2RSEB

Nmr structure of fkbp12-mtor frb domain-rapamycin complex structure determined based on pcs
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
VAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP1A
publication title Convenient method for resolving degeneracies due to symmetry of the magnetic susceptibility tensor and its application to pseudo contact shift-based protein-protein complex structure determination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
total genus 35
structure length 94
sequence length 94
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 2rseB00
4DRHB 2NPUA 5GPGB 4DRIB 4DRJB 4FAPB 3FAPB 2FAPB 2RSEB 1NSGB 2GAQA 1FAPB 1AUEA
chains in the Genus database with same CATH superfamily
1W2WA 1MQVA 3EH1A 2NPUA 5GPGB 3W8HA 5B1AC 5L0DA 1CPQA 3AOUA 3IQ6A 2LIGA 2R02A 3JRTA 1L3PA 5KYWB 1Q0DA 2V26A 4JE9A 4UDVA 3WAQA 3WODF 2HUJA 2IXPA 3HLZA 3AJMA 1A7DA 2KJGA 3Q7GA 2R7XA 3C8GA 4U9DA 4PJJA 2LSEA 3NKDA 4U5HA 1VYKA 3M4CA 4WABA 2NG1A 2EPNA 5BQGA 4BJ6C 1KNYA 1EI7A 1FFHA 3NYLA 3GM3A 4W8KA 2HV6A 4JEAA 3DJNB 3SNHA 3EGDA 3KMIA 3TD7A 3UGPA 4BJ5A 2E87A 1R5ID 2H8AA 1JRAA 3PCVA 2EPOA 3I5PA 3TJ5A 3VRCA 1O5HA 1YVIA 5F28E 1YJGA 2NSFA 3HJCA 3KYIA 4OIOF 4G0HA 1LPEA 3F47A 1RJ9A 4NCQA 2W4BA 4E7ZA 4PJMA 1OCCC 2EPKX 3DXJF 1Z6AA 1ZHWA 4HEAJ 2X0CA 4DXWA 4CIPA 5EGYA 3AGUA 5JUAA 5TJ5E 1ZU5A 2EIKC 2Q3TA 1SZIA 3Q6MA 1OW6A 3ZDLA 1O87A 3SXKA 3GEHA 3ZG1A 3V5XA 1WATA 4IGGA 4AL0A 1K05A 1LM3B 1NG1A 5B3SC 1BR2A 4JTAB 2OOCA 4YK5A 2YWAA 3FOOA 4IAQA 2QNLA 2J9WA 2VASA 4LDKA 3AQCA 4N06A 4JJFA 3UNGC 4LACB 4LDRA 3LAYA 1Y6DA 4CS9C 3K1IC 3ABLC 2GDCA 4U9EA 5KYYB 4MVRA 4C3BA 3RH3A 3G50A 3W4YA 4KC9A 3PMRA 5A6BA 1JAFA 4ZLDA 2PX0A 2Q9CA 2RD9A 4ULVA 4NQFA 1CPRA 1E83A 4G78A 1Z3IX 1JPNA 2B0HA 3QW0A 4XLPF 3VM6A 1MMGA 1T9KA 5JP7A 2A6EF 2VB6A 3T6GB 2P61A 1XZQA 3ECSA 1QZXA 3L1MA 2KNHA 3X2QC 3R2PA 3DAFA 1IZMA 1QPUA 2ZXPA 1PV3A 2AP3A 3JSEO 3NYMA 4U5GA 4ZLCA 5L0CA 2CDQA 1SF8A 3FMSA 4GEHA 4MS2A 1DOVA 5A69A 1QLEC 3LS0A 3OEOA 2AU5A 3AG4C 2EIJC 2XLOA 4WJ0A 1D1BA 3B0UX 3K7DA 2WB7A 4XTKA 3GM1A 5E3CA 3S27A 3J06A 3K1HA 3JZ0A 4E7SA 2PBEA 1H7IA 2A68F 2M4EA 3GANA 4CS8A 4DBQA 1D1AA 3CZ6A 1CGOA 1LS4A 2ZXWC 1QQ3A 1YZCA 2J9BA 4DRJB 3HNLA 2Z15A 3KYJA 5AC5A 2ZPAA 4OIRF 3M79A 3HNJA 2R25A 1OXKA 3T6JA 1A7EA 2ASRA 3K6BA 1EKYA 1G8XA 4RBNA 3S0XA 2QLAA 2XS8A 4JTCB 1H9TA 4CDYA 3IQTA 1L7CA 4CS9A 4U5DE 1FMWA 1AEPA 1D0XA 256BA 2HV7A 3DAGA 2H7BA 4NY3A 1ZHXA 5JT4A 1KTMA 4EBJA 1A7VA 2DGJA 3NKEA 2Q9BA 3EZHA 