2RSEB

Nmr structure of fkbp12-mtor frb domain-rapamycin complex structure determined based on pcs
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
b'VAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
molecule tags Isomerase/transferase
source organism Homo sapiens
publication title Convenient method for resolving degeneracies due to symmetry of the magnetic susceptibility tensor and its application to pseudo contact shift-based protein-protein complex structure determination.
pubmed doi rcsb
total genus 35
structure length 94
sequence length 94
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 2rseB00
4DRIB 3FAPB 1NSGB 4DRHB 1AUEA 1FAPB 2GAQA 4FAPB 4DRJB 5GPGB 2NPUA 2RSEB 2FAPB
chains in the Genus database with same CATH superfamily
1LIHA 3IQ5A 4CSAC 4IWBA 1PD0A 2VASA 4OD5A 1MNDA 2VCAA 4E7ZA 3QTHA 2PNOA 1BDJB 2Q3TA 3N24A 2ZXRA 1ZHYA 2PP4A 3KKBA 4NCQA 2X0CA 2HSQA 2J9WA 3SNHA 1T6UA 3AOUA 2HV7A 4ONSA 5FZTA 2KQ9A 4Q4ZF 3O39A 3B29A 1Q0KA 4EKWA 1L7CA 1E2XA 3K1IC 1BZ4A 2IXMA 2J7PA 3M79A 2V26A 1NG1A 4AK9A 4E18A 1IW7F 3U9JA 4G7ZF 3B9QA 3U5SA 1XWJA 3LAYA 1CGME 1APCA 3ZQYA 3NDBB 2P1AA 3DM5A 2YQYA 3LEVA 5BQIA 1AUEA 1SF8A 4BJ6A 4NTFA 2L6GA 4C3DA 1HW1A 4MVSA 1XZPA 2G3VA 2MHRA 2GA0A 3ATPA 4N6CA 3T4RA 4A2NB 5HSWA 1ZHWA 2V3CC 2G62A 3E9VA 2XXAB 3C8ZA 3ABKC 2IOQA 3FDQA 4DRHB 2PX3A 2OU6A 3JRTA 2PF4E 1VMAA 4N4WA 5T1DB 2VC9A 3FHDA 4IRUA 1JPNA 3A9CA 3DJUB 5JRAA 2HJMA 4U5FE 3ZDLA 4EBJA 1H7IA 1LPEA 3JT1A 4PK4A 1TWGA 2JX0A 5DLJA 4C7OB 2EINC 1TWHA 2EIJC 3HLZA 2AWCA 3QMKA 3T9OA 2FGYA 4JKVA 1Q0MA 2P6VA 4FESA 3ZWIA 3DD7A 3KH2A 1K04A 4EHPA 1WN0A 5B3SC 5L0HA 3PHF2 4ZLDA 5COFA 4BG0A 3R2PA 3CAXA 2UUHA 4WGYA 4C3EA 2OJED 4FX5A 4OIRF 2QE9A 3GORA 1VB5A 1ZHZA 1WOLA 4YL0A 4WGZA 1WGWA 5CIVA 4ANJA 3ZSUA 3GWNA 4CDVA 4MS2A 2ASRA 3ABLC 1ORYA 1SR2A 4BJ1A 4HFKB 3CSKA 3ITFA 5L0JA 3O6XA 1MMNA 3K1IA 2DGJA 3IQTA 5DS4A 2A6HF 3LNRA 3LS0A 1YAUO 2XLDA 3HNJA 3C18A 5A6BD 3UMKA 3FAJA 3DI5A 3G50A 2HFIA 1JAFA 2R7XA 3CQZA 1SYQA 5BQHA 1OCRC 4W8KA 5F5FA 3BRJA 1YVIA 2D5RB 1PCXA 2ZXPA 2W4MA 5DS5A 3FAPB 2EILC 2HZ8A 3O55A 3NMJA 1UG7A 1RKEB 3EZHA 1JOGA 4MVZA 1RMVA 4YK5A 1QQ3A 2FAPB 1HE1A 3FOOA 3WAQA 2DYRC 4E17A 3T6BA 4EWCA 1OW7A 2J0XA 3US6A 1ZHTA 3V5YA 4E0IA 2WVOA 1A7VA 4YL3A 2NUTA 1HMDA 1LE4A 3SXYA 3JSZA 5AC5A 3J06A 3MLGA 1I4YA 2BE5F 2YLGA 2ETSA 3FXHA 4Z9IA 5DS6A 3C7JA 5T3TA 4U5DE 2L7AA 2NUPA 2VCBA 1Z3IX 1E84A 1QLEC 2W45A 