2RSEB

Nmr structure of fkbp12-mtor frb domain-rapamycin complex structure determined based on pcs
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
VAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
publication title Convenient method for resolving degeneracies due to symmetry of the magnetic susceptibility tensor and its application to pseudo contact shift-based protein-protein complex structure determination.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 94
sequence length 94
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 2rseB00
4DRHB 2FAPB 2RSEB 1NSGB 2GAQA 1AUEA 4FAPB 2NPUA 1FAPB 5GPGB 3FAPB 4DRJB 4DRIB
chains in the Genus database with same CATH superfamily
4XQ1A 3HKKA 4J7TA 3NMJA 2XXAB 2HZ8A 2A1DD 5A6BD 2Y3HA 2UUHA 3HNKA 1HY5A 1V4AA 4WGYA 3K1HA 1CGNA 1KU2A 4CS7A 3HJCA 2EILC 3QZCA 5T3TA 2R9RB 3TOMA 4Q7CA 4AL1A 4E0IA 1A41A 5CIVA 4G7HF 2ETSA 4PACA 3QVYA 4HFKB 3PHF2 3RQEA 3U9MA 1EI7A 4XPWA 5A6BA 3KH2A 3C8GB 3NRHA 4XWJA 2HUJA 3EZIA 5CI8A 3PCVA 3ZQVA 1HE9A 1SZIA 4EWCA 3DZAA 3H65A 3VRCA 2DYRC 3CSKA 2EPLX 3EG9B 3HTKC 4ANJA 4E0HA 2CW0F 1YAUO 2XLHA 4U5DE 1YYXA 1YJGA 5FCLA 4OIPF 1N1CA 1WOLA 3SZRA 1Y4CA 2HJ3A 3S84A 3ABLC 3EH2A 1C02A 1LE2A 3B9QA 4JEAA 2Q4FA 3T6BA 2R7TA 2HFIA 2P1AA 3TK0A 1VK5A 2I15A 4XPYA 2VCAA 4NY3A 1E83A 3FAPB 1ZU4A 3JT1A 5DS6A 4BJ6C 2XXAA 4QI0A 2HSBA 2Y3BA 2FAPB 4CJOA 2LK4A 3B0PA 3C8GD 4WJ0A 3JRMO 2WB7A 3TQOA 2NUTB 4H54A 3U5SA 4O6YA 1YLMA 3ATPA 1U6HA 1C03A 3JTLO 2R25A 1Q0DA 2LP4A 2R05A 2HMZA 3POVA 2IXPA 2LIGA 3K1IC 5DVWA 2Y39A 4IJJA 3C8GA 1QQ3A 1WN0A 3V7OA 4KI2A 1AEPA 4OIRF 3W2VA 2MWQA 2Y3GA 2M4EA 1LI7A 3EHMA 3SNHA 3QW1A 1JRAA 3EG9A 4MVUA 2YVKA 2L7AA 4ER9A 2XL8A 3IQTA 5KYYB 4CJGA 5L0FA 1FMVA 4NQFA 2OU6A 3GEEA 1CGOA 2OOCA 1YA9A 2CCYA 2QNLA 4CS9C 3JRTA 1OCZC 1NBBA 2IXNA 4P9TA 2XS1A 4KNWA 5DQZA 4EHPA 2G62A 2OEXA 3U0CA 4ULWA 5B1BC 3J06A 4J32B 3BEHA 4CSAC 2G3KA 1WATA 4NC3A 3H2VA 1FFHA 3C62A 5E3AA 3RF3A 2GA0A 1A0BA 1QVXA 2AWYA 4O6NA 3JZ0A 4Z9IA 1D1BA 1OR3A 2AP3A 1DOVA 1WGWA 1XZQA 1BR1A 4I1OB 4MTOA 4O6MA 3K33A 2O9XA 5AGFA 2R7VA 4P6IC 4LACB 3NYMA 2D4UA 4Z9JA 2DYSC 4GEHA 4KC9A 5EGYA 1IW7F 4U5GA 1S05A 1E86A 1TWHA 2Q00A 2A6HF 1O5HA 2ZD9A 3L8IA 1RJ9B 3T9OA 1T6UA 2Q9BA 3C7JA 3L1MA 2A69F 2EIJC 2L6GA 1C17M 1LS4A 2CGEA 3EQLF 4CS8A 2PX3A 4N4WA 4DOZA 3B0VC 5KYYA 1T6QA 4AL0A 4JJGA 2XLOA 1JAFA 2QY9A 3E9VA 1BBHA 1V54C 3NKEA 1NFOA 3IEEA 3EH1A 2OJQA 