4BJ5A

Crystal structure of rif2 in complex with the c-terminal domain of rap1 (rap1-rct)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
328
structure length
292
Chain Sequence
PVKERVDHVFYQKFKSMALQELGTNYLSISYVPSLSKFLSKNLRSMKNCIVFFDKVEHIHQYAGIDRAVSETLSLVDINVVIIEMNDYLMKSDLMMMVMRKINNDESIDHIVYFKFEQLDKLSTSTIIEPSKLTEFINVLSVLEKSNNIAFKVLIYSNNVSISSLLSTSLKKKLNTKYTVFEMPILTCAQEQEYLKKMIKFTFDSGSKLLQSYNSLVTCQLNNKESNLAIFFEFLKVFPHPFTYLFNAYTEIIVQSRTFDELLDKIRNRLTIKNYPHSAYNFKKNQRLPLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rif1 and Rif2 Shape Telomere Funcation and Architecture Through Multivalent RAP1 Interactions
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords PROTEIN RIF2
total genus 103
structure length 292
sequence length 328
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1650 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4bj5A01
3.40.50.12060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bj5A02
4BJ5A 4BJ6A 4BJ1A
chains in the Genus database with same CATH superfamily
1TUIA 4MVJD 2ZU0C 1FYXA 3MTGA 4IVNA 1RKUA 2BUCA 3R41A 4E0BA 5IDQA 4LWZA 1O0BA 3LIPA 1ZU5A 5FO0A 4XB2A 5COBA 1G3UA 3BN3A 2VQ6A 3AB3A 1OLOA 1RR6A 4LHEA 1ELOA 2X5XA 2YWXA 4OFZA 2MCFA 1VKHA 3IULA 3BGDA 2OXCA 2BSAA 2FDRA 4KFUA 3SXJA 4G0WA 4Z8YA 4KYUA 2GA9A 1Z8FA 1LA2A 1YR6A 1K08A 2O2YA 1F8FA 3C7KA 1A4XA 5G41A 2DTXA 2NIPA 4JWTA 4CS8C 3HV0A 3ZEAA 3JQBC 3UNXA 1QHHB 2C58A 1WE2A 4MDEA 3B51X 3VOSA 2L6GA 1JWAB 3HB0A 3Q4GA 4N0PA 4F9GA 4KAAA 4Y2TA 4QDOA 2IGTA 1EHIA 1Z0IA 1V5IA 3DOJA 4X0EA 4J0GA 1JEYA 1XD2A 5F3WB 2DFPA 2DKFA 1KNXA 3QLEA 3QYFA 2IYFA 3IVCA 4IVQA 4RULA 3AXSA 5EIFA 1QYRA 3DPUA 3GJQA 3ZWMA 6PFKA 4TWBA 2FH5B 1G8JA 4J76A 3GVPA 1TEXA 2K5UA 3MUFA 3P9IA 4FOOA 2X4IA 2X0KA 3NNNA 5JY6A 1Y1SA 1WJGA 3ILYA 6ABPA 5JXIA 1JFLA 2QI9C 1GPDG 3JS5A 3PHGA 4JI3B 1RDFA 1I4TD 3SZUA 4DQXA 2C7OA 4D1YA 3CH5A 2GF9A 4EFNA 4EATA 3NAQA 3KKLA 3SDZA 1D1QA 1W30A 2OT3B 2Q1SA 3ZDFA 3DLPX 2HWXA 2G6BA 4CQLA 1NRIA 1Q16A 3NEJA 3WLSA 3H6KA 3WK6A 3LFHA 5AM2A 4D8VA 3D43A 4QGHA 2X0EA 4H7DA 3SSOA 1G6OA 4LMPA 4BEBA 1XDZA 2FN3A 2X8WA 1FP4B 1X1CA 2OLKA 2WFMA 3AUTA 5A62A 2OBFA 2VK1A 3ZWOA 4AKGA 4FZRA 1RKEB 4KWTA 4NZ9A 2QI9F 4YALA 4ZIRB 1UWVA 1C7EA 3ZGYA 2R96A 1Z8DA 2C5HA 4M22A 2Y77A 1EFTA 2NO9A 3FM9A 3U5ZB 5DVWA 1YB4A 2PFDA 2BHLA 3DA8A 1TT5B 3G2KA 4G0MA 5BMVF 1ZGCA 2I76A 1T1JA 1C0KA 3PQFA 1OH5A 4NCBA 1DJNA 2ZRHA 3LHKA 3F3YA 4HKTA 3R5FA 1YBMA 5EMLA 1PJBA 4KAXA 3X2SA 3K8ZA 1JIKA 3ZJTA 3GBPA 4H7IA 5JECA 5JJLA 3KC2A 1R0YA 3SBXA 2E0IA 2Q4BA 4Q9JA 1KAOA 1JVBA 3BSFA 4EB3A 2B34A 4FKBA 4UEJA 3FBGA 3K0FB 5IX8A 1IRIA 1K89A 1MQSA 1FMCA 3LGAA 2R7SA 4TMXA 5DLDA 4ZT3A 1HR0B 2AYXA 1A2OA 3ROKA 3WLLA 2OYSA 4X54A 4F2GA 2QW8A 1DEHA 4B2PA 3NC1C 2GN2A 2O4CA 1C0IA 5FDFA 5L3VA 2GLTA 3MGBA 3VBCA 3A6GA 3U44A 4BKQA 2XL8A 3U44B 4LZWA 3H9BA 4IMRA 1VE1A 1U7WA 1Z39A 3RS7A 3JQ9C 1FLVA 2Q62A 3BCHA 3ZD6A 5FLEX 1IWBB 1MPTA 2AGVA 3JQAB 3JTEA 2TMYA 4HQRA 3NANA 4M7RA 3Q6IA 3OQVA 1ZIOA 4PYKA 1LQUA 4JCCA 4I08A 2B7LA 1ZAYA 3P9XA 3A9RA 3AF5A 1M56C 1KSJA 1E3DA 1XTSA 3KM0A 2B2CA 1TTHA 5EGYA 2I3GA 2I4OA 4HNQA 4WFKA 3SYLA 3TBFA 2YZMA 3LQKA 4JVSA 4DXWA 1JR3E 1T1EA 1Y3DE 1IY8A 2C0PA 2OUKA 4YI3A 2FCAA 5AOAA 5KJEA 3ZWKA 1H3FA 5JJCA 3AB7A 3AEQA 2D0OB 3K33A 2BIFA 2R5FA 1C9KA 2A1IA 2YR0A 4UU7A 4REQB 2WD7A 5FOSA 5MN4A 2W9YA 1IXYA 2VHCA 2V5AA 1I5OA 5CTJA 1WKBA 4ILEA 2FZ4A 3U7EB 2ILVA 3M8KA 4JBXA 4KQXA 3GUYA 1B3RA 2V0GA 4NV1A 2QR5A 2NSGA 1YFKA 1KI8A 4BPMA 3BWEA 3ZCPA 2OZEA 3FNRA 5EXEA 4PNPA 5K0LA 5HOQA 3HM9A 1VHWA 3GEEA 4PZEA 4RMIA 4FMPA 1WF3A 2VH3A 4NH4A 2VAVA 2J0UA 3AFGA 2ZK7A 4RDHA 2BFWA 1LLFA 3GZNA 1OWNA 2EKDA 4GO1A 5LKRA 5L6LB 3QSYA 4AUNA 1MB0A 2B2NA 1GQ2A 4HWRA 3W2TA 2LDXA 2D1TA 2EJVA 5AOBA 2FEAA 3I9FA 1OUMA 2QG9A 2W48A 2W43A 2HPZA 2ZDHA 2J9BA 2BM0A 5A7GA 3MF4A 3QU2A 1QVRA 2P0YA 3D7LA 2J07A 4JQSA 3N24A 3OICA 4E1AA 4EELA 5A3QA 3O9MA 3FOZA 2C4HA 4JUCA 4RGQA 2QP4A 3OCVA 3EW7A 4CS7A 3TLCA 2X22A 3TRHA 3N6XA 4RCZA 3U56A 4LOLA 1S7ZA 1PFVA 3IPAA 3NBYC 2JGJA 4MW3A 5TGZA 4NABA 3MT9A 4NESA 1MMNA 5AVUA 4XQCA 4KMOA 5KYYA 4P1ZA 3SMQA 5K05A 4LF6B 2PGNA 4LRTB 4R7ZA 3P19A 3O3CA 4ITUA 3T7DA 1K5GA 4FNOA 3W8NA 1T5OA 3GWNA 2CN1A 4D41A 2NYUA 3OZBA 4MTOA 4DIDA 4ABTA 3AT1A 1NOKA 5C8DA 3UN1A 2EJBA 1IEQA 3CR8A 3TUZC 1Z08A 5EZYA 4C0QC 2Q4OA 5DNUA 4HAZA 1Z26A 4FOTA 4NEHB 2JD3A 2MYPA 3A06A 3NUZA 3GFTA 1CRPA 1KAMA 1ZXBA 1MKYA 1MFPA 1CV2A 3TN7A 2OM6A 2I54A 3R6DA 5EFZA 4YREA 4ANFA 3I45A 5CDFA 3M6LA 1LVKA 1WSBA 4WY2A 1UOEA 3BK7A 1ZNXA 4BBZA 3MWDB 5KNCH 3CUUA 1FPMA 1ORJA 1ZMBA 4FSHA 3EX7C 1ZMXA 3G3EA 4F3NA 3B9RA 4CLRA 1IOVA 3HN6A 2DHCA 3I01A 1R88A 3IDAA 4XTRA 5AIBA 1NR7A 1NFOA 1LQTA 3C3BA 5EE3A 5IDYA 4PXYA 1XLUA 1W94A 2VG8A 2W2MA 4GUAA 2QNRA 4LYYA 4QXAA 3RHSA 1JQ3A 2YJTD 3KNZA 3WV5A 4RETA 2RAFA 4GEKA 3CZMA 3EIUA 4HS4A 5I9MA 4D56A 3SICE 5DNYB 1D7AA 4D5GA 1GT91 2X15A 2Y6UA 4MJ3A 3PVCA 4BX3A 3TSAA 2GR9A 1ZCJA 3WBJA 1VMKA 5KSWB 1UFBA 3US6A 3H1AA 1J9ZA 1YHNA 2BL2A 3RYIB 4JT2A 3A32A 2NUAB 4TRNA 1VJGA 3R8FA 4K5QA 4RANA 2D1FA 1CJBA 3GR6A 4H15A 3O93A 4O08A 2G7MC 5IKOA 5AI6A 5E38A 1IH8A 1XF9A 4NNOA 4QFBA 1CUAA 1RMVA 2DWPA 