2RSEB

Nmr structure of fkbp12-mtor frb domain-rapamycin complex structure determined based on pcs
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
VAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Convenient method for resolving degeneracies due to symmetry of the magnetic susceptibility tensor and its application to pseudo contact shift-based protein-protein complex structure determination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
total genus 35
structure length 94
sequence length 94
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 2rseB00
4DRIB 1FAPB 2GAQA 4FAPB 4DRJB 1NSGB 5GPGB 4DRHB 2RSEB 3FAPB 2FAPB 1AUEA 2NPUA
chains in the Genus database with same CATH superfamily
4RD9A 3CZ6A 4Z9IA 2W9YA 3JSEO 3V5ZA 1FR0A 2CGEA 1T6IA 4KNWA 1CPQA 4W8PA 4MNDA 2OCCC 4XPYA 3EHMA 4YL1A 3NMIA 4BJ5C 4GYTA 1VLTA 1ZU4A 2IBFA 5DS6A 2CW0F 4AE4A 3GANA 4U5EE 3U9MA 2XLWA 5DLJA 4AL0A 1M57C 1DOWA 3IEEA 3NYJA 4JZAA 1WTYA 4OD4A 1RJ9A 2PP4A 4C3BA 1ZW3A 3LNRA 4MW3A 1QPUA 5A69A 5KYNA 1I4YA 1UFBA 2ICWG 1V54C 4N4WA 3FDQA 1BR2A 1T9KA 3S84A 1TWGA 1LE2A 1VYIA 2L6GA 3BRJA 4AK9A 1OXBA 2XSEA 4E0HA 4YL3A 4IJJA 2IOQA 5EGYA 3HKKA 4EIYA 1FMVA 2XXAA 2YLGA 5KYXA 2GWWA 1TFKB 2XL6A 4P6IC 1D0ZA 4XEKA 5T1DB 3S27A 2KJGA 3U3FA 1CGME 2CDQA 3KH2A 2ZXPA 4CBEA 2PX3A 3L34A 4D4NA 1A7DA 4Z9JA 3V7OA 3W8HA 3ZSUA 4PJJA 2WZLA 4PFPA 1E86A 1KNYA 4XLPF 4C7OB 1SYQA 2HJMA 3DAFA 1RXQA 1TWHA 2HFIA 4JE9A 4DRJB 2XLHA 2J9VA 2YHSA 5FCLA 3V5YA 3S90A 4N6HA 4QDLA 5DQZA 1APCA 2J46A 3JSZA 4JRZA 3I5QA 1LPEA 5L3VA 1OCZC 1JR8A 4Q7CA 3S29A 1OCOC 1PV3A 2IXOA 1E85A 2A0BA 1G4WR 1PD1A 1GGQA 1YZAA 3S0XA 4H4KC 4MVMA 3G50A 1LS1A 2Q9BA 5KYUA 3HJCA 3KYJA 3M1CB 4XPXA 1IW7F 3QMKA 3E70C 1E2XA 4QI0A 1C03A 2ZXOA 4MW8A 5CI8A 5A6KA 4YN0B 2R7VA 1OCRC 4JEAA 4J32B 3ZTZA 3GWLA 1BDJB 2H7VC 2A68F 4CDYA 4K7BA 3I5PA 4PACA 3JYYA 1Q0MA 3ABLC 3EH2A 1FFTC 1EI7A 3JZ0A 3LESA 5E3AA 4O7GA 4ZLDA 3BEHA 3N0TA 1GQAA 4OIOF 1XZQA 1K40A 4CX9A 3AGUA 3UMKA 1M2VA 2NUPB 3GEHA 3GODA 4U9EA 1NG1A 3HTKC 3IQCA 3MLGA 2OJED 1FNTc 1H6GA 1M56C 1HW1A 1RKCA 1YJGA 2L7AA 3UMIA 1R5ID 3LLKA 3Q6MA 3GORA 1NFOA 4MVUA 2P7VA 1YARO 2RD9A 1HMOA 3TQOA 3IQTA 3AJMA 2M64A 3PMRA 3GEIA 1UG7A 2L6FA 3M4BA 3ZWIA 4F4BA 4MVZA 4PJLA 3FMSA 4OINF 1A0BA 1NSGB 1OKKD 3NKDA 5BUOA 3K7DA 1OR2A 2F22A 4MVQA 3KKBA 2ZPAA 3CQZA 3HLZA 3K6BA 3EFOA 3TJ5A 1ORJA 1U89A 2LCHA 2DYSC 4NCQA 5KYYA 3FOOA 1T6UA 4E7ZA 