5TJ5E 4CDVA 1S7ZA 3UMIA 4MW8A 3DJNB 5CI9A 3RW0A 2X51A 3ASOC 4E18A 5IY5C 2YWAA 1BR2A 4DXWA 1PCXA 3X1OA 4ZLCA 2R7UA 5L0DA 2J0WA 1WTYA 2WVQA 2XM4A 3UGOA 4DRIB 4O7GA 4LDKA 3GM1A 1M6TA 3U2MA 1LKXA 3DM9B 3IQ6A 3M4CA 1LI5A 2NPUA 3Q7LA 3LUTB 4HE8D 1EA8A 2EPOA 3N24A 3CQZA 2H7BA 5A6KA 3DWWA 5BQIA 5L0GA 3SXMA 2Z15A 5JT4A 5BUOA 2J45A 4U9EA 5JVEA 1OCRC 3RIPA 4AE4B 1E84A 4AK9A 1VB5A 1E2XA 1VLSA 4DBRA 1VOMA 2YKZA 3I5QA 5T1DB 5KYXB 1RJ9A 2YEVA 3B71A 3EFOB 3L34A 3LJBA 2Y3DA 1H7IA 1RXQA 5AC4A 2YL1A 4JTDB 2L81A 4YK5A 4PJMA 1OCCC 2W4MA 1D1AA 4JTAB 4YT5A 3BRJA 3MYIA 1FAPB 256BA 2VASA 2WZGA 2OQMA 3W2WA 4FAPB 3Q6NA 5JP7A 3G4XA 2LFFA 4EBBA 1K05A 1VMAA 1YZAA 3FOOA 2WL8A 3JSZA 1GS9A 1H9GA 4IAQA 4YL3A 2ZXPA 3NMKA 3WAQA 3AQCA 2R7OA 3ZG1A 3MYFA 5L3VA 1HW2A 4YWQA 3S0XA 3AG1C 1I4ZA 1ST6A 4EKWA 4NTAA 3ITFA 3G50A 1H6GA 1OXKA 2J9UA 1YZCA 3MBGA 5EK0A 3SP1A 1JPNA 2QUPA 3B0UX 1Q0GA 2EPNA 3SXKA 2CNWD 1EKYA 3H2UA 3IQCA 3KYJA 4MVOA 2HV6A 2EINC 2Q9CA 1MNDA 1SMYF 2OCCC 3FMSA 4YN0B 2WZFA 3T6JA 4E17A 4EUKB 3NDBB 2KNHA 2QLAA 3GM3A 4AE4A 4E7ZA 1RKEB 5L0IA 3VM6A 2QE9A 1MNEA 4JVSA 2CNWA 1Z6AA 2IOQA 2J7PD 5B1AC 2X0CA 3RVYA 2ZXWC 1W2WA 2WVNA 4K1OA 4OD5A 4U5BE 3EFOA 4BJ1A 3WG7C 4XEVA 5L3QA 2J9VA 2OG2A 2LCHA 3GWLA 4C3DA 2AU5A 1XWJA 5HV9A 1VYKA 1SR2A 2FGYA 1L7CA 3DI5A 4NCQA 2W45A 4I44A 4E7SA 2J7PA 2OKUA 3TD7A 2HJMA 4JCHA 1Y6DA 1I4YA 2JX0A 4LERA 5D92A 4A4AA 2F22A 1Z63A 4W8KA 2Y69C 3U3FA 3V5XA 4C3BA 4A2NB 5DLJA 2OJED 3Q7GA 2L9JA 3FXHA 4JIOA 2IXOA 1Q0MA 1B68A 4B6IA 1MMDA 4XPXA 2EPMX 2NUPB 4N6CA 1G8XA 1YVIA 1HMDA 4EBJA 5KYNA 2YLGA 4G0HA 3O55A 2NUTA 5B3SC 3WHNA 4DVZA 3AOUA 3M4BA 1RKEA 1ORJA 1A7EA 3W4YA 4CBEA 4GQHA 3OWTA 2XLWA 2XRHA 3A9CA 2C03A 2L6HA 4CS8C 4IB4A 2LQGA 4BJ5A 1TKNA 4XLPF 5F5FA 4JTCB 3AGTA 4P9FA 2KW3C 3GM2A 2Q9AA 4C7OB 1RMVA 3LEVA 1DOWA 3ABMC 5DS4A 4G7ZF 5COFA 4GYTA 4N6HA 1CGME 2BC5A 2W4BA 1ZHZA 3IHUA 2C04A 2DI3A 4FWVA 4W8PA 5BQGA 2ASRA 2LD6A 1JMWA 3V5ZA 5L0JA 4O79A 3O6XA 2XLMA 4JE9A 3E70C 1V74B 3N0TA 4MNDA 1ZZPA 4AX2A 1E85A 1J8MF 2B0JA 4YT4A 1K04A 1OKKD 2J46A 4HEAJ 1OW8A 2AWCA 4HFFB 4L6RA 2GFHA 1VLTA 2R03A 3GORA 3RFYA 3SXZA 3UMHA 2M64A 1YDIA 3NMIA 3LS0A 3IPMO 1O3UA 2Q7RA 4LLCA 1ZU5A 1TWCA 3CEXA 3ZVRA 3SYNA 2I8BA 2IXMA 1OKKA 3ZDLA 2B0HA 2KQ9A 1BR4A 2KJGA 3K66A 2ZXRA 3PMRA 3PDMP 1FTSA 1M57C 3ECSA 3DXJF 3ZTMA 2HS5A 3I4UA 1TWAA 3T4RA 4I1MA 3DMDA 5A6AA 1BDJB 3K7DA 2ZXOA 3NKDA 3FHDA 4C7OA 2W9YA 2XSEA 1R4TA 1D1CA 