1ZONA 3MCUA 4JNKA 3HJAA 3A1FA 4OV6B 4DOZA 2AOTB 3LY9A 5FLKA 4EBFA 5BOVA 3WHKA 5F9FA 1NL3A 2V7BA 5LP6A 1EX6A 3E5RA 3W4KA 1GGNA 4K87A 3GUHA 3OEEA 3TD2A 2A9JA 1CY4A 2H0QA 2XMDA 4UD2A 2NP6A 2CJWB 4ENUA 4ZAGA 1G3IA 4WW0A 3OTGA 3M3DA 2IZZA 3NIFB 4JYPA 4CMEC 1JHZA 4W9RA 3DLTA 2X4DA 3PNBA 1J0CA 1E3JA 3EIFA 4DIKA 3BWDD 3TLJA 1P5ZB 1ECCA 1G5TA 2QUHA 4L16A 3AINA 4ZVMA 2XLBA 4BLOA 3W1EA 1WV0A 5CI8A 1WXIA 1K68A 1WSAA 5HBGA 3TX6A 2QIPA 5AVQA 2HSEA 3N53A 3K0HA 1FS4A 1WW2A 1UK9A 1WHSA 4OAOA 2R44A 2E5WA 2PX8A 3CY6A 3H0KA 1C8KA 2EWWA 4NKRA 1EFDN 4LSGA 3WL8A 3UMGA 4EI7A 2BBSA 8OHMA 1DKQA 5LYYA 3B2NA 4G5GA 1L4MA 4NYJR 5SY9A 1MO5A 4CL3A 3K73O 1EBUA 1LY1A 3TOSA 1KZYC 1EJ2A 1XV5A 3P4UA 5F5LA 4CR6A 1XZLA 3WGYA 2W0MA 3F98A 3TQQA 5JH7F 3VYRB 1Z35A 5IBQA 2PKXA 3LKZA 2YBEA 1L5KA 1JQAA 1W4BA 1RQRA 2O20A 3RCBA 5EQDA 5M29A 4WESA 2EOAA 3RJ5A 1KYTA 1U2EA 5CIWA 1PJAA 2CNOA 5DI3A 2C1EA 4B7CA 721PA 3AM1A 1DGQA 3CH7A 4YRNA 3KT8A 1RPTA 3PHHA 3U0VA 1CUDA 1EWRA 3ZI7A 1H8EA 1KFCB 2BJWA 3DAPA 5AC5A 1QGUA 2PDAA 2JH3A 3UCFA 2DRIA 1WCIB 1J33A 1ZESA 1MOSA 3HLTA 1WUHS 2UUHA 1H9GA 3WHLA 2Z58A 1E9RA 3ZZNA 2ZSKA 3RRFA 2QBYB 1D5CA 2WJ6A 3DE3X 3KYCA 3D6AA 4M99A 4DXDA 1YLMA 3CIFA 3ZTZA 2J9UA 2BFBA 3JYHA 2QG4A 3QBEA 1A7UA 2BGNA 2DR3A 2FGKA 1N0UA 1U0RA 3G7UA 4PLYA 1ZEJA 4W5JA 5CEJA 3CW2A 1G8SA 2VNKA 4ON9A 2QENA 4WJ0A 1H42A 3T5AA 2LDBA 1SBZA 4ZAWA 2B5OA 1WXQA 4WXPA 2IEGA 4O2BF 3BWMA 4ZALA 3R7WA 3URMA 4PQGA 2X0FA 2SECE 1GNRA 1HURA 3T9OA 1TEVA 2FUG6 1ZDMA 2W6ID 1FAPB 3HSSA 1IN4A 4YGXB 3WYAA 4GI5A 5FF9A 1CRWG 3K09A 3LPAA 1LC3A 2F64A 1XWIA 2V58A 3PX3A 2JGNA 4HDSB 4MWOA 3UJ7A 3CZRA 1I0ZA 2GNOA 3EVCA 3H8VA 1NYRA 4GZ6A 3RFTA 4AG6A 4RDCA 1IQPA 2KNHA 4X8HA 3ACDA 3ROQA 4R3UC 2CXUA 4F9TA 1Z6TA 2G40A 3PDMP 2CJWA 1KWGA 2J67A 5FUMA 1UMCA 4Q4ZF 4IUDS 2WB2A 4QTXA 2FWPA 1JLMA 3DNFA 2VP2A 4Q3CA 3ZY5A 3FPHA 1VBNA 5IF9A 1KMIY 3PUHA 3D8BA 5F7OA 1F7VA 2QQFA 4K86A 3SE0A 2HFJA 4Y9UA 4WJZA 2P9BA 3FETA 3QOWA 5DOZA 2JFVA 2BF7A 3E9ZA 4U9EA 1IATA 4JUFA 4BFLA 1NOIA 1L2TA 3G50A 3BWXA 2JDID 3FUVA 4R8MA 3BH0A 1V1MB 1NN1A 5CH8A 5G1NA 4WFIA 5CCEA 1FZTA 4WKOA 4HBGA 4OHRA 4LWQA 4CZ2A 3GD7A 2P5TB 1YB6A 1YS6A 4RCVA 1Z83A 3LEOA 4UTZA 5JVEA 4DMLA 3LW7A 4BAUA 2BEWA 4OH1A 3IRVA 3K32A 4IYJA 4JBGA 2B1GA 3MLEA 2BDUA 3GLGB 1M76A 2ZJ3A 3AEYA 1ZD2P 1RCPA 1GR0A 1ISJA 2JDIA 3JQGA 3IQCA 1UKEA 2YDYA 4MPPA 2XZTA 5JZMA 2CXTA 1ZD4A 4PBSA 3HDJA 2AVKA 4Y6LA 1Z7Qc 5HM6A 5KOJB 2D00A 3NV7A 4MK4A 4YJKA 2HK9A 2ZB7A 3L7OA 1QDUA 1EFVA 2BC9A 3OCWA 1J2TA 4MULA 4H0NA 4EABA 4E7PA 4FHEA 3DLCA 3K4QA 3OUTA 1FW8A 1G3QA 1O8BA 1ZUNB 1T4GA 3QF4A 3WGIA 2JGFA 1XHLA 4FBMA 4EKNB 1O95D 2JS7A 1LFDB 2H0AA 2Y1WA 3EEYA 2AN5A 3BIJA 3PICA 4O2AF 4W6QA 3AKEA 1MJFA 1EIZA 3B52X 1E7RA 2EZ4A 2MMGA 1CF9A 4ARSA 3VJLA 3C8GB 4FC6A 3AO0B 4MGKR 4M1YA 2OA0A 3L1IA 3NYRA 2BFFB 3ANYB 3GU3A 1IQRA 3LUTB 1U2SA 3DMFA 1OW8A 1JDNA 1U1CA 1T25A 2HPHA 1DO2A 5B1DA 5BURA 2I6SA 4Y0AA 4CM1A 1NASA 3AIOA 1A97A 4JUDX 2J6BA 4MAAA 2IYLD 1GL9B 4BLRA 1C30B 2J33A 3RQIA 3L7JA 2TMGA 2VDPB 4PQEA 2P7HA 3STXA 3BZUA 1TXGA 1APBA 3ZCUA 3NYMA 4KIFA 5KYWB 2JAXA 4YT5A 3QTBA 2R47A 3GLRA 4IV0A 2OXEA 4Z1OA 5KTOA 4Q4HB 1XNGA 2RHOA 4CNQA 2OORA 1TX4B 1XMVA 1ST6A 3FTFA 1O89A 3RAFC 3VX4A 3Q8MA 1E5XA 1CY2A 5L3QA 5AI8A 3D2BA 1X38A 1VSQA 4LQLA 4YAWA 5ALEA 2IUFA 1I7LA 5COQA 4NCJA 5COMA 1K7SN 1XN1A 4CPDA 2ILTA 3A1WA 4FQ7A 1I13A 3QNMA 5K8JB 2OO5C 3R5JA 5A0VA 3H1PA 4QOJA 2WNIA 3N76A 2XODA 4WLFA 3I4FA 3R9KA 4KPFC 2XR1A 4KX3A 2C3UA 2ZB2A 2V7GA 3N7TA 1U8FO 1W35A 2BCEA 2RGUA 1HW1A 4QXOA 4PN3A 4BB6A 3ZZ0A 2WWYA 3HFGA 1YOBA 2O2XA 4OX9Y 2QRJA 5B3KA 2B83A 256BA 3B0PA 2BOVA 3H4TA 4RKFA 1WCXA 4FMBB 4MLCA 1I0LA 3C3YA 1VOMA 2NTNA 3RB8A 4X3PA 1A8SA 4OQMA 4MKFA 1EU1A 2JI9A 4M4SA 3UR3C 1JSRA 4DBRA 3K05A 4P4TA 5D3MA 1K8YB 2H9IA 1TUEA 2JAUA 4HAIA 3JQFA 2MR6A 3ZK7A 3COJA 3K9WA 4JENA 1LGYA 2IXDA 3O8QB 3G2LA 4Y6QA 4R54A 1MO2A 2JGRA 1D0ZA 2GXQA 3UAOA 4RHTA 2ZYIA 3CINA 4JP3A 2AF4C 2IYSA 4P4NA 1VE6A 1QO7A 4PNHA 3V1NA 5EHHA 1I6WA 1MAWA 5I5EA 3QNUA 1PSZA 4JX9A 2FPIA 4RIFA 5IPFA 4Z3OA 2SCUB 5TB5A 1HFJA 1RWPA 4EFKA 4W5NA 5CXUA 4JEMA 1JI3A 4UUQA 5JI3E 3CR3C 3QKIA 2A3NA 3CO0S 4YDQA 4AZTA 4LLEA 2BP7A 1F60A 4CJXA 4CU5A 5K3AA 3MB5A 2AL7A 2QRLA 3U17A 2EP8A 4CMAA 2EP7A 1TZCA 2XZPA 2FR8A 3FFAA 2BL4A 5GV7A 3V7FA 1OSNA 4B1FA 3INYA 1UOPA 1TCVA 2CXRA 3FDXA 4YJGB 5H02A 4RK5A 3IERA 1JZSA 4YXWA 1NVXQ 4JJZA 4MTLA 1JMYA 1FA9A 3C87A 4PR9A 3M7IA 3MJEA 2JFXA 1QYDA 2VUSA 4P5DA 1WUKS 4AN4A 1II8B 5HKLA 4F6RB 5EJ4A 5HQ3A 1XNQB 4BCDA 2ZBVA 2BGGA 3A1TA 2GPJA 2GBFA 1N3IA 4HMOA 5B36A 3DO5A 5FUWA 3E8XA 4DYDA 3TOZA 1T91A 2CJXA 4R9UC 2YZGA 4CX9A 3FSGA 2V4MA 4ZVSA 1ZNQO 2FPXA 1NUTA 1YMUA 3NETA 4CM4B 5HZHA 4MI6A 1N2CB 2YBDA 2C7BA 3X1XA 3S1SA 2G04A 1MEEA 5DLQC 5DGIA 4CT0A 5IZCC 4YBRA 3C1OA 3S28A 3MGKA 4QC2A 4IKPA 5AI9A 5GGXA 1ETHA 2F9FA 4M87A 1XP5A 2O2JA 1DOHA 2VH2A 3DPIA 5AM1A 4B48A 3PITA 4ZVTA 2NU7A 4S04A 4KV9A 4A2NB 4RKEA 5ALVA 3QEMB 1ZA2A 2FGYA 2XH8A 1O2DA 3DDNA 4BV3A 3RBXA 5BN5A 5AXDA 3FX2A 1QR6A 4HFMA 4PO1A 2WMYA 3WAQA 1BDMA 3IBTA 2RJ3A 2DYSC 3QW2A 5A5GA 3I76A 3HKDB 4LK3A 4Q9IA 3UPUA 4YMIA 3KWJA 4CCWA 2O0MA 5CA0A 5LQRA 1LBQA 1Q83A 1YIOA 