4BJ5A

Crystal structure of rif2 in complex with the c-terminal domain of rap1 (rap1-rct)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
328
structure length
292
Chain Sequence
PVKERVDHVFYQKFKSMALQELGTNYLSISYVPSLSKFLSKNLRSMKNCIVFFDKVEHIHQYAGIDRAVSETLSLVDINVVIIEMNDYLMKSDLMMMVMRKINNDESIDHIVYFKFEQLDKLSTSTIIEPSKLTEFINVLSVLEKSNNIAFKVLIYSNNVSISSLLSTSLKKKLNTKYTVFEMPILTCAQEQEYLKKMIKFTFDSGSKLLQSYNSLVTCQLNNKESNLAIFFEFLKVFPHPFTYLFNAYTEIIVQSRTFDELLDKIRNRLTIKNYPHSAYNFKKNQRLPLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN RIF2
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 103
structure length 292
sequence length 328
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1650 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj5A01
3.40.50.12060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bj5A02
4BJ1A 4BJ6A 4BJ5A
chains in the Genus database with same CATH superfamily
4RHFA 4Z86A 1E9SA 1DL5A 2Q29A 5I7AA 1QDUA 5J9FA 3TUZC 1H69A 4MB6A 3WIUA 4UOZA 3SY8A 2IHJA 4HXFB 3HM9A 1FLVA 4LRYA 4EG8A 3KOMA 4GSLA 5C4MA 1NI5A 3NXKA 4MTGA 4I9FA 2IXDA 2FW8A 1OFUX 4J1TA 1V7QA 3LHIA 3BHMA 4NTFA 2GD1O 2XZTA 2Q1SA 1WE2A 3NWBA 3RS5A 4DDWA 3AVOA 3OIWA 2QNRA 1FP1D 1XWJA 3DL4A 1KK2A 2XUIA 2P1AA 4IDFA 2KC3A 4U8GA 4F11A 3EEQA 3SGLA 2ESRA 4YAUA 5CIQA 1AGPA 2XUFA 3E3AA 4Q12A 4UDVA 5FIUA 2YEVA 1R8SA 1CXZA 3O0TA 3IELA 2EXXA 3H9QA 2CSUA 1QQ3A 3UWMA 2Q9UA 2JFHA 2PBEA 4LMBA 3DJFA 1I7PA 1ICEA 4ZK2A 3CLTC 3D8BA 3C8UA 3I9OA 4XPYA 3E1SA 5IT5A 1MEOA 2IBTA 1H6BA 4P84A 4DR6B 3ON5A 1PNTA 5A4MS 3AHGA 3QWFA 3R5TA 3TEMA 1SCUA 4W9NA 1T5IA 3DDWA 3R7BA 5B2EA 2REOA 4K1LA 1RU3A 3RS9A 4BS9A 4R7GA 1J0CA 3LPMA 1QP0A 2ATVA 4EW6A 5FLEX 4TM7A 3IBYA 1PL7A 3TGPA 4KQXA 2YJ5A 1QKKA 3PG5A 3S5UA 1J2JA 1T9GR 4XWTA 3R3UA 5D1HA 4AURA 3RAFC 1NSYA 1V3TA 1GPBA 5TPZA 2W6CX 1R66A 3D0QA 4RQUA 3T5TA 4M4SA 2GOYA 2LDXA 1OCRC 1OGIA 3VF0A 1SUPA 2W2VA 3NVDA 3PVZA 3AF3A 2DU8A 4MW5A 3O4HA 2VUSA 4CU5A 1SCKA 1T3GA 3ROMA 3BRSA 5L7WA 1GEGA 4RNDB 4LJ5A 4GWKA 4PC7A 2H7YA 5DOVA 4CM9A 3CH6A 4ZGBA 2HHCA 1E79D 2BEWB 2QIOA 4U3JA 5IXJA 5GZ1A 3QLTA 1WSDA 3R9IA 2A1TS 5KCMA 4M63A 3UT5B 1YQGA 5JSQA 1R88A 1P2TA 1N2CA 2EERA 3K8YA 3A6PC 2HRBA 1E86A 1XHEA 1NMZA 4RHYA 3IAHA 4IZHA 3P19A 3HK2A 1H6GA 3N2IA 4ND1A 4MV0A 4BOYA 4IIJF 1Q3TA 3S40A 5KNLA 1Y89A 3ZNQA 2AJCA 2P11A 2QP3A 2YWHA 2XNJA 1MMNA 1KI1A 4HV4A 2PL3A 4DKJA 1L2TA 4AG5A 2D00A 2A84A 2FLKA 2C82A 1TQ8A 1S7ZA 4YAIA 1YS1X 4HGOA 2FR1A 1XLTA 3VR3A 4UHKA 1M83A 4ZOCA 4QICA 4I50F 4M8KA 4MPDA 1QIMA 1XPJA 1QF7A 2PA0A 1Y9AA 2I8AA 3QLEA 1OAOA 5DYIA 3PC4A 4DY6A 4HZIA 1M1YA 2H3HA 2ZYUX 4UNSA 2HQSA 2QZJA 2OBFA 1ORRA 1W30A 3B6EA 3ITNA 3NTLA 4CF4A 4YJKA 2VQFB 2BFEB 2QR2A 4DQKA 2Z15A 1WMDA 2X13A 3EPRA 2CNOA 3NCTA 1X1TA 5FORA 4L7VA 2QGNA 1RR6A 4D45A 1AKUA 5CB4F 4QFCA 4KE8A 2BJWA 3ZY4A 2Z43A 4RADA 2YZMA 3U3JA 3WZ2A 5TLSA 1YZYA 3K2IA 4JC5A 4DFDA 2YHAA 3L07A 1IBSA 3JS5A 3TQRA 2AGVA 4N03A 1W25A 4NMWA 4Z8YA 3C70A 4BX9A 3I1IA 1TJ3A 3A1SA 4FEGA 3UMCA 2OXEA 3IJPA 2W58A 2NUBA 4DRHB 2LPMA 1UBFA 5LVAA 4XM2A 1F1BA 1EU1A 4D9MA 1SHLA 5L3SA 4DNXA 4WD3A 4V0QA 5K6AC 1QH8A 4E12A 2YMQA 5JBNA 4JJ7A 3UJ8A 1GN8A 3CRNA 4BNNA 5K8TA 2A68F 2Q9BA 2PL5A 2IOYA 4BX2A 4WJ0A 4E5SA 1Q16A 3ZKWB 2BGWA 3IHKA 2J0VA 1A9OA 2QI9C 1P1IA 1P39A 3FD8A 4X6YA 2P90A 1PX2A 4OATA 1NT4A 4QLAA 3MBGA 2G5TA 2WABA 4UTPA 1P1RA 2FLWA 4PLFA 1YR2A 3IMCA 2P62A 2FWAA 4LVOA 4CQLB 2I8BA 3VAAA 3LOUA 1N5LA 1TIPA 3RC2A 4XDGA 2QAIA 3LQ4A 1TMOA 1G5RA 3IE0A 1UJCA 4D8XA 3WC4A 4N41A 1EBFA 7AT1A 1YQWA 2XGJA 1GZ6A 3I9NA 2XVAA 1TZBA 1NHGA 2L17A 4HFFB 5AR1A 4HQOA 4Y98A 3EVGA 2NNLD 2H1VA 2KLBA 3KQTA 2BZSA 3BIJA 2I0FA 2OHVA 4N8DA 4UBMA 3WMWA 5HTKA 4ZQIA 1MMAA 1WY5A 2YVQA 3QF7A 5TJHA 4J43A 1KBZA 1Q0UA 5JZOA 1Y5NA 1WVMA 4S2EA 1RMYA 2IHBA 3D8RA 2HMSA 2BFOA 4XUGB 2GWWA 2DFKB 4TVKA 1ZXBA 1B74A 1BGWA 1A7AA 3TMAA 2QMEA 5FWYB 4OB7A 5FQNA 4P98A 2C07A 3KLNA 1GWNA 3NC1C 3NDBB 1R16A 4TRNA 1E4OA 2PA3A 1X7YA 3PTZA 5CXUA 1OUMA 4EA7A 3WG7C 3CUTA 1UJ2A 5ITSA 1SBYA 1W9HA 4C6HA 1PZXA 5FAXA 1AUEA 1PJ2A 3K53A 4EHKA 4C4OA 4Q21A 1WDTA 2JLAA 2O19A 3PXDA 4IQFA 4M99A 4ZXPA 5KKAA 2XAAA 3GIDA 1YRHA 3HXOA 2AFIE 1NYQA 1HMPA 3QUTA 2K87A 3DFMA 4NARA 1FMJA 4Q5SF 5B4UA 5KYNA 4LXYA 5JSZA 2GK3A 5A5DA 3W6NA 3W4KA 2JD3A 3GWNA 4U0JA 4R1MA 5JTUA 3AUFA 1G38A 3N07A 5JADA 4C05A 2CDCA 1M34B 1UODA 1KH3A 5BY2A 1ULBA 4CYMA 4IL5A 4X00A 4R0VA 3BJEA 4A2PA 4M1TA 1JDZA 5EXPA 4G1VA 1DAOA 1T8TA 1TWGA 1BTOA 2LKDA 4A2WA 2ERCA 3F6CA 1DEXA 4UVGA 1XCMA 1Y8QA 3KC2A 3M6VA 1C1DB 3EZIA 3PCTA 1Z0KA 4GECA 4PYMA 3WI7A 5GAJA 5KWVA 4GUDA 2PEZA 5FUXA 3PC7A 3RS7A 3TULA 1Y7HA 5IH7A 4FBMA 2Q6VA 5HP4A 5JEEA 1OB5A 2XWBF 4B6QA 4TXLA 4Q1EA 4KFRA 3LY8A 2X1LA 4QARA 1BOOA 5ALHA 1FL9A 2IGBA 4MUAA 1JHXA 2LIVA 1EHIA 2GRAA 1IWBB 2WKQA 1UL1X 1GDHA 5MGBA 4PEVA 1EI7A 1JYFA 1VB3A 2RH9B 4XRRA 1BWSA 2PZKA 3TOZA 3ZSUA 4QGFA 1XLTC 5C8ZA 1FLNA 3DAGA 4MWGA 2V7EA 2P8SA 3ELUA 3F6EX 3TIXB 4J16A 2VYND 4K3UA 5DOZA 2OCXA 3PEYA 4AWXA 3EB9A 1PFYA 2QTHA 5I51A 1V5IA 3KD3A 3NAQA 3OETA 5CBKA 2QTNA 1U4OA 3CVJA 3WL4A 2NQ2C 2OEXA 1DIAA 2Q99A 2C9ZA 1OWPA 1KORA 2XNCA 2R11A 2C5EA 1SZDA 1XDSA 5BSGA 