A14A 4OHYA 3U3DA 3RFCA 2K5UA 1RRVA 3DULA 1TCCA 4EJ6A 1BVRA 1CUCA 5GONF 3JQGA 3K09A 3TLBA 1O9HA 3F49S 1AZTA 1TQ8A 1XK6A 3FBWA 3VR6A 4RPJA 1XRNA 2GAAA 2PYIA 3SPXA 2J3IA 2FLVA 3ZDFA 4ZT4A 5JTUA 1ZRSA 2NPIA 4AQ7A 4TLEA 4QDXA 3VH4A 2O52A 4IMIB 2CYBA 2ZAOA 4NCJA 2ZUFA 2HXSA 3LY5A 5AK0A 1P2GA 3NRBA 2QLFA 3FA2A 4DXAA 5SY4A 2AVNA 3PYMA 4KWCA 4RPKA 1X1SA 2FF5A 5HEKA 4U7GA 2G9ZA 3EAGA 3W2FA 3MTQA 4KKVA 2CKMA 4ZQCB 3MERA 2INGX 3EBPA 5JVEA 2UV8A 4G9EA 2FZVA 3QSGA 4OQNA 2RGNC 2B4AA 1EG2A 4Q9AA 4WCFA 4JI6B 3EMDA 1RWNA 1H8EA 1M5RA 3W1WA 4P4SB 2L6HA 2VHYA 3ZZUA 1L7MA 2XMRA 3L93A 2QRZA 1DOVA 5CM2Z 1NWCA 3TTSA 3ZIAD 5ADUS 3TR0A 1J00A 2KPOA 4PZUA 4LHYA 2I7CA 2P6PA 5E7IA 4MKFA 4Q1BA 2OCBA 5HF6A 1DEOA 5P21A 1NQWA 3EVNA 3GEGA 3QGMA 4HR7A 2Y1FA 3RBAA 4OQEA 3W5AA 2FF7A 2C9BA 3NNSA 1U0LA 5CA0B 4F6RA 2DWOA 2YUIA 3G4XA 1SCJA 5DHAA 1RPJA 3FPAA 4GI2A 4FHZA 4CETA 1URPA 5DTMA 4C0XA 3W0LB 5FTWA 2DQKA 3EVDA 3FOAA 3CWQA 4R1LA 4Z9HA 5A62A 3KQTA 4GMKA 4I5IA 4JROA 2HU5A 1R8YA 1P7VA 3NKVA 4DSNA 4FI3F 2GSWA 3RYHA 2CC2A 4RGYA 5AKKA 4FT2A 5BVGB 2QUZA 5DSZA 3PQ8A 4P93A 3GT7A 4X62B 3ZI0A 3WL6A 1QGYA 1ZN9A 1HMDA 4HPWA 5IVKA 1T2NA 2QZPA 3GEPA 4PG6A 2PGLA 1VOMA 5H7XA 1EFRD 1GPUA 2M64A 4MAAA 2DC1A 4R1MA 4B46A 4G8BA 3UYKA 3LNMB 4WLFA 2BBTA 2YJ4A 3COSA 2WMYA 3BWEA 1D2GA 3LI2A 1JJFA 3HR4A 2BGJA 2CLFB 1FJXA 2I4IA 3WJ1A 1LU9A 3TLJA 3DMTC 1YB4A 5JNTA 3DQPA 3IRUA 1TQ2A 1C2TA 3ZTTA 1AK1A 1L9XA 2IZ5A 2J8ZA 1XTSA 1JS1X 3JALB 3PXAA 4TKVB 5G0WA 3NRJA 1E69A 1T1SA 3WGIA 1NF9A 1GAEO 2UZ0A 4DL9A 4PYNA 3NRCA 3OPQA 2P3QA 4BN0A 5JD3A 3U26A 2XVXA 4BV8A 3CZ5A 5AR1A 4GR9A 3OEED 5G41A 2V74B 4NABA 1UZUA 3AIOA 3NOVA 3EW7A 1FFEA 3LSYA 1RPTA 4HGYA 2OFOA 3OPXA 2JAXA 1IIRA 