4UNPA 5FADA 3CSKA 2G67A 2OY0A 2YCLA 3HB5X 4JLDA 2C3PA 5F7JA 1LPBB 2RHWA 3T9AA 1C0EA 3T3IA 4CUZA 5LYJB 2XUDA 3FMGA 1W47A 4TL6A 3K15A 2Q7RA 2NZ8A 1LBEA 1YFLA 3GORA 1SKYB 3ZHSA 3KSBC 4RZXA 1UPXA 3HEBA 4V0NA 5EP4A 1B76A 4Y6GB 4GRDA 5DNCA 3VYUB 4PQFA 3C48A 4MINA 1FU8A 2ZSIA 5IDWA 5JH7B 4H3VA 1PJZA 1T13A 4DLNA 3EUAA 4GX2A 2Z04A 4TMYA 2AMLA 3IHWA 1GGQA 4HEJA 4WTOA 5GV8A 3OT5A 5J59A 3OWHA 2ZAGA 1ZUHA 2VJQA 3OM9A 2OFPA 1FFGA 2RGBA 5HFNA 3T7IA 3PPWA 2C8VA 3DZGA 4J1TC 1Z75A 4M1WA 3IRUA 4G63A 3SEAA 1HLFA 2R2AA 3OJEA 3Q7TA 3VR6A 5DKFA 5CAEA 1V16A 3OLZA 4ZRNA 1ONOA 1NSGB 3DVQX 4LZLA 1AMOA 4EJSA 4B43A 5TY0A 3OMLA 4PAWA 4CQLB 5JHHB 2RI6A 3IAS6 3ZQ6A 3EY4A 1R0LA 4X20A 3HEAA 3U3FA 2IHZA 4IJVA 3HI4A 1TQGA 3JD3A 3GJ7A 3SC2A 4V2IA 4KLNA 1CWUA 3NV9A 3LHIA 1PK7A 3D7MA 1DAFA 1GTL1 3H2BA 1CY0A 1NKTA 3DMTA 4WN9A 5A4FS 2UDPA 1CF2O 3JWHA 3PUZA 1GTG1 4HSEA 1VQ1A 2CUZA 2IT1A 2XPCA 5M34A 5CM8B 3N7UA 1FCJA 3V46A 3U9TA 3M2TA 2P9QA 4NAHA 4DIUA 5FBVB 3RRNA 5AW2A 1LI5A 4IIGA 4NMXB 1IZ7A 2RB4A 1M6EX 3GZ4A 1UADA 4D46A 2INGX 2RB5A 5IT4A 3ZVKA 2IS2A 4M1EA 2OBMA 2PT7A 2DTEA 2WTXA 5TGDA 4UEKA 4ZFNA 1PR3A 4L8YA 4C05A 1XRRA 4Z86A 2OYRA 4V3BA 3H97A 4Q3BA 4K8OA 2JH8A 3ED5A 3Q10A 3OUZA 3TB6A 1ISMA 1VJ0A 3I28A 3ORHA 3AL2A 4X0RA 1E2NA 1T9DA 3UAYA 4YMVA 2JCSA 3KXKA 4PX5A 3VAZA 4DPLA 2CVOA 4QQKA 4JA0A 4MVMA 5KNDD 4AO7A 3H05A 1PKXA 4NMHA 5DN9A 4OK3A 1JLKA 1XNRB 4IRXA 3P2KA 4P84A 3FMOB 1ZK2A 1EK0A 3OPQA 2V3VA 3OQBA 4O2LA 3E9VA 4TOIA 1NQ5A 5HJ2A 3B1WA 2PRKA 2CHQA 1CR1A 3HVRA 1Z13A 1YS1X 2F1KA 4EL5A 2HO4A 3JRMO 3VZSA 2HMYB 4ITRC 4EHLA 1DX9A 3TNFA 1OI3A 3UJAA 1I10A 5CLJA 4NXNB 2HSQA 4ND8B 5DU2A 5E3HA 3SVZA 2YRFA 3RVRA 3G89A 4C6HA 2B4AA 3IQTA 1JB1A 4IDHA 4WLVA 3FKSD 1IWOA 3DFZA 4L95C 3IMKA 1JFFA 4QHSA 3TX2A 3W4YA 2BRUC 1VI2A 3S7ZA 5L0FA 3SS8A 1QSGA 3RODA 1DJQA 2FZKA 2IOFK 1ZH4A 4JCZA 2J0XA 1F0YA 2HEIA 3UMKA 5LFAA 2PGLA 4QGSA 1W29A 2TS1A 4QT0A 3VI4B 1E8DA 2R25A 5L95A 3PCVA 1CZKA 5BSHA 2A57A 2BSXA 4JJEA 3A9WA 2CNNA 4OHKA 3U8PA 4JLBA 4QFCA 2WB4A 2FJPA 1P2UA 4YDHB 2Q9UA 2Q7DA 4TLCA 4WLUA 1DFGA 5BSTA 3C6BA 5CCDA 2XMQA 1U1IA 3C8GD 2ABWA 2VQDA 3ZWVA 1TCUA 1KC3A 4ECEA 2IPMA 3CXRA 1CJVC 3G0CA 4GQIA 2BMJA 1LJLA 5L0CA 1NFFA 2C2ZA 4JXKA 4KVFA 3ZHRA 5I9LA 1F14A 3C3MA 3ECCA 1BTOA 3G2OA 1QJCA 3NYJA 3KOWA 3DONA 3P0JA 4GPZA 4YUAA 4NK4A 4NQZA 4KMMA 5E9WA 3PFBA 3PUYA 3ZNQA 1YZYA 1OZHA 4I1IA 1MEOA 1RI3A 2HMQA 1KH1A 3LBHA 2I80A 1O4VA 2VSXA 1DBQA 2R86A 3AU9A 5T41A 1QGYA 3PTZA 1NN3A 9LDTA 1W0KD 4V3CA 5BYJA 3KUKA 4A6EA 4AO8A 5JNWA 2MSDB 2QMZA 2WA1A 2YVQA 3R40A 1PU2A 4I5IA 1RBQA 1TQ6A 1U2DA 4AS3A 4ER3A 5C51B 2M1XA 2HO5A 2H57A 1GZVA 3LVRE 4RABA 2AQHA 3L7NA 3OQJA 4B2IA 2IP2A 3D3JA 3OEHD 2Z2YA 2HM7A 2JLYA 2DQYA 2VJCA 5TLSA 2VO1A 1AO0A 4S12A 2QV7A 3H18A 3WY9A 3SQNA 1F06A 1E79A 1QRSA 5DDIP 1QVWA 5B7GA 3L79A 1WN0A 5IASA 3HVJA 5K8LA 3ZGZA 2CEAA 2ZJ5A 3T5CA 4BO2A 4LYJA 1TF7A 4MIYA 2I6GA 4NC3A 3S2FA 4UJ3A 4Q9HA 5DLYA 5DNVA 5EIAA 1BCSB 5CM2Z 2ZT6A 1S1MA 1Z2NX 1HKHA 1BE0A 1XDDA 1XKTA 3DC7A 3MJHA 3R24A 2HHAA 4EPRA 1N6PA 4KREA 1VHDA 1Z0FA 2OZLB 1DEXA 1EVYA 2EDAA 1RHJA 2ZEJA 4OJKA 4E2WA 1E7SA 2O7NA 1VG1A 2I4MA 4NE7A 2AFHB 2AUMA 2GAFA 1KI1A 2ZITA 3MLBA 4W1SA 1AVOB 3H13A 4U5QA 5DYIA 3ZUGA 1L5SA 4AKTA 2ZI5A 5JCOC 4O79A 4LZPA 5IXSA 2H7CA 5A05A 1XA0A 1J70A 2Q3FA 3KB2A 2XT0A 4IJMA 4LV8B 3SF0A 2K2WA 4NWIA 2F22A 3T1OA 2P6RA 1IBSA 3OJFA 1WY5A 2GDCA 1TR2A 4LGVA 5FEMA 1M2VB 1MD9A 4IXNA 5DNEA 5EJIA 1GQOA 2P62A 2VWGA 3O4HA 1NVGA 4LXTA 3KZOA 2HJ3A 1JAXA 1JG3A 2AOTA 4BPBA 1YDMA 1A95A 2FV8A 4NECA 4TXHA 1CP3A 2F3SA 2HSJA 4DG9A 2C31A 1EHCA 3QV1A 4G1CA 1OJLA 3W2VA 4M8SA 4AS2A 1NA5A 4HT3B 1IC6A 2DETA 1KSHA 5ICFA 4LXHA 1GZHB 2J5XA 2WMDA 4M76B 1ZJ4A 1JQEA 4N7MA 3ROMA 1V8FA 1TFKB 2NUAA 4JWKA 1ETUA 1QX3A 1GVHA 3K6KA 3RQSA 2BGJA 3LT5A 3R7FA 3T6JA 1HMPA 2A9FA 1GZUA 5DW3A 1N8KA 2ZIGA 3IAEA 4L4XA 4XYEA 1FVFA 2CL0X 1IE3A 3TIIA 2VLIA 4W5WA 3GLUA 3FOFC 5GADl 4GFDA 1YAJA 4N06A 3NVDA 3B12A 5CNIA 3L1UA 1KL7A 2HY7A 4QPZA 3L05A 3OCZA 4MVJI 1IK6A 1CJTC 1NQOA 2NUTB 2PBZA 3QY9A 1XQ1A 2Q27A 5DGXA 3VH4A 2RK4A 5JMTA 5EKSA 4ZOLA 4CQMB 3P0HA 3O10A 5JZ9A 1J39A 1CUGA 3A04A 2HGZA 3HL0A 2AQIA 1HKUA 1JEOA 2Z4SA 2PSSA 4KNYA 3F5MA 4MVSA 2I6QA 1EQAA 3LNMB 1YACA 3HH8A 2FF5A 3NJ4A 4NENB 3KWFA 3NRHA 3A27A 4RE5A 5DRYA 4ZAFA 4MRMB 4F93B 2ZI3A 3IB3A 3EG9B 4DANA 1NF9A 2W2VA 2M6LA 1E8NA 1K8RA 3EOAI 5ER9A 4WBNA 5IN4A 2D7DA 4TUYF 4C03A 4JVOA 4Y1RB 1P45A 4ZI3A 2R7NA 1J0EA 5F5HA 2DHQA 4MV6A 1R0BA 1C1DB 2Q41A 4H9GA 4QUBA 4WY5A 2O50A 4WAUA 3TI9A 1M8JA 2Q0XA 3UCEA 4ALKA 1ZN9A 4G8BA 4W9MC 4TSFD 3FMIA 3RRXA 1XQYA 4C7BA 3TRKA 4HNVA 2Y4OA 3MQ4A 4HVLA 1LX6A 3R0QA 5K2OA 4PEVA 4QECA 5FOQA 1I80A 4PPYA 2AN4A 3N8DA 4XOIA 1PUJA 2ZWIA 1XZMA 3EAGA 3UH1A 1PZHA 2OHXA 4R8LA 5ECDA 5AOVA 4ZZ2A 4R9RA 3Q88A 2JI8A 2I03A 3FPGA 2WZDA 1KAEA 4M8NE 1RZUA 2JLVA 4OYRA 1BBHA 1DRJA 2H18A 4MHSA 5MDHA 4XX1A 1Z0JA 2G3KA 3I09A 3UJDA 4ZQBA 4BNMA 3ZIDA 3REOA 1T2VA 2WYIA 3K9BA 4ZOAA 4YP6A 3P4XA 4FGSA 1I5EA 3EA0A 3TTWA 4EA7A 4N01A 4G4SP 1A04A 3F47A 1T3ZA 1ZGZA 2HF9A 3GZNB 4W82A 2WU1A 5KHAA 4TM7A 3G5LA 2R85A 1BMTA 4G1MB 4ZOCA 3ZDCA 4NC9A 4XVHA 5G0VA 4OYHA 4N6CA 5KAPA 3P0RA 