2Y3HA 2J7PD 3M15A 2WZFA 3Q7GA 2BL2A 3RQFA 1R5ID 2Q4FA 5COMA 5JUAA 2A0UA 3NYLA 1YLMA 5KYYB 2Y69C 3ZTZA 5D91A 1DOVA 3B71A 1ZW2A 2CNWA 3ZQVA 2OKUA 1S7ZA 3B0PA 4JTCB 3TULA 4EUKB 3RKOF 3OEOA 1NSGB 1G8XA 4JCHA 5L0FA 2HKVA 3EFOA 3V5XA 4DRJB 4E7SA 3IHUA 2EPOA 3VAYA 2R02A 4PFOA 2NUPB 3FMSA 3GEEA 1EA8A 1D1CA 3AG1C 4I44A 4JE9A 2G3KA 5F28E 2J9VA 2PBEA 4MVOA 5IY5C 4JZAA 4IJJA 1YJGA 2Z15A 1CGOA 1G4WR 1M2VA 3C62A 3EJNA 2NPUA 4KBLA 1TWCA 3AJMA 2EPKX 3RQEA 2R25A 2VB6A 2ZPAA 4IAQA 4R32A 3V5ZA 2Q7RA 4JVSA 3QVYA 2A69F 2OEVA 2Q00A 1GM5A 3Q6MA 3JYHA 3X2QC 4MW8A 2EPNA 1QZXA 3KPHA 2YRFA 1YARO 4P6IC 2NSGA 5JVEA 3AG2C 3GM1A 2OEXA 2PX0A 4LLCA 3FOPA 2AU5A 3DXJF 5A69A 3MBGA 4JURI 3JCUQ 2WL8A 4I1OB 3L34A 1ST6A 3AQBA 1QVXA 2CYDA 3ZTMA 4O7GA 4MVRA 5JSLA 3ASOC 3M4BA 3EH2A 4DXWA 3NYMA 4MNDA 1FFHA 3ECSA 3EFOB 3ZC4A 4DJ9A 4NQFA 1T6IA 3H2UA 1G5ZA 3I5PA 3Q7LA 2NUTB 3K66A 2DYSC 3W8IA 1Y4CA 2WZLA 1O5HA 4XPWA 1M2VB 2YL7A 3SEOA 3VM6A 4BJ5A 3X1OA 2ZXOA 4ULWA 1OXKA 3DE8A 3K7DA 2QTVA 3RIPA 4CJGA 4G7HF 1V55C 2JPUA 2XS1A 4GQHA 1O3UA 3SXMA 1I5NA 2VH3A 1QPUA 3LNMB 2J8WA 1FTSA 4QI0A 2LCHA 1QSPA 1NZEA 1Q0FA 2E87A 3F46A 1QKRA 3U2LA 1LS1A 2X51A 3CZ6A 4GYTA 4O6YA 2F22A 4G7OF 4UDVA 4JW1A 2IXNA 3SXKA 5BUOA 5L0CA 3UGPA 4XPXA 5JLIA 2HSBA 4YWQA 1D0ZA 1J8YF 3U8VA 4F4BA 2H7OA 1R4TA 2Q9CA 1KNYA 4ZLCA 3L1MA 3KL4A 1VYIA 3ABMC 1E85A 2J45A 1EI7A 1A7EA 2KSFA 3GWLA 4LDRA 1IZMA 1D0YA 4KC9A 3O10A 2Q9AA 2XRHA 4AX2A 4H4KC 3U0CA 4QI2A 2CDQA 4BPMA 1VTMP 1DOWA 3SP1A 3EGDA 3JZ0A 3LLKA 3K33A 5AC4A 5JT4A 1BR4A 1CPRA 4DVZA 4OIQF 2R05A 4LACB 2R7RA 2LSEA 4Q5SF 4IB4A 1LI7A 4CBEA 3NRHA 3IQ6A 1A7DA 1NFOA 1J8MF 4YT4A 2MWQA 1TWAA 2KJGA 3EGXB 3ZG1A 3RH3A 2NSFA 1ORJA 2XLWA 1RJ9B 4N6HA 4CIPA 1MMGA 5L0DA 2J46A 4KI2A 1T5OA 5DQZA 3JSEO 3LESA 1BR2A 3W4YA 4MW3A 4C3BA 4OINF 2YL3A 1U89A 2FFHA 2H8AA 3HTKC 1RKEA 2J9BA 1WTYA 1FMVA 2M64A 4I1MA 1NFNA 3EG9A 4NC3A 3LEOA 1WASA 3JRMO 4O6MA 4KNVA 3H2VA 3JYYA 4IARA 2R7WA 4ULVA 1TFOB 3LLIA 3VF0A 5A6BA 3MX3A 1C17M 3EZIA 1OKKA 2LQGA 3I5QA 4CJOA 4LDQA 3PMRA 2OJQA 3U3FA 4GEHA 3B0VC 3I4UA 2YL0A 5KYXB 1JMWA 4E0HA 1LI5A 5AGFA 1Q0GA 2P7VA 3EGDB 3AG3C 3WHNA 3LJBA 3UGOA 2A68F 2GDCA 1FFTC 1OQCA 2LP4A 2AP3A 1AEPA 2KW3C 2WB7A 3C8GB 4MTGA 2IXPA 2KK1A 2VCCA 3ASNC 4Z9HA 4BJTA 4CS9C 1B68A 1I4ZA 3EGXA 4OIOF 4U5GA 3TOLA 3M4CA 2LIGA 1VOMA 1ZVZA 1LM3B 2HV6A 2TMVP 3DE9A 2BC5A 2MYSA 3N2ZB 4U9DA 4B6IA 4MVMA 2A0BA 2XLEA 5FCLA 2Y3DA 1FR0A 4WJ0A 1LE2A 