3HXOA 3HCBA 2UKDA 4YMVA 2JKVA 5ELMA 4IDPA 4KPUA 4GMDA 4C4YA 1NBME 4HAOA 1L5GB 2J1LA 2R4QA 2FX2A 2ZZMA 2J32A 1N77A 1RQ2A 1ZUWA 2QIOA 2IODA 2OQVA 3PXDA 4FNAA 1HLGA 4LRWA 2OBFA 1HBJA 1OW6A 3VI4B 3MWYW 2JCXA 2PTGA 3KX2A 721PA 3HY6A 4NL4H 3J7AC 3DUFA 3H13A 1ICIA 1CR6A 4N0DA 4TLMB 1AZSC 3L8FA 4HEHA 4HYTA 3ZS8A 5EP3A 4S05A 2V7VA 3TIIA 3K30A 4LRXA 3ZHQA 1UM8A 3GNTA 3ICEA 1VCOA 3VSBA 5DYNA 5B2EA 1FLNA 4HFKB 3QXSA 2IDJA 2R7AA 1PIWA 3PL5A 2YOGA 2ODNA 3WSWA 3J80A 4DUYB 4FNOA 4OMFG 1U0BB 4ISBA 1MJNA 2JLUA 4D5EA 4RZUA 3G8DA 3WDSA 4A0HA 4QQFA 3PNPA 3QV2A 3SEQA 4OQYA 2QOEA 3GFTA 3TOXA 5TPWA 5IJAA 3S8MA 2DPXA 2K2WA 2YL2A 1QZ3A 4RHUA 1E59A 3PGKA 1MJGA 4K9DA 4MLPA 1Z74A 2XCRB 4ALMA 4EMTA 1L7QA 3HK2A 3D4LA 4CF3A 2R1VA 1XX6A 2MHCA 3VOSA 1C8VB 3OIWA 5HOQA 1QVXA 5EINA 2FWJA 3F5QA 1GR1A 3B51X 3H2ZA 3NHKA 1C7JA 2D7JA 4FPXA 1US8B 3BF8A 3MINA 1UR5A 3BD6A 3FAPB 4D0NA 4MEBA 5DK4A 3OX2A 1IOLA 3TJZA 3IQFA 3N8HA 1U7TA 3G5TA 3HBLA 3VUFA 1FFXA 3DL7A 1BWQA 2WJHA 1NI3A 3SLGA 1YFZA 2Z8XA 1LF5A 3WBJA 1B8VA 2XZPA 4NJEA 4Z7QB 5D6NA 3NWOA 3MD9A 2BPOA 4MRMA 2PKQP 1DC5A 4URHA 4YT8A 3HGQA 5JFGA 2VP5A 3HXKA 4YAJA 2V6IA 5I7FA 2VQ3A 2OO5A 5E7QA 3KH2A 2PMKA 3WGHA 3KYBA 3PIDA 3E9QA 2AOVA 2C96A 4PVCA 4YMSA 4TV8F 2JI4A 1ZO8A 2TECE 2X42A 2XA2A 2DGDA 3O26A 4HDRA 2Q2QA 4F85A 4F84A 1NUSA 1CFJA 4RABA 3ZZNA 4NYIR 2H8KA 3I8SA 4FYVA 4DTIA 5IP5A 3FCOA 3KDAA 3B7GA 3FSGA 1JG7A 1T3ZA 1OILA 1YRAA 5E6SA 4GL2A 2VWGA 4LOJA 4TN5A 2GFQA 5BURA 3IJEB 3ISJA 1K4MA 1ZFNA 2KQ9A 4X7BA 6NULA 4G0NA 1JF8A 2LKCA 4J1TC 5D51S 2PT6A 3WGUA 3KJFA 1QQTA 1GN9A 1PG0A 2OQIA 4Y6QA 1YOBA 3IERA 1ATZA 3NAZA 2R6GA 2B3TA 4ARVA 1ONPA 2WM8A 4QGBA 3GOQA 4JN6B 5I9MA 1SOVA 1J20A 1ZHWA 1IHPA 1ORSC 