5LYJF 4N9WA 5HTOA 1RWOA 3LM8A 4YRCA 2L17A 2B1JA 2LK4A 4KOEC 4RPLA 1VDZA 4NONA 1IN7A 1F2TA 4QDXA 4W63A 3CKLA 4XM2A 4E70A 3PBKA 4N03A 5A4KA 5MGBA 4RPJA 1Q12A 2G1JA 2O05A 1KBOA 1U1FA 5C52B 2D3WA 2YN4A 3V8PA 2WP0A 1WXFA 1OQAA 1SWVA 4UZEA 1QGED 4BQEA 1JU9A 1Z74A 4A2PA 2ZSUA 2VJOA 2W6IA 2FEKA 3LWBA 4HV4A 2GCEA 5F3RA 5C35A 4CMGA 3OTWA 4XJXA 3KD2A 2ZTHA 3RROA 4A0FA 4AQDA 3GAMA 5BVGB 3CJRA 1QZZA 1W76A 4LGMA 4P8RA 4PCLA 2DQSA 4WUTA 5DM0A 3VR4D 4A16A 2PL1A 1V96A 3DDUA 2XGOA 4UU1A 1HQKA 2NV6A 3AUFA 1M1NB 1IL0A 2GDJA 2HUPA 3T34A 4BZWA 4YIKA 1I2CA 1MW9X 3T5DA 1KRWA 3PJEA 3O3OB 4B6PA 1BWQA 2G5CA 4BJHB 3MRTA 3ZWXA 1DXQA 1N6IA 1J9GA 2QY9A 2ZWOA 3PEFA 4M46A 2WE8A 3VM6A 3LTEA 3QVUA 4Q3KA 5AKIA 2QMOA 5A2GA 5LXTF 3T38A 2HMUA 4M55A 4YRFA 1CK4A 1NF2A 1Q91A 4FP9A 4MYRA 5FR1A 5KNDA 3LVFO 3IQEA 4K88A 4P6IC 1FNMA 4DR7B 3BGIA 3EASA 4YN0B 2V7VA 2X77A 3U40A 4OK5A 3WLMA 1X77A 1G291 2EG9A 1Y7HA 3D3WA 4YJ2B 4Q7EA 3CYFA 4AX4A 1EE1A 1NBMD 3PENA 4A8JB 1XZIA 2KM1A 3VH2A 4A15A 1D1TA 2ZJ6A 1SUBA 4X7RA 3HPQA 2QLTA 4BKRA 1PG2A 2BMVA 1DQPA 3VGJA 1DWPA 3ZH9B 2DJ5A 4PFPA 3AEZA 5AI0A 5JAOA 5JJBA 3AOGA 3GRAA 4OP2A 1H4VB 1YJAA 4BNWA 2PZ8A 3HC7A 5B64A 4AJLA 1EA5A 2GK4A 2QVXX 1NI4A 2OK8A 2VCBA 1NF3A 4K3UA 4RCYA 2WR8A 4ZK2A 4JR2A 3AF0A 4B2LA 4PXAA 5FWDA 4DBLE 5B58C 5BVHB 3HR7A 4Q24A 4RF5A 1QP4A 3IJPA 2YW2A 1QIGA 4MS4B 3H2GA 4KZPA 5D1HA 4BZPA 2ZSBA 3C74A 4G01B 2GZ1A 2QRKA 2CFOA 3ZE2B 3ACCA 2YLIA 4JAVC 1JPNA 3WBFA 5JWHA 1T5LA 4LY6A 3QE0A 4GS5A 2H2DA 3MA0A 4PZUA 5DTMA 4DMGA 4EHIA 3JD0A 3PGA1 1F1MA 3OZTA 1Q0LA 3MPUA 1IM8A 2OQ2A 4K9OA 1R37A 4MROA 4U2DA 4W7SA 2EDCA 1QB7A 1IIRA 2C07A 4I19A 5KYXB 1VOTA 4MVJG 1VMDA 5D6NA 4A03A 4E3ZA 1I1NA 1AKNA 3ILVA 4ITVA 2PS9A 4EB8A 2V3CC 1IG0A 3H4VA 3VGPA 3UA3A 4ESOA 1OOEA 3SKXA 1U1DA 4JVMA 2BEKA 2IWRA 4ARVA 4TTJA 1NX6A 1NVEA 1F0NA 2OLJA 4DBZA 1R6VA 1A82A 2ON6A 5C8VA 3DQZA 3K1IC 2DUUA 2GYUA 3TW8A 4MKIA 4XPIB 1CYDA 3MTBA 4OQDA 5ALJA 3JWPA 1NSTA 5AD1A 1TIPA 1OYOA 2IJGX 1N6OA 3CT6A 2V5UA 2XHEA 1Q95A 1J22A 3EEFA 1LRJA 4K3VA 5L0HA 5EHNA 1NAIA 1V5GA 5BPFA 1WABA 1MRSA 1XEWY 1GFSA 1XRSB 3F7TA 1NBME 1RHKA 1VRCA 3QW4B 4JJFA 2I2BA 2JANA 4H7KA 3LY5A 1P31A 4YPVA 3IBSA 4NZZA 2HMSA 2A5GA 3JQAD 1XL0A 3PDUA 4U6QA 3U3JA 1UT8A 3ROXA 4CFYA 1IY0A 1HC7A 5FUBA 3OHPA 4ZU6X 4BBAA 3Q9LA 4CS8A 2JFQA 1YYJA 4D0NA 4BOYA 2C77A 3PWSA 4LHVA 2ZJAA 2O1EA 3TXXA 3ZE8A 2H1WA 3DB2A 1QKIA 3HWX1 5ITZB 4E2ZA 3CSDA 3OEWA 5EHZA 4UMFA 3PNLA 1R5NA 1EE2A 4RA6B 5KJFA 1DBPA 3EIXA 4K6GA 2BDEA 2IHNA 3AR9A 1EJ0A 2OHHA 1QVXA 2AFVA 4MLZA 2CBXA 4JN6B 1CY6A 1B7GO 1E92A 2HMTA 4JGIA 1YQTA 4DT1A 1QOPB 1TJ4A 1X1AA 2XA9A 3CX4A 2LW7A 4X65B 2P75A 1UF9A 5IRCD 1E7MA 2ORVA 3AVQA 3NI2A 2QRZA 1TLLA 1ZUIA 2VT3A 3PPVA 1NZDA 3SS9X 3ZWQA 5FTLA 3PLRA 1RJ9A 1G6KA 4CKEB 5TS3A 3V5YA 1DUSA 5EJ2A 2CLEB 1XGKA 1JH8A 3I1IA 1Y63A 4EQ6A 5KYUB 4YAJA 5CFQA 4ONEA 3PR1A 4LISA 3Q9SA 1KR5A 5REQA 1X7YB 2FVXA 2WAXA 1DARA 1YS2X 1SBYA 2ZYAA 1QG6A 3FDJA 2ET6A 4U0JA 1DWOA 2VUTA 3UTDA 1V3QE 2EARA 3L77A 2B0JA 1GCAA 1BE8A 2ZJZA 1N78A 4I1RA 1MQ8B 1AGRA 3CF4G 4NBKA 4XW2A 1P9OA 2B1IA 3MD9A 3LDAA 5FJJA 5CB4B 2PKWA 5EKXA 2H4JA 4YRTA 3VR2A 4WZAE 1ZM4A 4UUBA 1C14A 1U0OC 4MS3B 2QU8A 4XM1A 3WLPA 4EA6A 4CEIB 3PIIA 3TI7A 1RQXA 5IKMA 5A7FA 5G3YA 4JZYA 3UYLA 5C1IA 2PX0A 3ONNA 4OL0A 5IUKC 1P4RA 1P73A 1XWJA 1NKSA 4B3FX 4QRIA 4BEVA 4AC9A 5TMDA 1IHOA 4L22A 4ZO4A 2NPUA 3AG4C 1WMBA 3U8VA 3GG9A 4HAUA 4LG1A 1L5NA 1W4RA 5KTKA 1CUHA 2E55A 4B3DA 3MJDA 2A69F 2PZAA 4N5LA 4J3JA 4XEKA 5T4HA 4H6PA 3U2LA 5K45A 4YT4A 2G3YA 3ZI0A 4ALJA 4C9BA 5H3LA 4ZYTA 3L5KA 1YA9A 4F5YA 5G1OA 2C2YA 3SU8A 1H6GA 3JD2A 4C0XA 4NOKA 2ZXEA 1JPJA 2HCRA 4QDUA 1OI2A 3ETHA 1PT6A 2VVTA 3UOWA 4ACBA 4X1IA 1CFJA 4DMFA 1UQRA 1CIJA 1KFJB 4DJTA 1Y5NA 5KPDA 1ZGAA 3QQ5A 2BTOA 1FRQA 4X6UA 1G1MA 1MW8X 1CLUA 3DAOA 2VEOA 3EPHA 4RH0A 3D6NB 1GTJ1 4AL1A 1QO9A 2WYUA 4H3HB 3RUFA 2I22A 3ZJYA 2XCTB 1OLUA 3AUAA 3PYXA 5DF1A 1SBTA 3F6BX 1QRDA 3C3JA 4KP7A 4MIEA 5FI3A 1GPH1 3DPSA 4IQ4A 3RYHA 2WWFA 2G6TA 3QWAA 3T0FA 1R9GA 1QNLA 4GYTA 2OCGA 2R62A 2Y0EA 2XMPA 2GARA 3KLNA 3CLVA 4DZZA 3DO6A 5IKPA 4OMCA 3QBDA 3GPLA 1XD2B 1E7YA 1XQXA 3KQLA 2Z8XA 1TWHA 2BISA 1GTVA 2ZRFA 3F1KA 3IP6A 5IWCA 2JFFA 3NC4A 1OFIA 5DNDA 1JTFA 2FFHA 4HF7A 3L0SA 1PF7E 1K2WA 1VPTA 2GN8A 1QQTA 2MHCA 3KUXA 3HCCA 2K6GA 4IEFB 1VHQA 4KTVE 4QE3A 3SD7A 4NCHA 1VYKA 1C2TA 4CLXA 3VH3A 3GCWA 1QHIA 4J1QA 4CM9A 4QUKA 3IVRA 4KXLA 3MX3A 3TLXA 5BYAA 2PUEA 3L7MA 4JSYA 3MHTA 4JTDB 621PA 2EAUA 2QTRA 2ROQA 1KMNA 1F6DA 1PWXA 3U1VA 1BQEA 2BFEA 2DF8A 2I78A 2JJ1D 2QL7A 4JFAA 4TYMA 5AO9A 2F43A 1NNI1 4RZUA 5FQOA 4CTKA 3K9CA 2HRCA 2VXYA 2C9ZA 2XW6A 4GLJA 4KBYA 2QZ9A 3KXIA 1NG9A 2A1DD 1FIUA 3L7BA 5EPOA 2HRDA 2PGIA 3NIBA 3TO5A 4CG0A 1N57A 3DD7A 3M4YA 4KRYA 4R2WA 1FPQA 2VDNB 3NRJA 4ZOLF 2VATA 2JVJA 2FLVA 3TSYA 2X1VA 3OZVA 2HU8A 4UAUA 4Y2HA 4YRLA 3T35A 4CEIA 3K0EA 3HJNA 4MP8A 3L6DA 1CUVA 2OQVA 5IJ0A 4UASA 3O84A 3WWEA 3OPYA 3V55A 2WHEA 3AEUA 3CLKA 4EKWA 1QHSA 5CI9A 3UBMA 5KJ1A 4PZAA 4L3OA 2OBYA 3DZCA 3QLUA 3KRTA 5IXYA 2PUTA 3I0ZA 2F17A 2VDWA 4X20B 3R2JA 2O19A 1DG1G 2OGUA 2WG0A 2HHCA 3QW1A 3B78A 3PZBA 3B6ZA 3KB1A 4J2TA 4N0DA 4IWBA 4XD7D 3T54A 