3G4ZA 1AVOB 3T6GB 2XM0A 2CW0F 2HUJA 3K1HA 3VYWA 3NKEA 2XLOA 1JRAA 1RCPA 3NMIA 4HE8D 4LDKA 1NLXA 4YT8A 2ZXWC 4IGGA 1NBBA 1HMOA 3RQGA 2IYLD 5A6JA 3C8GA 5L0IA 5KYNA 4C7OA 1ORSC 2OG2A 2W9YA 5KYWB 1A0BA 2IBFA 2L6FA 4JC7A 3RVYA 1ZW3A 4BJ5C 2GWWA 2EIKC 4PJMA 3TK0A 3MYFA 3W2VA 2WZGA 4CS7A 3H65A 2LFFA 1V4AA 5F5HA 3DMDA 3EPVA 3FVYA 1RKCA 4PFPA 1JR8A 5B1AC 1VYKA 4AE4B 1GGQA 1S05A 2LK4A 3F47A 3WG7C 5K0IA 3SYNA 5COGA 1SZIA 4XQ1A 2RSEB 2R7TA 2EPMX 3GM2A 2B0JA 3E70C 4JJGA 3TD7A 2QUPA 2XL6A 4CIHA 1E86A 4BEJA 4O6NA 256BA 3W8HA 5KYUA 4L6RA 4BJ6C 3NYJA 2J0WA 1Z63A 3RF3A 2WVQA 1D1BA 1YYXA 4MTFA 4LERA 2JD3A 2HJ3A 3L8IA 2DI3A 2R7VA 2OCCC 3RVZA 3RYLA 2AVKA 4XLNF 4CDYA 1Z23A 3ZIBA 1VLTA 1M2OA 3GEIA 4U5HA 3RFYA 2B0HA 2KNHA 3TJ6A 5KYXA 1OW8A 2YHSA 2R03A 1K05A 1OR2A 1SMYF 4FWVA 1W2WA 3GANA 3S9OA 2QY9A 4OD4A 2I15A 4M63A 1H6GA 2XM4A 1F1MA 1HW2A 5HV9A 1OXBA 3UMHA 2YLIA 4J30B 5L3QA 4G78A 1HE9A 1NU7D 3A11A 4W8PA 4XWJA 3UMIA 2M4EA 4BEMJ 4JEBA 1YA9A 5DVWA 5E3CA 4QDLA 5EHHA 4H54A 1EQ1A 2KGOA 1VLSA 3TJ5A 4HFFB 4RBNA 5JS5A 4U9EA 4YJWA 1O87A 1C03A 4NTBA 3L8JA 3IEEA 3QVZA 3SZRA 4CS8C 2P61A 2R7SA 1TKNA 3G4XA 4EBKA 2O9XA 3CEXA 4NY3A 1M57C 1NU9C 5KYUB 1CPQA 4G0HA 2XXAA 3AG4C 5E33A 2XLHA 4YT2A 1VK5A 1CGNA 5JP7A 4J7YA 1EKYA 3U2MA 1XZQA 3PDMP 2EPLX 2QNLA 1TFKB 3UNGC 4XLPF 1MMAA 3B0UX 2R9RB 1HY5A 1OCCC 1OW6A 2C03A 3MYIA 4JCZA 5B1BC 4AE4A 1FNTc 1U0BB 4J32B 3JTLO 4WABA 5L3VA 3EQLF 4DRIB 1Z5ZA 4N06A 5KYYA 3KYJA 4I3MA 3QW1A 4MVUA 4PJNA 2NG1A 4RDAA 2HMQA 2LFDA 2RD9A 1FAPB 1PD1A 4XEKA 3AGUA 2OOCA 4YT5A 5T3WA 5D92A 2HMZA 3DWWA 1WATA 2ICWG 4KNWA 2D4UA 4MTOA 4IAOA 3TQOA 4DVYP 3AGTA 3NMKA 3DZAA 1RJ9A 4K0DA 2H7BA 4PACA 1YA7O 4X0RA 4A4AA 3IPMO 4D4XA 4FAPB 5L0GA 3NG1A 1BBHA 1M56C 2L9JA 2YWAA 4XEFA 4DOZA 1V54C 5E3AA 1G4US 3GM3A 3ZVRA 2YEVA 3WODF 3S84A 1M6TA 3DM9B 4MVQA 3U9MA 1KU2A 1C02A 1T01A 3R7CA 2IM8A 4XEVA 2J9UA 4P9FA 4JTAB 3DAFA 4XTKA 3EHNA 3OA1A 4PJJA 3V7OA 3S0XA 2UUIA 2R7QA 4OIPF 1ZU4A 1K40A 2W4BA 2CCYA 2WVNA 1MMDA 4JEAA 4DBRA 3KMIA 2A6EF 2EIMC 3HKKA 1Z6AA 2XS8A 1YZAA 2XLVA 4JTDB 2AWYA 4K7BA 3C8GD 4CSAA 3C63A 4U5CE 4ER9A 3T6JA 1V74B 4P9TA 1TR2A 2GFHA 2XSEA 3GODA 4K1OA 4PJLA 1UFBA 1RXQA 1ZHXA 3LS1A 3DAGA 1JPJA 4U5BE 3GEHA 3AQCA 3W2WA 3HNLA 3HJCA 3TOMA 1YDIA 4YL1A 2YVKA 4AL0A 2ZD9A 3S29A 3U8PA 3UR3C 5EK0A 2R7UA 2L6HA 2OQMA 4J7TA 2HS5A 4CDAA 1L3PA 4EBBA 5EGYA 1ZU5A 1LVKA 1T6QA 2XL4A 3MFNA 4RD9A 5BQGA 4DBQA 3KYIA 2Y3GA 2P0NA 