4NU6A 4EJSA 4TS4A 1H22A 5CHEA 3BEDA 1IY0A 1Z23A 4F2WA 5J2UB 5KC9A 1U3TA 2ANBA 1H6AA 4KQHA 3WLFA 4EI8A 2XNCA 5ULLA 1A1SA 3DMNA 4C14A 3K0CA 2KBFA 4MUEA 2GMWA 1FNMA 2H1FA 2P4EA 5C34B 1X2EA 1K86A 5JLIA 3IPXA 5UKDA 2WV7A 1VHTA 2KHZA 2ZB2A 2AD1A 1J2RA 4PLCA 2WT8A 3I0MA 3RK4A 1I4ZA 3WJ7A 5K4HA 5AOBA 3IVCA 1I51A 2HFJA 5CM9C 2C98A 2NXJA 2N1BA 3KSDO 3Q40A 3JWGA 1UJ6A 4B6PA 4D46A 1DO0A 4NOJA 1Y5RA 4TLLB 4OFWA 1NY6A 2NYRA 1T5LA 4WH0A 5KAPA 5AVRA 5KYUA 4UUOA 2PBRA 2GZMA 4IV8A 1J39A 4UHHA 1LPSA 2VYQA 4D3ZA 1W6RA 3KO8A 1JLRA 1QIJA 3H8SA 4N9WA 5L0IA 2VHXA 4OB6A 5KWIA 4M1OA 1FNSA 3OQHA 1N4AA 1SIUA 3MC1A 1TT7A 9ABPA 3QBDA 4Y1RB 1MABB 1P45A 4W9NC 2IOQA 3F5MA 3KB2A 2XYVA 2QX9A 1UK7A 1WUTA 5CLQA 4FJ2A 4QG7A 5G53C 3UKJA 2ODAA 1QIMA 1D0YA 1W5FA 3JVUA 4ZV9A 5CNKA 2FMKA 4AMVA 2FG7C 2O7VA 5DULA 1W8DA 4RENA 4A6EA 3ONWA 4HVAA 4FQ8A 3MGKA 1OOEA 2Z6UA 4RLFA 1KMHB 1LJUA 2Y93A 4E7ZA 5LXTA 1UMBA 4B33A 4X1OA 3UF0A 1LPMA 1G8AA 2JFZA 2JDIA 3ZQ4A 1C3JA 3DB1A 4EYOA 2BRUA 2GCIA 2P62A 1T2EA 1R3UA 1BR1A 1T9ZA 3Q9LA 2QR3A 3LHSA 3MJFA 4EYEA 2Y2UA 2O3SA 5FLEX 3WV4A 1KNXA 3ACBA 4PQFA 1NVFA 3V8QA 1BQEA 2F64A 4UW9A 1V71A 1OB5A 4EHDA 3U3JA 2B6NA 1SIOA 3NP7A 1E3IA 2E2WA 3DNPA 1MDBA 2I6TA 2ARKA 4L7VA 5ITSA 4UZSA 4KXQA 3OOSA 5DXJA 2OZPA 3CVUA 3GAMA 2CD9A 4Q1FA 1GPKA 2ZW9A 1CF2O 4Q05A 3Q7PA 1N1MA 3OF3A 3E5HA 1PR9A 2GZ3A 3GG2A 1GADO 3N8KA 4UZFA 2W6MA 3A6JA 3RNOA 1OXKB 4ETIA 2W42A 1PFQA 5ALRA 3O93A 2ZAYA 2XL8A 1OBHA 4AF7A 3W7AA 4P4SA 2BONA 3T3NA 1UWKA 3MBIA 5IZCC 3AGQA 3DVLA 5HKBA 3I8OA 5CT5A 3RSCA 3RVKA 3TYXA 4BE4A 1WXXA 4IL5A 3TR6A 5LQUA 3P26A 2XOEA 1JE1A 4FYHA 4JT4A 5IBQA 5AWFC 2FPKA 8LDHA 5CA0A 1HV8A 1U2RA 2WEKA 1UPAA 2HCTA 1GG9A 2VLIA 2SBTA 3V5ZA 