4ER6A 2BR3A 1AMNA 1K3TA 4WK6A 4EF6A 5BUQA 3BTSA 1ILWA 1YB1A 2J7PD 5C1OA 1O6BA 1H0SA 2GTHA 2XD9A 4JOCA 1YXMA 4EHBA 2JASA 5FJIA 5HIJA 2I0FA 5IN5A 4CIWA 3KELA 2ETVA 1YS9A 4ZPXA 4PRZA 3G2HA 3V8RA 1BN6A 3DE9A 1BEEA 2GZSA 4LNAA 3TZEA 5DM60 3WAGA 1HRKA 1T15A 4IW3B 4IIJF 4MB6A 2V45A 4IIXA 1CBUA 1SUFA 3DTNA 3PRYA 2WV9A 4NATA 5JZBA 3OCCA 4I4NA 1ZYRF 1E9BA 1OIXA 5D51S 2FPUA 1KFBB 1S3FA 4AJEA 2Q2OA 4Q7MB 3DJNB 5AJWA 1U28C 3IMFA 4PNEA 1PVOA 1IONA 1LKZA 1SR8A 3WIBA 1U8XX 2H11A 3H8JA 1ZVZA 5JVDA 3LHFA 3A9CA 1I3OA 2H2GA 4KFCA 3VPDA 1EZ4A 3IP5A 4F7WA 1BCSA 1C7QA 1TVKB 2H7YA 3EZ6A 3L6RA 3O0DA 2H00A 4EW6A 1UXJA 1J07A 3ZE6A 2Q2WA 3O8BA 3ITNA 3VR4H 1YR3A 2EZUA 2HCTA 3PNMA 5D87A 1RJEA 5LBUA 3AR3A 1XDBA 1JEYB 4JLWA 1ESMA 2PKQP 5JPDA 5BSUA 2E5LB 3JVUA 4OI2A 1I7DA 4XWWA 3L1HA 5IH7A 3BSWA 2VPPA 4RVHA 3X43A 4HPWA 5JV5A 3K7DA 4JJ6A 3IE0A 5E3CA 1KE2A 4YCMA 4GC5A 5LKAA 1QDEA 1JIXA 2J30A 1M57C 4CQNA 3K5HA 4JKIA 3RAPR 2NO7A 5EP2A 2YV1A 2IUTA 3PHBE 4RF4A 3S6JA 3ZLTA 4ZJYA 4RTJA 2OC9A 3TZBA 3GXOA 3VPCA 2O14A 5EPEA 4B0OA 2BDTA 2IE0A 3M2PA 2IHBA 4MRNA 5IBRA 4QYSA 5F9HA 5CGQB 1M83A 2VBCA 5HZMA 1LDNA 1PDVA 2EGUA 2H8KA 3WOHA 2RC5A 3OLYA 4CMHA 3S40A 4WBSA 5PGMA 1QB8A 1S2IA 2W22A 5B3JA 4B81A 1A5BB 3WGQA 4MGYR 1K06A 2YZKA 1X0VA 2FSPA 2RHDA 3HDTA 2KI5A 4RQBA 3S99A 5DQZA 3C8ZA 4PAMA 3VC3A 5FYQA 1PFYA 4B4DA 5KVSA 2A84A 4PHHA 2VF4X 1OW6A 4LDQA 1JZTA 2I4IA 2RSEB 2ZB4A 4JYMA 3PGVA 2PRZA 3RIXA 4YJDA 4YBZA 1T6BY 1WO8A 3AV0B 2CSUA 3LRTA 4JC5A 1N7JA 3FR8A 2NACA 2W8BB 3EF1A 3OPYI 3BRCA 4PGGA 3TEFA 2VP5A 2CFCA 2J9VA 1QIJA 3NO4A 2WOJA 1JRAA 3JALB 4X94A 4P7FA 1OCRC 2DPXA 3O1HB 3A31A 3N8KA 2VB6A 4MCJA 5KTNA 2HW8A 3H1GA 1QYWA 4PG4A 1PS9A 1U02A 2AHRA 2LBPA 1U8ZA 3K0FA 1GZ4A 2MT9A 3M4JA 3DE1X 3TIVA 3Q12A 1PL8A 1KEUA 1B42A 2PFKA 4BQOA 4B9EA 3ANSA 5DGTA 2CK3A 4U7JA 4XTCS 4ROTA 1D9ZA 3ZGOA 2P30A 4PY2A 3SBEA 3M9LA 1JOGA 1C3LA 1FTNA 1HZZC 2FG6C 4OSEA 3OQ1A 1GDDA 2OBBA 4JGBA 4PR3A 3FWZA 4Z49A 3SEZA 4R4JA 3U3BA 4EJFA 1JDTA 3FUXA 5KNDH 1MO4A 3OP4A 2FPSA 1XAHA 4V24A 3LQYA 3RSCA 1OIVA 1OFTA 4I5GA 1WWKA 1HA3A 1EAMA 4OP3A 1Q0KA 3L0BA 5KX5F 3A11A 1ISPA 1WBDA 3UZUA 3U61B 3GYGA 3OPMA 5I5GA 3A6KA 3WJAA 3Q7PA 4GH5A 4NYMQ 5ES4B 1JQDA 5KNBH 2FQXA 4B31A 3GODA 4PRKA 2JARA 2ZYWX 1TMKA 5EQJB 2D2XA 1Z2CA 2WU8A 4JMPA 4FEEA 2Q50A 5D3ZA 2PUWA 1KAGA 3FVVA 1GU7A 4I5DA 3R6LA 1XDWA 2YIJA 3NS7A 1BOFA 2YJZA 4GQHA 4IQGA 5ERXA 4P98A 2A88A 5FOTA 5THXA 3HA7A 3Q40A 3E5NA 4TTVA 5KQGA 1C3OA 2IUEA 1NTRA 4OCZA 3IQ5A 3E3OA 3EZYA 4MYTA 5T1DB 2V7EA 1V41E 1T01A 4R05A 2P11A 5AHXA 5F21A 2ZAOA 3OX1A 3P4YA 3L8JA 1IU9A 4JS0A 5DSXA 4FJ1A 1Y0BA 3K9LA 4F9EA 1VSTA 1QE5A 4B6IA 2HHLA 1YJ5A 2I3BA 1DI0A 2PM8A 1SBQA 3LBYA 2FG7C 1SKQA 5K51A 2HI0A 4A5SA 4BZQA 5KCZA 1UZAA 3JZFA 2E3JA 2I1QA 4IAQA 2ZUUA 3AERB 3C1UA 4IUYA 5DM2A 5THQA 5CJ2A 2ZUBA 2YVAA 3DYVA 4BQQA 4DV7B 3V2GA 2WKRA 1WY7A 4UUNA 3V7UA 4U00A 5B5SA 1NBOA 1NP3A 1B0AA 2F9MA 4P9FA 4MV9A 1D2EA 1EVIA 1OFVA 4LC1A 2LPMA 5DBEX 4C2AA 5JCJD 4DUYB 2NVUA 2PLRA 4PE5B 2PV7A 4JLMA 4E7SA 1EA7A 3BXHA 3RKUA 4AJ9A 5IVIA 4E0HA 1NY6A 1ISHA 3O73A 3EGXB 4ZT7A 1KE1A 1Q1QA 2XNHA 1NNEA 5IMSA 3WL3A 1IBCA 5MGNA 3E22A 3PLAE 2O2CA 5KMGB 2FEOA 5C3UA 1KVTA 3HL4A 1KQOA 1Q3KA 1RKBA 2EWVA 2IKSA 4FDAA 4CIYA 1G5ZA 1PNRA 4FFMA 5KYYB 4CTMA 2ZETA 3EZNA 1R5OA 1IFXA 2ZUDA 1V1RB 2VA8A 4G5SA 4XFKA 3JU3A 1Y1QA 1M6TA 1L6IA 3TSCA 3MWJA 3P8ZA 2IRWA 3E05A 4IBOA 3CF4A 3MNFA 5GP1A 3ZDQA 3I2IA 2AD1A 4FNAA 3VUEA 4AP6A 2YJNA 3B7PA 3DXXA 4Q7LA 4BJ5A 3W5DA 2B61A 2IEBA 1ATZA 2V74B 1FSGA 4LF7B 3NBKA 5A9TA 2E4WA 2JZCA 4Q0MA 3SJBA 3WI7A 1BZ4A 1WHTB 4WA7A 4BMDA 2Y3GA 2XA1A 4AROA 2IPOA 4Q6WA 2I91A 4UEQA 1QDLB 3PK0A 5UKDA 4NBTA 3ZKWA 1G4WR 1JP7A 4IGGA 2KC3A 3EAQA 1IBKB 5G3ZA 1ENYA 1PCXA 4PK4A 1P0IA 3WLOA 4TZ6A 5LDGA 1XZEA 2YQ4A 2JVIA 4O4HA 1SPXA 1S8NA 2J0UB 3INNA 2PGXA 3GEHA 3HJRA 4IWXA 4F3YA 3WGHA 4JTAB 1V35A 5KAMA 1DC7A 2VL7A 3M6IA 4UBIA 3G5TA 5IU6A 1V8PA 2R9RB 3IAUA 2VZLA 1I30A 4H7PA 3FMVA 4DC1A 1Y4CA 3A4LA 1WZ2A 1TJ3A 3QFCA 2PKRA 3A3OA 2E4YA 3WLFA 1GG8A 2YICA 3C6QA 1VPDA 1TZKA 5E2BA 4RHEA 4PYRA 1QNFA 2WK1A 3GP3A 5FTJA 2HYIC 1M1YE 1H05A 4DNQA 3DT8A 3F6SA 3LO5A 5DQTA 1Z0UA 3P5BA 4R1LA 2DC1A 4ETMA 2QZ4A 2C5SA 2HA3A 3OM8A 1VGVA 2IPXA 4C07A 1PD0A 3VVLA 3CUEF 4Q15A 2XOEA 3PXUA 3SGLA 1P18A 2WUWE 4EHJA 1T5SA 4NMLA 1Z4QA 2B36A 1LU9A 2GYYA 2PMFA 2QZPA 4K9MA 4L2IB 4MICA 4EZEA 5HVNA 4OHFA 3DDHA 4PSKA 1X8KA 2DI3A 4KQ2A 4WCVA 5EPUA 1ML4A 3FF1A 3SYTA 1PZXA 2GN9A 5K0TA 3QEOA 3QUCA 4M9ZA 3W5UA 4UNRA 1RBMA 1YQWA 5JLAA 3UHOA 4DAOA 4ARBA 3ZXUB 1BR2A 3V5XA 5HMLA 3IXQA 2HJMA 3P45A 2C4KA 5AW6A 4MGHA 2JFHA 1NUHA 1U0LA 1Y1LA 3KKZA 3L43A 1Y1TA 1T0PA 4ZAXA 4PLWA 1AO3A 3NMJA 2OO5A 3R0VA 1PS8A 1PQYA 2AYYA 3DFFA 3N0VA 4OJQA 2IU0A 4CN8A 1L4LA 2PX6A 1SU7A 3DEKA 4IZOA 3TW8B 3A6DA 5HS6A 3UCXA 2PSEA 2COUA 3WG7C 2P8SA 1D1BA 4Z9FA 3I1FA 2MYNA 4HADA 1GU1A 4US0R 4X8OA 2XCSB 1DX6A 1OTXA 2C7PA 1KNYA 1B93A 1KZHA 4NZMA 4QOSA 4RPGA 2JIZD 5FX2A 1LDBA 1Z73A 1F5NA 3K6JA 1IMOA 4JOSA 4RHFA 4Y2GA 1Q7RA 3FOCA 5AKKA 3NUQA 3LSYA 2BLLA 3CKYA 1AN0A 5LQDA 4GP9A 4A6XA 4TV8F 1C9DB 1Q1ZA 5G53C 2CV0A 4M7OA 4G23A 3TR5A 3I9MA 1BHO1 1KK1A 3OMXA 5H9VA 4C78A 2XF8A 