1Y6DA 3DJNB 3M1CB 4PR9A 1Z7Qc 5KYWA 4NTAA 1TQGA 3K6BA 3IQCA 3N0TA 1LS4A 3LUTB 3S27A 4XPYA 1A41A 5E2QA 3EH1A 1LKXA 2L81A 2YL1A 3HNKA 1YYJA 3BEHA 3PCVA 4AL1A 1KTMA 2YLDA 2CNWD 1N1CA 3POVA 1OKKD 1Q0DA 1WWPA 4HEAJ 1E83A 1OCZC 3HNIA 2C04A 2Y3BA 3L0IA 4Q7CA 4U5EE 5GPGB 1GS9A 1MNEA 2CGEA 3OWTA 3U3BA 5A6AA 2KYHA 2QLAA 4CS8A 2I8BA 4LLEA 3RW0A 4CS9A 3NKDA 4EIYA 1ZZPA 1PV3A 1MQVA 1U6HA 2XL8A 5TJ5E 5CI9A 4CX9A 3QZCA 1D1AA 5DQTA 2PFDA 2R7OA 3Q6NA 4JRZA 2GAQA 3EG9B 1OCOC 3EHMA 4YN0B 3S28A 1BR1A 2LD6A 2Q9BA 2XLMA 1T9KA 2Y39A 3DKAA 3SXZA 1H9TA 1H9GA 1YZCA 5A6KA 1OR3A 3QW0A 3S90A 4JIOA 1FMWA 2YZSA 2DB4A 4JJFA 1ZYRF 4MQ9F 5CI8A 2KC3A 4Z9JA 2A1DD 1D0XA 2H7VC 2IXOA 2YKZA 4D4NA 3VRCA 5B3IA 4O79A 1GQAA
chains in the Genus database with same CATH topology
4DRIB 3FAPB 1NSGB 4DRHB 1AUEA 1FAPB 2GAQA 4FAPB 4DRJB 5GPGB 2NPUA 2RSEB 2FAPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRI B;  3FAP B;  1NSG B;  4DRH B;  1AUE A;  1FAP B;  2GAQ A;  4FAP B;  4DRJ B;  5GPG B;  2NPU A;  2RSE B;  2FAP B; 
#chains in the Genus database with same CATH topology
 1LIH A;  3IQ5 A;  4CSA C;  4IWB A;  1PD0 A;  2VAS A;  4OD5 A;  1MND A;  2VCA A;  4E7Z A;  3QTH A;  2PNO A;  1BDJ B;  2Q3T A;  3N24 A;  2ZXR A;  1ZHY A;  2PP4 A;  3KKB A;  4NCQ A;  2X0C A;  2HSQ A;  2J9W A;  3SNH A;  1T6U A;  3AOU A;  2HV7 A;  4ONS A;  5FZT A;  2KQ9 A;  4Q4Z F;  3O39 A;  3B29 A;  1Q0K A;  4EKW A;  1L7C A;  1E2X A;  3K1I C;  1BZ4 A;  2IXM A;  2J7P A;  3M79 A;  2V26 A;  1NG1 A;  4AK9 A;  4E18 A;  1IW7 F;  3U9J A;  4G7Z F;  3B9Q A;  3U5S A;  1XWJ A;  3LAY A;  1CGM E;  1APC A;  3ZQY A;  3NDB B;  2P1A A;  3DM5 A;  2YQY A;  3LEV A;  5BQI A;  1AUE A;  1SF8 A;  4BJ6 A;  4NTF A;  2L6G A;  4C3D A;  1HW1 A;  4MVS A;  1XZP A;  2G3V A;  2MHR A;  2GA0 A;  3ATP A;  4N6C A;  3T4R A;  4A2N B;  5HSW A;  1ZHW A;  2V3C C;  2G62 A;  3E9V A;  2XXA B;  3C8Z A;  3ABK C;  2IOQ A;  3FDQ A;  4DRH B;  2PX3 A;  2OU6 A;  3JRT A;  2PF4 E;  1VMA A;  4N4W A;  5T1D B;  2VC9 A;  3FHD A;  4IRU A;  1JPN A;  3A9C A;  3DJU B;  5JRA A;  2HJM A;  4U5F E;  3ZDL A;  4EBJ A;  1H7I A;  1LPE A;  3JT1 A;  4PK4 A;  1TWG A;  2JX0 A;  5DLJ A;  4C7O B;  2EIN C;  1TWH A;  2EIJ C;  3HLZ A;  2AWC A;  3QMK A;  3T9O A;  2FGY A;  4JKV A;  1Q0M A;  2P6V A;  4FES A;  3ZWI A;  3DD7 A;  3KH2 A;  1K04 A;  4EHP A;  1WN0 A;  5B3S C;  5L0H A;  3PHF 2;  4ZLD A;  5COF A;  4BG0 A;  3R2P A;  3CAX A;  2UUH