2V5AA 3ZD7A 4GI3A 2Y0BA 4P7BA 3PC6A 2CLMB 3MWEB 4LJSA 1OTYA 2BC9A 4EFKA 3O83A 2PBEA 4QJ5A 3PUHA 3DWIA 5ER9A 4Q5IA 3E8XA 3FHLA 4JW1A 1VBMA 1VLQA 3KOZA 5A4FS 2EF1A 3KQYA 5BVGA 1CPQA 3EXIB 6ADHA 2ZPAA 2NM0A 4FKZA 4MVJI 5ITZB 1RKBA 2PFSA 4XUEA 5FFFA 4NZZA 3ACCA 1W47A 2X0NA 1O96B 4ALNA 4JZYA 2ZSIA 3AOEA 4LNUB 2XZOA 3F4KA 1GV1A 5EE3A 1ZAKA 4QHYA 1MH9A 2WTMA 4HWTA 3FZGA 4UZEA 1SBIA 3N2EA 2EPOA 3KQPA 3FUXA 4D98A 4MWOA 4M1MA 3OURA 3W6OA 3K20A 4EW6A 1CGME 1WDKA 4EO7A 2GEDA 4PJJA 4HEA1 1O5OA 1FTNA 5DNYB 3FNHA 1PU2A 2XB4A 2JFPA 3OWTA 1XNGA 2PX4A 3UT6A 4U2CA 1IZ7A 4TTPA 4ZREA 4XVQA 3W77A 2XLDA 3JALA 4TKVA 1GCIA 4NENB 4MX8A 1O8BA 3D3EA 1YIOA 3W8EA 2TMDA 4FFNA 1EVKA 2ET6A 4Y2VA 4E18A 1VL5A 3V1TC 1KC1A 1IZYA 4EECA 2Y3IA 4B8ZA 3G9UA 3E05A 4JLSA 3DF9A 3A36A 5JADA 3DPSA 3FYSA 5IBRA 3F0TA 1RLJA 1TADA 2Z3WA 5TRTA 5FV4A 4ZT3A 4GOOD 5KQRA 5COQA 4B32A 4CMAA 1NNUA 3OIGA 1KEEB 1RADA 4RV4A 4J4TA 2F2TA 4PPQA 4PLPA 3TIXB 5D84A 1DRUA 1EVIA 3MMZA 1U0JA 3SNKA 5JWOA 3C6KA 2X2FA 3G0BA 4JRZA 4R1QA 3QTHA 1PJSA 4Q3CA 3FHOA 3I4CA 3QU2A 3U62A 1KYQA 2QT0A 2JFBA 3SVTA 2ZIAA 3QUSA 4U5FE 1KGDA 4BX9A 4BJHB 4JI8B 4E70A 4W7HA 5JRDS 1VJRA 3DE1X 4I50B 2FRXA 3V7UA 1Z28A 3T12A 4DUGA 3DZHA 4C01A 1WQ1R 4D82A 4XH9B 4DM7A 5IDYA 5AVZA 4BVHA 4N5MA 3CMCO 1ML4A 3HA3A 3PC2A 3HJBA 2WLSA 3M3PA 3FVWA 5DP2A 5JBIA 4B5KA 1WMSA 3QXGA 4HLDA 1MZVA 3N9IA 1JKXA 3TX2A 4QUEA 4ARBA 3SXYA 3E2IA 2J0SA 1OPRA 4PCLA 4LVNA 1ISGA 1HNWB 3PHHA 4HGZA 1Y3DE 4KR9A 2RGDA 2ZQZA 3SJUA 1KTMA 5D87A 3I2JA 1XJ5A 3CN9A 3AUJB 4DIDA 3QYAA 3RSLA 5D86A 2CHVA 4BJ5A 5A1TA 3DE0X 1W44A 3JVVA 5JD4A 4A0RA 1OLSB 1R0BA 4F86A 3BSYA 4ZVRA 4F1JA 2C9DA 2O7RA 4YO8A 3NH6A 1YDFA 1VBNA 3BK7A 4RKQA 1OCRC 