3BIOA 2FX3A 4GVXA 4NICA 2X3UA 1JSZA 1WCXA 2QK4A 3HJBA 3A32A 1SC1A 2J4FA 1RZUA 1TA9A 4RH3A 2QTBA 2HHAA 4E3ZA 2UYCA 5IT4A 2DQSA 1QRRA 1XRSB 3IBSA 1YB2A 1U6IA 1JBQA 2GCPA 2HLDA 4XASA 2O8BA 2DFTA 5BNTA 2P9HA 2H3EA 1BWRA 5DVZA 1TKRA 4CLDA 1TYBE 1H3EA 2E85A 2RONA 3DBOB 3F7TA 3QVTA 4LDJA 3J7TA 1ZGHA 1X9IA 4HTFA 4I08A 1DWPA 1E6UA 1RYNA 1Y4ZA 3IFSA 5IG2A 3BWVA 1D09A 5LSAA 3DEJA 1P3Y1 2HY7A 4DZRA 3TVDA 1AB6A 4I9NA 1U2ZA 3VU0A 2DTDA 1FX0B 3FJ1A 3R4CA 1E2MA 3OCUA 1J2YA 2P9GA 3CX8A 2IYYA 4P7FA 4BMCA 2IEBA 3REOA 4CQMA 3CE6A 4I0WB 4AL4A 2HA2A 2Y3IA 3IHTA 2QN3A 3R8CA 1J21A 1ZUHA 1M2VB 5CFMA 2NUAB 4DWWA 3BCHA 4P9TA 3G13A 4HVTA 3SFZA 1E96A 2QWXA 2FMTA 2B37A 3H8SA 1QVXA 2VAVA 3DO5A 1CJMA 3WLNA 8ABPA 1E3IA 2Y69C 3ISVA 5G1OA 2JLCA 4A1OA 3UK6A 1EXVA 5E95A 5KNCA 2J0SA 3DAHA 4IDNA 3ZIAA 3CX4A 4UUAA 2Q3TA 2JZCA 1AV7A 3R2JA 2LP4Y 4DNPA 2CJYA 5E4FA 1P5FA 1MG0A 5FJIA 4JKVA 1UK7A 1R5JA 3GRCA 1UXJA 4NENB 4OJMX 1XNJA 3UK7A 2IXPA 5JRAA 5KWSA 2XQGA 2ZQ5A 5KTKA 3KEMA 4PS0A 1CTQA 3EHMA 1QIJA 1KE2A 1KJNA 3NKVA 4LA4A 5C51B 2BFAA 2XUOA 4G01B 1XDDA 1MLDA 4DJFC 4TWJA 4FYPA 1NXVA 2GZRA 2ZYIA 1UPFA 4HUTA 1SCIA 3HE3A 1ODSA 2ZJ6A 5AVZA 5J58A 2ZKIA 2FZEA 3KQYA 3A6ZA 3ONFA 3HU1A 2FX5A 1ZW6A 1Q6YA 1JECA 3R8FA 2PGIA 4KL8S 4TZ0A 1SQ0A 4G0WA 5DN6A 3HDHA 1EKYA 2JD0A 2QQ5A 3Q3GE 1Y80A 4RSGA 3M6UA 5B3LA 1J5PA 1JLMA 2VUHB 1UMCB 1ZSYA 2IUUA 3WMFA 5ER6A 4MUBA 2G0AA 3K0BA 1ZZGA 3F98A 4BFSA 1XD9A 4X92A 3HB0A 3GUUA 2Q5EA 3M5CA 1YL6A 4RD9A 1M57C 4BWVA 3IRVA 3O9ZA 3GA7A 2RK3A 1QTIA 3BE4A 2HFJA 2IBMA 5IAOA 3CVOA 3QZCA 4QKQA 1I4DD 1M67A 1L7BA 4JR1A 1T5BA 1WMEA 4AJIA 4DIFA 3EXHB 1KQ3A 5D5PA 3QE9Y 4JB8A 4RJKA 4IFEA 1EK5A 2Y0CA 1BXZA 4B4OA 4CFZA 4RS4A 1C80A 1Q19A 3QELB 1TVKB 1DG3A 3ONDA 3IEUA 1OWOA 1G63A 2IJGX 4UATA 3X1OA 4ZRMA 2L0XA 3LCMA 2V4MA 3V8QA 1O96A 1QKIA 1B0UA 5F9MA 3E4DA 4OKNA 4QODA 3VTKA 3SSAA 4DR2B 4B4WA 4J3FA 2QT0A 4XI9A 2PX2A 3LPLA 1MPXA 4JI5B 1V4BA 4G5FA 2Q3FA 4RZHA 2I3ZA 3Q6MA 4JI0B 3LVFO 2NAPA 3M0EA 5DXJA 2VTBB 4YCNA 3LGSA 2QX8A 4M60A 521PA 5K01A 2JLYA 3SQNA 4RXTA 3DZGA 2ZEJA 1K0FA 2PWYA 4NU5A 2PS9A 2SBTA 3SMQA 3KQWA 4KXLA 3VNQA 2IEDA 2P6PA 4K9DA 4LXTA 4FB4A 1U0HC 2Q0QA 2NU8B 1T0UA 3OOEA 1J9GA 3AVWA 4MW0A 2E49A 2UVDA 3KAJA 4MVJH 3ER8A 1C9MA 4DWOA 2Q1YA 2ID4A 3KB1A 1NNEA 4OSEA 1ZYUA 1NRIA 3G0HA 4F2WA 3ZWOA 3MJHA 2WVNA 4R98A 1LLCA 3RVQA 5DLQC 4M9ZA 4OAOA 4LJ7A 4BV2A 3COVA 4CN9A 4OYHA 5BUQA 3PQEA 4JX8A 1TI7A 3JD1A 1XU4A 1ZRSA 4K03A 1FE8A 3FI0A 4TUYF 5L4NA 1MB9A 5FI1B 3WQSB 1U6KA 2P5TB 1VE1A 3K20A 2X77A 1P75A 2G25A 2ZRBA 4PSKA 4ZOLA 3HUDA 2BZ0A 2EFGA 1TW2A 2JK1A 1LDNA 3WXBA 2JAXA 1VE5A 5CIWA 5CVTA 3PE6A 1QLWA 1DIGA 4HD8A 3W1EA 1F4VA 5TSDA 1L7QA 4QI0A 4I36A 1EHYA 2H5EA 1DRKA 3QMMA 2J0WA 5K6RA 1ZGJA 2Y67A 3R74A 3IULA 3C3CA 4XIFA 3U3BA 3C4QA 4EY5A 4MUGA 5DHPA 3ZBQA 2QMYA 4YAWA 4GOKA 5D6OA 2FUCA 4P3KA 3DDOA 1JR8A 3ZWWA 4BO4A 3LW8A 1JGTA 2B36A 3VMMA 1IHPA 1SOAA 4QDTA 1ZH2A 1WV0A 4ZU6X 1Q0LA 3OT1A 2WZBA 1JEDA 4BRZA 5E6RB 2R8BA 1VYKA 2V65A 2VJOA 1M0SA 1A95A 5HM8A 4B32A 2JAQA 3DL7A 3LNRA 5I7SA 5G1NA 3RSQA 3AQCA 1HYBA 2Z1MA 1GZ3A 5E1MA 4Q48A 1JFSA 3LLMA 4GI7A 3PUWA 1BE0A 3WWPA 2EIMC 1Q1QA 3JAKB 1OXSC 1XZIA 4MYHA 2GZ2A 1OX4A 1NBIA 1S1MA 1VCNA 3NT4A 2OBXA 3GZNB 4BP8A 1RXVA 2YIMA 1HF3A 3IHLA 3ZHYA 4B9AA 2V0NA 5A4KA 5IN4A 4J07A 3EVNA 4NQZA 4NAHA 1R6BX 3DW1X 2HF2A 3OAAA 4RIHA 1B41A 3OT5A 1G3IA 1E9CA 4O8CA 4FDUA 1I5OA 5LU9A 5FUQA 1V8OA 3VTZA 3LEVA 3IUPA 2YS6A 2BGTA 3NOOA 4K88A 4ZQFA 4FFBB 1VDZA 1WBBA 4D82A 2QR5A 3CUUA 2RBKA 1XYYA 2BOVA 4TXNA 1EHCA 1GXSA 1U4SA 5E8RA 4W6ZA 2YRFA 1BKYA 2E37A 4EYEA 1O5IA 4RWEA 1EFRD 4OBEA 4O8ZA 4UBIA 5T6MA 4R0NA 2YZSA 2HK9A 2QN9A 4Y2VA 1W5AA 4LN1A 1NW6A 1H2HA 5JFTA 1BHQ1 4K9SA 2X76A 1RFGE 5F5HA 1Q44A 2BP7A 4FWIB 3KE8A 1SGWA 3FDZB 1UDRA 4HWRA 5EWLB 4YWQA 3P0JA 3EZGA 2XLMA 4M38A 2EFCB 3S2EA 2I3AA 3ELDA 3PNOA 4QWWA 4RK5A 1NJ2A 2C42A 3KSRA 1VI2A 2AL7A 4REQA 3ECCA 3KOXA 4E2YA 5TT0A 5IVIA 3CUKA 4AXBA 3H7AA 3CGWA 3NP7A 6PFKA 3B6KA 1HSOA 3UYLA 1QB7A 4IINA 2JBAA 4GE0A 1AKEA 1WQ1R 1AGYA 1RWXA 2PKWA 4J7XA 1WUTA 2GK7A 4ENVA 3V1MA 4NESA 5DQZA 4TTQA 1R6TA 2DVMA 1P9NA 2PRJA 2R8XA 2OAP1 2G6BA 4KSYA 4DYHA 5HGXA 4EGQA 2GYWA 2VZEA 3HVRA 5K8LA 4O2AB 4LYFA 3ABKC 3PUKA 4LBZA 2HV7A 1IATA 4RIEA 3WYFA 2WTAA 3OJFA 4X90A 2Y1EA 3ND7A 1PL8A 4C7JA 5HIJA 1N1EA 1U90A 2D2VA 1X3SA 1WTYA 2PPVA 3L06A 1LEHA 2W4IA 1JLKA 5DX1A 2CJFA 3MT0A 4NCKA 2N47A 1UBLS 1IZZA 2O0KA 2PYDA 1L1FA 3VZRA 1WCYA 3A6EA 1G5HA 2V9ZA 3JVUA 5JE8A 1DBPA 5LNK1 4BO8A 2WE8A 3PWSA 4E31A 5E7JA 4MUYA 2DGJA 4G1UC 2VYVA 1RHKA 4LWOA 4KV9A 4KDFA 1X7WB 5EG5A 1C7ZA 3TEFA 1CRQA 4C4ZA 3BC1A 3Q15C 1J9ZA 5KX5B 3AJAA 3BF7A 1Q15A 1SUIA 3W8DA 4YRNA 3WG9A 4OSPA 1QWOA 1UMDB 3KOOA 3RQGA 3OWHA 4JVSB 1ISIA 3ZYZA 2OKUA 4M0UA 3AF4A 4JLPA 1UADA 3BRWA 4WKBA 2R6GA 3KDSE 4QI2A 3VNRA 3TLAA 2PKRA 4F4UA 3P32A 2Q46A 1ODFA 1JQLB 4RCVA 4F92B 3DO8A 5EYPA 1VLVA 3TI7A 1F17A 3C3JA 3DTVB 3HKBA 4LE2A 2EYUA 4DABA 3GBVA 4IJMA 2D54A 4CKCA 1HNXB 2PX6A 3O8BA 4NZNA 5IWAB 3DHEA 3G7UA 1M8JA 1HYHA 1ITZA 4V0SA 1H3NA 2H0RA 2C61A 5DULA 2Z5FA 4N48A 2AWOA 1ZIPA 2WAXA 2FPMA 2WVQA 5B1SA 4MDHA 5I5EA 5L0DA 2O5RA 4KGXA 