A;  4WGY A;  4C3E A;  2OJE D;  4FX5 A;  4OIR F;  2QE9 A;  3GOR A;  1VB5 A;  1ZHZ A;  1WOL A;  4YL0 A;  4WGZ A;  1WGW A;  5CIV A;  4ANJ A;  3ZSU A;  3GWN A;  4CDV A;  4MS2 A;  2ASR A;  3ABL C;  1ORY A;  1SR2 A;  4BJ1 A;  4HFK B;  3CSK A;  3ITF A;  5L0J A;  3O6X A;  1MMN A;  3K1I A;  2DGJ A;  3IQT A;  5DS4 A;  2A6H F;  3LNR A;  3LS0 A;  1YAU O;  2XLD A;  3HNJ A;  3C18 A;  5A6B D;  3UMK A;  3FAJ A;  3DI5 A;  3G50 A;  2HFI A;  1JAF A;  2R7X A;  3CQZ A;  1SYQ A;  5BQH A;  1OCR C;  4W8K A;  5F5F A;  3BRJ A;  1YVI A;  2D5R B;  1PCX A;  2ZXP A;  2W4M A;  5DS5 A;  3FAP B;  2EIL C;  2HZ8 A;  3O55 A;  3NMJ A;  1UG7 A;  1RKE B;  3EZH A;  1JOG A;  4MVZ A;  1RMV A;  4YK5 A;  1QQ3 A;  2FAP B;  1HE1 A;  3FOO A;  3WAQ A;  2DYR C;  4E17 A;  3T6B A;  4EWC A;  1OW7 A;  2J0X A;  3US6 A;  1ZHT A;  3V5Y A;  4E0I A;  2WVO A;  1A7V A;  4YL3 A;  2NUT A;  1HMD A;  1LE4 A;  3SXY A;  3JSZ A;  5AC5 A;  3J06 A;  3MLG A;  1I4Y A;  2BE5 F;  2YLG A;  2ETS A;  3FXH A;  4Z9I A;  5DS6 A;  3C7J A;  5T3T A;  4U5D E;  2L7A A;  2NUP A;  2VCB A;  1Z3I X;  1E84 A;  1QLE C;  2W45 A;  2Y3H A;  2J7P D;  3M15 A;  2WZF A;  3Q7G A;  2BL2 A;  3RQF A;  1R5I D;  2Q4F A;  5COM A;  5JUA A;  2A0U A;  3NYL A;  1YLM A;  5KYY B;  2Y69 C;  3ZTZ A;  5D91 A;  1DOV A;  3B71 A;  1ZW2 A;  2CNW A;  3ZQV A;  2OKU A;  1S7Z A;  3B0P A;  4JTC B;  3TUL A;  4EUK B;  3RKO F;  3OEO A;  1NSG B;  1G8X A;  4JCH A;  5L0F A;  2HKV A;  3EFO A;  3V5X A;  4DRJ B;  4E7S A;  3IHU A;  2EPO A;  3VAY A;  2R02 A;  4PFO A;  2NUP B;  3FMS A;  3GEE A;  1EA8 A;  1D1C A;  3AG1 C;  4I44 A;  4JE9 A;  2G3K A;  5F28 E;  2J9V A;  2PBE A;  4MVO A;  5IY5 C;  4JZA A;  4IJJ A;  1YJG A;  2Z15 A;  1CGO A;  1G4W R;  1M2V A;  3C62 A;  3EJN A;  2NPU A;  4KBL A;  1TWC A;  3AJM A;  2EPK X;  3RQE A;  2R25 A;  2VB6 A;  2ZPA A;  4IAQ A;  4R32 A;  3V5Z A;  2Q7R A;  4JVS A;  3QVY A;  2A69 F;  2OEV A;  2Q00 A;  1GM5 A;  3Q6M A;  3JYH A;  3X2Q C;  4MW8 A;  2EPN A;  1QZX A;  3KPH A;  2YRF A;  1YAR O;  4P6I C;  2NSG A;  5JVE A;  3AG2 C;  3GM1 A;  2OEX A;  2PX0 A;  4LLC A;  3FOP A;  2AU5 A;  3DXJ F;  5A69 A;  3MBG A;  4JUR I;  3JCU Q;  2WL8 A;  4I1O B;  3L34 A;  1ST6 A;  3AQB A;  1QVX A;  2CYD A;  3ZTM A;  4O7G A;  4MVR A;  5JSL A;  3ASO C;  3M4B A;  3EH2 A;  4DXW A;  3NYM A;  4MND A;  1FFH A;  3ECS A;  3EFO B;  3ZC4 A;  4DJ9 A;  4NQF A;  1T6I A;  3H2U A;  1G5Z A;  3I5P A;  3Q7L A;  