3VHXA 3OEHA 5JALA 2ODPA 2CUKA 5TDHA 4ICIA 4MWZA 5TT0A 4OIQF 1LI4A 4J07A 2ATVA 1P1IA 1OZ0A 1M1UA 2GTPA 3CW8X 3N59A 1OFHA 4G67A 3U6BA 4HN4B 2FFQA 5BRNA 4TXLA 2PWAA 3DDSA 3MFQA 4Q1VA 3UHAA 2WD9A 1I0IA 1E4YA 3WRWA 4AJ1A 2MSKA 3BB4A 3MWDA 1LDMA 3UIEA 2CLDX 5HQTA 1EB8A 1N32B 2B0HA 4EBJA 1RLUA 1ORWA 4CF3A 1SC1A 4XQ1A 4IOMA 4RVCA 4E18A 2R66A 4X9XA 2OV6A 2QRGA 3D6TB 1N2HA 2A2ZA 1CDZA 2D1QA 3ENQA 2FZLA 4L8WB 3DOUA 3G88A 3H87A 2XY4A 4PZCA 1ZR2A 1VKJA 1ZGJA 1FYVA 1RI4A 3EISA 3PNQA 4GMDA 3PG5A 3PI6A 4G0HA 4P2BA 4M9CA 1M6VA 1XTRA 3TTYA 1X70A 1ZWLA 3BF7A 4GR4A 2YCBA 5IAEA 3E6AA 4OQ4A 2JLWA 1BDHA 4H27A 2Z83A 4QLOA 4INJA 2R79A 1XZJA 2YWAA 4KE9A 1KJ9A 1ENZA 2O1SA 5HF8A 5L53A 5IYZB 2PL9A 3AG2C 2D4AA 3B9QA 4DN6A 4MEJA 3H75A 3LKVA 5FPPA 1I6LA 4MUHA 4F8EA 2Y71A 4O7GA 2RGXA 4N5DA 1H6BA 2EG5A 2E37A 1ZD1A 4J7XA 2FX5A 3ZG6A 1QVVA 1L5GB 3QVMA 3FWKA 2BM1A 2PBEA 1O94A 3PC6A 5ED0A 2G77B 1ZL0A 1GUAA 4K8RB 3SFVA 2BGWA 4D45A 1QV6A 3MWFA 1NQAO 4YP5A 3KJIA 1HE1A 3WLJA 5IZ4A 1XTZA 1OC2A 3AC0A 2YXDA 3LT4A 4LK2A 1RVDA 4J3FA 1EDDA 4KXMA 2OJED 1TJYA 4HGQA 4YECA 1Q0TA 1TKCA 1MC8A 3NGMA 2B4RO 3G2MA 4MIOA 5DHQA 3R75A 1ZJ5A 4DEVA 3Q3GE 1TWCA 1ZD5A 4FB4A 2B94A 4MP3A 5A04A 1WDTA 1M1YA 4EB0A 4GKBA 1DSSG 1R5JA 3JYPA 3KYDA 3T61A 3RQFA 1LC0A 4OUDB 3SHFA 4FM9A 1QANA 4E5VA 1WKCA 4HWPA 2B2XA 2WA2A 4UZFA 3RT9A 4RE6A 2BBWA 2X8LA 1NN5A 3F0TA 1DKMA 2ETXA 3I37X 4PPQA 3ZCTA 2RKOA 4CW7A 3PEUA 3PQ6A 4FS8A 1KYXA 1T2FA 1HDGO 1CUUA 2X8JA 3W9SA 2GNPA 1JSZA 2J5RA 2ZIAA 4DJAA 3B29A 3EGDA 3OQNA 4HYTA 3RKOF 2RSLA 2B99A 3HYNA 1F2UB 5BN1A 3HFJA 4CKEA 5CA1F 3C39A 3IKTA 4FJ0A 3OFND 4DDKA 1SHKA 3BA6A 1ZN7A 4RV5A 4W8KA 3QLUC 3PC8A 5IC6A 1U2GC 2XMBA 2O07A 5P21A 3K30A 3KKBA 3UV6A 3ZV7A 4BATA 1RWQA 5HF9A 3I9V6 5AW7A 3NYLA 1BCRB 3NHLA 4ENVA 3I5XA 3AHCA 1AA9A 2Y69C 1X8JA 1K0UA 4LGCA 4OFXA 1N4AA 2QQGA 4IJJA 1B26A 1OFUA 1PJ2A 2WIKA 2X2OA 4ER5A 3O94A 1PR1A 3AR8A 2VK8A 3OU2A 4YCJA 3RS0A 1A1VA 3RSGA 3AWDA 2ZWMA 3WLEA 4FZVA 3NXSA 5BOSB 5AW0A 2IXMA 3GM1A 1AF7A 3ZR4B 1GNPA 1D4FA 1F2TB 1R3UA 2CFRA 3IJ5A 2E85A 1X7HA 4LGYA 1OHHD 3ZI4A 5T4EA 1X15A 4DPMA 3FYTA 3LOQA 4FN4A 2VCEA 4IHJF 4ZHQF 1I24A 3VJMA 2DECA 5C80A 3VR6H 4YRKA 3ER8A 3CRW1 3QENA 1R5BA 5H3HA 3FTDA 4EH1A 1HDOA 3PHCA 3Q0EA 1ZM7A 2IHVA 2ZIEA 4M9QA 2H1FA 3P0FA 3QG5A 5CCBA 2N46A 5AHKA 5K0CA 1KK2A 3K70C 2J9FA 4GQBA 5LJLA 2QUZA 1USIA 4OM8A 1BQ3A 2FLWA 4KLAA 5A4MS 3PFFA 2H7OA 1U2TA 5FHRA 4E1BA 1TMYA 2J9ZB 4MYUA 5E0KB 4AUKA 2C1ZA 3QUAA 2VDOB 4A4AA 5JDCC 4RO0A 3M1CB 4YS6A 4GX5A 3WQBA 4LV6A 1CIVA 4AX8A 4PX9A 4RJIA 4D96A 4FEGA 2NSHA 3BIFA 5FAKA 3O3MB 5A69A 1CEQA 4HDKB 4E2FA 3VNUA 1HXHA 2OZKA 2VF2A 4OQPA 1OW3B 1WX1A 4BG0A 2PZMA 4IHJA 1E96A 1L5RA 3QU7A 2BGIA 3R76A 2A78A 4B3CA 3L4BA 1P91A 2ONCA 4OO3A 5DEOA 4C0LA 1ADYA 3KOXA 1T43A 3OX4A 4XQEA 3ZVMA 1ZHZA 5EK0A 3EBLA 1PVVA 4HB0A 2A9RA 2ZROA 3O8LA 5D5PA 2HCBA 1YVEI 3D5QA 3TCKA 3RHZA 1FRVA 3L5OA 1UMDB 3A6LA 3VC7A 1DQNA 2P77A 3IAXA 2CHGA 2IV3A 2IOQA 3SCZA 4YAIA 1A3CA 4UNIA 1P2VA 2W71A 1ZBQA 2VR1A 3EIEA 3WL6A 1OXKB 2RCNA 1D2RA 2AS0A 3LDUA 3O4GA 4HJXA 3C7DB 1PR6A 1QHYA 3H7IA 1SCJA 3LQ4A 2AU5A 4WDQA 2R7XA 3MYYA 4ATNA 3IE1A 1PWYE 4CJGA 4RTKA 4F46A 3N2GB 1E2FA 3MVEA 2C2MA 2ZCJA 1AT1A 1MX9A 1XZHA 1J00A 4RK7A 2NQ8A 4ZJZA 3OZAA 1E2JA 2NLOA 5E9AA 5J43A 4CEJA 4R71A 1BDBA 5JDCA 2QN7A 3H4IA 4FN5A 4O1IA 4OLBA 2DQ4A 2R7UA 3I4CA 3ZSUA 3BKXA 3QITA 2HQSA 2A1TS 3KDSE 3UG6A 5LMUB 3JD1A 1J8QA 1JAIA 4DKJA 2C2HA 1FTGA 1KARA 4S2UA 5GY7A 4BV2A 3HS3A 4RS4A 1NN0A 3DG9A 1L6RA 3KU4A 2FWAA 4P31A 1C7FA 5JOQA 1G60A 4D4KA 5K8TA 4ERXA 5CFRA 5ITVA 1DOWA 3O4VA 2Z09A 3M1YA 3NW9A 3ORYA 5I8ZA 4E33A 3U6KA 1NXPA 1V7PC 3BMNB 3ZWBA 2HDWA 4QPCA 1PQPA 3GCDA 1Z2DA 2EZ9A 2FPPB 2RHRA 3ES9A 1RKEA 2P3LA 3ZNNA 2NU6B 2GF2A 1LK5A 3G4ZA 4JT9A 2IEIA 4YP0A 2NQ2C 4AF7A 4HNAA 4LWOA 2P90A 2PKYX 1XELA 2X76A 2XYHA 5SYAA 5T3TA 4XR4A 2ZQ5A 3IC5A 1S0UA 4QVIA 1WSDA 3ZQYA 5LIRA 2GD2A 4ZICA 4BBJA 2E4ZA 3N0WA 4MUYA 1AZWA 4Z99A 3J81A 2Q8PA 4IJUA 1L3BA 2CXNA 1Z3CA 3W79A 5L3QB 3HUDA 4DOMA 3EFEA 4A2WA 1DO8A 4XVQA 1VBKA 4M0LA 4GZLA 1F6WA 4HPJB 4TQGA 3IT1A 2N3ZA 4GF5A 3EJWA 5CNJA 5K03A 5EJMA 4QD3A 2DQKA 4QTYA 1F51E 1I14A 3WGUA 1OPRA 3ZBTA 3ZD8A 1KEVA 1VIAA 2V3WA 4LYEA 4Q1DA 6REQB 1ZLXA 2PWZA 1O77A 1LV7A 3HR8A 2A0XA 1YZTA 2FEWB 3KZMA 3FDIA 5FT9A 2HR1A 2F3TA 5FUQA 2VT6A 4OK6A 1U0TA 2MSLA 1Z6XA 3QK7A 4J0HA 5JO9A 3O90A 2BW0A 1YKFA 1U0JA 4RZIA 1SOWA 3AY0A 2JBAB 3TMYA 3K5IA 4M49A 4I50F 4U3JB 5DM4A 5ENZA 1U9YA 3QUBA 1PZEA 2D62A 2K2QB 4XEHA 1EVLA 2Z08A 2BD0A 2WE7A 3QYAA 3SR3A 4IDQA 1C3JA 5B4TA 1E2LA 2Q3CA 1VDMA 2Q6LA 5CX4A 3TQHA 4UFPA 3TR6A 1AKVA 1XEFA 4ER7A 1EQ2A 4NZNA 2I99A 4QULA 3JQ8A 1I5NA 4A8JC 2BGUA 1JT9A 4A0QA 1NNUA 4RY2A 5KU1A 1PRYA 1I51A 3IILA 3PGXA 2P2ZA 2UVQA 4RSRA 5EZYF 3TLKA 5C8ZA 2IBSA 5JQWA 4MI9A 4BEJA 2DGJA 3KMIA 2X3FA 2FJ0A 3T95A 1SOUA 4LVNA 1U7UA 1SK9A 3PIRA 2X9QA 3G85A 1M6YA 1NJFA 1QBKC 3HU2A 4N41A 4ESHA 2X0CA 5J4HA 4R5MA 2EYQA 2WTNA 3U0CA 2I4LA 5L0DA 4YV1A 2PX5A 2O9JA 3TYXA 4KQWA 1O9BA 2WZFA 1YO6A 3EWNA 1BGWA 1RW4A 3EBPA 4L85A 4YJGA 4N5HX 5K6AC 1NURA 5GIOE 4QI2A 1U04A 4HQKA 4C4OA 1LTHR 3JTMA 3FIJA 3LY8A 5AKJA 2I1VB 5BN5B 4PLFA 1R9NA 