3M5DA 3V7UA 1M5RA 1DCKA 2O8FB 1K8ZB 2WD7B 1VMIA 4DDKA 3WLFA 5EMKA 1C3OB 4MW9A 1F14A 2FPGB 2GGSA 1SCAA 2C7QA 1RWOA 1Z0ZA 3W5IA 3I92A 1PT5A 1IB6A 4K9NA 1DRUA 2AUMA 1PDWA 4K7JA 2HSJA 2PU5A 4ZO8A 2IX3A 4ZI5A 3HFSA 1P45A 3BFXA 3E81A 5CDTA 2QR3A 5A2QA 2UUBB 1BMDA 1RYBA 2JEOA 2NQTA 3B1XA 1OQCA 2CHVA 3WA7A 1FSZA 1EG2A 4O59O 1W1WA 2NZYA 2QX9A 1F9AA 4F1WA 2GAAA 1LA2A 4G0OA 5JNLA 3Q7TA 4D80A 1RHRA 1BMFA 2EG9A 4EK9A 2ZR8A 2CB9A 4M8NE 3PHJA 2LD6A 2X42A 5AO9A 3AHJA 3U81A 3F67A 1CGME 1TCBA 2PUEA 4GOOD 4OHOA 5TX7A 5EUMA 4WBSA 3EFHA 4BNKA 3RRJA 2Y1DA 5CLIA 1U9YA 1NG9A 3EDMA 3DMRA 4WFIA 2KK1A 5AGFA 2XA2A 3PKJA 3L18A 5JJ5A 3BK7A 1TAGA 3TDMA 5JDCA 4J0DA 1WKCA 3FFTA 3JAWA 3LL4A 1RKEB 3RSZA 4NAUA 4YJ3A 3D3WA 3W8HA 3WKCA 4M46A 3AEUB 2XBUA 1EWVA 4YFYA 4DA4A 4CF6A 5A02A 2BEKA 3OQIA 5DXAA 2EARA 3VRHA 4EUHA 2OGSA 3Q3IA 1NLYA 1A69A 1N6NA 4G78A 4U9UA 1Z0FA 2G17A 4P6VF 3PICA 2GKOA 1WPGA 5C81A 1UMBA 4PHTA 1VHQA 1ZHXA 3PNVA 1LZLA 1SXHA 3W4YA 4JAVC 4QXQA 2HJMA 4PSUA 3SZ3A 4OQEA 2YWBA 4QQNA 4I1MA 4J7TA 2X0JA 4IIHA 2UUHA 2G71A 3QP9A 4D9FA 1LE2A 2V03A 3DD7A 4OHMA 3HJHA 3BD7A 1J24A 4B81A 3I6IA 2R1VA 4X1IA 2ZJBA 2OPHA 2H16A 2LCQA 4C1BA 4HB3A 2C4TA 4NATA 3ETDA 2KBFA 3RV3A 1E1KA 4Z4QA 4D4JA 3WBJA 1DO8A 3OEYA 3HDVA 3CURA 4KU4A 2IHYA 1KSHA 2J07A 4B2LA 4YJHA 1JU4A 2PX3A 1U11A 3UWPA 2NP6A 4PLGA 5IJAA 5FLYA 5GV7A 2L82A 3DZBA 3DXYA 3LCUA 4O2LA 3LBFA 1NUSA 3PYXA 4FUQA 3GLFB 1L4MA 3LE8A 3IERA 3T4PA 4Y2XA 5SZIA 4RFSB 2QJOA 3ZXUB 3DDZX 4OA5A 4PS1A 3ML1A 3Q0TA 2WDPA 1XXLA 3CEAA 5DHUA 5FQOA 3ZJ4A 1SZJG 3QLVA 2JVIA 4MUXA 3V8PA 4PCUA 4JJZA 1KK0A 4WJLA 3ICCA 5EJEA 3HHPA 6YASA 1LSUA 2ICWG 4JYCA 1AQUA 3P9NA 3AP3A 5LMNB 4B7AA 2K2WA 3RSFA 3VH3A 3B3AA 2I7DA 3UJ3X 5IARA 4H60A 1VG9B 2PBLA 2WSSD 5JY1A 2BR4A 3HU5A 4MR9B 2L42A 3LD9A 1A1SA 4PO8A 2QMUA 5C5EA 2HTFA 1L9XA 2CXUA 4PG4A 5GM1A 1D5WA 3MJVA 1QQ5A 4YRCA 2GZ3A 3O6XA 1E79A 2EPMX 4Q3LA 4EZEA 3TTWA 4YJ2F 2V3VA 1XK7A 1XR3A 3KPJA 2CCGA 3ABLC 3LBYA 4NEHB 1FSSA 1Y8ZA 1K9VF 1YTLA 3WSWA 4R6WA 2ZI5A 2R6FA 1J9EA 1H0HA 4RL6A 4HI0E 2PUFA 5HF8A 2GCIA 1AN0A 2DULA 3DB2A 2HV9A 1KEZA 1BA3A 4K5QA 3WFZA 1E3JA 1MFZA 1BX0A 1P81A 4E09A 3Q7RA 5HFNA 1F0NA 3QHAA 4HJXA 3L1KA 3W6PA 3W8FA 4V02A 3L7JA 4AYWA 3HY4A 1WHSA 1YZLA 1O3YA 3WYCA 4BP1A 4UM5A 2Q7OE 3ZTWA 3HH8A 3LIPA 4A0FA 1NBMD 1JBKA 4FZ3A 1Z5ZA 3I73A 4G0PA 3A4MA 4MQ6A 1I0LA 1I3LA 2QM7A 2FCAA 4LJKA 1D1PA 2JZOA 2HBYA 5ERYA 3M5PA 4WCDA 4GYYA 1E2EA 2EJTA 4YJGA 1UBSB 4H16A 1JB1A 2MSNA 3Q4GA 2K7FA 1M3SA 2X7XA 1S3IA 2J30A 1OU0A 4LBYA 4BZZA 2IZZA 2UYOA 1K97A 3OKFA 3RARA 2A30A 3MAGA 4TZ6A 1QVRA 3MLGA 4C29A 3R44A 3QPVA 3KYJA 3PEUA 2Y77A 3T3EA 4IIJA 3I32A 4HRXA 2B8EA 4QUGA 3ZE2B 2HV8A 2WF8A 2TRSB 4D9GA 4EUKB 2Y1KA 1VPEA 3VR6H 1QZUA 3GCDA 5D3ZA 3UAOA 1YR9A 2D1QA 2D4UA 3GHYA 4BNGA 1KQOA 1SBNE 2XKBA 3OZVA 4D46A 2P6MA 3UGQA 1SKBA 3T3MB 4I50A 3WK6A 3UH1A 2GBGA 1IEWA 4A3SA 2HR1A 2YLIA 1YR1A 3GVHA 3VJLA 1QRAA 1BMQA 1OLSA 3U4HA 3T7JA 4P8RA 4GZ6A 1PQ4A 3BWYA 4BVLA 3K0EA 3H2GA 4BMXA 1PGOA 5JDCC 4U63A 1HEIA 5JNSA 4MMXB 2VC9A 2FW9A 3RTBA 2FR8A 1QHXA 2NXJA 4YDRA 5B36A 4I2NA 3ZLUA 1M1XB 3W8IA 4DGQA 5EUQB 4ZQHA 3HI4A 3N2KB 4B3IA 5TARA 3D0KA 4ZZ3A 3OLXA 1X0XA 1NZDA 2H5LA 1P1CA 5DVWA 2HQRA 4A6PA 3RHFA 3L77A 1YSCA 5L3QB 3HGQA 5DLDA 2HM7A 1T2UA 5CB8A 2QBYB 4IMIB 4YR7A 3MM4A 4M9SA 1MNEA 2C3PA 3SBEA 3PC8C 1MABB 1EUYA 4Y1GA 1CQWA 3ZVLA 4YP9A 3SZUA 3WBFA 1WP9A 4GLJA 1N3YA 2DLNA 2X9VA 4OI0A 4RHUA 3EIFA 2O54A 4WOJA 2VJPA 3EEYA 4C7VA 4YJ3F 4D3SA 3C2QA 3RS4A 1ZUD1 2VXOA 5F1YA 2REQA 5HJ2A 1OZ0A 2A9RA 4DOMA 4L6AA 4XJVA 1LSOA 3D5EA 1FSGA 3RS2A 3IKLA 1AZTA 3HS3A 3D3JA 3P71T 1E32A 3NGLA 1CY7A 4IO1A 3VUFA 4RKRA 3L0SA 2FW0A 3BH0A 4DLLA 2JEYA 5HDQA 1SVUA 3AU8A 2ONCA 2PQ6A 3ESAA 1Q0QA 2XZPA 1G8SA 2FUNB 4G4IA 3SX0A 2ODQA 3UMFA 3HKCB 3RRYA 1NV8A 3KL2A 3AVXA 4LAFA 5BW5A 5F7JA 3RAPR 1QQ6A 1WKBA 4HCJA 3B3JA 2FE4A 3MB5A 4WZBA 1GQ2A 2FGKA 5EHHA 4DIOA 4U7GA 3HKDA 4RLHA 5CP8A 3C1AA 1NY6A 1AS3A 4BLWA 2IYXA 3LYHA 5K45A 1XF1A 3RJ5A 3A4IA 3AIMA 5FLXA 1ULAA 4HQLA 4NTZA 1Z7EA 4J0CA 3V7OA 1GZ5A 2P4QA 4PBSA 3IBFA 3SJBA 1JUDA 3SYKA 5LYJF 3IUSA 3ULKA 2ZBVA 4X6XA 3BREA 1P4HA 1IN4A 3NUGA 3RRMA 4FQ5A 4DIUA 3HUFA 4ND6A 1ZVJA 3VH1A 4EG0A 4ILKA 3RFCA 4ETNA 4HGRA 2ZBQA 1V2HE 1L7CA 1MD9A 4PACA 1G4US 1C41A 2GCOB 4BV3A 2VPXA 5H1YA 1QH9A 1J7JA 2XXAB 1YBHA 2QTAA 4WNYA 1YDWA 3I3SR 5LP6A 4X91A 1T6NA 2J3KA 4YT8A 3SLKA 2VHVA 1F5SA 3FUTA 2BEUB 1SVMA 3D8NA 3R5FA 1Z3CA 3KSBC 3DKAA 3NTVA 3WWYA 4XZ3A 4TMKA 2H6EA 2HWWA 4D3DA 3OE7D 4OGKA 3AVVA 4C3ZA 4Y30A 3MLBA 4JSYA 2PVSA 1CZRA 4UBJA 4AW9A 2JI6A 4RNCA 3RR2A 1A04A 2WM2A 2EZUA 4AJ9A 1I2CA 4UNRA 4CE6A 5K8UA 1X19A 1EUDA 1T24A 5AUPB 3VSCA 1CGOA 4F0JA 4LX0A 2VYNA 3MWDB 3BJIC 2VHXA 3GLKA 4N6OA 4DDMA 1Z5OA 3U3MA 1TLFA 3PQ3A 3VGJA 2WF7A 4Z9XA 3Q7QA 2CJXA 4BQOA 3NVMB 3DYIA 1R4NB 4KDEA 1DQNA 4F5EA 3UWOA 3TZHA 1QOQB 4R8RA 3GNLA 5LMZA 1XALA 3PEEA 4KEAA 2A0UA 4NBTA 4MXDA 2NT3A 4GBMA 3GG9A 2QRZA 1VJ0A 4WLEA 3D7RA 1NDUA 4C4TA 4PC3A 3PHHA 4FMDF 3PWKA 5CM8B 3GM3A 3TUIC 4II3A 3DJNB 4MLPA 1KC1A 2NVWA 4BVHA 5ISMA 3VPSA 1OY1A 2UKDA 2YQ4A 3EFEA 4TVSA 2HMZA 1BE8A 3WHKA 4D2IA 3UYKA 1NDQA 5SYAA 1CKEA 4AJNA 