4YT5A 3TK0A 3DXJF 3RQEA 2P6VA 1H9GA 3LEOA 1NU7D 1XWJA 2UUIA 3E9VA 2KYHA 3RF3A 3C7JA 3NRHA 4E0IA 1OW8A 1Q0KA 3U8VA 3C8GA 4WJ0A 1WWPA 1ZW2A 1E84A 4WABA 3DZAA 1SF8A 1MNDA 2LIGA 2W45A 1JRAA 4HEAJ 4I44A 3NDBB 2J7PD 3EZHA 3VM6A 1F1MA 5L0JA 2QNLA 3QZCA 2H8AA 2L6HA 2EINC 4EBJA 3RVYA 4G7ZF 3GWNA 2Y3BA 1H9TA 3SNHA 4PJMA 5DQTA 1LI5A 5HSWA 4P9TA 3T9OA 3U8PA 4U5GA 1ST6A 4LERA 5BQHA 3TJ6A 4C7OA 2AU5A 2G62A 2YL3A 1OQCA 4N06A 3C18A 3ZDLA 3HNLA 3IQ5A 3LS1A 5B1BC 1ZHTA 3B0VC 1C02A 2ASRA 2YKZA 3RH3A 5D91A 1M2OA 3DKAA 5DVWA 2CCYA 2AWCA 1NBBA 1TWAA 2YWAA 5COGA 3TULA 2XS8A 3UR3C 2VCCA 2OU6A 2P0NA 4UDVA 1SR2A 1GM5A 3ZG1A 2Y3GA 2DB4A 4EUKB 3DM5A 4I1OB 4CS9C 4CIHA 1HW2A 1A7EA 4IB4A 2C03A 4IAOA 5CIVA 1N1CA 3K1IA 4E18A 3F47A 1FAPB 3LAYA 3QW0A 3SXMA 2GAQA 1ZHZA 4JJFA 3TD7A 3W8IA 1YYJA 2R7SA 4DOZA 1Z63A 1JAFA 4D4XA 4PR9A 1E83A 3Q6NA 1RKEB 2YVKA 4JTDB 2R7QA 2I8BA 1ZYRF 3PCVA 4G0HA 3HNJA 3K1HA 2ETSA 1L3PA 3RQGA 2J9UA 1OCCC 1U6HA 2J0XA 2XM0A 2ZXWC 1VYKA 3EPVA 3SZRA 3ZC4A 1D1CA 1FFHA 1OXKA 4OIPF 4XTKA 2EILC 2J8WA 2KQ9A 4DRIB 2V3CC 2A0UA 4C3DA 4YWQA 3QTHA 3NYMA 2OOCA 3H2UA 1WATA 3ASNC 3EGXB 4IGGA 5FZTA 4BG0A 3AQCA 5JUAA 2LFDA 1Y6DA 3ABKC 4YT8A 5EHHA 4NQFA 4Q5SF 2HUJA 2Y69C 2MHRA 3U5SA 2OKUA 3B0UX 3JTLO 2KNHA 5A6BA 2YL1A 3LS0A 5E2QA 2HKVA 3G4ZA 3LUTB 3LJBA 1KTMA 4YJWA 2VCBA 4U5HA 5JRAA 2L81A 3W4YA 1TKNA 3C8GB 3I4UA 3N24A 4NTBA 1A7VA 4CSAA 2VASA 5GPGB 1AVOB 3SP1A 1ORSC 1LKXA 3EZIA 3DD7A 3POVA 4CS9A 1OW6A 3IQ6A 3EJNA 2HS5A 2LP4A 3EFOB 3GM2A 3K1IC 4O6YA 2G3VA 4OD5A 2A6HF 1HMDA 2J9WA 2QUPA 3RVZA 4JCHA 4JEBA 3DWWA 3L8IA 4MS2A 4NTAA 3T6GB 2QTVA 1LVKA 3X2QC 2WVQA 2VH3A 1YYXA 1CGOA 4LDQA 4PK4A 4ER9A 3SXYA 2WVNA 3C8GD 3PDMP 1HY5A 1ZVZA 4MVRA 3V5XA 2GDCA 1WOLA 3UMHA 3FVYA 2P1AA 2Q9AA 2J7PA 3FAPB 5BQGA 3ASOC 2EPNA 2LSEA 4C3EA 3HNIA 1VTMP 4BEJA 2LD6A 4U9DA 3T6BA 1MMNA 1XZPA 2YL7A 2Y3DA 1TWCA 2FGYA 5E3CA 4JURI 5DS5A 1C17M 4A4AA 1JPNA 2R02A 2FAPB 5CI9A 1SZIA 2PBEA 3VF0A 3HNKA 4MVOA 1JOGA 1YZCA 1Z7Qc 5DS4A 2OEXA 2BC5A 4OIQF 1QKRA 4WGYA 1S05A 2IXNA 2OJQA 2R03A 1CPRA 2HZ8A 3ZQVA 5A6JA 1D0YA 2R9RB 4U5DE 5T3TA 3WAQA 5D92A 3G4XA 2CYDA 3ZVRA 3RFYA 1YAUO 1MQVA 2KW3C 3NKEA 4AL1A 5AC5A 2R7RA 2PF4E 2Q3TA 1Y4CA 1Q0GA 1SMYF 1VMAA 3JCUQ 2XLOA 2QY9A 1I5NA 2Z15A 1YA7O 2FFHA 2PFDA 2W4MA 3DMDA 4JTCB 5A6AA 1LM3B 2XXAB 4BJTA 2EPMX 1CGNA 2OQMA 4MTFA 2LQGA 2B0HA 5A6BD 2YL0A 2QLAA 5F5FA 1Q0FA 1AUEA 3GEEA 3H2VA 3L0IA 4LDRA 1EKYA 1NLXA 