1WWPA 2L6FA 1FMWA 4PFOA 4MVZA 1VTMP 3R7CA 3QTHA 4QDLA 1QKRA 4YL0A 4RBNA 4F4BA 2IYLD 4MTFA 4MVRA 3MLGA 4CX9A 3NYLA 5F28E 1CPQA 1IZMA 1T9KA 2ICWG 4H4KC 1PD0A 5L0HA 3GWNA 2YLDA 1T6IA 4M63A 2A68F 3QVZA 2EIKC 1YYJA 1QLEC 4NTBA 5JSLA 3ZQYA 3RQGA 3ZTZA 3AJMA 3DAGA 2J9BA 1ZHTA 5D91A 2J0XA 3OA1A 3U8VA 2PFDA 4PJNA 2GAQA 1U89A 4U9DA 3S27A 5DQTA 3RQFA 5A6JA 1JR8A 5GPGB 2YL7A 4PK4A 2D5RB 1LIHA 1MMNA 1M2OA 1QSPA 1ZHYA 3C8ZA 3CZ6A 3ZWIA 2R7XA 4IARA 3KPHA 2WZLA 4OD4A 1ZW2A 4Q4ZF 2QTVA 3UGPA 2R7RA 2J8WA 1SYQA 3K6BA 2J9WA 2A0UA 3S9OA 1FNTc 1O87A 1LS1A 1LM3B 3DKAA 4WGZA 1T5OA 5E3CA 4OIOF 3JYHA 1ORYA 2RD9A 1Z23A 2VC9A 3U9JA 3UMKA 5EHHA 5L0CA 1A7DA 2UUIA 2VH3A 3DJUB 4IRUA 1APCA 4MVQA 3VYWA 2PF4E 2PX0A 3TJ5A 1PV3A 4DVYP 3DE8A 2YL0A 4ZLDA 2CDQA 3RYLA 3LEOA 1M2VB 3O39A 1OW7A 2VCCA 3RH3A 4ONSA 1H9TA 1NFNA 3DD7A 4IAOA 2A0BA 3C18A 1LPEA 3QMKA 4NTFA 2XLVA 4EBKA 2NSGA 4CIPA 3ZIBA 1NZEA 4CDYA 2KYHA 3FVYA 4I3MA 3ZC4A 1OXBA 1TFKB 3LESA 4JCZA 4XTKA 4BJTA 2EIMC 3KKBA 3F46A 3KYIA 3RVZA 3UNGC 5KYXA 4JURI 2JPUA 2V26A 2XS8A 2YL3A 3LNRA 3S28A 1AVOB 1G4WR 1FFTC 3CAXA 2FFHA 3LS1A 4MVSA 4ULVA 1PD1A 4BJ5C 1WASA 3KMIA 1I5NA 1NG1A 3LNMB 3M15A 4MVMA 4KNVA 3RKOF 3OEOA 1SF8A 1ZHWA 3L8JA 3LLKA 4RD9A 3EHNA 2P6VA 2BE5F 3NYJA 4X0RA 3HLZA 1OQCA 4LDRA 2V3CC 2KSFA 1HW1A 2DB4A 1OCOC 3VF0A 1D0XA 2MHRA 1A7VA 1G4US 3HNJA 3Q6MA 2XM0A 2IBFA 3FAJA 1R5ID 3S90A 4KBLA 4MTGA 1U0BB 3AGUA 1M56C 1HMOA 1TFOB 4PJLA 1M2VA 3EGXB 4PFPA 5DS5A 2XLEA 5JLIA 1ORSC 2PBEA 2VB6A 1UG7A 3A11A 4JKVA 5FZTA 3DE9A 2PP4A 4JZAA 1GGQA 4J30B 1F1MA 3WODF 2YZSA 1KNYA 3ZSUA 1QZXA 3FOPA 4YL1A 4OINF 1G5ZA 1YARO 4U5HA 4IWBA 2NSFA 2GWWA 2G3VA 4DJ9A 3U2LA 5B3IA 5KYUB 1HE1A 1XZPA 2OEVA 2ZPAA 2YLIA 3EJNA 3GEHA 4RDAA 2R7QA 4U5FE 5E2QA 3HNIA 4LDQA 3U8PA 5BQHA 5K0IA 3AG2C 2R7SA 3DM5A 2H7VC 2P0NA 4JRZA 5KYWB 1CPRA 1MMAA 4FX5A 3KL4A 1ZHXA 1L3PA 4MW3A 4J7YA 3T6GB 1ZVZA 4MS2A 3W8IA 2R7WA 1D0YA 1Z5ZA 3VAYA 1GM5A 2KC3A 3JCUQ 3NG1A 2E87A 4QI2A 2HSQA 3GODA 3AG4C 1J8YF 3FDQA 1NU7D 3AQBA 3JYYA 4DRHB 4YT2A 4U5EE 1LE4A 2AVKA 2PNOA 1TQGA 4UDVA 2LFDA 4D4XA 4Q5SF 3M1CB 3EGDB 3LAYA 1GQAA 3EGXA 3G4ZA 2NUPA 4BJ6A 1VYIA 2TMVP 1OR2A 2MYSA 2HMQA 3DAFA 2CYDA 2H8AA 3JSEO 3X2QC 4JW1A 2KGOA 2VCBA 4G78A 4Z9HA 5HSWA 2RSEB 5COMA 4K0DA 1NLXA 4DBQA 2IM8A 1LVKA 2XL4A 3M79A 4PJJA 4JC7A 4XEFA 3V5YA 1RKCA 5JS5A 1NU9C 5KYUA 3K1IA 3U3BA 2KK1A 3GEIA 3MFNA 2BL2A 3MX3A 1ZYRF 3W8HA 5E33A 3TULA 4XEKA 4BPMA 