3QQPA 1IY0A 3ETGA 4O3FA 5EEGA 4GXTA 3ONWA 2M6LA 3FFXA 4LSGA 4A16A 1KJ8A 4P38A 4MHTA 2MSEB 3AUUA 1OTXA 1U6HA 4K28A 1S1CA 4X61A 4ZHQB 2AXPA 4M89A 3UW1A 3WLJA 4J1QA 4J7YA 1A7KA 4EWLA 3QYJA 3UAWA 2XWSA 3WXMA 2ZRHA 4UJ5A 1G8PA 3MCVA 2HGZA 2Q5JA 3DOOA 3T9DA 3FFWA 3PRKE 1AQIA 1BDHA 2QM3A 2QN6A 2GDCA 3ZWNA 2FSUA 1BCRA 1J1IA 3WLAA 4B6RA 1NR5A 9ABPA 1K8XB 3A3YA 2H06A 1QV7A 3PEFA 2G9ZA 4YP5A 2HSWA 3WLOA 4PZZA 1JEQB 4LV5B 4HX2A 3ZIBA 5K3DA 3GLHB 4ER9A 1WPQA 3EFOB 3DOUA 4G4GA 2O8CB 2IK8A 4UAUA 2ZROA 2RGDA 4YIHA 4IDEA 4XR9A 3H05A 1BA2A 3G68A 2QSJA 2I9PA 5AM1A 3RKRA 4HO1X 3A04A 4NZZA 4QULA 1VKJA 2WNSA 2QN1A 2J5KA 4PJJA 2O3UA 1Z12A 4QEDA 4GL2A 3AL3A 1UJBA 4LBWA 4DIDA 4JNCA 4IARA 4DL9A 4RKYA 4MWOA 5HBGA 4YUZA 5C1OA 3DDUA 3FPKA 1DKUA 3FNGA 4YBZA 1LDGA 1QLJA 1JHPA 1F3LA 3PX3A 2NSGA 4KK3A 4G26A 4PGAA 4RD2A 1Z2PX 5C8XA 4YMIA 1HTWA 4BJTA 4DJEC 3KYCA 3L34A 1PJQA 2PUTA 3IQEA 1I2AA 4RK0A 3QH4A 4QLOA 4QX6A 4QHTA 3FI9A 2WWWA 3QKWA 2W48A 3ROKA 3EOBI 1Q2XA 1O2DA 2XMSA 3AEKB 2GSDA 1ZR2A 1HUQA 3UB2A 3V8VA 3H8WA 1JTVA 1BIFA 2QU7A 4BMSA 1S3FA 1YVRA 5LLDA 3OCYA 3SXUB 3ACCA 2BTOA 5JUAA 5PGMA 4OY3A 1R6XA 3NAMA 2PSEA 4YEDA 2IH4A 4CKWB 3US6A 2EKQA 4TROA 5IXYA 5G0UA 3WO1A 4FFPA 4RTJA 2V5VA 1U9IC 2UZ1B 3B78A 1T91A 4DQVA 4XSHA 1V74B 2XUZA 2PZAA 4E1BA 3AG5A 3TAHA 3C8MA 2AKYA 3GXOA 2MWMA 2RFLA 3U7HB 4U00A 2BI4A 4B44A 5AKGA 5JJKA 3B8EA 1JLLB 2B7LA 3KEFA 4E08A 1M6EX 1S2IA 3NOVA 4ODIA 5AJHA 2GAOA 4Q3BA 2PIDA 4OH1A 1KI8A 3P9KA 1T5DX 2NOAA 4DV6B 5D92A 4IEIA 3WBBA 4Z4CA 4L8VA 1C8BA 2V7BA 2IS4A 5DPMA 5HM6A 1PG0A 4J1TC 1I2BA 2A8YA 1JFFB 3RFYA 1MXHA 2A7QA 1EVYA 4LZNA 3T7RA 3R9XB 2OFWA 4M49A 1WUJS 1JR6A 3HBLA 3FPBA 2ZDHA 1RW4A 3BA6A 4YAEA 1J99A 2FXVA 3FNEA 2QQ0A 3PRJA 3Q9LA 3LX5A 4NMHA 2IU4A 4H77A 1XK6A 1Y3FE 3NT2A 5BOSA 5LUAA 4EYQA 1EQAA 3N5CA 5FOUA 1VHTA 2WJPA 1JDTA 3PT5A 4E5PA 4J0JA 2QNLA 1GQSA 4GEGA 5LD2B 5TV2A 1AE1A 3WLTA 1JWAB 1IHDA 1ORJA 4IHQA 3IKJA 1CF4A 3OWTA 5GJVC 3KXDA 2E5LB 4RIGA 3IT0A 1Y9DA 2WVHA 1O89A 5LP6F 2NUPB 5B4TA 4ID9A 1P7ZA 1UBKS 4W9NC 2ZCJA 4MKXA 1J8FA 1ORHA 3E84A 2H1HA 2ZYWX 4CUZA 1YZFA 2NU7B 4BLPA 1EFDN 4EKIA 2ONJA 4XLZA 4GGMX 4B0PA 1I5NA 3EXEA 1QTRA 2XMDA 2ZB2A 1ZLXA 4L5JA 3U7RA 4G8JA 1X8LA 1EVEA 3EXG1 3S7TA 1NT2A 5HFAA 1MO4A 1UIMA 1PIWA 2JHPA 4EWCA 4GR4A 4CG1A 2KHZA 1L3IA 4MKGA 5FI0B 5HKLA 3UAYA 5JG7A 4FU0A 4KC0A 4IQ4A 1FTQA 2WAYA 2M6SA 3T7SA 3MIZA 1VG8A 3EAQA 2AJDA 1YS7A 4YCSA 3RFTA 1YQTA 3OFND 3V4LA 1SC4A 5AKEA 1U0NA 2XL6A 4U5QA 4YWHA 1UQTA 1DCMA 4DEVA 3IJEB 4KFTA 1G6OA 3DE5X 3DBLB 1ZK0A 1XDBA 1NE7A 4P2BA 4WOBA 1LLQA 4LF8B 1T3HA 4TKVA 3DXJF 2QY9A 3HY3A 4D9JA 4TLDA 2H4HA 3MN1A 3PCVA 4N5MA 4Q39A 1SPBS 4P6IC 2JCXA 2ZJ1A 3SI7A 4JZYA 3DDNA 1HEUA 3A9SA 1TJNA 4CZ2A 1Q3HA 4B34A 1L5QA 4CEHB 3DQPA 1D03A 5B5SA 3FYUB 1UBCA 1DZ3A 3PQDA 3RC7A 1GADO 4KAFA 2UYYA 1G5QA 5HA5A 2Z30A 1P9WA 4H0CA 3R7LA 5K0GA 3O1IC 3GVIA 4I9GA 4E14A 3TI9A 4AWAA 2BY4A 4JB0A 4ZV9A 5E38A 1B00A 2XUHA 3I2FA 1C29B 1TM3E 1AM4D 4M88A 1H9AA 4L28A 4TUYA 4MRNA 3KV3O 2QMOA 1OAOC 1G6HA 2A1IA 1Z4MA 2PBFA 4IVRA 4TTSA 2M32A 5TT1A 1EDEA 1QRUA 3RBXA 1FB5A 5B55A 2IPNA 1N7GA 1YRAA 1RPZA 3W3ZB 5BN4B 1MC5A 5DLJA 1JTEA 1N6RA 1QDEA 3V4RA 1JA0A 1N3BA 3H6HA 2FG6C 1IYZA 1P5RA 1C30A 3L1UA 4AY5A 4Y67A 1IXZA 2JGLA 1YJAA 3LJKA 5LQDA 1W87A 3RHTA 4C0AC 4RPLA 3I5QA 2X22A 1ST3A 1QU2A 3W2IA 1UZUA 2ZB8A 4DR5B 5ER9A 1Y98A 4YXWD 1ILEA 1PTKA 1H2YA 2I1QA 1IN7A 2VHCA 5AW3A 2Q0XA 1MBZA 4KFCA 2W6ID 1G2IA 3IJ5A 2ZR9A 2OFXA 1PR0A 4MPRA 3K9FC 1AZLA 5DGCA 3POVA 3GPBA 5IBQA 2X4GA 2BGMA 4YAJA 5EGYA 1EFRA 1RRVA 1A4XA 2O20A 5KHAA 2Q1TA 4BNVA 1VMEA 3M3HA 1TCCA 1HT2E 1ZA2A 4Y9UA 4TXMA 2HZ7A 2HJSA 4GI2A 1OT3A 4WZ6A 1BVYF 2QLLA 3AZQA 5LL6P 2A4KA 2FWNA 3DT9A 1WQ3A 2W2XA 1UEJA 3A3KA 3O8NA 2NZWA 1AKMA 2E4WA 3AESA 4ZIRA 4DBQA 4LX8A 2AP3A 3H3FA 4RDCA 5KS2A 1E58A 2FK8A 4Z54A 4EKWA 2BM1A 5CLGA 3BERA 3AKYA 4UJ3A 3DUFA 4IIEA 2OCDA 4PAQA 1GYPA 1UBUS 2J32A 1T4MA 2ZRKA 1O77A 4GW3A 4L5AA 4R8KA 3T3NA 5MN5A 5C1IA 3ED1A 2YXLA 4L02A 5TE9A 3JYLA 1PNRA 3K32A 6REQA 5BV0A 2VSNA 1YNOA 3ZHXA 1FCJA 4Q34A 4JJEA 1QFJA 4MKIA 3WLPA 2L6FA 4TTPA 1ZOIA 4H0NA 4NRDA 2P0EA 2I67A 1OIXA 3FYSA 1NMEA 5F5LA 1FPQA 3I9KA 3BWXA 1UJNA 2ZANA 3Q8LA 4OPMA 5KHLB 4ACAA 4DLNA 2W45A 5HIMA 5F23A 1ISRA 1Y6GA 1V7ZA 1XVAA 4IHJB 1TEVA 3G5LA 3JPWA 4F9EA 3IDOA 4UUNA 2DCMA 3CZAA 1IZ9A 1C9DB 1TLTA 3ZEIA 1LH0A 2CUZA 2ZETA 4KWHA 5CT8A 4W8HA 2OZLB 2PH3A 1TW3A 2IEIA 4MCIA 3C7KA 4C4PA 2CV1A 3IYLW 5EL0A 2K6GA 2WYIA 2SECE 1UOOA 3MINA 4EKDA 4LVNA 4ESVA 4YY3B 1EBUA 3N59A 3ABMC 4U5FE 3ZV7A 1F4PA 4WKOA 2IS2A 3R3XA 2GD2A 1LPOA 1BKSB 5TQVA 2Q7XA 5DTEA 5DLYA 1Z4QA 1ZK4A 5IPFA 3CXRA 1U0LA 1UT6A 3AKDA 3F6SA 2G07A 3VV3A 2VP5A 2BM9A 1BCSB 4C04A 3I8OA 1DIHA 1RFLA 4DM4A 1OPRA 4NE2A 3HJCA 1KKUA 4HUQB 4HGZA 1BWPA 3X44A 1TTHA 1ZD5A 2XGGA 1XXHA 3U9TA 3U6BA 3N39C 4YV2A 2NQ8A 3WHNA 5AHOA 3CLKA 2HJGA 3RQEA 4JOBA 3K1IA 3CJQA 2VCAA 2ZYTX 4FGZA 3R6LA 3RTGA 2YRWA 4FLMA 1G1MA 4CCYB 1CS0A 3D31A 4EHPA 3EEBA 1PBNA 2CMKA 3HGTA 5BN5A 4HDNA 2APJA 5HS4A 1KAGA 5JBQA 1IZ8A 2ZJ7A 1N32B 1G0NA 1ZIYA 1Y6QA 2AIRA 4KE7A 5BQXA 4WESA 2NX2A 3H2VA 2YQZA 3C41J 4LV8B 1YFLA 5B2FA 4I1OB 5K99A 