1QLEC 2PNOA 3QW1A 4O79A 1Z5ZA 4XEFA 5JSLA 3O39A 3KPHA 4ZLCA 3KMIA 1MMAA 2KC3A 4FAPB 3W2WA 1Z3IX 4ULWA 4BJ5A 5AC4A 1WN0A 4DVZA 1H7IA 2XLEA 1G8XA 1NZEA 2XM4A 3LEVA 2GA0A 3TOMA 4JC7A 3AG4C 3DE8A 1Z23A 2D5RB 1OR3A 5E33A 2AP3A 5TJ5E 2XS1A 2J0WA 2VC9A 3GM3A 1L7CA 3O55A 3OA1A 4CSAC 1RKEA 2EIMC 2HMQA 3DJUB 3SEOA 1QZXA 4DJ9A 5F5HA 4JTAB 2G3KA 3FAJA 3FOPA 2VCAA 3M4CA 5L0IA 3EGDA 2R7XA 3EQLF 1ZZPA 2HV7A 4J7TA 5COMA 3DJNB 3TOLA 5B3SC 3AGTA 2R05A 4HFKB 4CS7A 5IY5C 2IXMA 3B0PA 4U5CE 1VOMA 4IRUA 3OEOA 1M2VB 2NUPA 4JIOA 2RSEB 3KYIA 2M4EA 4X0RA 1MMDA 2CNWA 3CAXA 3M79A 1D1BA 1QQ3A 4OIRF 4BJ6A 4E17A 1OKKA 3U3BA 1IZMA 2A1DD 3AOUA 4GEHA 2XLVA 3VYWA 4YT2A 3U0CA 4EKWA 5L0HA 1YA9A 1PCXA 1NFNA 2DYRC 2Y39A 2KSFA 3A11A 2Q4FA 4GQHA 5KYXB 3PHF2 3JRMO 4ULVA 2HMZA 2Q7RA 2NSGA 2OEVA 3QVZA 5KYWA 1LE4A 1VLSA 3GM1A 4CDVA 2YLDA 1MNEA 2A6EF 4E7SA 4O6NA 2V26A 2X51A 1BR4A 1OW7A 2DI3A 1G5ZA 3ATPA 4PFOA 4YT4A 1TQGA 3O10A 2H7OA 2EPOA 3UNGC 1RJ9B 1Q0DA 2H7BA 2XL8A 2QE9A 3AG3C 3EG9A 4DVYP 4JVSA 3J06A 3LLIA 4AE4B 2R25A 4L6RA 5KYUB 3DAGA 5B1AC 1G4US 2VB6A 4MTOA 4G7OF 3H65A 1I4ZA 1VK5A 5AGFA 1JPJA 2NG1A 2NUTA 3S9OA 2W4BA 2YQYA 4EBKA 5B3IA 1EQ1A 2NPUA 4B6IA 3DM9B 2YLIA 3EH1A 1V4AA 2EIJC 4LDKA 3M15A 3NYLA 4NTFA 4U5BE 5T3WA 4BEMJ 4U5FE 1NU9C 3N2ZB 2IM8A 3B71A 4G78A 1ZHXA 4J30B 4O6MA 4Z9HA 2XRHA 3RKOF 2ZD9A 5HV9A 3K33A 1KU2A 2BL2A 5JP7A 3W2VA 1ORYA 2EPKX 1RMVA 2JX0A 1D0XA 3C8ZA 3NMKA 3WODF 3MX3A 1LIHA 4DBRA 1GS9A 1YLMA 1JMWA 4BJ6C 4FX5A 4W8KA 4H54A 3X1OA 2D4UA 4HFFB 2WZGA 3B9QA 1B68A 1O3UA 5EK0A 2R7WA 2P61A 1TR2A 3US6A 4XWJA 5L0CA 4NC3A 3ABMC 1K04A 2I15A 2HJ3A 3RQFA 4ONSA 3NG1A 2OG2A 3K66A 4YL0A 4IWBA 4CJOA 2JPUA 1BBHA 256BA 2E87A 3EG9B 1ZHYA 4EBBA 2YZSA 2PX0A 1T5OA 3QVYA 5K0IA 3EGDB 5L0DA 2JD3A 4LLEA 4QI2A 4XQ1A 1J8YF 2EIKC 1WASA 1V74B 3LNMB 1R4TA 1T6QA 4IARA 4I3MA 1DOVA 4DXWA 4EHPA 4DRHB 1RCPA 1BR1A 4CS8A 3SXZA 1PD0A 1ZU5A 3T6JA 1V55C 3RYLA 2WL8A 1AEPA 1LS4A 1W2WA 3IPMO 3ITFA 4FESA 4ANJA 1FTSA 4I1MA 3OWTA 2TMVP 2LK4A 1MMGA 4AX2A 5JS5A 2C04A 4JJGA 1TFOB 3ZQYA 2R7UA 5JT4A 4MTGA 4CJGA 1HE1A 3VAYA 4CIPA 4HE8D 2ZXRA 4KBLA 3U2LA 3R2PA 4G7HF 3VRCA 1LI7A 2HSQA 2WZFA 1S7ZA 3S28A 4A2NB 4CS8C 1BZ4A 1D1AA 3B29A 3EHNA 3JRTA 4N6CA 5JLIA 1O5HA 2O9XA 4WGZA 2BE5F 3DI5A 2IYLD 3R7CA 1J8MF 1HE9A 2EPLX 3IHUA 3NMJA 2CNWD 3MYIA 4P9FA 4RDAA 3L1MA 4XEVA 5L0GA 1Z6AA 2AVKA 2UUHA 2WVOA 4LLCA 2J45A 4YK5A 1K05A 2XL4A 2WB7A 3CSKA 3DE9A 3MBGA 4XLNF 