2NUT B;  3K66 A;  2DYS C;  3W8I A;  1Y4C A;  2WZL A;  1O5H A;  4XPW A;  1M2V B;  2YL7 A;  3SEO A;  3VM6 A;  4BJ5 A;  3X1O A;  2ZXO A;  4ULW A;  1OXK A;  3DE8 A;  3K7D A;  2QTV A;  3RIP A;  4CJG A;  4G7H F;  1V55 C;  2JPU A;  2XS1 A;  4GQH A;  1O3U A;  3SXM A;  1I5N A;  2VH3 A;  1QPU A;  3LNM B;  2J8W A;  1FTS A;  4QI0 A;  2LCH A;  1QSP A;  1NZE A;  1Q0F A;  2E87 A;  3F46 A;  1QKR A;  3U2L A;  1LS1 A;  2X51 A;  3CZ6 A;  4GYT A;  4O6Y A;  2F22 A;  4G7O F;  4UDV A;  4JW1 A;  2IXN A;  3SXK A;  5BUO A;  5L0C A;  3UGP A;  4XPX A;  5JLI A;  2HSB A;  4YWQ A;  1D0Z A;  1J8Y F;  3U8V A;  4F4B A;  2H7O A;  1R4T A;  2Q9C A;  1KNY A;  4ZLC A;  3L1M A;  3KL4 A;  1VYI A;  3ABM C;  1E85 A;  2J45 A;  1EI7 A;  1A7E A;  2KSF A;  3GWL A;  4LDR A;  1IZM A;  1D0Y A;  4KC9 A;  3O10 A;  2Q9A A;  2XRH A;  4AX2 A;  4H4K C;  3U0C A;  4QI2 A;  2CDQ A;  4BPM A;  1VTM P;  1DOW A;  3SP1 A;  3EGD A;  3JZ0 A;  3LLK A;  3K33 A;  5AC4 A;  5JT4 A;  1BR4 A;  1CPR A;  4DVZ A;  4OIQ F;  2R05 A;  4LAC B;  2R7R A;  2LSE A;  4Q5S F;  4IB4 A;  1LI7 A;  4CBE A;  3NRH A;  3IQ6 A;  1A7D A;  1NFO A;  1J8M F;  4YT4 A;  2MWQ A;  1TWA A;  2KJG A;  3EGX B;  3ZG1 A;  3RH3 A;  2NSF A;  1ORJ A;  2XLW A;  1RJ9 B;  4N6H A;  4CIP A;  1MMG A;  5L0D A;  2J46 A;  4KI2 A;  1T5O A;  5DQZ A;  3JSE O;  3LES A;  1BR2 A;  3W4Y A;  4MW3 A;  4C3B A;  4OIN F;  2YL3 A;  1U89 A;  2FFH A;  2H8A A;  3HTK C;  1RKE A;  2J9B A;  1WTY A;  1FMV A;  2M64 A;  4I1M A;  1NFN A;  3EG9 A;  4NC3 A;  3LEO A;  1WAS A;  3JRM O;  4O6M A;  4KNV A;  3H2V A;  3JYY A;  4IAR A;  2R7W A;  4ULV A;  1TFO B;  3LLI A;  3VF0 A;  5A6B A;  3MX3 A;  1C17 M;  3EZI A;  1OKK A;  2LQG A;  3I5Q A;  4CJO A;  4LDQ A;  3PMR A;  2OJQ A;  3U3F A;  4GEH A;  3B0V C;  3I4U A;  2YL0 A;  5KYX B;  1JMW A;  4E0H A;  1LI5 A;  5AGF A;  1Q0G A;  2P7V A;  3EGD B;  3AG3 C;  3WHN A;  3LJB A;  3UGO A;  2A68 F;  2GDC A;  1FFT C;  1OQC A;  2LP4 A;  2AP3 A;  1AEP A;  2KW3 C;  2WB7 A;  3C8G B;  4MTG A;  2IXP A;  2KK1 A;  2VCC A;  3ASN C;  4Z9H A;  4BJT A;  4CS9 C;  1B68 A;  1I4Z A;  3EGX A;  4OIO F;  4U5G A;  3TOL A;  3M4C A;  2LIG A;  1VOM A;  1ZVZ A;  1LM3 B;  2HV6 A;  2TMV P;  3DE9 A;  2BC5 A;  2MYS A;  3N2Z B;  4U9D A;  4B6I A;  4MVM A;  2A0B A;  2XLE A;  5FCL A;  2Y3D A;  1FR0 A;  4WJ0 A;  1LE2 A;  3G4Z A;  1AVO B;  3T6G B;  2XM0 A;  2CW0 F;  2HUJ A;  3K1H A;  3VYW A;  3NKE A;  2XLO A;  1JRA A;  