5CT6A 2AZTA 4IDOA 1OU0A 4AYWA 3COSA 3W5VA 1CGNA 1I01A 3WGKA 3GEDA 2A0BA 1DIBA 1H2BA 3GLFE 2PZLA 3JAWA 4EHAA 2VJLA 1B1CA 2P2SA 4ZC1A 1Q3TA 2UZIR 1IJBA 3L84A 3OUUA 4HLCA 4B6GA 4M38A 4CM4A 3M79A 1XRLA 5K4GA 2XOKA 1I4OA 3L8ZA 4UAVA 3B82A 1UP6A 3U3XA 5DMXA 2WHPB 3C45A 1ZQ9A 5FUYA 4DE5A 4AZWA 2P2LA 1G21A 1Z4JA 4ZJPA 2Z4RA 3RVMA 1UFRA 4X85A 2VC9A 4I1OA 2C9OA 4HXYA 4LECA 1LKXA 5I9SA 3SIXA 2PLNA 4I1OB 1NJ5A 1UJMA 5K0BA 5ALFA 4LZAA 3MTEA 4M0EA 4PTZA 1JKIA 4EFDA 2CLSA 4LXYA 2JGEA 3R7AA 3T5MA 4C4XA 4WNYA 4DCTA 4JKYA 4KC9A 2HLHA 3TTSA 4F4HA 4RVDA 4PHCA 2ATCA 3PL5A 1GYQA 1JT2A 2H4WA 3P71T 4TSFA 4ZVLA 4KGZA 2B35A 4HI0E 4G0OA 3GGJA 1L7XA 2IXOA 4YAGA 1MABB 1U7ZA 4YNBA 4D97A 3CX8A 1GV1A 1W44A 2JHFA 1O0CA 4LXQA 3ZW9A 2WVAA 1Y5MA 1NLXA 1E18A 1ZI8A 1SHTX 1PT7A 1E64A 4ISBA 3D6JA 4PHFA 1HPLA 3CLUC 4GLLA 1FQWA 3ESCA 3NDRA 4A0GA 2GEKA 2B8NA 3G13A 1ECGA 6Q21A 3SEQA 1E6UA 1RRFA 1XTQA 3A37A 3MLAA 4HYEA 3TDMA 3IUPA 3V1TC 5FCLA 2EW2A 2I2FA 2I4NA 4WN9B 3DFUA 5EVJA 3I9JA 4E4RA 1CE8B 1DUVG 5E1BA 1WB6A 3D1LA 4P58A 2A9KA 2BHNA 5FIUA 3TNJA 2I66A 2D1YA 2ID9A 2CMDA 1SK8A 5EUMA 3SZGA 4MQUA 4AFNA 2C2XA 1PYOA 3EZGA 4QM7A 4I4TF 1FFWA 1HOXA 1NY5A 4NS4A 5ARCA 4GUDA 4BJ6A 1TT5A 3MXTA 4ZANA 3WK7A 2GD6A 3LWZA 3R5HA 3WNZA 1P3Y1 1WUJS 3U2QA 3ZHCA 2ZRGA 4OI0A 2VUIB 5E1DA 3E9MA 3I6ZA 2YHAA 1G2OA 2P67A 3H0EA 1JX6A 4NTFA 1XCJA 3U13A 3VYTB 4F38A 1UM8A 3L41A 2CFSA 4QSMA 3MTQA 2DTDA 4KLZA 3WLNA 4W5QA 4D4MA 1QCCA 1KTVA 1PK9A 1P19A 4I36A 2ZJ7A 1SCUB 3DBRB 3AVXA 4DCGA 3LYLA 4XIFA 1F3OA 1EMDA 3R9IA 4TM8A 2H5JA 2P7VA 1NW7A 3BK2A 3AP2A 2NPIA 2X3YA 2A33A 3IA7A 1K6EA 1FLDA 2ODBA 3EGWA 2BPOA 2WJ3A 4IDAA 2R6AA 3LL4A 4MZDA 2ZS7A 2CLLB 4UOEA 3M82A 4D3SA 2YZNA 3HYSA 1M2OA 2QUIA 4I5FA 5AXAA 2KQ9A 2R00C 3I9OA 3PIDA 1IUPA 3MBOA 1V9CA 1OR3A 1DINA 2XTJA 3FFTA 1MO3A 1Q74A 1ZP6A 3F7NA 3G6KA 4MKXA 4D9EA 1SULA 4FX5A 1RWVA 5FLYA 3A3NA 1IB0A 1ZBDA 3O7WA 4IH1A 4R40A 4L51A 4R51A 4NNPA 3NBXX 4OSPA 2A5DA 3KZNA 3HZHA 5HK8A 1JDBB 2R6ZA 2QR2A 5LZ4A 5LB2A 2IXNA 3NTXA 3PUIA 4LRSB 4HUJA 2FEXA 1YCHA 4V0OA 2RIPA 4FHDA 5CX1B 2QX6A 1WNFA 1A9SA 2AQ8A 2JH9A 3HFRA 4MV8A 4UDXX 4PBTA 2O3SA 3S9OA 2WWTA 4ZVVA 4EG0A 1W8IA 2W2NA 4I4TA 3VDNB 3OF2A 4CKWB 3UY4A 2CB9A 2FW9A 4TUYA 1GXSA 3KR2A 1JHYA 4BX2A 1Y9EA 5KQSA 2Q99A 5LPNA 2Z5VA 2B30A 2C54A 5BR7A 1FYFA 1YFJA 1G20B 1NDHA 3Q3JB 3ANLA 3OAAA 5LBTA 1AB5A 3Q5DA 4X91A 4IDEA 1RHMA 3DL4A 3B70A 5HILA 2NU8B 4EUFA 5ADVA 2BE5F 1B14A 2KLHA 4B7XA 4OQLA 4J7TA 4FHFA 1RTKA 4PVCA 5AYVA 2XLOA 2WJIA 1QS0A 4PGAA 1PV1A 3JYLA 2O7SA 3UKOA 1YARO 2Q46A 4U6SA 5HA5A 1XKQA 3KQNA 1VB5A 2JAWA 2F6RA 3QU9A 2I6FA 1T4BA 3K4PA 5GJVC 3IKLA 2G9NA 5A6JA 5H81A 3PWTA 3NT2A 4TKMA 2PU5A 1QCYA 1WF6A 4MR7A 2VSOA 2CZGA 2IXAA 3BIXA 2VHTA 2Q1YA 2WJWA 3EC2A 4J1SA 3EDMA 3C3EA 3QX7A 4II2A 3RYTC 1BH6A 4L2IA 3TEJA 5GVSA 5JXJA 2WB7A 5BMVB 1Z15A 2XQKA 1RABA 4HFJA 4A2QA 2ZS9A 3EJ6A 2FFBA 4RFVA 4ZCIA 4C30A 5HYVA 5JEEA 2X13A 1CRLA 3KIPA 5HNKA 2WHXA 1FK8A 1WP9A 3BL8A 4DRIB 3BEHA 1AF4A 1U7HA 1X1TA 5JCOA 4DCJA 3V4LA 3GJ4A 5LP6B 2OXIA 5K99A 5ALMA 3EOBI 3H9CA 4D3FA 3FKJA 4GL4A 5DWVA 4Q05A 1ZCFA 3DBOB 3VISA 1GIAA 4YACA 4YDRA 2JKYA 2PK3A 5ALWA 4ZREA 4PYLA 1MNAA 1FDWA 4GQAA 4A27A 5CAEB 1ORHA 4O4JA 4HB4A 4D98A 1WOYA 1VCOA 4YGYA 2XS8A 3AKCA 3V9PA 1G5PA 3HHPA 2OQMA 1WBBA 3TOMA 1TW2A 4DC0A 4KZKA 3ELDA 3F6PA 3PXBA 2AN3A 3F4KA 2QRPA 2AXEA 4Y1FA 3UMJA 3CGGA 1NQWA 2JFYA 4DNXA 1DVRA 2X2FA 3DZFA 1VLMA 4ZQEA 1JAFA 1YZVA 1Z6QA 3OKCA 3OWOA 1JG1A 4B3MB 1FUIA 2I8AA 1FNDA 2QTMA 1GPAA 1ZNZA 5JE8A 1NVVQ 1VJRA 4JLUA 4WCDA 3FIUA 4BX8A 4EVIA 3MOGA 2YYAA 1X1RA 1K97A 1YB2A 4C20A 3ZLBA 4WV3A 1O9GA 1KI3A 3GRPA 5KB3A 3BL5A 4RV9A 2RK6A 3OCUA 4D92A 3WODF 2ASRA 2Y1OA 3M5CA 3B1XA 1F1JA 4TWAA 2WJVA 4GSYA 3I0MA 4F56A 3NIGB 3LNTA 5JXGA 5JTTA 1RAAA 4B8YA 4N39A 3VZBA 2R7TA 1HRDA 4F3CA 4LJ8A 1DQSA 4UUMA 2HJVA 2PZKA 1KKLA 3C1TA 3E61A 1F17A 5H80A 3NYIA 1SZJG 2HTEA 1QE0A 2VF7A 3KPVA 4FOPA 3D02A 4FYPA 2H1VA 2PXAA 4QOIA 2Y0DA 4HRYA 4C7XA 4NZPA 5AESA 4RLHA 4UJ5A 5DYGA 1FUYB 2Z95A 4PFQA 1RJGA 3C8GA 5ECWA 2I9KA 1SHLA 3HDQA 2Q0HA 5CB4F 1J49A 4D25A 4BE9A 3C70A 3I73A 1YB5A 3G8DA 3GT3A 4TZTA 1XPUA 2NYAA 821PA 4BPRA 3ML1A 1QF7A 2BEUA 2VPZA 3H16A 4G0NA 4J0QA 2B20A 5AKLA 1TYCA 2FZGA 3U7RA 3DP7A 4TS4A 2B4TO 1SZIA 1MGOA 1YR2A 4KRGA 2R751 2RKBA 3C14C 4I1PA 1TB4A 1UZUA 1HTTA 1L9XA 1EVQA 3W6OA 3ENKA 5HXAA 3MMXA 3ISTA 1UBGA 5FPKA 3R5XA 4QICA 1OBVA 2OVBA 1QV7A 1XXHE 3A4YA 2MINA 1FMLA 3Q3CA 2PRJA 3STYA 4MAMA 3RVLA 4KKVA 3HUEA 3ZC3A 1XYVA 3P9NA 4Q39A 1WA5A 3I72A 1CULC 1TECE 1I7QB 4EYSA 1ZINA 4RJKA 1PLKA 1Y98A 3DJUB 4JLKA 2UYQA 3STWA 2DPYA 1YT5A 1TVMA 1H69A 3OZCA 5F7ZA 4CCSA 4HNUA 5JPIA 1DZ3A 3RH3A 2AG8A 2YFKA 3EMVA 4LEIA 1EFVB 1V1MA 3QP9A 3EVDA 1EVEA 1YE3A 2GPBA 2PXHA 2ZVJA 4GWGA 3JQFC 3R9XB 4NQFA 1EJ6A 4URHA 5B3SC 4C1NA 4TS9A 1P2DA 1KI9A 2WUFA 1TEHA 4HL6A 4KGXA 4OGKA 2BLNA 2IY7A 2P1AA 3P0EA 3UWPA 3ZHYA 1UAYA 3DUWA 2YWHA 2BEWB 3PU6A 3CKMA 3KYCB 1UPBA 2HJWA 2K4MA 1VKNA 2PH5A 3MYRA 5JRJA 4IDBA 5KYKA 1CSEE 1EUYA 1K5PA 1SELA 3GT0A 1A9ZA 3HY4A 1GRCA 4JK3A 3SFZA 4P4LA 2OBLA 1OMOA 3QIVA 4GM1A 4PSCA 1NSYA 4NPAA 1TE2A 1Y5IA 3KG2A 3F9RA 3LRXA 4IRMA 2OPBA 3LW8A 