2PXAA 4DREA 1ESCA 5JVDA 3EGXA 4Z53A 3JQ6A 2GWRA 1I2ZA 1L5HB 4G5RA 1G9SA 3WY9A 4L9SA 3SS7X 2R65A 2I34A 2O8EB 4NCIA 3VPXA 4Z1MD 4MV3A 1BXGA 1ZJZA 1VGQA 4KQFA 3NASA 1CUFA 5IJ0A 3UCFA 3TL2A 3GRUA 3E82A 3HCRA 4MWDA 2UDPA 2X2PA 5IT0A 4J16C 3QU5A 3L8YA 3IALA 4NCBA 2PMFA 2O6LA 2AK2A 3GQVA 4JASB 2VP6A 2A1TR 3A2MA 3DT8A 5A2GA 3D6UA 1PJRA 2ETVA 1PJCA 1CNFA 4YHBA 5CBPB 3JSEO 1MB3A 5AJUA 1ZN8A 4NJMA 3MT7A 3X2SA 1SFRA 3BBLA 4JY7A 4O2BB 4FOLA 3A6KA 4D97A 1E2XA 3AVPA 3D3QA 4IOJA 1Q22A 2F00A 3MFYA 1D8TA 1QCYA 1EFPA 1DQYA 1BYIA 3D6MA 2WWHA 4TMVA 3H1BA 3UGKA 4QOSA 5K0CA 4CV0A 1EFVA 3TOSA 2EYQA 4IIGA 4WFKA 1XL0A 2YNMD 3AJ9A 3QF4A 4MAMA 4NBRA 3K1TA 4Q4AB 2Q4TA 1EFTA 3GN2A 2LGJA 3S55A 2QG9A 1ZL0A 5AC5A 4F8YA 1QK5A 3IH5A 4BO3A 3W5DA 3U5SA 3AF5A 4EJ2A 3CSKA 1VFNA 1Z8NA 3BWEA 4XYEA 2IP2A 1PTJA 5I4KA 4RD1A 2XQJA 5A5FA 4D8VA 2X15A 4HN4B 4OJQA 2W90A 2KW5A 1ULUA 1JE0A 1PWXA 1TYEB 3OOYA 1KI7A 2DX7A 3PQ8A 3GGSA 2A9JA 2ZS9A 3L7YA 1VSUA 4JKYA 3BEOA 3KQOA 3ASNC 1DAEA 4M1EA 4MJLA 3SBXA 4OHCA 1FP2A 3W2GA 3H9BA 4FT2A 2WG0A 4YL3A 2C4UA 2QP9X 3GEDA 1Z7YA 1RYZA 4CVNA 5LDGA 3STTA 4K86A 5EIXA 2FU5C 1C9EA 2R2AA 3JVEA 2AN9A 3LP8A 3LO8A 3OI7A 4PZLA 5HCUA 2W43A 1ATZA 4YQFA 3NRCA 3EBLA 3DBRA 5IMBA 2HRCA 3JALB 4F9FA 5IVPA 2ZTMA 1VZ2A 4M87A 3WGUA 3L7DA 4LRUA 2ADOA 5DNDA 3GP5A 1X3LA 2PLAA 1EDBA 2D5IA 1U5BA 1RC1A 1B43A 1MC8A 1CJTC 2WRZA 4XH9B 3IQGX 3SHVA 3BWDD 1D07A 3KL4A 2M98A 3C98A 2XTZA 5HZHA 3SVTA 3F90A 4UOQA 3GFQA 1QZTA 3AB8A 3F3SA 1I3MA 2ACKA 4IIVA 1M8KA 1XTRA 3KALA 2R02A 4RAQA 3WNVA 1GV0A 3SE7A 2HJVA 1UDBA 3FRIA 4ZODA 5JLIA 2WA1A 3UOAB 1E2IA 3ANMA 4AMZA 2XDQB 4PPQA 4QOIA 1OFGA 5ECYA 2RGEA 2XXBA 3TXYA 3TD6A 1TQDA 1IVSA 1LBTA 1XU9A 4MWZA 5JAOA 2IL1A 2C0PA 1YA6A 4HAIA 4ES6A 2WSSA 2WM9B 2YJ3A 1SIOA 2DKOA 4V2IA 1S0UA 4RQAA 5NLLA 1ZMBA 1GTSA 4ZDWA 1V8DA 1Z63A 4V1CA 2ZPUA 2XL4A 2OSVA 4RWZA 3I5XA 1U7XA 2QNBA 3LS2A 1MF7A 3DEFA 1CVLA 2C1XA 4CL0A 3TKLA 3BMCB 1KMHB 3VO9A 5PNTA 2D1YA 3VZQA 3M6WA 3PPVA 5AJXA 2SKEA 2GBIA 3CW9A 2A67A 3TD9A 1RIIA 4ARSA 1Q11A 1GPWB 2JC3A 5A7GA 1BKDR 4L2IA 1DLJA 2EJVA 1JJFA 4YXFA 3KEQA 1FP6A 4A73A 4C6TA 4UNPA 2JA2A 1MOPA 3Q41A 1DHTA 3MMXA 1R0SA 3COYA 3PR3A 1CDZA 1E2PA 4QDXA 1P6XA 1XMXA 1X8XA 3GFPA 2CYAA 3RD5A 3O73A 3SJ7A 4EVQA 4AJ2A 1N6LA 1CF2O 2E55A 3ENKA 1TAHA 3RB8A 3LBNA 2EFDB 4EGFA 1NBMA 2NXEA 4NHEA 1VBNA 2I4NA 4RYLA 5FL3A 4E0HA 3BKWA 1SRRA 3PJEA 1M2EA 3FOBA 4JJKA 4D6PA 2VDWA 2AC4A 1U9CA 3QZUA 1DS6A 1VLHA 3VI3B 2V7WA 2ECFA 4YP7A 4EMBA 4YJ2A 2DFPA 3TSYA 1YA4A 2PX8A 2E21A 3Q6IA 4HQ0A 4B4VA 2AYXA 1UPTA 5E3AA 3K5PA 4MS4B 3H2UA 1WUYA 2XW6A 1P9OA 2WPNA 3TQQA 1RRCA 5JVDF 5IC4A 1LPAB 1XTQA 4Z9IA 4B82A 5KMGA 4V0RA 4HNVA 3TH5A 3B12A 4CIAA 3GJ8A 3BULA 2JPDA 4ZI3A 1M6YA 3BMQA 3G8AA 2HKVA 5BN3A 3RVDA 5HK9A 3ERCA 2GR9A 5F5NA 1PJZA 3COPA 3PNLA 3ZU3A 5EZQA 3KZ1E 3TIFA 3RIHA 2XS8A 2Z2JA 2CCJA 3FPEA 3BILA 1KDPA 3NQ41 5A5EA 2WMDA 3TOXA 3KVRA 1ODIA 1JDPA 3O74A 5BRNA 1NYTA 4U02A 1CZHA 4AP6A 3KX2A 3S5JA 5B2ZA 2A0XA 3JZFA 1FUUA 2G7ZA 3SQMA 4OXXA 1I4TD 3E1KA 1MA0A 1R50A 1CEQA 4DMCA 1CJCA 4J0KA 3MMPA 3HO1A 2DLCX 1EM6A 3WZLA 1D0YA 2CW5A 2WNHA 4DWJA 3V2IA 1AHPA 3RVKA 1YZNA 1NQTA 1L5NA 1M7HA 1PTJC 5ADHA 3LJBA 3MJSA 3WICA 4FOPA 2JI8A 2PP4A 1LKXA 1WY7A 5IANA 3OWXA 1QYRA 4M76B 4B3JA 1SC6A 1M2OA 5BR8B 1U89A 5E4TA 4TTJA 4U2KA 1B68A 2I2WA 1J25A 2NTJA 3UJCA 4QJBA 1H23A 5FPHA 1TM4E 3VYVA 3QUAA 2I8CA 4N06A 1YZHA 2LW7A 3SNHA 2XNKA 1Y33E 4CMHA 1QR6A 4YYZA 3L7MA 3GJZA 1QHYA 1DRVA 4B2YA 5E3JA 3AG6A 3EA5A 4MS3A 1FQOA 5IMSA 2L6HA 4O5AA 4DUPA 3HKEA 4XR4A 1J2RA 1PV4A 2A94A 1QS0A 4K6KA 1TUEA 2JFFA 2XDWA 1ECGA 3BSFA 3DHYA 2VZ9A 4WA8A 4HNGA 4M21A 3R75A 3LLIA 1GT6A 4IMJB 2R84A 3VJKA 5EZYA 3D2CA 1R5NA 4NBWA 5TIIA 3LL7A 3BGSA 1SCQA 1FRFS 4BP3A 1UQUA 3C15C 3TLJA 5ADVA 3ORRA 2IDZA 3GUVA 4BKUA 4C03A 4XIGS 3M9WA 3DA8A 3RRBA 4BYMA 3ILYA 5B64A 2H92A 3W5CA 2OG2A 1EM8B 3LCCA 4U6QA 3ZWYA 4JVNA 3A1WA 3P4UA 2H1LA 3EPJA 3NOXA 1ZSVA 5H9WA 4ONEA 5EWMA 3REQB 5T8KA 4KQMA 1UWKA 1NYLA 2V0GA 1P1BA 4LJ8A 2WVJA 1Z8DA 2OC4A 2P9EA 3HEMA 1V43A 1AMUA 4N5NA 3H2ZA 3TPCA 4L9RA 2AK3A 3CLSD 4TS4A 2O3TA 2V4UA 5JARA 4R8MA 3DS8A 2VHUA 3K2BA 4Z9FA 5FR2A 2FSFA 3EEIA 1MA3A 3BKXA 2C00A 4R1TA 2HPZA 4KUGA 4F96A 3DULA 4JFAA 3ZNOA 4LCEA 2F3PA 4XB6B 2DKNA 3I3OA 4FNGA 1JPVA 4RA9B 4U8HA 3BXHA 5LJIA 4CIYA 3ROZA 5CVDA 1J09A 4ENRA 5FUVA 1W44A 4UKDA 4V0MA 1D2HA 1TKAA 1ORDA 3C3KA 1YR8A 4K9OA 1E2DA 3GB9A 1HW1A 4I9UA 2NU9B 1EIZA 4XYBA 2I78A 1M8FA 5U4QA 3P0RA 4LDKA 4R9VA 1DFHA 3OE7A 4F86A 2Y1LA 3CA8A 4JLMA 3TLXA 4ZCQA 4X84A 4BNWA 4LOKA 1YZKA 1PE0A 4WDQA 1KJYA 1F48A 1MMDA 3GV0A 3MS2A 1JZQA 2G3YA 3CH5A 3ZWDA 4TMXA 1KDVA 3VPFA 2VLIA 2GPAA 3CPJB 3K0SA 2OC9A 2H0AA 1H22A 3JD2A 4J3NA 4F2PA 1M72A 3C6BA 5EPUA 5LYJA 1M0EA 3E03A 4GYJA 3GUHA 1RS0A 1TMGE 3ICWA 3HYNA 1DBWA 5FA5A 3QKSB 5LZ2A 1Y3IA 1CUYA 1Z37A 1GUBA 2AN4A 5E1OA 2GN1A 4BO1A 3LDAA 2P5YA 2AJBA 4XUEA 2XL8A 4GKBA 3ORSA 4GP9A 1I1QB 4KXNA 3HXKA 3O39A 4B3HA 2HWUA 1N8KA 1E5XA 1EDDA 1YQXA 5L95A 2HU8A 2C2GA 2HUNA 5KYUB 4BL5A 2ZAYA 1I4EB 2C59A 2Q3LA 4K0KB 1Z08A 1JMWA 2ZXEA 1AGNA 1OLUB 3JX9A 5FBWB 4DCSA 1DEHA 2XYRA 2C9DA 1M5TA 5IN5A 1R2QA 4Q1CA 3LF1A 