4BEMJ 2WVOA 4LLEA 5T3WA 3TOLA 4YT8A 2HKVA 5KYWA 3N2ZB 3SEOA 5JRAA 2XL6A 5COGA 4DRJB 4CIHA 1EQ1A 1KTMA 4XLNF 2Q3TA 1Q0FA 3US6A 1BZ4A 1AUEA 4CS9A 2A6EF 2YQYA 1Z3IX 4D4NA 5A69A 3C63A 3R2PA 1RCPA 3GANA 2DGJA 3EGDA 3QW0A 2R02A 1ZW3A 3L0IA 4CDAA 2NG1A 4FESA 1JOGA 4CSAA 1K40A 1FR0A 1T01A 3HNLA 2P61A 3F47A 3I5PA 1JPJA 1NSGB 2JD3A 2YHSA 3LLIA 4N06A 1MMGA 1TR2A 2LSEA 4MQ9F 4YJWA 2GDCA 3AG3C 3ASNC 3ABKC 4JJFA 2P7VA 3IQ5A 4OIQF 4G7OF 1D0ZA 5F5HA 1MQVA 2EPKX 3EZHA 4IGGA 5AC5A 4C3EA 3UR3C 4EIYA 4K7BA 3TJ6A 4U5CE 1QPUA 3EPVA 4PR9A 4R32A 2H7OA 3SXYA 1OW6A 1Q0KA 1YA7O 1Z7Qc 1V55C 4JEBA 2HV7A 5JUAA 4BG0A 1UFBA 3S29A 4BEJA 3B29A 2XLDA 1TWGA 3O10A 2YRFA 4WABA
chains in the Genus database with same CATH topology
4DRHB 2FAPB 2RSEB 1NSGB 2GAQA 1AUEA 4FAPB 2NPUA 1FAPB 5GPGB 3FAPB 4DRJB 4DRIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRH B;  2FAP B;  2RSE B;  1NSG B;  2GAQ A;  1AUE A;  4FAP B;  2NPU A;  1FAP B;  5GPG B;  3FAP B;  4DRJ B;  4DRI B; 
#chains in the Genus database with same CATH topology
 4XQ1 A;  3HKK A;  4J7T A;  3NMJ A;  2XXA B;  2HZ8 A;  2A1D D;  5A6B D;  2Y3H A;  2UUH A;  3HNK A;  1HY5 A;  1V4A A;  4WGY A;  3K1H A;  1CGN A;  1KU2 A;  4CS7 A;  3HJC A;  2EIL C;  3QZC A;  5T3T A;  2R9R B;  3TOM A;  4Q7C A;  4AL1 A;  4E0I A;  1A41 A;  5CIV A;  4G7H F;  2ETS A;  4PAC A;  3QVY A;  4HFK B;  3PHF 2;  3RQE A;  3U9M A;  1EI7 A;  4XPW A;  5A6B A;  3KH2 A;  3C8G B;  3NRH A;  4XWJ A;  2HUJ A;  3EZI A;  5CI8 A;  3PCV A;  3ZQV A;  1HE9 A;  1SZI A;  4EWC A;  3DZA A;  3H65 A;  3VRC A;  2DYR C;  3CSK A;  2EPL X;  3EG9 B;  3HTK C;  4ANJ A;  4E0H A;  2CW0 F;  1YAU O;  2XLH A;  4U5D E;  1YYX A;  1YJG A;  5FCL A;  4OIP F;  1N1C A;  1WOL A;  3SZR A;  1Y4C A;  2HJ3 A;  3S84 A;  3ABL C;  3EH2 A;  1C02 A;  1LE2 A;  3B9Q A;  4JEA A;  2Q4F A;  3T6B A;  2R7T A;  2HFI A;  2P1A A;  3TK0 A;  1VK5 A;  2I15 A;  4XPY A;  2VCA A;  4NY3 A;  1E83 A;  3FAP B;  1ZU4 A;  3JT1 A;  5DS6 A;  4BJ6 C;  2XXA A;  4QI0 A;  2HSB A;  2Y3B A;  2FAP B;  4CJO A;  2LK4 A;  3B0P A;  3C8G D;  4WJ0 A;  3JRM O;  2WB7 A;  3TQO A;  2NUT B;  4H54 A;  3U5S A;  4O6Y A;  1YLM A;  3ATP A;  1U6H A;  1C03 A;  3JTL O;  2R25 A;  1Q0D A;  2LP4 A;  2R05 A;  2HMZ A;  3POV A;  2IXP A;  2LIG A;  3K1I C;  5DVW A;  2Y39 A;  4IJJ A;  3C8G A;  1QQ3 A;  1WN0 A;  3V7O A;  4KI2 A;  1AEP A;  4OIR F;  3W2V A;  2MWQ A;  2Y3G A;  2M4E A;  1LI7 A;  