3ZTMA 3F46A 3AQBA 3C63A 4PJNA 1YVIA 2DGJA 3A9CA 1EA8A 2X0CA 5BQIA 5JVEA 3UGPA 4Q4ZF 2MWQA 4J7YA 4JW1A 5F28E 5KYYB 3ZIBA 3FHDA 3FXHA 2J9BA 2YEVA 2Q00A 3T4RA 4MVSA 1O87A 2LFFA 2NUTB 3C62A 3MFNA 3WHNA 2R7OA 4IAQA 4JCZA 1QSPA 3RW0A 3WG7C 4K1OA 2KGOA 5L3QA 3AG1C 1A41A 2MYSA 3ECSA 2GFHA 4JKVA 1ZHWA 2YRFA 4CDAA 3JT1A 1VB5A 2L9JA 4M63A 3KL4A 1QVXA 3AG2C 4XPWA 1U0BB 4LACB 4KNVA 4NY3A 3JYHA 2KK1A 2XLMA 4R32A 1T01A 1WGWA 4FWVA 4EWCA 2Y3HA 4BJ1A 4KI2A 5L0FA 2IXPA 3CEXA 3L8JA 2AWYA 4DBQA 2A69F 3Q7LA 2NSFA 1M6TA 4BPMA 3Q7GA 1YDIA 3U2MA 2XLDA 3O6XA 2HSBA 3U9JA 2R7TA 2HV6A 4K0DA 5COFA 5KYWB 3EGXA 1FMWA 2B0JA 3MYFA 3RIPA 4RBNA 3SYNA 4KC9A 4MQ9F 3SXKA 3UGOA 2Q9CA
chains in the Genus database with same CATH topology
4DRIB 1FAPB 2GAQA 4FAPB 4DRJB 1NSGB 5GPGB 4DRHB 2RSEB 3FAPB 2FAPB 1AUEA 2NPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRI B;  1FAP B;  2GAQ A;  4FAP B;  4DRJ B;  1NSG B;  5GPG B;  4DRH B;  2RSE B;  3FAP B;  2FAP B;  1AUE A;  2NPU A; 
#chains in the Genus database with same CATH topology
 4RD9 A;  3CZ6 A;  4Z9I A;  2W9Y A;  3JSE O;  3V5Z A;  1FR0 A;  2CGE A;  1T6I A;  4KNW A;  1CPQ A;  4W8P A;  4MND A;  2OCC C;  4XPY A;  3EHM A;  4YL1 A;  3NMI A;  4BJ5 C;  4GYT A;  1VLT A;  1ZU4 A;  2IBF A;  5DS6 A;  2CW0 F;  4AE4 A;  3GAN A;  4U5E E;  3U9M A;  2XLW A;  5DLJ A;  4AL0 A;  1M57 C;  1DOW A;  3IEE A;  3NYJ A;  4JZA A;  1WTY A;  4OD4 A;  1RJ9 A;  2PP4 A;  4C3B A;  1ZW3 A;  3LNR A;  4MW3 A;  1QPU A;  5A69 A;  5KYN A;  1I4Y A;  1UFB A;  2ICW G;  1V54 C;  4N4W A;  3FDQ A;  1BR2 A;  1T9K A;  3S84 A;  1TWG A;  1LE2 A;  1VYI A;  2L6G A;  3BRJ A;  4AK9 A;  1OXB A;  2XSE A;  4E0H A;  4YL3 A;  4IJJ A;  2IOQ A;  5EGY A;  3HKK A;  4EIY A;  1FMV A;  2XXA A;  2YLG A;  5KYX A;  2GWW A;  1TFK B;  2XL6 A;  4P6I C;  1D0Z A;  4XEK A;  5T1D B;  3S27 A;  2KJG A;  3U3F A;  1CGM E;  2CDQ A;  3KH2 A;  2ZXP A;  4CBE A;  2PX3 A;  3L34 A;  4D4N A;  1A7D A;  4Z9J A;  3V7O A;  3W8H A;  3ZSU A;  4PJJ A;  2WZL A;  4PFP A;  1E86 A;  1KNY A;  4XLP F;  4C7O B;  1SYQ A;  2HJM A;  3DAF A;  1RXQ A;  1TWH A;  2HFI A;  4JE9 A;  4DRJ B;  2XLH A;  2J9V A;  2YHS A;  5FCL A;  3V5Y A;  3S90 A;  4N6H A;  4QDL A;  5DQZ A;  1APC A;  2J46 A;  3JSZ A;  4JRZ A;  3I5Q A;  1LPE A;  5L3V A;  1OCZ C;  1JR8 A;  4Q7C A;  3S29 A;  1OCO C;  1PV3 A;  2IXO A;  1E85 A;  2A0B A;  1G4W R;  1PD1 A;  1GGQ A;  1YZA A;  3S0X A;  