1Y63A 1Q7TA 3BCUA 3MOIA 4Z3DA 1ZJWA 2X23A 1Q74A 1SO8A 3Q8MA 5JCZA 4EELA 1BZYA 4CI9A 5EMJA 2BSXA 3AIIA 1N78A 4TZKA 1GN9A 1SK9A 1C3VA 3E3OA 4Q4HB 2B5OA 1IZ0A 4L4XA 3TNFA 1MXFA 3KR1A 2H2FA 2KYRA 4YI5A 1SA0B 5CU7A 2YWCA 2XRFA 4IVNA 4UZSA 3RO7A 3ZW8A 1D1QA 4UAVA 4CDAA 1XTSA 1Y1KE 1JIVA 2FPIB 3Q2OA 3KYDB 2R7KA 5AW1A 2FETA 3FR8A 3K7EA 4PO9A 4C6SA 3VU9B 3C48A 3F8TA 4EA6A 2IPMA 4D4XA 1SK8A 4LV6A 2Z3ZA 4W5WA 2NSHA 1GO2A 4IDDA 1Q1ZA 3FAPB 1HE1A 1CUWA 1EFLA 2OQ2A 1IOWA 2OV4A 3DFKA 4OREX 2ZTLA 3EWAA 1Q0HA 3FHOA 4QOJA 1X2EA 6ABPA 2L69A 1JLRA 1A3CA 1RKUA 1RM0A 3EWSA 2F3RA 4BJ3A 1PK7A 2DWUA 1AQLA 3O8OA 1SM4A 3DFIA 1KJQA 1M6VA 4LZLA 1CULC 4W1PA 1CUEA 1ULSA 4JIGA 4EUSA 3PDHA 4UQOA 1G5PA 2C2YA 1KZHA 4ZPXA 3VPHA 4KPUA 4HAUA 2C98A 3DWGA 1IW7F 3DM9B 1ZESA 5L0CA 3UV7A 5EQFA 4RVOA 3U9MA 2O9JA 1Y9EA 1MZPA 1SQ6A 3R7CA 3ZXIA 3R6WA 2IEZA 2PWBA 1FS5A 4X7PA 3U7JA 4RE6A 4HNAB 3QE4A 1JX6A 5KQRA 1BDJB 1VSQA 2VPQA 2W6QA 2CVOA 2G06A 4MR8B 3LT5A 4FS8A 5E6UB 3JTEA 3T0FA 3JD3A 3WLIA 3U1VA 1T13A 5H4GA 1ZJ6A 1Z7BA 2CMFA 3RK4A 4TS3A 2J3IA 5LXTB 1NQ5A 2Z8YA 3GC6A 3NBZC 4UXJA 4YRFA 2IXGA 3A2NA 4ND8B 5JOQA 3NTRA 1CY6A 2GJ4A 3OZAA 2VH5R 3L7OA 5EZYF 2ORIA 2PD6A 5DLEA 4Z0PA 3NV9A 5J4HA 1AK2A 3UUGA 3H4IA 1FNMA 4WOCA 2WU3A 2H5JA 1QYIA 1EQ1A 3E6AA 1RPAA 3UHJA 2AXQA 3VC7A 1SQ5A 4FE4A 3NIGB 5D01A 5T5QA 4Q47A 2YY6A 1C5KA 4EY4A 3ANSA 3QPAA 1XRJA 4FCWA 2PD4A 5CDUA 3K0AB 2XMGA 3T0IA 3ZQ4A 4EH1A 3VM6A 2GASA 4KMMA 1ZISA 4TS1A 2C2MA 1GG8A 1EESA 4P5EA 2D7DA 2FY8A 3ZCXA 2DHDA 2OWEA 3SHTA 2B6HA 2WU8A 4OAPA 4MVMA 2EP7A 1TMYA 2CLHB 3IDSA 5HE8A 2ZAIA 2V9PA 3DKPA 2OCCC 3GZTB 4CRWB 5KNDD 3CF4G 4EJFA 3GLTA 3HY6A 4OQXA 4OQNA 1RYHA 4C7OB 3PFIA 1PHPA 4GDMA 4Z51A 3RS8A 1FXSA 1UZLA 4G1CA 4D0SA 4CUJA 1YI8A 4PHGA 3U3KA 1PI3A 4EHJA 2JFZA 4FDTA 4J0GA 1NP7A 1O6GA 1TQHA 3DL2A 2PWZA 4FDVA 4CV2A 3MYFA 2Y93A 2DFVA 2RI6A 1G4HA 3S90A 1CC1S 3EPPA 4UD6A 3M6XA 1WU7A 4RY8A 3CHYA 2ZR0A 3QLVC 1HDRA 3N8GA 2UAGA 3ESZA 1RRPA 2O2IA 4IY1A 4B47A 5FH9A 2RGYA 3IL2A 2X1VA 2YICA 3TLGA 2IXFA 4XWAA 4QTTB 3P9RA 4FR2A 2MHRA 3CLUD 3LDHA 1SUAA 1O0SA 3KVOA 2JFWA 3CNNA 1Z6GA 2YOHA 2LTAA 3LDUA 4D5EA 2HSZA 1VRWA 3II6X 4ZU3A 3OFNA 4IGEA 3ZY3A 5F98A 5ELLA 4XGRA 4MB2A 4RZSA 3GLQA 2ZYVX 1XMSA 4D0NA 2CZQA 1QCZA 4BGEA 1JG1A 1NN3A 1B8VA 2PMKA 4YONB 3MT9A 3CLRD 3AGPA 1YHNA 3VPBA 1VXRA 3G2IA 4LY9A 1LPPA 1QTNA 3Q5DA 3FOWA 4KN9S 1FFHA 5BUOA 4MQLA 1SEPA 4KPYA 1Z0AA 2P1DA 3UPUA 1XJ0A 2FFQA 4F3YA 4UNQA 5AKYA 2Z1NA 2WIBA 2QTWB 2QUJA 2DPYA 4KR7A 4NY3A 2HBZA 2RK4A 4Z3KA 1BFKA 3OTOB 4BWYA 3M1CB 1UBHS 3E22B 3WGYA 1EQUA 5HZGA 1YFJA 1WB5A 4RF5A 2UZ3A 2XB4A 1QGAA 2AH5A 2OZEA 5LIRA 4LYDA 3FAZA 1XZAA 3L8ZA 3UBTA 3KUUA 3FPAA 4IJJA 2BIFA 1A5BB 5F64A 1HE1C 1LVKA 2FPUA 2UXDB 4Q4DA 1NQUA 2AX4A 3AI7A 3FCYA 4I1RA 2WINI 5TVKA 4I7EA 4LRQA 3QSGA 2FPOA 3QIVA 1ZD1A 3KD2A 1UKVY 5IKEA 5AK4A 4G07A 1TC1A 2G9QA 2JATA 3EVAA 3OZGA 1EG7A 5G41A 4H7KA 4RLFA 3GFVA 4BMNA 4A2CA 3U19A 2PPLA 2WOOA 5A06A 4HNQA 1P0PA 2GPSA 1D6JA 1LM3B 3KSUA 2WIAA 5K3EA 2AOTA 1JDNA 4KOAA 1OJ7A 4YXWA 1F2UB 5J4YA 1NMSA 4RGQA 1K0UA 2W6IA 3RVJA 4FB5A 2UZIR 1Y1LA 2EL9A 4CU2A 1ZL2A 2VPPA 4HADA 3X2QC 3TINA 2MYTA 1HE4A 4RS3A 3IX7A 4RPGA 1M6NA 1GEEA 2O8VA 2PZ8A 4YBRA 2PSHA 5F3DA 1K3FA 5E9QA 2VJLA 3L4KA 1OZAA 1CUZA 2ZI9A 3ZCSA 3MTJA 4ROTA 1KKLA 4QDZA 5AKLA 1IQPA 2FR8C 1HMOA 1ZHZA 1TF2A 3VH2A 5EPOA 1XSEA 2HF9A 2O2SA 4CMIA 3H1AA 4N5LA 2DH6A 2B4AA 1NX6A 5FTLA 3ODPA 4MYDA 2PYIA 3OTHA 5CFRA 5HUQA 2QX7A 3DAYA 2DTEA 1KMCA 5D84A 3D1LA 4RF3A 5A0VA 3U6KA 2QT1A 4O2AF 3ROTA 3MERA 3ASYA 3OD5A 4B3GA 4RPJA 3SE0A 3LUAA 1RVDA 3SJZA 1J0AA 4CBVA 2BL2A 2M4EA 3QU9A 4GQIA 1WNTA 5ALPA 5JASA 3AP2A 4DBZA 4BQFA 3R7NA 2EWWA 4BVKA 5CNKA 4LJ9A 2VIIA 1JR3D 1A2QA 2BE7A 3ZNNA 2BHTA 4PLZA 2WK1A 1ZNQO 3MYIA 3SLRA 1KPHA 3Q72A 3B2EA 3VZCA 3U40A 3R41A 2A1UA 4FW9A 2JANA 4MEBA 1E3SA 2H59A 3THWB 4ZZIA 4RENA 3ASUA 3GFGA 2DLDA 4NECA 3DO6A 3C3MA 3DPSA 5LQMA 3LCVB 1RIFA 2VJAA 5BYJA 2NO6A 2QF7A 4UMFA 2OUKA 4IZ6A 5LU8A 1KFJB 4FHCA 1JNXX 4ZFNA 2PN1A 1EE9A 2E4ZA 2WICA 3TTXA 3OJXA 2JCVA 3EXG2 2IS1A 3B3FA 1DOVA 1FDVA 4WVFA 2IV7A 2FA9A 1U1GA 3IQWA 1X70A 2FZCA 1RI3A 3NBXX 1AK1A 2R1UA 2G28A 3IVGA 3RYCB 5D7NA 5FI3A 2WU0A 5JC8A 2IE0A 4Y6OA 5HVNA 2EEPA 1S7CA 4HDKA 2G3KA 3EEOA 4LXHA 1K40A 5FBRB 1WZCA 3TMYA 4MR7B 4PWYA 2ZYRA 3I1YA 5DO9A 2F8MA 5A3VA 4EUFA 1TWHA 1NULA 2OD9A 1X38A 1VPVA 2P27A 4K6CA 2NVUB 5JAUA 3P2JA 4BV9A 3I5MA 5B1EA 4PLHA 3UNGC 3PQ6A 4RK7A 3NKDA 3ASOC 4JBXA 5B58C 1Y3DE 3PQCA 5LP6C 2XE4A 3EGOA 4UQPA 4C4YA 3P52A 3N87A 1OH5A 2OTCA 2PT7A 3N58A 3T95A 1V37A 3N2NA 5KOHB 3KPHA 1O95D 1YDHA 1F2VA 3OPQA 3PQ4A 1CUBA 2QXYA 3FJYA 3JZ0A 3IPXA 4Z2YA 1BEUB 1QGZA 1T6XA 4KQ2A 1E9EA 2MHCA 5D3MB 4U5EE 4N76A 4Z1MA 2RH5A 4DQXA 2FW1A 3VVCA 1W35A 3PI6A 2GDZA 3HN2A 4IDHA 4ZQCB 2BF7A 2B92A 4JU8A 2WU4A 5CMLA 4LYHA 4M0CA 3KVYA 5BYBA 3EF0A 5AW4A 4X1YB 4GVLA 3DTVD 4Q05A 3HUUA 1P7VA 4AZ0B 4W1SA 4YMTA 2OZKA 3OU6A 4G37A 3GGGA 4G81A 2QRVB 4D6XA 3NOQA 2C94A 4RETA 4LPKA 3SKVA 1OYVA 1Z0SA 2X4LA 4L15A 2R25A 3WIEA 5DP1A 4U2FA 2OPBA 1P62B 3TRDA 7MDHA 1U8CB 2P4EA 4QUEA 1OCOC 2N9UA 4Y1RA 2W6NA 2IU0A 4M7WA 4HDCA 1WB6A 4Q1DA 4R2LA 3TJRA 