3EHM A;  3SNH A;  3QW1 A;  1JRA A;  3EG9 A;  4MVU A;  2YVK A;  2L7A A;  4ER9 A;  2XL8 A;  3IQT A;  5KYY B;  4CJG A;  5L0F A;  1FMV A;  4NQF A;  2OU6 A;  3GEE A;  1CGO A;  2OOC A;  1YA9 A;  2CCY A;  2QNL A;  4CS9 C;  3JRT A;  1OCZ C;  1NBB A;  2IXN A;  4P9T A;  2XS1 A;  4KNW A;  5DQZ A;  4EHP A;  2G62 A;  2OEX A;  3U0C A;  4ULW A;  5B1B C;  3J06 A;  4J32 B;  3BEH A;  4CSA C;  2G3K A;  1WAT A;  4NC3 A;  3H2V A;  1FFH A;  3C62 A;  5E3A A;  3RF3 A;  2GA0 A;  1A0B A;  1QVX A;  2AWY A;  4O6N A;  3JZ0 A;  4Z9I A;  1D1B A;  1OR3 A;  2AP3 A;  1DOV A;  1WGW A;  1XZQ A;  1BR1 A;  4I1O B;  4MTO A;  4O6M A;  3K33 A;  2O9X A;  5AGF A;  2R7V A;  4P6I C;  4LAC B;  3NYM A;  2D4U A;  4Z9J A;  2DYS C;  4GEH A;  4KC9 A;  5EGY A;  1IW7 F;  4U5G A;  1S05 A;  1E86 A;  1TWH A;  2Q00 A;  2A6H F;  1O5H A;  2ZD9 A;  3L8I A;  1RJ9 B;  3T9O A;  1T6U A;  2Q9B A;  3C7J A;  3L1M A;  2A69 F;  2EIJ C;  2L6G A;  1C17 M;  1LS4 A;  2CGE A;  3EQL F;  4CS8 A;  2PX3 A;  4N4W A;  4DOZ A;  3B0V C;  5KYY A;  1T6Q A;  4AL0 A;  4JJG A;  2XLO A;  1JAF A;  2QY9 A;  3E9V A;  1BBH A;  1V54 C;  3NKE A;  1NFO A;  3IEE A;  3EH1 A;  2OJQ A;  5TJ5 E;  4CDV A;  1S7Z A;  3UMI A;  4MW8 A;  3DJN B;  5CI9 A;  3RW0 A;  2X51 A;  3ASO C;  4E18 A;  5IY5 C;  2YWA A;  1BR2 A;  4DXW A;  1PCX A;  3X1O A;  4ZLC A;  2R7U A;  5L0D A;  2J0W A;  1WTY A;  2WVQ A;  2XM4 A;  3UGO A;  4DRI B;  4O7G A;  4LDK A;  3GM1 A;  1M6T A;  3U2M A;  1LKX A;  3DM9 B;  3IQ6 A;  3M4C A;  1LI5 A;  2NPU A;  3Q7L A;  3LUT B;  4HE8 D;  1EA8 A;  2EPO A;  3N24 A;  3CQZ A;  2H7B A;  5A6K A;  3DWW A;  5BQI A;  5L0G A;  3SXM A;  2Z15 A;  5JT4 A;  5BUO A;  2J45 A;  4U9E A;  5JVE A;  1OCR C;  3RIP A;  4AE4 B;  1E84 A;  4AK9 A;  1VB5 A;  1E2X A;  1VLS A;  4DBR A;  1VOM A;  2YKZ A;  3I5Q A;  5T1D B;  5KYX B;  1RJ9 A;  2YEV A;  3B71 A;  3EFO B;  3L34 A;  3LJB A;  2Y3D A;  1H7I A;  1RXQ A;  5AC4 A;  2YL1 A;  4JTD B;  2L81 A;  4YK5 A;  4PJM A;  1OCC C;  2W4M A;  1D1A A;  4JTA B;  4YT5 A;  3BRJ A;  3MYI A;  1FAP B;  256B A;  2VAS A;  2WZG A;  2OQM A;  3W2W A;  4FAP B;  3Q6N A;  5JP7 A;  3G4X A;  2LFF A;  4EBB A;  1K05 A;  1VMA A;  1YZA A;  3FOO A;  2WL8 A;  3JSZ A;  1GS9 A;  1H9G A;  4IAQ A;  4YL3 A;  2ZXP A;  3NMK A;  3WAQ A;  3AQC A;  2R7O A;  3ZG1 A;  3MYF A;  5L3V A;  1HW2 A;  4YWQ A;  3S0X A;  3AG1 C;  1I4Z A;  1ST6 A;  4EKW A;  4NTA A;  3ITF A;  3G50 A;  1H6G A;  