1RCP A;  3NMI A;  4HE8 D;  4LDK A;  1NLX A;  4YT8 A;  2ZXW C;  4IGG A;  1NBB A;  1HMO A;  3RQG A;  2IYL D;  5A6J A;  3C8G A;  5L0I A;  5KYN A;  4C7O A;  1ORS C;  2OG2 A;  2W9Y A;  5KYW B;  1A0B A;  2IBF A;  2L6F A;  4JC7 A;  3RVY A;  1ZW3 A;  4BJ5 C;  2GWW A;  2EIK C;  4PJM A;  3TK0 A;  3MYF A;  3W2V A;  2WZG A;  4CS7 A;  3H65 A;  2LFF A;  1V4A A;  5F5H A;  3DMD A;  3EPV A;  3FVY A;  1RKC A;  4PFP A;  1JR8 A;  5B1A C;  1VYK A;  4AE4 B;  1GGQ A;  1S05 A;  2LK4 A;  3F47 A;  3WG7 C;  5K0I A;  3SYN A;  5COG A;  1SZI A;  4XQ1 A;  2RSE B;  2R7T A;  2EPM X;  3GM2 A;  2B0J A;  3E70 C;  4JJG A;  3TD7 A;  2QUP A;  2XL6 A;  4CIH A;  1E86 A;  4BEJ A;  4O6N A;  256B A;  3W8H A;  5KYU A;  4L6R A;  4BJ6 C;  3NYJ A;  2J0W A;  1Z63 A;  3RF3 A;  2WVQ A;  1D1B A;  1YYX A;  4MTF A;  4LER A;  2JD3 A;  2HJ3 A;  3L8I A;  2DI3 A;  2R7V A;  2OCC C;  3RVZ A;  3RYL A;  2AVK A;  4XLN F;  4CDY A;  1Z23 A;  3ZIB A;  1VLT A;  1M2O A;  3GEI A;  4U5H A;  3RFY A;  2B0H A;  2KNH A;  3TJ6 A;  5KYX A;  1OW8 A;  2YHS A;  2R03 A;  1K05 A;  1OR2 A;  1SMY F;  4FWV A;  1W2W A;  3GAN A;  3S9O A;  2QY9 A;  4OD4 A;  2I15 A;  4M63 A;  1H6G A;  2XM4 A;  1F1M A;  1HW2 A;  5HV9 A;  1OXB A;  3UMH A;  2YLI A;  4J30 B;  5L3Q A;  4G78 A;  1HE9 A;  1NU7 D;  3A11 A;  4W8P A;  4XWJ A;  3UMI A;  2M4E A;  4BEM J;  4JEB A;  1YA9 A;  5DVW A;  5E3C A;  4QDL A;  5EHH A;  4H54 A;  1EQ1 A;  2KGO A;  1VLS A;  3TJ5 A;  4HFF B;  4RBN A;  5JS5 A;  4U9E A;  4YJW A;  1O87 A;  1C03 A;  4NTB A;  3L8J A;  3IEE A;  3QVZ A;  3SZR A;  4CS8 C;  2P61 A;  2R7S A;  1TKN A;  3G4X A;  4EBK A;  2O9X A;  3CEX A;  4NY3 A;  1M57 C;  1NU9 C;  5KYU B;  1CPQ A;  4G0H A;  2XXA A;  3AG4 C;  5E33 A;  2XLH A;  4YT2 A;  1VK5 A;  1CGN A;  5JP7 A;  4J7Y A;  1EKY A;  3U2M A;  1XZQ A;  3PDM P;  2EPL X;  2QNL A;  1TFK B;  3UNG C;  4XLP F;  1MMA A;  3B0U X;  2R9R B;  1HY5 A;  1OCC C;  1OW6 A;  2C03 A;  3MYI A;  4JCZ A;  5B1B C;  4AE4 A;  1FNT c;  1U0B B;  4J32 B;  3JTL O;  4WAB A;  5L3V A;  3EQL F;  4DRI B;  1Z5Z A;  4N06 A;  5KYY A;  3KYJ A;  4I3M A;  3QW1 A;  4MVU A;  4PJN A;  2NG1 A;  4RDA A;  2HMQ A;  2LFD A;  2RD9 A;  1FAP B;  1PD1 A;  4XEK A;  3AGU A;  2OOC A;  4YT5 A;  5T3W A;  5D92 A;  2HMZ A;  3DWW A;  1WAT A;  2ICW G;  4KNW A;  2D4U A;  4MTO A;  4IAO A;  3TQO A;  4DVY P;  3AGT A;  3NMK A;  3DZA A;  1RJ9 A;  4K0D A;  2H7B A;  4PAC A;  1YA7 O;  4X0R A;  4A4A A;  