3VOSA 3MLAA 4PO1A 4U5XA 1YOVA 3WAGA 2X7JA 5A69A 3UOGA 1POXA 2YNMA 2LSEA 4DA7A 2A9VA 1RCPA 1MENA 1WD5A 2C2BA 3AY6A 3COSA 3F97A 1RWNA 2WFLB 4F6LA 3OPXA 2D59A 2P7VA 2NTNA 5TMDA 2NO7A 1JXOA 4QTXA 1JKMA 1U7WA 2UZ4A 1JDSA 5ESWA 3UHAA 2XNSA 3KBBA 1H8ED 3ZVNA 4FE7A 5F2NA 1GGVA 4Z99A 2C5LA 3WMRA 4ZQGA 5HE9A 2JVKA 3OBIA 2H9AA 4K1OA 2VAMA 4QUIA 7ADHA 1FFGA 3NBAA 2ZIXA 4G84A 4GDFA 4Q9JA 4Q7JB 3C6KA 3EQLF 4H15A 4MJ7A 4B6SA 1HDXA 2OXTA 1Z23A 1T5SA 2I3GA 4I3FA 1LF5A 4LHEA 3KAQA 3T3DA 4IUYA 5DSTA 4DB2A 3KSMA 5DWQA 2ZVDA 3A9CA 5IJ9B 5DBOA 3EOZA 3ZHTA 1NGSA 1FS4A 4YC7A 1VIYA 4OI1A 5CTAA 3OPNA 1NRJB 2BCJQ 4RVGA 1O6FA 3G0IA 1HWYA 5LB4A 3HNIA 3JSXA 2P9JA 5FA8A 4RVSA 5C3MA 2V45A 3H3XA 4KO4S 5IZ4A 3AG4C 1ZCAA 5T41A 2H52A 2Q5HA 2OB1A 1PF7E 3AUXA 5ELXA 3HYCA 3FUCA 3KQSA 5AQ1A 3PPWA 4DV5B 1SXJE 3IQ6A 1MDBA 3SSOA 3QKRB 3ZBPA 4PHHA 3DZHA 1TM1E 3P45A 3QEOA 1EWKA 4FEYA 2D13A 2FWJA 2XLHA 3ADOA 1KJZA 2YUIA 1ESEA 4P36A 1SXPA 2XD9A 2YMMA 2ZSIA 3KHUA 1KL7A 3ANXA 4Z3OA 1OFVA 4EZBA 4FEAA 4IWNA 3KB6A 1EB9A 2J85A 3NYMA 4IYRA 5CJ2A 2FQXA 3ELYA 2NSLA 1T0HB 5J1TB 4FTWA 4EHLA 2ZIWB 4HLNA 2VJQA 4Y6QA 3FBTA 1FS6A 5DBGA 1G0OA 1DG9A 3JZMA 4JYZA 5A0FA 1Y8AA 4GLBA 4FKZA 1DSSG 2FSHA 4M1KA 4QM7A 4AZSA 1R7RA 3MTIA 1FDSA 3GNSA 3KNZA 1RLMA 4ALKA 5CAEB 4CDRA 4F91B 1P4GA 3MTEA 5LYYA 1UBEA 4I99A 2PQ0A 4W5HA 1IBCA 3ER6A 5EA2A 4XOUA 1MPTA 1WETA 4Y1FA 3UJ6A 1VE7A 1A9TA 5ECGC 4Q01A 3VO8A 2D5LA 1LFAA 2PX4A 5IVKA 1B6RA 3S1LA 4UXHA 1GCAA 4Q15A 4AP9A 2GTIA 3AHIA 4RVDA 3DOCA 2EX1A 3THOA 4OLBA 4L27A 1JAZA 5ECDA 5CFQA 2LNDA 1E8DA 3K0HA 2CLKB 4MKFA 4R3NA 2ZPTX 2NV0A 2V97A 1PVDA 2AOVA 3I2JA 4FQ8A 5M34A 4PGFA 1M1ZA 1KXJA 3WLRA 2UVPB 3DZFA 1XEFA 4R51A 3SC4A 5E0KB 2VPTA 2QYTA 4LJRA 4ZU1X 1FK8A 4D25A 4MVJE 4G5QA 1YXMA 2BEWA 2AFIB 1Q95A 4B6IA 1NJ6A 3EGEA 4N49A 1NLFA 3UT5A 5H68A 1Q0RA 3G88A 1BVRA 1G3QA 4KOEC 3IEMA 5DNYB 4ZEOA 1XWFA 2GNOA 4JXJA 4BO6A 4NJEB 1NVWQ 1FFXB 2H5IA 2OA0A 2QM8A 1WEKA 3L9XA 1JBEA 1UT8A 1L5YA 2YN0A 3MXOA 3ZC3A 3KYIB 3CSUA 4E0IA 2P3LA 5K9ZA 1G4UR 4QYIA 4XA8A 2BTEA 5D87A 3WA6A 5KU1A 4LKRA 5E4JA 1YS9A 2HKIA 1H9GA 1Z18A 1E20A 2I66A 1RBZA 1IUKA 4XJXA 1I6WA 3IPLA 3INRA 2R6DA 4HDSB 1MB4A 1V1MA 1AKYA 2YL2A 1PS9A 1W47A 4OJKA 3JQQA 4NS4A 5TGTA 1SBCA 4E18A 3NZEA 1K98A 1X8JA 3LHFA 3W6OA 1B3RA 3DVQX 2A58A 1OREA 1YQQA 2YNMC 4DM7A 3PX7A 3JCUQ 4YUAA 2FMFA 4M0KA 2NYAA 3MQ4A 2MSKA 5FPKA 5CURA 2R3SA 4NNJA 3MBKA 1QHEA 2XBLA 5IC6A 3SMVA 2EW2A 2NSYA 4YROA 4LZPA 4A9AA 3LFHA 3EIEA 3FLAA 4B3FX 2BFBB 4KQ6A 2WJIA 3D0OA 5AIAA 1YBAA 4HEA6 3C1OA 1GGEA 1SVKA 1HL7A 2COKA 2WKWA 1UDAA 4R68A 3LNCA 3Q7PA 3BMOA 1JF8A 2IZ7A 1KAOA 3RU3A 4DV7B 4RF2A 3F6PA 2IYZA 4P35A 3TTYA 2ZIZA 4HUJA 2Q8NA 2P9CA 4J91A 2EV9A 1C1YA 2C2ZA 1JRAA 3RUCA 3WO0A 2W4MA 1D8AA 3EQ7A 3GPIA 3ZKWA 4BLOA 3GEIA 4BEMJ 5IBPA 2RHHA 3A4TA 2IYPA 3WRXA 2CHEA 1DKRA 5JP7A 1B76A 4I5EA 2PQ2A 3QNUA 4GSYA 4F04A 1QZXA 2Q45A 3EZLA 2QRKA 1J6UA 4MICA 2WYOA 5A1TA 2WR8A 4CQLA 1ARZA 1B7GO 3MEQA 1KYYA 2HDHA 4M53A 2BKEA 1GPUA 1YJXA 3I2KA 4BCCA 1WV1A 4YWJA 1UR5A 4ETIA 4RAOA 2WTMA 3UNXA 1VCMA 3M4YA 3U4GA 4GKJB 1G42A 3N75A 1KEUA 2Q3DA 3OF3A 1XA4A 5I4IA 2ADFA 2ZQZA 3B6JA 3RJZA 2VQ6A 2QRLA 3SM9A 3THSA 1D2EA 4LVCA 4OKSA 3T4XA 2J7PD 3HRIA 3L0OA 3VR4H 3BTSA 3MLEA 4UVEA 4MAAA 4J6EA 1MNDA 1WDKA 3E2IA 1YDEA 1ZVZA 1IG3A 4HEJA 1V0JA 3MPOA 4YRPA 2FKAA 1ECCA 1P3DA 4BJ6A 3OIGA 5FWYA 3FTPA 2Z8YM 2ATXA 1FDIA 4MV5A 3UGOA 2LIPA 3KZXA 2QQGA 3EIUA 2IPLA 2ZITA 2B4RO 4Q03A 4QAQA 1CVRA 1YQ9A 1Y4AE 1E4EA 1U2EA 4C7BA 3RIPA 4X60A 2R66A 2QUPA 1SUDA 5ITVA 3L8MA 1TKCA 3AERB 3QWAA 5DHTA 4O7GA 2AXEA 2VHZA 3H13A 3EG9B 2D1RA 4RF4A 3FUUA 2A5GA 2W2NA 1O58A 4QXRA 5CEJA 5A62A 3I34X 4EGAA 4RGBA 1U2DA 2YFHA 3F5FA 1KVUA 1KZ1A 3S84A 4L8WB 1JEJA 2YX1A 4QVIA 1W85B 3CF0A 2OXCA 5T3TA 3T35A 1ZHYA 2WZLA 3ASVA 5KNCH 3U0VA 3NBKA 5AJWA 2ON6A 3QW2A 4LYEA 2VAXA 3V5XA 1E9BA 2VYQA 5E0OA 4JEBA 2A0WA 2P35A 1A27A 1M34A 1ZITA 1GS9A 3IKMB 5EOVA 5KSWB 4S12A 2PR7A 1U8YA 3FMPB 4J90A 4ZVUA 1KEWA 6AT1A 1RM4A 3QKUA 3UTCA 1HNWB 4G41A 4GMDA 3SZRA 3DBHA 5IEJA 2WJVA 4HZUA 3C4JA 1PSZA 4MKHA 1YZVA 3AC0A 2QGZA 3U61B 1EJ0A 1B73A 2V7GA 4CEJB 1Z2DA 2BTQB 4U1RA 5IM5A 2PY6A 1Q0PA 2GO7A 2WHEA 3I4CA 3U3ZA 3QYPA 1P6UA 4X24A 1ZC4A 4PAOA 1K6EA 3GELA 2W4BA 5IY5C 2HUPA 1PJBA 3FXHA 4HEHA 4GICA 5AXAA 2YHIB 3WDKA 5ILGA 4DDTA 3HM2A 2WKPA 3B5IA 1AN9A 3I4LA 1YUMA 4FIZA 2Q2WA 1MU0A 2O7NA 5K4HA 3GEMA 3KOYA 4H7EA 3GPDG 4IDOA 4D98A 2YYZA 1GUDA 1MDFA 3N9IA 3DZJA 4LNAA 3AR2A 1X39A 4ZYZA 4N6CA 3AR8A 1N6OA 4ZHQF 2ZYSA 5DQTA 3QG5A 3H2BA 3PKIA 3HCWA 4PLYA 3JRXA 1SUEA 2G5PA 5DYWA 5LLSA 3TSAA 4PFKA 4X0RA 1RRGA 3EAFA 3CLVA 2FW6A 5A3QA 1Y5IA 2PIAA 4BMOB 2XB6A 1RKVA 2H8GA 3SS9X 3B38A 5HV9A 2FZ5A 2FRDA 3K1IC 3R6TA 1DWUA 4ZC8A 3JVDA 1Q0GA 2AJLI 3L0CA 1EFUA 2LP4A 3ZNPA 2GZSA 4DBLE 2DPHA 3BWCA 2VF2A 2YXBA 2WT8A 2JIBA 2IE8A 4IGKA 2H11A 3EW9A 4OUKX 1HQYE 2FV8A 3ZW9A 1G60A 2FQQA 2MJLA 1KI2A 3DBIA 1VTKA 5B6PA 1CZKA 1NVAA 1K6XA 2BZ1A 3FSGD 1GU1A 2XWJI 4Z7NB 1JQAA 2LVBA 4XVRA 4WNAA 3WIDA 3V9AA 4HMQA 2E5FA 2B82A 2OESA 3CW8X 1DAFA 2B5VA 2XLDA 1FX0A 1YQDA 4HDMA 4D43A 4P80A 2WTUA 1TPZA 2FE1A 2KYHA 5JIBA 1HM5A 1U7DA 2PCLA 4PFSA 