1OXK A;  2J9U A;  1YZC A;  3MBG A;  5EK0 A;  3SP1 A;  1JPN A;  2QUP A;  3B0U X;  1Q0G A;  2EPN A;  3SXK A;  2CNW D;  1EKY A;  3H2U A;  3IQC A;  3KYJ A;  4MVO A;  2HV6 A;  2EIN C;  2Q9C A;  1MND A;  1SMY F;  2OCC C;  3FMS A;  4YN0 B;  2WZF A;  3T6J A;  4E17 A;  4EUK B;  3NDB B;  2KNH A;  2QLA A;  3GM3 A;  4AE4 A;  4E7Z A;  1RKE B;  5L0I A;  3VM6 A;  2QE9 A;  1MNE A;  4JVS A;  2CNW A;  1Z6A A;  2IOQ A;  2J7P D;  5B1A C;  2X0C A;  3RVY A;  2ZXW C;  1W2W A;  2WVN A;  4K1O A;  4OD5 A;  4U5B E;  3EFO A;  4BJ1 A;  3WG7 C;  4XEV A;  5L3Q A;  2J9V A;  2OG2 A;  2LCH A;  3GWL A;  4C3D A;  2AU5 A;  1XWJ A;  5HV9 A;  1VYK A;  1SR2 A;  2FGY A;  1L7C A;  3DI5 A;  4NCQ A;  2W45 A;  4I44 A;  4E7S A;  2J7P A;  2OKU A;  3TD7 A;  2HJM A;  4JCH A;  1Y6D A;  1I4Y A;  2JX0 A;  4LER A;  5D92 A;  4A4A A;  2F22 A;  1Z63 A;  4W8K A;  2Y69 C;  3U3F A;  3V5X A;  4C3B A;  4A2N B;  5DLJ A;  2OJE D;  3Q7G A;  2L9J A;  3FXH A;  4JIO A;  2IXO A;  1Q0M A;  1B68 A;  4B6I A;  1MMD A;  4XPX A;  2EPM X;  2NUP B;  4N6C A;  1G8X A;  1YVI A;  1HMD A;  4EBJ A;  5KYN A;  2YLG A;  4G0H A;  3O55 A;  2NUT A;  5B3S C;  3WHN A;  4DVZ A;  3AOU A;  3M4B A;  1RKE A;  1ORJ A;  1A7E A;  3W4Y A;  4CBE A;  4GQH A;  3OWT A;  2XLW A;  2XRH A;  3A9C A;  2C03 A;  2L6H A;  4CS8 C;  4IB4 A;  2LQG A;  4BJ5 A;  1TKN A;  4XLP F;  5F5F A;  4JTC B;  3AGT A;  4P9F A;  2KW3 C;  3GM2 A;  2Q9A A;  4C7O B;  1RMV A;  3LEV A;  1DOW A;  3ABM C;  5DS4 A;  4G7Z F;  5COF A;  4GYT A;  4N6H A;  1CGM E;  2BC5 A;  2W4B A;  1ZHZ A;  3IHU A;  2C04 A;  2DI3 A;  4FWV A;  4W8P A;  5BQG A;  2ASR A;  2LD6 A;  1JMW A;  3V5Z A;  5L0J A;  4O79 A;  3O6X A;  2XLM A;  4JE9 A;  3E70 C;  1V74 B;  3N0T A;  4MND A;  1ZZP A;  4AX2 A;  1E85 A;  1J8M F;  2B0J A;  4YT4 A;  1K04 A;  1OKK D;  2J46 A;  4HEA J;  1OW8 A;  2AWC A;  4HFF B;  4L6R A;  2GFH A;  1VLT A;  2R03 A;  3GOR A;  3RFY A;  3SXZ A;  3UMH A;  2M64 A;  1YDI A;  3NMI A;  3LS0 A;  3IPM O;  1O3U A;  2Q7R A;  4LLC A;  1ZU5 A;  1TWC A;  3CEX A;  3ZVR A;  3SYN A;  2I8B A;  2IXM A;  1OKK A;  3ZDL A;  2B0H A;  2KQ9 A;  1BR4 A;  2KJG A;  3K66 A;  2ZXR A;  3PMR A;  3PDM P;  1FTS A;  1M57 C;  3ECS A;  3DXJ F;  3ZTM A;  2HS5 A;  3I4U A;  1TWA A;  3T4R A;  4I1M A;  3DMD A;  5A6A A;  1BDJ B;  3K7D A;  2ZXO A;  3NKD A;  3FHD A;  4C7O A;  2W9Y A;  2XSE A;  1R4T A;  1D1C A;  1WWP A;  2L6F A;  1FMW A;  4PFO A;  4MVZ A;  