4H4K C;  4MVM A;  3G50 A;  1LS1 A;  2Q9B A;  5KYU A;  3HJC A;  3KYJ A;  3M1C B;  4XPX A;  1IW7 F;  3QMK A;  3E70 C;  1E2X A;  4QI0 A;  1C03 A;  2ZXO A;  4MW8 A;  5CI8 A;  5A6K A;  4YN0 B;  2R7V A;  1OCR C;  4JEA A;  4J32 B;  3ZTZ A;  3GWL A;  1BDJ B;  2H7V C;  2A68 F;  4CDY A;  4K7B A;  3I5P A;  4PAC A;  3JYY A;  1Q0M A;  3ABL C;  3EH2 A;  1FFT C;  1EI7 A;  3JZ0 A;  3LES A;  5E3A A;  4O7G A;  4ZLD A;  3BEH A;  3N0T A;  1GQA A;  4OIO F;  1XZQ A;  1K40 A;  4CX9 A;  3AGU A;  3UMK A;  1M2V A;  2NUP B;  3GEH A;  3GOD A;  4U9E A;  1NG1 A;  3HTK C;  3IQC A;  3MLG A;  2OJE D;  1FNT c;  1H6G A;  1M56 C;  1HW1 A;  1RKC A;  1YJG A;  2L7A A;  3UMI A;  1R5I D;  3LLK A;  3Q6M A;  3GOR A;  1NFO A;  4MVU A;  2P7V A;  1YAR O;  2RD9 A;  1HMO A;  3TQO A;  3IQT A;  3AJM A;  2M64 A;  3PMR A;  3GEI A;  1UG7 A;  2L6F A;  3M4B A;  3ZWI A;  4F4B A;  4MVZ A;  4PJL A;  3FMS A;  4OIN F;  1A0B A;  1NSG B;  1OKK D;  3NKD A;  5BUO A;  3K7D A;  1OR2 A;  2F22 A;  4MVQ A;  3KKB A;  2ZPA A;  3CQZ A;  3HLZ A;  3K6B A;  3EFO A;  3TJ5 A;  1ORJ A;  1U89 A;  2LCH A;  2DYS C;  4NCQ A;  5KYY A;  3FOO A;  1T6U A;  4E7Z A;  4YT5 A;  3TK0 A;  3DXJ F;  3RQE A;  2P6V A;  1H9G A;  3LEO A;  1NU7 D;  1XWJ A;  2UUI A;  3E9V A;  2KYH A;  3RF3 A;  3C7J A;  3NRH A;  4E0I A;  1OW8 A;  1Q0K A;  3U8V A;  3C8G A;  4WJ0 A;  1WWP A;  1ZW2 A;  1E84 A;  4WAB A;  3DZA A;  1SF8 A;  1MND A;  2LIG A;  2W45 A;  1JRA A;  4HEA J;  4I44 A;  3NDB B;  2J7P D;  3EZH A;  3VM6 A;  1F1M A;  5L0J A;  2QNL A;  3QZC A;  2H8A A;  2L6H A;  2EIN C;  4EBJ A;  3RVY A;  4G7Z F;  3GWN A;  2Y3B A;  1H9T A;  3SNH A;  4PJM A;  5DQT A;  1LI5 A;  5HSW A;  4P9T A;  3T9O A;  3U8P A;  4U5G A;  1ST6 A;  4LER A;  5BQH A;  3TJ6 A;  4C7O A;  2AU5 A;  2G62 A;  2YL3 A;  1OQC A;  4N06 A;  3C18 A;  3ZDL A;  3HNL A;  3IQ5 A;  3LS1 A;  5B1B C;  1ZHT A;  3B0V C;  1C02 A;  2ASR A;  2YKZ A;  3RH3 A;  5D91 A;  1M2O A;  3DKA A;  5DVW A;  2CCY A;  2AWC A;  1NBB A;  1TWA A;  2YWA A;  5COG A;  3TUL A;  2XS8 A;  3UR3 C;  2VCC A;  2OU6 A;  2P0N A;  4UDV A;  1SR2 A;  1GM5 A;  3ZG1 A;  2Y3G A;  2DB4 A;  4EUK B;  3DM5 A;  4I1O B;  4CS9 C;  4CIH A;  1HW2 A;  1A7E A;  4IB4 A;  2C03 A;  4IAO A;  5CIV A;  1N1C A;  3K1I A;  4E18 A;  3F47 A;  1FAP B;  3LAY A;  3QW0 A;  3SXM A;  2GAQ A;  1ZHZ A;  4JJF A;  3TD7 A;  3W8I A;  1YYJ A;  2R7S A;  4DOZ A;  1Z63 A;  1JAF A;  4D4X A;  4PR9 A;  1E83 