4G24A 3W4IA 2X1LA 2XDQA 5CPFA 3R74A 2DUNA 3ITEA 3U4HA 3W7AA 1BA3A 2ZJ8A 3R7LA 1EGMB 3GHYA 4WOKA 2P40A 3ADKA 2NTEA 3PCXA 4KKXB 1DEOA 2OXTA 4BGDA 3HKCA 1V8OA 3HCWA 1G9XA 2FE4A 3P2IA 3SBDA 2DBQA 1ESDA 5HKKD 1YI8A 1YFZA 2QTNA 4RWZA 2ZR0A 3A6EA 4PC1A 5CBKA 2QM8A 1H3EA 4M86A 3GWLA 2H5IA 1L7QA 4DWWA 2GCOA 3LUPA 1PYDA 1OGIA 2DP4E 4P34A 5CVEA 2VCAA 1AK1A 1IXZA 3T41A 3FYUA 4HEAJ 1ZOPA 1JXOA 3M5DA 1I7SB 3FWPA 1QTNA 2ZRDA 2IDZA 3ZLVA 3OHMA 1T3HA 5FO1A 3LMKA 1Z4IA 1WULS 2XXAB 1XZDA 2QX7A 3AVOA 3E7WA 3HSYA 3MXOA 5BV8A 4BNZA 1SJ9A 2NSYA 2OO7A 2WTBA 3O1IC 3OEOA 5F2KA 5SZJA 1SA0A 2NOAA 3ODGA 4WFJA 4JYZA 4J8PA 2PIDA 1Q0PA 2XADA 1VECA 3NEYA 3EZIA 4HFKB 1ZM9A 2W58A 4K46A 3AB8A 5KTSA 1NMSA 2VRCA 1NP6A 1V5EA 2OCBA 3HZOA 4U9DA 1GYPA 5JSZA 2HGSA 5AKXA 3V4PB 4G5OA 2UZ1B 4PNZA 3CU5A 2OILA 3RVSA 4ASUA 4DREA 5JUWA 9MHTA 4TKUB 3DLBA 3U9JA 1KOJA 5AVOA 1MBZA 4MUXA 5FNZA 4TKUA 1P9LA 2IU6A 2FR1A 3PWZA 4YUWA 4FHZA 2YL2A 3IPCA 3PI7A 3ASVA 1R15A 1XBTA 2L0XA 3A4MA 5ED4A 4WWHA 1SU4A 4TQUS 3ZDZB 1HWYA 3RM3A 2EYUA 2RDMA 3DOCA 5KWIA 4QPJC 2GN6A 4RY8A 1EQ1A 3M0EA 1WMEA 5ICEA 1P44A 1M66A 1LJ8A 3JR7A 3LJBA 3H2ZA 1QMPA 3KVOA 2ZSAA 3UAGA 5DS6A 2FEPA 2HKVA 1LPSA 1P81A 3HVIA 1YONA 4HDOB 1NRXA 1BDJB 2P5SA 3KT0A 1D03A 3EARA 2VNAA 1U6KA 3FI9A 4P3XA 3WA7A 4B8ZA 4JI2B 2P4QA 3P1JA 2BEVB 2EKZA 3U4GA 2FU5C 3T4XA 3I92A 3GRRA 4LOAA 1WASA 4DRHB 2BJVA 2V8OA 2VPYA 5KYUA 5IDXA 4JW1A 1E20A 1SCKA 4MR9A 1XWFA 1IOLA 3RVQA 2XDYA 4FYKA 3TLAA 3WTCA 4BZXA 3ZXIA 3SOZA 4HVAA 4EUKB 1PQUA 1T6UA 2JPUA 1J8FA 1GPBA 1M2NA 2NXWA 3EGEA 2E5FA 3V6LA 2RHMA 1Q0DA 5L8VA 3FNFA 2GKSA 3SXMA 2KBEA 2QUBA 4EBKA 3KD3A 1PX2A 1N25A 4U5EE 2I29A 3GQBA 5BUOA 1UP7A 3NOQA 4TMWA 1T9BA 1WR8A 1DAHA 1DUIA 1X7ZB 2DCUA 3DEIA 3JVIA 4MS3A 4RMNA 4EX6A 2V9ZA 1R4NB 3QPDA 4C3EA 1O3YA 4JDUA 5ICGA 4QGFA 4YRRA 4HNAB 2LTAA 3AHEA 3D0OA 4UNQA 1D0VA 4NMMA 3WX0A 3W8HA 1OIWA 4RAOA 3IMCA 1TKNA 1E84A 1SVMA 3LOPA 4IXTA 4X6LA 1NVAA 3D2LA 4N12A 5DCLA 3T9CA 5IYZA 1HOTA 2XQJA 3E7XA 2RH8A 1UZMA 5ESRA 2FZCA 2IHTA 3GV0A 3EA4A 5EGNA 4DYHA 4PZLA 1XMPA 4BVJA 4FDUA 5HOEA 1X19A 4J03A 3VR6D 1A27A 1LJUA 2COEA 4JE9A 2G28A 1WBJB 1XNJA 1P4JA 1XJ0A 1U1GA 2OECA 1GRVA 4OPMA 1RHUA 2OR3A 2C61A 4QBKA 1EDEA 2PBFA 3RAJA 3V4FA 4F86A 1YE5A 3VU1A 3V7OA 3SI7A 4GVLA 4IJQA 1SA0B 2DFNA 3EMDA 3L8MA 4DQVA 1MORA 1F4PA 1S3SA 3CRVA 4KBLA 2FEMA 1BU5A 1QYXA 1Z6YA 3BZWA 3LQFA 4MJXA 1RC1A 1GU0A 3KHTA 5G4KB 1GTRA 3M4NA 2AWOA 2VKTA 1PL7A 1HNNA 3H4MA 3LS0A 5JPCA 5HF5A 1V26A 4Y2JA 3UK1A 3H5AA 4MRAA 2WYHA 1PJQA 4QDTA 3HA5A 2VBFA 3RVZA 3IOMA 3PXAA 1AUPA 2GEBA 2YYZA 4KX5A 2XTAA 4PO8A 4BVKA 4GOKA 5KU7A 5JR3A 3O2NA 3HBAA 3HVKA 4RC9A 5EWJA 3KQOA 4BFVA 3ZU2A 5I9TA 1LLUA 5DYWA 3U48A 1FS5A 2BFNA 4CT4B 1YRHA 2UV8A 3H9EO 4FBGA 4KR9A 4PRYA 1KRXA 3HN7A 1TL7C 4NPHA 1KZ9A 1W96A 4OX9B 4Q4AA 1G8HA 4KXNA 3RRZA 5L3SB 3BILA 2PZEA 2BKXA 1RAIA 5DWQA 1OCOC 1GA4A 5AK0A 4KNVA 3NMUF 4A8HA 3L8DA 3KYBA 1CVIA 4W5RA 1HT3A 1PLJA 1WW3A 1KRHA 2GD1O 4XXHA 4HHEA 3WRXA 2C99A 3ZYZA 4J43A 5BT9A 4UEOA 1IHXA 4QU8A 2XOKD 3P9KA 1M1XB 2Q3HA 5DGCA 4QUDA 3LLIA 1E6EA 1ORVA 3QYJA 2PJZA 4RVNA 3OLXA 3ABLC 2H65A 4WOCA 3LIIA 2L69A 1RI5A 3HO8A 1YRWA 2X5NA 3KJQA 5TQ2A 3ESYA 4O4HF 4O29A 5ITSA 5TQ2B 1PNVA 1TYBE 5BW6B 4UFOA 1EI9A 1FUKA 4F71A 5GM1A 4YVFA 5CGZA 1DJLA 2ADMA 3MSXA 3B0VC 4WLOA 3STHA 4D8XA 1O4WA 2OM2A 2CCYA 4U63A 2IEDA 2XWJI 4EL0A 4W99A 1NC1A 2JAQA 2ORED 2CLCX 4AKSA 3WDMA 4CF7A 1QTQA 3SC4A 4B3BA 3WZMA 5KNCD 2AOUA 1XL1A 1XXHB 4ZEOA 1CPQA 2VTEA 1NM5A 1U31A 1A98A 5L0GA 2C9YA 3IOCA 4GPEA 1EI7A 2CD9A 4N8SA 5IAAA 1NBIA 1N5RA 2DFTA 1QGOA 2YOFA 1Z7EA 1GQSA 1X8XA 5CFOA 4MHTA 4JTCB 1NRWA 4OEHA 3JQPA 3HFSA 1A4RA 2EF1A 5C8XA 1ST3A 2JKVA 2F1RA 3U1TA 2HV9A 4FGWA 2VPXA 5TNXA 4QXMA 3DZ8A 2V6BA 4JQCA 1V7QA 1FP7A 3EZ2A 4PHTA 1HDCA 3O4FA 5NLLA 1XLWA 4UUOA 3AL0C 2GAJA 5JADA 2VXOA 1RC8A 3D8SA 2PKEA 1ND6A 3U39A 3HXQA 3ZJ4A 2C1XA 1M2OB 4L0QA 1O1YA 1IN5A 2XNJA 1NAHA 3B48A 3DXFA 5LYJA 3KBBA 1ECFA 3RYHB 3VU9A 2HV8A 1E3LA 5CYGA 1ANKA 3H2IA 3UWDA 3KFXA 1WWPA 4XX0A 3OWXA 1G55A 4CQJA 3C1AA 3KZKA 4JT8A 1H66A 4XX0B 3ZPXA 1XHEA 3ZV4A 2QVZX 4CLDA 3FAPB 4HLQB 4MV3A 1CZHA 5HSWA 1IPFA 3T6KA 4RELA 4KGDA 1PSDA 1MVNA 2YVUA 5HV9A 5A1JA 1Z5OA 4GXQA 4PIPA 4ZQHA 2ONJA 7MDHA 5ESWA 3N2GA 3MWYW 5SY4A 1C7RA 2EC5A 3ZV3A 5J2UB 2IYAA 3VV3A 3H9GA 3KKMA 4D9IA 1OWLA 1U8CB 2I2XB 4CIDA 2HPVA 2A3RA 3DUFB 1ZSNA 4G4SO 2X14A 1OVMA 1TCAA 4Q1BA 4Y2UA 3WIVA 5A3JA 3EIQA 1G21E 2J0EA 2EBWA 3BTUA 4WZAA 5EKUA 4KYVA 5ICMA 2JAOA 1JFTA 1DBWA 1JDZA 2FB9A 1JG4A 2H1LA 4KW7A 4D9GA 4E2XA 1G19A 3FOBA 1P0PA 4WECA 4KO8A 2HRRA 2NN3C 2ID4A 4RHYA 1E2UA 1DCMA 2PV0A 2H17A 3M4XA 3JRNA 4KSYA 1EH5A 4HZUA 2IW1A 1ZGHA 4DDVA 2W6CX 3V8BA 1R6DA 3ONEA 3IIIA 2P9JA 4YH1A 1Y6QA 3HY6A 5TX7A 2EQAA 3NFRA 2XUZA 1R64A 1DC4A 4C5BA 5EXSA 4ND1A 4CKBB 2QRUA 5IHPA 3VTFA 1RFLA 1AHHA 2VBIA 3PJFA 3L0IA 4DARA 3FOPA 1PR2A 2VSNA 2W98A 1CJMA 3AEUB 5E6UB 3HNOA 5F35A 4ERNA 2X1HA 4B3IA 1SPBS 1EFUA 1IPEA 2V6IA 3CIOA 4I9HA 4QEDA 4U7DA 1SC6A 4MDFA 1U6JA 1DIRA 3MAAC 3NVMB 1B74A 3LUJA 3OPNA 1O9HA 4EFMA 2IBFA 2DWUA 4KUHA 4WADA 3S44A 4AYXA 2Y2UA 4Y9TA 1TYDE 1DQZA 3O26A 1JYEA 4XA8A 2W2LD 2J31A 2FAPB 1E4EB 5LP6F