1VTM P;  3R7C A;  3QTH A;  4QDL A;  1QKR A;  4YL0 A;  4RBN A;  4F4B A;  2IYL D;  4MTF A;  4MVR A;  3MLG A;  4CX9 A;  3NYL A;  5F28 E;  1CPQ A;  1IZM A;  1T9K A;  2ICW G;  4H4K C;  1PD0 A;  5L0H A;  3GWN A;  2YLD A;  1T6I A;  4M63 A;  2A68 F;  3QVZ A;  2EIK C;  1YYJ A;  1QLE C;  4NTB A;  5JSL A;  3ZQY A;  3RQG A;  3ZTZ A;  3AJM A;  3DAG A;  2J9B A;  1ZHT A;  5D91 A;  2J0X A;  3OA1 A;  3U8V A;  2PFD A;  4PJN A;  2GAQ A;  1U89 A;  4U9D A;  3S27 A;  5DQT A;  3RQF A;  5A6J A;  1JR8 A;  5GPG B;  2YL7 A;  4PK4 A;  2D5R B;  1LIH A;  1MMN A;  1M2O A;  1QSP A;  1ZHY A;  3C8Z A;  3CZ6 A;  3ZWI A;  2R7X A;  4IAR A;  3KPH A;  2WZL A;  4OD4 A;  1ZW2 A;  4Q4Z F;  2QTV A;  3UGP A;  2R7R A;  2J8W A;  1SYQ A;  3K6B A;  2J9W A;  2A0U A;  3S9O A;  1FNT c;  1O87 A;  1LS1 A;  1LM3 B;  3DKA A;  4WGZ A;  1T5O A;  5E3C A;  4OIO F;  3JYH A;  1ORY A;  2RD9 A;  1Z23 A;  2VC9 A;  3U9J A;  3UMK A;  5EHH A;  5L0C A;  1A7D A;  2UUI A;  2VH3 A;  3DJU B;  4IRU A;  1APC A;  4MVQ A;  3VYW A;  2PF4 E;  2PX0 A;  3TJ5 A;  1PV3 A;  4DVY P;  3DE8 A;  2YL0 A;  4ZLD A;  2CDQ A;  3RYL A;  3LEO A;  1M2V B;  3O39 A;  1OW7 A;  2VCC A;  3RH3 A;  4ONS A;  1H9T A;  1NFN A;  3DD7 A;  4IAO A;  2A0B A;  3C18 A;  1LPE A;  3QMK A;  4NTF A;  2XLV A;  4EBK A;  2NSG A;  4CIP A;  3ZIB A;  1NZE A;  4CDY A;  2KYH A;  3FVY A;  4I3M A;  3ZC4 A;  1OXB A;  1TFK B;  3LES A;  4JCZ A;  4XTK A;  4BJT A;  2EIM C;  3KKB A;  3F46 A;  3KYI A;  3RVZ A;  3UNG C;  5KYX A;  4JUR I;  2JPU A;  2V26 A;  2XS8 A;  2YL3 A;  3LNR A;  3S28 A;  1AVO B;  1G4W R;  1FFT C;  3CAX A;  2FFH A;  3LS1 A;  4MVS A;  4ULV A;  1PD1 A;  4BJ5 C;  1WAS A;  3KMI A;  1I5N A;  1NG1 A;  3LNM B;  3M15 A;  4MVM A;  4KNV A;  3RKO F;  3OEO A;  1SF8 A;  1ZHW A;  3L8J A;  3LLK A;  4RD9 A;  3EHN A;  2P6V A;  2BE5 F;  3NYJ A;  4X0R A;  3HLZ A;  1OQC A;  4LDR A;  2V3C C;  2KSF A;  1HW1 A;  2DB4 A;  1OCO C;  3VF0 A;  1D0X A;  2MHR A;  1A7V A;  1G4U S;  3HNJ A;  3Q6M A;  2XM0 A;  2IBF A;  3FAJ A;  1R5I D;  3S90 A;  4KBL A;  4MTG A;  1U0B B;  3AGU A;  1M56 C;  1HMO A;  1TFO B;  4PJL A;  1M2V A;  3EGX B;  4PFP A;  5DS5 A;  2XLE A;  5JLI A;  1ORS C;  2PBE A;  2VB6 A;  1UG7 A;  3A11 A;  4JKV A;  5FZT A;  3DE9 A;  2PP4 A;  4JZA A;  1GGQ A;  4J30 B;  1F1M A;  3WOD F;  2YZS A;  1KNY A;  3ZSU A;  1QZX A;  3FOP A;  4YL1 A;  4OIN F;  1G5Z A;  1YAR O;  4U5H A;  4IWB A;  2NSF A;  2GWW A;  