A;  3Q6N A;  1RKE B;  2YVK A;  4JTD B;  2R7Q A;  2I8B A;  1ZYR F;  3PCV A;  4G0H A;  3HNJ A;  3K1H A;  2ETS A;  1L3P A;  3RQG A;  2J9U A;  1OCC C;  1U6H A;  2J0X A;  2XM0 A;  2ZXW C;  1VYK A;  3EPV A;  3SZR A;  3ZC4 A;  1D1C A;  1FFH A;  1OXK A;  4OIP F;  4XTK A;  2EIL C;  2J8W A;  2KQ9 A;  4DRI B;  2V3C C;  2A0U A;  4C3D A;  4YWQ A;  3QTH A;  3NYM A;  2OOC A;  3H2U A;  1WAT A;  3ASN C;  3EGX B;  4IGG A;  5FZT A;  4BG0 A;  3AQC A;  5JUA A;  2LFD A;  1Y6D A;  3ABK C;  4YT8 A;  5EHH A;  4NQF A;  4Q5S F;  2HUJ A;  2Y69 C;  2MHR A;  3U5S A;  2OKU A;  3B0U X;  3JTL O;  2KNH A;  5A6B A;  2YL1 A;  3LS0 A;  5E2Q A;  2HKV A;  3G4Z A;  3LUT B;  3LJB A;  1KTM A;  4YJW A;  2VCB A;  4U5H A;  5JRA A;  2L81 A;  3W4Y A;  1TKN A;  3C8G B;  3I4U A;  3N24 A;  4NTB A;  1A7V A;  4CSA A;  2VAS A;  5GPG B;  1AVO B;  3SP1 A;  1ORS C;  1LKX A;  3EZI A;  3DD7 A;  3POV A;  4CS9 A;  1OW6 A;  3IQ6 A;  3EJN A;  2HS5 A;  2LP4 A;  3EFO B;  3GM2 A;  3K1I C;  4O6Y A;  2G3V A;  4OD5 A;  2A6H F;  1HMD A;  2J9W A;  2QUP A;  3RVZ A;  4JCH A;  4JEB A;  3DWW A;  3L8I A;  4MS2 A;  4NTA A;  3T6G B;  2QTV A;  1LVK A;  3X2Q C;  2WVQ A;  2VH3 A;  1YYX A;  1CGO A;  4LDQ A;  4PK4 A;  4ER9 A;  3SXY A;  2WVN A;  3C8G D;  3PDM P;  1HY5 A;  1ZVZ A;  4MVR A;  3V5X A;  2GDC A;  1WOL A;  3UMH A;  3FVY A;  2P1A A;  2Q9A A;  2J7P A;  3FAP B;  5BQG A;  3ASO C;  2EPN A;  2LSE A;  4C3E A;  3HNI A;  1VTM P;  4BEJ A;  2LD6 A;  4U9D A;  3T6B A;  1MMN A;  1XZP A;  2YL7 A;  2Y3D A;  1TWC A;  2FGY A;  5E3C A;  4JUR I;  5DS5 A;  1C17 M;  4A4A A;  1JPN A;  2R02 A;  2FAP B;  5CI9 A;  1SZI A;  2PBE A;  3VF0 A;  3HNK A;  4MVO A;  1JOG A;  1YZC A;  1Z7Q c;  5DS4 A;  2OEX A;  2BC5 A;  4OIQ F;  1QKR A;  4WGY A;  1S05 A;  2IXN A;  2OJQ A;  2R03 A;  1CPR A;  2HZ8 A;  3ZQV A;  5A6J A;  1D0Y A;  2R9R B;  4U5D E;  5T3T A;  3WAQ A;  5D92 A;  3G4X A;  2CYD A;  3ZVR A;  3RFY A;  1YAU O;  1MQV A;  2KW3 C;  3NKE A;  4AL1 A;  5AC5 A;  2R7R A;  2PF4 E;  2Q3T A;  1Y4C A;  1Q0G A;  1SMY F;  1VMA A;  3JCU Q;  2XLO A;  2QY9 A;  1I5N A;  2Z15 A;  1YA7 O;  2FFH A;  2PFD A;  2W4M A;  3DMD A;  4JTC B;  5A6A A;  1LM3 B;  2XXA B;  4BJT A;  2EPM X;  1CGN A;  2OQM A;  4MTF A;  2LQG A;  2B0H A;  5A6B D;  2YL0 A;  2QLA A;  5F5F A;  1Q0F A;  1AUE A;  3GEE A;  3H2V A;  3L0I A;  4LDR A;  1EKY A;  1NLX A;  1QLE C;  2PNO A;  3QW1 A;  4O79 A;  1Z5Z A;  4XEF A;  5JSL