5EJFA 3E5NA 1ZNWA 3O2NA 1NW7A 1EMDA 4V3CA 2UYYA 3WICA 4QEZA 2AB0A 4O79A 2YOHA 3MQ2A 4PCUA 5AVJA 4E2YA 3ETEA 1PJ2A 2X7HA 1PL8A 1U6IA 2V58A 3GUYA 1RYEA 4J7YA 1US8A 4B7XA 4LXQA 1USWA 3MJVA 1XU7A 4F7WA 4BKRA 4OXNA 4CKCB 4X3CA 5CH3A 4F4FA 2I7TA 2XUIA 2AG8A 1NP6A 5C80A 1XT6A 1ZRHA 2A78A 5LM3A 1XTRA 1Y7HA 4M8KA 2CFRA 3QBVA 3UGPA 3AINA 1ODFA 1G6KA 3UGQA 4DBVO 4W8GA 4P9FA 4JJKA 3BM5A 4U2FA 1NQOA 4KR0A 1A5BB 2AEJA 2QJTA 1QRAA 5H0IA 2EW8A 2BZGA 3N5CA 2A6HF 1PE0A 2RGWA 1QCDA 1J9GA 2FW7A 3NYLA 2ASEA 4QU8A 3EEFA 4F4HA 1U2QA 4C1BA 5ALZA 1J2TA 4D9JA 4YAWA 1O4VA 2N1MA 2PRZA 2XVZA 1JDVA 4L57A 1RMVA 1U5CA 4RVCA 3SG0A 4XUGB 1HXHA 5THXA 4UHEA 2VATA 3WGOA 1OAOA 4C2AA 1HQDA 2REOA 3PUYA 2I55A 3PJEA 4PR0A 1N34B 1WXQA 4CDMA 2VXBA 1F1JA 4TYMA 3HLYA 3J06A 2QG9A 4AO8A 2YWCA 3DOUA 3IURA 3HXLA 1P31A 3U37A 3GA5A 4PW0A 5ALYA 1SBCA 3LF2A 5DGCA 1E2HA 1LLCA 4LV8B 2VCAA 4COOA 2OV1A 3SEOA 2R8EA 3AEZA 3K8OE 2UUPA 3WJ2A 2G9VA 1R88A 5T8KA 1ZMTA 1VYUA 2IPMA 1YWGO 1YONA 1YKGA 4RS3A 3E0XA 4C4ZA 2I2BA 1H94A 4K28A 4WKPA 4RAOA 5I9NA 1XNRB 1XJWA 2HRZA 2WFMA 2UYGA 4NU8X 2FSPA 2FAPB 5F12A 3RYIB 1M73E 5DTJA 4DV3B 4KOEC 5EMKA 1G41A 2OWDA 3N7UA 3RYCB 5J2UA 4MMZB 2WB2A 5TJ5E 4NG5A 3FZNA 4C7VA 5JRZA 2ID7A 3QG1A 3MFYA 4RPCA 2GN9A 1SA0B 1K6MA 2MSDB 4YDHB 5AKIA 5EAIA 4EF5A 2D5AA 1U7ZA 4DW8A 3FB1A 4ZAGA 4V02A 1QKKA 2XE8A 3Q6NA 5K0BA 1QR2A 4WOPA 2R6CA 3N0TA 3KHTA 4LV5B 5IMSA 4XJTA 4CV3A 3CZMA 4BU1A 2GARA 2OCYC 1AUPA 1WSWA 3UWOA 1RE1A 2IBTA 3TW6A 2R5WA 1Z7EA 3ETJA 1HRDA 5DIFA 3E7XA 3ZY4A 2PZBA 2W9YA 3BRWD 1ZA1A 2NSGA 1BOFA 2HA5A 1UJCA 4JI5B 2C2OA 3HLTA 4MCJA 3Q8LA 3QEMB 2V96A 4PS0A 4TZ6A 4JBIA 4YYZA 5TT0A 3E70C 3RF3A 2DYKA 1IYZA 4QPPA 2V4ZA 1UKVY 5CNIA 3WDLA 