2KPOA 4RCYA 4TKLA 3OZCA 2I4OA 2FDRA 3U44B 3OOWA 1HC7A 3WNZA 4Y6LA 1ZM4A 1J22A 3UJDA 3IA2A 2JIOA 4EGJA 1CBUA 4RDXA 3P1JA 5BNFA 3DV9A 1M2VA 2NUAA 4NOKA 4U6SA 4N0PA 2V58A 1DGQA 1O1YA 3Q9UA 2EBUA 4R3UC 4PZPA 3PXUA 3OQ6A 4LACB 2Z04A 1IZ7A 1R4MB 4L08A 2Q62A 4HNHA 2GEVA 4N5IX 2B35A 4OIFA 4M0PA 5DWVA 2GBLA 3FCEA 4RK6A 3PZRA 1MRSA 2B94A 5DTQA 4CKYA 4NENA 3STVA 4IX1A 4HNTA 1V25A 3I76A 2GB4A 1T2EA 3QJYA 5JRJA 1U31A 1DC8A 3T61A 2X0FA 2B4TO 2A6HF 4G25A 1M6HA 5EFOA 4LC9A 4Q24A 4HWSA 3V1YA 1OOEA 1L3CA 1DRWA 1DXHA 3ZD7A 4BJ6C 2WHQA 2ATCA 3GH3A 3SZLA 221PA 3I83A 4DSUA 1Z4PX 1O7JA 1V16B 2WQZA 4H9GA 3CGGA 1WHTB 1HT1E 3HJTA 3K96A 4A26A 4J6FA 1D0ZA 3INGA 1DVRA 3NORA 1JEEA 5J63A 4IKOA 4EMUA 3CLSC 2XQVA 1HKUA 2RIPA 3L7CA 4NXMB 4EI2A 5FOTA 1E5QA 2VDPB 2YIVX 1HQCA 5L3VA 1K7SN 2QTRA 3WFIA 1C3EA 5G2OA 2XRHA 1I3CA 3M6FA 1U2DC 1UC9A 1WVIA 4QDUA 1T29A 2YHUA 4MKRA 2R7VA 4IW3B 2V96A 3L8IA 3TW8B 1BE6A 5CGQB 2QXUA 1T0BA 3EF3A 4QTZA 5CD9A 5B1IA 2G3VA 4PFOA 1GAXA 4IPTA 4OLAA 4BG0A 1EX7A 4PU0A 4JSTA 4MK4A 2PV7A 1EGMB 1K7YA 3U9SA 2V9CA 3DZKA 4FNAA 4JW1A 4RFLA 1USUA 2ECPA 4MV4A 3I2HA 3WADA 1QAMA 1KGSA 4C14A 4AMYA 1CSEE 1N9KA 5KNDA 3HA2A 1L0BA 2ZVQX 1NR7A 1WPRA 2FK7A 2AKEA 4MW3A 2CVZA 1Q0TA 5CYPA 3QELA 1TVKA 1MRNA 4JOCA 4JEMA 1LLUA 2POCA 2BM0A 621PA 3FHLA 5EXTA 4L73A 1IFXA 3IJRA 3RHSA 5KOIA 4MVOA 2C7OA 5M7EA 4J7CA 5EINA 3H1EA 3PFHA 5ECWA 6ADHA 5LZ7A 4PF1A 2E5WA 3AGTA 3IPAA 3QEKA 4EB0A 5LB2A 4DXAA 1KOGA 4NNOA 2VNAA 1OW6A 1OI4A 3USCS 2ZPAA 4NYMR 2VTBA 2WYVA 2RKWA 3REGA 3UXHA 1I4OA 3B5EA 5KYKA 2H1OA 3GCGA 4GEHA 3NH9A 4P4NA 3DCIA 1ZHFA 1P91A 1S4MA 1C0EA 4BNDB 2GHIA 3O9MA 2R5FA 1IY8A 1W75A 5D3QA 4BJ5A 3EGCA 1K06A 3WAQA 2CUKA 3TNLA 3ZQJA 3K1YA 2Z0MA 2Q5OA 3QFTA 1XE3A 4IF4A 5A6AA 2GSWA 3FSJX 3F4LA 4F9GA 4RZXA 2D3WA 4P93A 1KH1A 2BBTA 2AZTA 3LBIA 1ISHA 1MIHA 4IIDA 2Z4SA 1A9ZA 2O9XA 5J43A 4O63O 3NO4A 2FSPA 1UFQA 4N54A 1L6RA 3MOSA 3KR2A 4J4HA 1MIOA 5SY9A 1NI4B 1Y3BE 1Q7BA 2VZ0A 2DG2A 5I8WA 1K2WA 3G4XA 1I2MA 1FP4B 1FNBA 3S9OA 1U0EA 2DWCA 1CY4A 4GS5A 2G88A 3KKZA 3UXEA 3KP1A 3QY0A 4JEHA 5IUNC 1E77A 3EPKA 3QTHA 3FGZA 4OGFA 2OD7A 3KFVA 3D6JA 2OU6A 1NXQA 1Q14A 1N2XA 3CR3C 3MD0A 4RJIA 2NXCA 1NXOA 3I5UA 1Z26A 2VBGA 2O3JA 5C32A 2C5FA 1DIRA 3K3PA 9LDTA 3LRTA 3L7NA 3H5RA 4CL8A 5BQFA 4P0PB 2GTHA 3ZG6A 4X9XA 3QLUA 2WZFA 5D5QA 4EMSA 4GNRA 3U37A 2Y9PB 1TUGA 3GH1A 2BYTA 4XXHA 3SD7A 2IPAB 4KI7A 2GF9A 1TQGA 2X0KA 5B3JA 4LRTB 5A4FS 1RQPA 2OL4A 1KDZA 5C0OE 1MN6A 3PHIA 5EXDA 3NDRA 4YCLA 4OGLA 2ZJOA 1ZP6A 1EEHA 4KRYA 5UKDA 3TOCA 4X7BA 3E3LA 4LCJA 1JEOA 1LXCA 1TIBA 4DMLA 2R7LA 2C4MA 3KUKA 4YP1A 3A28A 2YWAA 3NS7A 3GRAA 3FTNA 3V32A 3O4JA 3ROFA 2OCGA 3S1SA 5M04A 4UC0A 2IXNA 3BD6A 4MVZA 4R9NA 4H1VA 5EIAA 2FFBA 2Q8PA 3QYFA 4N7MA 3AT1A 2Z2IA 1X86B 1MB0A 1ORSC 4ZAYA 3LUTB 4PIPA 2GBLC 3JAKA 3OZ7A 3WLSA 2XM0A 3GZNA 4RTLA 1GFIA 1LNZA 1ZEJA 2XA1A 2JIZD 2NIPA 3PPIA 4IBOA 2OK7A 3ZHOA 4X6LA 3V5ZA 2XTNA 3S68A 5COMA 5COBA 3QKTA 4FR5A 4M8IA 4HDOB 3DFZA 4PAWA 1PFUA 3E61A 4PCVA 1KZ7B 3INNA 4FFBA 3AB3A 4ZA2A 2Y39A 1QH1B 2COEA 5F2KA 1E3WB 2CFOA 2ZP1A 4QA9A 5H70A 4A92A 5A6SB 4MUKA 4C3DA 1OCEA 5HJ7A 3O10A 3S70A 5JWOA 2VP0A 5EUBA 1PR6A 4JC8A 4EY8A 3H1GA 4BKMA 5TGZA 5COQA 3G17A 4AP5A 1PQWA 5GTDA 3M3DA 5FKJA 1JG4A 4X93A 2PH5A 1W581 1F6DA 3OX2A 5FADA 1OAKA 3R3VA 5HR5A 3LRXA 5EMHA 2PNOA 1VBKA 1YFZA 2R60A 1JR3A 3TLEA 4BLTA 3QHPA 1IG0A 5HCNA 4YNBA 4AJHA 3LUKA 3EULA 3HFJA 1UFKA 2Q7RA 2HZBA 4C20A 1GGMA 4N0EA 3EIHA 5DTMA 4K6OA 1XELA 1B4DA 1FLDA 1UFOA 4EJSB 5JAMA 4TTVA 4DSAA 1SBHA 3QE0A 4Y9TA 5IJZA 4K87A 1P4RA 1P0FA 4BQQA 1NP3A 1YE5A 4XVUA 4MW6A 1N6KA 5LJLA 2BVNA 4KYUA 4KZPA 2CZCA 3G2PA 4B2IA 4GWGA 1MMFB 1A5AB 2PUCA 1M66A 4CDMA 2F8LA 1NWCA 1I6LA 2C3OA 2R6ZA 1MX9A 1YKFA 3CCBA 2QPAA 2Z5VA 1J1UA 2NO9A 4DIBA 5KTMA 1QSPA 4E4YA 4PQEA 3NJ8A 4TRMA 2A9KA 1GZ4A 2W4QA 4O2AA 4CFYA 3AJRA 3K6RA 4INOA 2ZZMA 1QGOA 1R5OA 1XZ8A 3OZSA 1KBOA 4R84A 3OM0A 3L7LA 1SNYA 1NIJA 5T8KC 1B0PA 8ATCA 1SZCA 5AM4A 3O1JC 3SQDA 1Z4NA 1QF9A 4JGBA 1A0OA 4X63A 2XTAA 4FCTA 1APCA 1YCDA 1OBCA 1A8IA 3AVTA 3OZBA 2QSUA 2IVFA 4XQ0A 2VWPA 2CLCX 2TECE 2YFKA 4BJ5C 5JD5A 4ALNA 4AN0A 5JPDA 1WLSA 1QPZA 5BQOA 1BEEA 2WP8J 2CMGA 3B51X 3CLRC 2PGDA 1KO8A 3N8IA 3HFGA 4RTKA 5DYNA 1CDDA 2OGWA 2JJQA 2R5NA 1DRJA 4PC6A 5BURA 5KX5A 2ZWIA 4UMEA 4QUDA 5CA0B 1W1IA 4EHDA 1JU9A 3IXLA 1LJ8A 3CR8A 3DPUA 1S4QA 3DZCA 1UMDA 1F51E 4JVSA 4MEJA 1O95A 3QU2A 3DEKA 1H65A 1RJEA 2JFPA 3EIXA 2GA9A 4CLHA 1MAUA 5KUTA 2ZBRA 3IPMO 1YO6A 2YL1A 2ROQA 1W1UA 1WF3A 3ZQKA 5BSFA 1QG2A 1BX3A 4UHDA 3HXPA 2XZLA 3NHUA 3FOEC 1IIBA 1KDRA 2BBSA 2O52A 3P9ZA 3PJRA 3L4EA 1KO5A 3DTVA 1WCV1 4PINA 4XEHA 3LBAA 2XI4A 1UOPA 1E1MA 1WB9A 4BO5A 4GAEA 821PA 3BGIA 1WDWB 3DLTA 4C0QC 1Y8CA 2LR0A 3DONA 5JQGB 4PXSA 4C0JA 3DB1A 3ADPA 3E05A 3L1MA 1O57A 1P2BA 5KYVA 4GZMA 3QLUC 3VJMA 3BD8A 4MUNA 2A0YA 2WWXA 2BFCB 3EIWA 4DCMA 1LW6E 2DXIA 3OQHA 3O8QB 3GLGE 1JLSA 1Z83A 1EH5A 5IAAA 1ZWKA 2CL5A 2EZ9A 2VXYA 5DS5A 1U8AA 5B3JC 1KO7A 4AU1A 5C4GB 4IDPA 5JV5A 3E5HA 2C4VA 2ID7A 1NWHA 4YIKA 2WD7A 1Z29A 5EHZA 4I2VA 3TJ5A 2OLJA 1C3OA 4MINA 1EX9A 4PYLA 4HYEA 5FTKA 2FPGA 3TLZA 4JBYA 3QXXA 1UXOA 3LQKA 2CVQA