A;  3O39 A;  3KPH A;  4ZLC A;  3KMI A;  1MMA A;  2KC3 A;  4FAP B;  3W2W A;  1Z3I X;  4ULW A;  4BJ5 A;  5AC4 A;  1WN0 A;  4DVZ A;  1H7I A;  2XLE A;  1G8X A;  1NZE A;  2XM4 A;  3LEV A;  2GA0 A;  3TOM A;  4JC7 A;  3AG4 C;  3DE8 A;  1Z23 A;  2D5R B;  1OR3 A;  5E33 A;  2AP3 A;  5TJ5 E;  2XS1 A;  2J0W A;  2VC9 A;  3GM3 A;  1L7C A;  3O55 A;  3OA1 A;  4CSA C;  1RKE A;  2EIM C;  2HMQ A;  3DJU B;  3SEO A;  1QZX A;  4DJ9 A;  5F5H A;  4JTA B;  2G3K A;  3FAJ A;  3FOP A;  2VCA A;  3M4C A;  5L0I A;  3EGD A;  2R7X A;  3EQL F;  1ZZP A;  2HV7 A;  4J7T A;  5COM A;  3DJN B;  3TOL A;  5B3S C;  3AGT A;  2R05 A;  4HFK B;  4CS7 A;  5IY5 C;  2IXM A;  3B0P A;  4U5C E;  1VOM A;  4IRU A;  3OEO A;  1M2V B;  2NUP A;  4JIO A;  2RSE B;  3KYI A;  2M4E A;  4X0R A;  1MMD A;  2CNW A;  3CAX A;  3M79 A;  1D1B A;  1QQ3 A;  4OIR F;  4BJ6 A;  4E17 A;  1OKK A;  3U3B A;  1IZM A;  2A1D D;  3AOU A;  4GEH A;  2XLV A;  3VYW A;  4YT2 A;  3U0C A;  4EKW A;  5L0H A;  1YA9 A;  1PCX A;  1NFN A;  2DYR C;  2Y39 A;  2KSF A;  3A11 A;  2Q4F A;  4GQH A;  5KYX B;  3PHF 2;  3JRM O;  4ULV A;  2HMZ A;  2Q7R A;  2NSG A;  2OEV A;  3QVZ A;  5KYW A;  1LE4 A;  1VLS A;  3GM1 A;  4CDV A;  2YLD A;  1MNE A;  2A6E F;  4E7S A;  4O6N A;  2V26 A;  2X51 A;  1BR4 A;  1OW7 A;  2DI3 A;  1G5Z A;  3ATP A;  4PFO A;  4YT4 A;  1TQG A;  3O10 A;  2H7O A;  2EPO A;  3UNG C;  1RJ9 B;  1Q0D A;  2H7B A;  2XL8 A;  2QE9 A;  3AG3 C;  3EG9 A;  4DVY P;  4JVS A;  3J06 A;  3LLI A;  4AE4 B;  2R25 A;  4L6R A;  5KYU B;  3DAG A;  5B1A C;  1G4U S;  2VB6 A;  4MTO A;  4G7O F;  3H65 A;  1I4Z A;  1VK5 A;  5AGF A;  1JPJ A;  2NG1 A;  2NUT A;  3S9O A;  2W4B A;  2YQY A;  4EBK A;  5B3I A;  1EQ1 A;  2NPU A;  4B6I A;  3DM9 B;  2YLI A;  3EH1 A;  1V4A A;  2EIJ C;  4LDK A;  3M15 A;  3NYL A;  4NTF A;  4U5B E;  5T3W A;  4BEM J;  4U5F E;  1NU9 C;  3N2Z B;  2IM8 A;  3B71 A;  4G78 A;  1ZHX A;  4J30 B;  4O6M A;  4Z9H A;  2XRH A;  3RKO F;  2ZD9 A;  5HV9 A;  3K33 A;  1KU2 A;  2BL2 A;  5JP7 A;  3W2V A;  1ORY A;  2EPK X;  1RMV A;  2JX0 A;  1D0X A;  3C8Z A;  3NMK A;  3WOD F;  3MX3 A;  1LIH A;  4DBR A;  1GS9 A;  1YLM A;  1JMW A;  4BJ6 C;  4FX5 A;  4W8K A;  4H54 A;  3X1O A;  2D4U A;  4HFF B;  2WZG A;  3B9Q A;  1B68 A;  1O3U A;  5EK0 A;  2R7W A;  2P61 A;  1TR2 A;  3US6 A;  4XWJ A;  5L0C A;  4NC3 A;  3ABM C;  1K04 A;  2I15 A;  2HJ3 A;  3RQF A;  4ONS A;  3NG1 A;  2OG2 A;  3K66 A;  4YL0 A;  4IWB