3KV3O 1HYEA 5K0SA 2XX3A 3RROA 2DT8A 2KLHA 3M9XA 1Y7TA 1RJ9B 1XZBA 4D4IA 3WYAA 3MJDA 3R5TA 4CMBA 4G8JA 3P0HA 4RY8A 2QX6A 4Y1RA 2VUHB 1WBJB 2G36A 1MABA 4L6RA 4QG3A 1G8SA 2WSBA 2VT3A 1DTEA 1XE3A 3PWSA 5SY6A 1QWSA 5FORA 5CK5A 4H3VA 3RIPA 3O8NA 5FLKA 1V3UA 4S3MA 2ATCA 4PC3A 3TPCA 3JTLO 2EP8A 1LBTA 3PEVA 1IC6A 4IJWA 1JH9A 2Y3GA 3KPVA 3UUGA 1KMHA 2ZR7A 1LNSA 1E2KA 1J7KA 3O1LA 5CH5A 4DR2B 4JOCA 4ZMRA 4W5HA 2UZ4A 4IG9A 4WN3A 1DKRA 3F3KA 3FCCA 1RI2A 1Q5PA 5JT4A 4CV2A 4RLSA 3VGPA 1BRMA 1ONBA 4KX5A 2Z2IA 4LE0A 3CW9A 2R6FA 1N7HA 4G2NA 5LZ8A 2F9MA 3R8FA 4FHCA 5AI0A 2V98A 3TKYA 2GM5A 1T6ZA 3S84A 3OCXA 2LRHA 2ZI7A 4JSYA 3VR3D 1CZHA 1XZJA 1J23A 2DYRC 2JJ8A 5TQJA 4PX2A 4MW6A 4XVCA 3CUKA 3VU8A 3ONFA 3FJOA 4HTFB 1NF2A 2XNDD 3UMBA 4IO1A 3UGTA 1TZMA 5EJAA 1NBEA 1L4EA 2LW7A 1IU9A 3KXPA 1JJBA 4KV9A 1DBIA 1E96A 3QVJA 2WIBA 1L8OA 3S6JA 4KIWA 3PFKA 1XLWA 2VHJA 2HQSA 1UG7A 1GNQA 1ZRMA 4NPHA 2ETSA 3U1BA 4D45A 4JJAA 4JLVA 2FWPA 5FAKA 1OXKA 2PUCA 1Q1ZA 5EZYB 1ZA2A 3BEHA 5AKGA 1JA0A 3AGUA 4PHTA 3U4AA 2R7SA 2PMEA 1U99A 2F8LA 4AJLA 2QRHA 4MYDA 2ZU6A 3NJ4A 3EZXA 2W90A 5EPOA 1AN9A 4CNQA 2Z2KA 4TS1A 2W2QA 4HZIA 3BKWA 1CUAA 2CVHA 4L51A 4NMLA 3ZNNA 3ZY2A 3TSZA 3BBPA 3MAGA 4CI0B 2Y9PB 3SXUB 3PNMA 4HJXA 5FL3A 2HJ9A 2WOOA 1W48A 2WG1A 4GI5A 1GITA 1NIJA 5F78A 4AZSA 4WJ0A 1FXSA 3VPHA 4D02A 3RTBA 1K5DA 3MWEA 2AOXA 2FKAA 1ECBA 3KZMA 3P5SA 2JC3A 4RK4A 1HO3A 3AVTA 3BEOA 2POQX 4AQDA 1W4ZA 5ITZA 5B4TA 4RY2A 5EA2A 4G6ZA 1F3OA 1O0SA 1XHLA 3P2KA 4P3OA 4CMCA 1ULSA 1O96A 1R5BA 4LNUA 2VNHA 4R0VA 1O08A 2J45A 3OP4A 1WJGA 3DOOA 3OPYI 4KACA 3S2SA 2KWIA 4W7IA 4C0WA 1JBQA 1LPOA 3ZKWB 1IRXA 1KFJB 3VPCA 2YMPA 2V1UA 4LFAB 2JI6A 1WSBA 2JIZD 3O73A 5L7YA 1DLJA 3PK0A 