3IPM O;  4D4X A;  4FAP B;  5L0G A;  3NG1 A;  1BBH A;  1M56 C;  2L9J A;  2YWA A;  4XEF A;  4DOZ A;  1V54 C;  5E3A A;  1G4U S;  3GM3 A;  3ZVR A;  2YEV A;  3WOD F;  3S84 A;  1M6T A;  3DM9 B;  4MVQ A;  3U9M A;  1KU2 A;  1C02 A;  1T01 A;  3R7C A;  2IM8 A;  4XEV A;  2J9U A;  4P9F A;  4JTA B;  3DAF A;  4XTK A;  3EHN A;  3OA1 A;  4PJJ A;  3V7O A;  3S0X A;  2UUI A;  2R7Q A;  4OIP F;  1ZU4 A;  1K40 A;  2W4B A;  2CCY A;  2WVN A;  1MMD A;  4JEA A;  4DBR A;  3KMI A;  2A6E F;  2EIM C;  3HKK A;  1Z6A A;  2XS8 A;  1YZA A;  2XLV A;  4JTD B;  2AWY A;  4K7B A;  3C8G D;  4CSA A;  3C63 A;  4U5C E;  4ER9 A;  3T6J A;  1V74 B;  4P9T A;  1TR2 A;  2GFH A;  2XSE A;  3GOD A;  4K1O A;  4PJL A;  1UFB A;  1RXQ A;  1ZHX A;  3LS1 A;  3DAG A;  1JPJ A;  4U5B E;  3GEH A;  3AQC A;  3W2W A;  3HNL A;  3HJC A;  3TOM A;  1YDI A;  4YL1 A;  2YVK A;  4AL0 A;  2ZD9 A;  3S29 A;  3U8P A;  3UR3 C;  5EK0 A;  2R7U A;  2L6H A;  2OQM A;  4J7T A;  2HS5 A;  4CDA A;  1L3P A;  4EBB A;  5EGY A;  1ZU5 A;  1LVK A;  1T6Q A;  2XL4 A;  3MFN A;  4RD9 A;  5BQG A;  4DBQ A;  3KYI A;  2Y3G A;  2P0N A;  1Y6D A;  3DJN B;  3M1C B;  4PR9 A;  1Z7Q c;  5KYW A;  4NTA A;  1TQG A;  3K6B A;  3IQC A;  3N0T A;  1LS4 A;  3LUT B;  3S27 A;  4XPY A;  1A41 A;  5E2Q A;  3EH1 A;  1LKX A;  2L81 A;  2YL1 A;  3HNK A;  1YYJ A;  3BEH A;  3PCV A;  4AL1 A;  1KTM A;  2YLD A;  2CNW D;  1N1C A;  3POV A;  1OKK D;  1Q0D A;  1WWP A;  4HEA J;  1E83 A;  1OCZ C;  3HNI A;  2C04 A;  2Y3B A;  3L0I A;  4Q7C A;  4U5E E;  5GPG B;  1GS9 A;  1MNE A;  2CGE A;  3OWT A;  3U3B A;  5A6A A;  2KYH A;  2QLA A;  4CS8 A;  2I8B A;  4LLE A;  3RW0 A;  4CS9 A;  3NKD A;  4EIY A;  1ZZP A;  1PV3 A;  1MQV A;  1U6H A;  2XL8 A;  5TJ5 E;  5CI9 A;  4CX9 A;  3QZC A;  1D1A A;  5DQT A;  2PFD A;  2R7O A;  3Q6N A;  4JRZ A;  2GAQ A;  3EG9 B;  1OCO C;  3EHM A;  4YN0 B;  3S28 A;  1BR1 A;  2LD6 A;  2Q9B A;  2XLM A;  1T9K A;  2Y39 A;  3DKA A;  3SXZ A;  1H9T A;  1H9G A;  1YZC A;  5A6K A;  1OR3 A;  3QW0 A;  3S90 A;  4JIO A;  1FMW A;  2YZS A;  2DB4 A;  4JJF A;  1ZYR F;  4MQ9 F;  5CI8 A;  2KC3 A;  4Z9J A;  2A1D D;  1D0X A;  2H7V C;  2IXO A;  2YKZ A;  4D4N A;  3VRC A;  5B3I A;  4O79 A;  1GQA A; 
#chains in the Genus database with same CATH homology
 4DRI B;  3FAP B;  1NSG B;  4DRH B;  1AUE A;  1FAP B;  2GAQ A;  4FAP B;  4DRJ B;  5GPG B;  2NPU A;  2RSE B;  2FAP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...