A;  4CJO A;  2JPU A;  1BBH A;  256B A;  2E87 A;  3EG9 B;  1ZHY A;  4EBB A;  2YZS A;  2PX0 A;  1T5O A;  3QVY A;  5K0I A;  3EGD B;  5L0D A;  2JD3 A;  4LLE A;  4QI2 A;  4XQ1 A;  1J8Y F;  2EIK C;  1WAS A;  1V74 B;  3LNM B;  1R4T A;  1T6Q A;  4IAR A;  4I3M A;  1DOV A;  4DXW A;  4EHP A;  4DRH B;  1RCP A;  1BR1 A;  4CS8 A;  3SXZ A;  1PD0 A;  1ZU5 A;  3T6J A;  1V55 C;  3RYL A;  2WL8 A;  1AEP A;  1LS4 A;  1W2W A;  3IPM O;  3ITF A;  4FES A;  4ANJ A;  1FTS A;  4I1M A;  3OWT A;  2TMV P;  2LK4 A;  1MMG A;  4AX2 A;  5JS5 A;  2C04 A;  4JJG A;  1TFO B;  3ZQY A;  2R7U A;  5JT4 A;  4MTG A;  4CJG A;  1HE1 A;  3VAY A;  4CIP A;  4HE8 D;  2ZXR A;  4KBL A;  3U2L A;  3R2P A;  4G7H F;  3VRC A;  1LI7 A;  2HSQ A;  2WZF A;  1S7Z A;  3S28 A;  4A2N B;  4CS8 C;  1BZ4 A;  1D1A A;  3B29 A;  3EHN A;  3JRT A;  4N6C A;  5JLI A;  1O5H A;  2O9X A;  4WGZ A;  2BE5 F;  3DI5 A;  2IYL D;  3R7C A;  1J8M F;  1HE9 A;  2EPL X;  3IHU A;  3NMJ A;  2CNW D;  3MYI A;  4P9F A;  4RDA A;  3L1M A;  4XEV A;  5L0G A;  1Z6A A;  2AVK A;  2UUH A;  2WVO A;  4LLC A;  2J45 A;  4YK5 A;  1K05 A;  2XL4 A;  2WB7 A;  3CSK A;  3DE9 A;  3MBG A;  4XLN F;  3ZTM A;  3F46 A;  3AQB A;  3C63 A;  4PJN A;  1YVI A;  2DGJ A;  3A9C A;  1EA8 A;  2X0C A;  5BQI A;  5JVE A;  3UGP A;  4Q4Z F;  2MWQ A;  4J7Y A;  4JW1 A;  5F28 E;  5KYY B;  3ZIB A;  3FHD A;  3FXH A;  2J9B A;  2YEV A;  2Q00 A;  3T4R A;  4MVS A;  1O87 A;  2LFF A;  2NUT B;  3C62 A;  3MFN A;  3WHN A;  2R7O A;  4IAQ A;  4JCZ A;  1QSP A;  3RW0 A;  3WG7 C;  4K1O A;  2KGO A;  5L3Q A;  3AG1 C;  1A41 A;  2MYS A;  3ECS A;  2GFH A;  4JKV A;  1ZHW A;  2YRF A;  4CDA A;  3JT1 A;  1VB5 A;  2L9J A;  4M63 A;  3KL4 A;  1QVX A;  3AG2 C;  4XPW A;  1U0B B;  4LAC B;  4KNV A;  4NY3 A;  3JYH A;  2KK1 A;  2XLM A;  4R32 A;  1T01 A;  1WGW A;  4FWV A;  4EWC A;  2Y3H A;  4BJ1 A;  4KI2 A;  5L0F A;  2IXP A;  3CEX A;  3L8J A;  2AWY A;  4DBQ A;  2A69 F;  3Q7L A;  2NSF A;  1M6T A;  4BPM A;  3Q7G A;  1YDI A;  3U2M A;  2XLD A;  3O6X A;  2HSB A;  3U9J A;  2R7T A;  2HV6 A;  4K0D A;  5COF A;  5KYW B;  3EGX A;  1FMW A;  2B0J A;  3MYF A;  3RIP A;  4RBN A;  3SYN A;  4KC9 A;  4MQ9 F;  3SXK A;  3UGO A;  2Q9C A; 
#chains in the Genus database with same CATH homology
 4DRI B;  1FAP B;  2GAQ A;  4FAP B;  4DRJ B;  1NSG B;  5GPG B;  4DRH B;  2RSE B;  3FAP B;  2FAP B;  1AUE A;  2NPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...