1UBRS 1B41A 1C81A 4QELA 1E2FA 4YH1A 4WJKB 3CNHA 1L1QA 4LXIA 1XAJA 1MW8X 4PS1A 4NENA 1YFLA 4RK0A 1YOVB 5BV0A 5FV7A 4YLEA 1B43A 3NR2A 3DQQA 1K04A 3OAAA 1N36B 1PSWA 3V8VA 3FMVA 1Z0DA 3SSMA 5DS4A 4N65A 3HLKA 4U7WA 3VVBA 4BKMA 3NHFA 2NZWA 4GZ3A 2F22A 4OD5A 4N39A 4JCCA 1I94B 1IZZA 5C8YB 4NRDA 5EVCA 2I8LA 3QTLA 1Q74A 1KEEA 2QN6A 4OHWA 4YRPA 2PZEA 2QUJA 5K3BA 4XPIB 4LQ4A 5CD1A 3OC0A 1T3TA 3DWFA 4PLGA 2WU1A 5JAQA 1DPFA 1MBZA 4QC2A 1TFUA 2ILTA 5CCXA 1G5IA 3NIFB 1NLFA 2B1QA 1TEZA 4GW3A 3DC7A 3MYRA 3KWFA 4Z3KA 5MN4A 2ODEA 4MZXA 4I50A 1UBJS 2LCQA 1KWGA 2FPWA 5JECA 4HEA6 2DSTA 3IULA 1PJLA 3G3EA 5KTNA 2CNNA 2IHTA 4WK6A 3UAWA 3DCNA 5C2JB 2IX9A 4N03A 4Q37A 2HZ8A 1APBA 3DE4X 1MFZA 4WKNA 1GGNA 4Z53A 4NMMA 3BTOA 2CLIB 3OLWA 4MCIA 3ZV6A 2ZYAA 4BNZA 4EGFA 4OA5A 3MBOA 5EKSA 1P1IA 1ZM9A 3ETGA 1RYNA 1R3DA 3RQEA 2ZJ1A 2RAFA 1JU4A 5FAXA 4ZZ2A 1QH9A 4OLBA 3HACA 1Y6FA 3LDHA 1AE1A 1IXKA 13PKA 5EXTA 3SYNA 1VHLA 7MDHA 3B9RA 1VJTA 1JIVA 4B1FA 3CKLA 1NMYA 1Y9AA 3KSUA 1OLSA 1IRIA 1CERA 4ALLA 2MSNA 3AJRA 4GZMA 2ZYWX 4V1CB 5B58C 4RPGA 4KMOA 1Z0UA 2FXVA 1Z34A 3ASUA 2RCNA 1QGUB 1QIIA 4LC9A 1ZC4A 1OIWA 2M6KA 1MAUA 1VLMA 1RHQA 2I66A 1ZGGA 4DB4A 2VHCA 3D81A 2Z1NA 2YXNA 3S68A 3DFUA 3HC7A 2OFPA 1F0KA 4QYMA 1E3EA 5I4IA 1W96A 3C0KA 1U1CA 4OIPF 2JVIA 1NXTA 3R0IA 4CKCA 3TLAA 4XQCA 2PUTA 5EJ6A 3UOAB 2WMOB 1I5NA 4IY1A 5ALLA 1C9DB 4BVLA 1W6UA 2PN1A 5B55A 2P9TA 4FK8A 3DI5A 3IPYA 3LLSA 3G85A 3V4FA 3RUCA 4PYKA 4PONA 2P9ZA 1KE2A 4O6MA 2C3OA 3F67A 4E11A 1HEYA 2MT9A 2WW8A 4N6HA 3GJTA 3F6EX 1D5WA 3L1MA 4RA6B 4M1YA 1LSOA 5JH7F 2ZGVA 1K92A 4UMDA 1RDFA 1XRRA 1L5ZA 4R41A 3LJKA 5CDHA 1PRYA 1MU0A 1NVUQ 4V39A 3FHDA 2ZTHA 1JQDA 3IBCA 4HGPA 1BC5A 1BHJA 3LTEA 4MVJE