2G3V A;  4DJ9 A;  3U2L A;  5B3I A;  5KYU B;  1HE1 A;  1XZP A;  2OEV A;  2ZPA A;  2YLI A;  3EJN A;  3GEH A;  4RDA A;  2R7Q A;  4U5F E;  5E2Q A;  3HNI A;  4LDQ A;  3U8P A;  5BQH A;  5K0I A;  3AG2 C;  2R7S A;  3DM5 A;  2H7V C;  2P0N A;  4JRZ A;  5KYW B;  1CPR A;  1MMA A;  4FX5 A;  3KL4 A;  1ZHX A;  1L3P A;  4MW3 A;  4J7Y A;  3T6G B;  1ZVZ A;  4MS2 A;  3W8I A;  2R7W A;  1D0Y A;  1Z5Z A;  3VAY A;  1GM5 A;  2KC3 A;  3JCU Q;  3NG1 A;  2E87 A;  4QI2 A;  2HSQ A;  3GOD A;  3AG4 C;  1J8Y F;  3FDQ A;  1NU7 D;  3AQB A;  3JYY A;  4DRH B;  4YT2 A;  4U5E E;  1LE4 A;  2AVK A;  2PNO A;  1TQG A;  4UDV A;  2LFD A;  4D4X A;  4Q5S F;  3M1C B;  3EGD B;  3LAY A;  1GQA A;  3EGX A;  3G4Z A;  2NUP A;  4BJ6 A;  1VYI A;  2TMV P;  1OR2 A;  2MYS A;  2HMQ A;  3DAF A;  2CYD A;  2H8A A;  3JSE O;  3X2Q C;  4JW1 A;  2KGO A;  2VCB A;  4G78 A;  4Z9H A;  5HSW A;  2RSE B;  5COM A;  4K0D A;  1NLX A;  4DBQ A;  2IM8 A;  1LVK A;  2XL4 A;  3M79 A;  4PJJ A;  4JC7 A;  4XEF A;  3V5Y A;  1RKC A;  5JS5 A;  1NU9 C;  5KYU A;  3K1I A;  3U3B A;  2KK1 A;  3GEI A;  3MFN A;  2BL2 A;  3MX3 A;  1ZYR F;  3W8H A;  5E33 A;  3TUL A;  4XEK A;  4BPM A;  4BEM J;  2WVO A;  4LLE A;  5T3W A;  3TOL A;  4YT8 A;  2HKV A;  5KYW A;  3N2Z B;  3SEO A;  5JRA A;  2XL6 A;  5COG A;  4DRJ B;  4CIH A;  1EQ1 A;  1KTM A;  4XLN F;  2Q3T A;  1Q0F A;  3US6 A;  1BZ4 A;  1AUE A;  4CS9 A;  2A6E F;  2YQY A;  1Z3I X;  4D4N A;  5A69 A;  3C63 A;  3R2P A;  1RCP A;  3GAN A;  2DGJ A;  3EGD A;  3QW0 A;  2R02 A;  1ZW3 A;  3L0I A;  4CDA A;  2NG1 A;  4FES A;  1JOG A;  4CSA A;  1K40 A;  1FR0 A;  1T01 A;  3HNL A;  2P61 A;  3F47 A;  3I5P A;  1JPJ A;  1NSG B;  2JD3 A;  2YHS A;  3LLI A;  4N06 A;  1MMG A;  1TR2 A;  2LSE A;  4MQ9 F;  4YJW A;  2GDC A;  3AG3 C;  3ASN C;  3ABK C;  4JJF A;  2P7V A;  3IQ5 A;  4OIQ F;  4G7O F;  1D0Z A;  5F5H A;  1MQV A;  2EPK X;  3EZH A;  4IGG A;  5AC5 A;  4C3E A;  3UR3 C;  4EIY A;  4K7B A;  3TJ6 A;  4U5C E;  1QPU A;  3EPV A;  4PR9 A;  4R32 A;  2H7O A;  3SXY A;  1OW6 A;  1Q0K A;  1YA7 O;  1Z7Q c;  1V55 C;  4JEB A;  2HV7 A;  5JUA A;  4BG0 A;  1UFB A;  3S29 A;  4BEJ A;  3B29 A;  2XLD A;  1TWG A;  3O10 A;  2YRF A;  4WAB A; 
#chains in the Genus database with same CATH homology
 4DRH B;  2FAP B;  2RSE B;  1NSG B;  2GAQ A;  1AUE A;  4FAP B;  2NPU A;  1FAP B;  5GPG B;  3FAP B;  4DRJ B;  4DRI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...