4H54A 2YZSA 1HE9A 1B68A 4XEVA 1RKCA 1VOMA 5KYXA 2TMVP 2WL8A 3LEVA 3U0CA 1T6QA 4MVSA 3HTKC 4N6CA 2W45A 3AG3C 3BRJA 4KNWA 4DJ9A 1LIHA 2V3CC 2BL2A 2R7VA 1M2OA 2C03A 4NTFA 5E33A 2R7UA 5F5FA 2XL6A 3GEEA 2MYSA 2AWYA 3CEXA 2DB4A 1NFOA 2I15A 3QW1A 1CGNA 1YZAA 1TFKB 1G4WR 1RKEA 4JIOA 5CI8A 2W4MA 2XRHA 4K0DA 1BR1A 3ABMC 4MTFA 1J8YF 3TQOA 2HS5A 2A0BA 4JTDB 4U5EE 1T6UA 4J7YA 2D5RB 2B0JA 2YL0A 1MNEA 2OJED 4HFKB 5A6KA 3Q6NA 3NDBB 5T1DB 5FZTA 1C17M 3FAPB 2XLVA 3ASNC 2Y3HA 1QSPA 3TOMA 4U5FE 3ABKC 4AK9A 5DS4A 4LDQA 1FR0A 5JVEA 4HFFB 2EILC 5F5HA 1LKXA 1FMVA 1WASA 2J7PD 3RQGA 1WGWA 3LESA 4OD4A 1SYQA 4W8PA 5KYXB 2LFDA 3MYIA 4NTAA 2XLEA 2J45A 2LK4A 3DI5A 1ZW2A 2XM0A 3QTHA 1I4YA 1BDJB 3L34A 3R7CA 4MW8A 3C8ZA 1Q0GA 4QI2A 1YYXA 2HJ3A 1OCZC 3T6BA 1TKNA 2CYDA 3EGXA 3IHUA 2PX3A 1A41A 4CSAA 3EG9A 3B71A 2PP4A 3RW0A 2ICWG 4GYTA 3T4RA 1T01A 5L0IA 1TQGA 1M2VA 2P6VA 4C3EA 5AC4A 2KSFA 4MTOA 3MLGA 2YRFA 3UMHA 3ZQVA 3AQBA 4CDAA 4MVOA 2HMQA 2OU6A 1E84A 3NYJA 2RSEB 4M63A 2J9UA 4MVZA 5AGFA 1GGQA 1YARO 2CCYA 4CBEA 1CGME 3V7OA 2YKZA 2CNWD 3NRHA 2JD3A 3RYLA 1OKKD 2P7VA 1S05A 2XLHA 2C04A 3ASOC 3X1OA 1D0ZA 4MNDA 1ORJA 4EBBA 3SXMA 5JLIA 2LCHA 1TWGA 2JX0A 4EHPA 4QI0A 1NSGB 1WOLA 5CI9A 5BQIA 3ITFA 1DOWA 3IEEA 5DQZA 3O10A 2A69F 3CQZA 3C8GB 4NTBA 1R4TA 4CS7A 2KC3A 3EG9B 3U2MA 1MMDA 3FHDA 2PFDA 3FXHA 4YT2A 2ZXOA 1H9GA 1OXBA 2GFHA 3DE9A 3VAYA 2R7RA 3B0VC 1Z63A 3N0TA 1OCRC 2EINC 1V4AA 2EPMX 4J7TA 3EGDB 4Q7CA 3US6A 3B9QA 3MYFA 4LLEA 2YEVA 3A11A 4F4BA 1OCOC 2X51A 5T3WA 3SEOA 3EPVA 5COGA 1GS9A 3GODA 4P9TA 3PDMP 4E0IA 1SR2A 2OQMA 2R9RB 4G7ZF 4EKWA 2CGEA 1VLTA 1RJ9B 2KGOA 2FFHA 4U5BE 1E2XA 2IBFA 3G4XA 1LI7A 4PJLA 1YA9A 3U8VA 1EA8A 3DE8A 3O55A 2XLMA 2WVOA 4PJNA 1OW7A 5E3AA 3SYNA 4BJ6A 5B3IA 2Q00A 4XQ1A 2LP4A 1U89A 2EPLX 3NG1A 2YL1A 4P9FA 4QDLA 1LE4A 2IOQA 3MFNA 5EK0A 4AE4A 3V5ZA 4MW3A 4MTGA 4GQHA 2BC5A 1BZ4A 3EZIA 3QZCA 4J30B 2YL3A 4WGZA 5HV9A 3JYHA 1Q0FA 4E17A 1TWHA 3M15A 4DBRA 1RXQA 3JTLO 1Z7Qc 1PD1A 3HKKA 4R32A 4BG0A 4HE8D 5BUOA 5L0HA 4XPYA 3JYYA 4Q4ZF 2DYRC 4D4XA 3POVA 4G7OF 1VTMP 4ONSA 3S84A 5JSLA 1YYJA 4FESA 2AWCA 1I4ZA 2QTVA 2MWQA 1WWPA 1Z5ZA 4CIHA 4YL3A 2KW3C 3C18A 1T6IA 2XXAA 3RVZA 3K66A 3A9CA 3TK0A 3U9JA 1G5ZA 4A2NB 1D1CA 1V55C 4I3MA 2L6HA 1NU7D 2L6FA 3K1IA 4RDAA 2J9VA 3JSZA 3WHNA 3F46A 3FAJA 3H65A 5KYNA 1T5OA 3MBGA 4XPWA 2A0UA 4ULWA 1IW7F 1OQCA 1WTYA 2YQYA 1I5NA 4MVUA 2R7QA 3H2VA 5A6AA 5COFA 3GM2A 3RIPA 3VF0A 4CJOA 2L6GA 2ZXRA 4YT8A 3GORA 4DRHB 3IQ5A 2R7TA 1E86A 2NUTA 4PACA 1S7ZA 2XM4A 4IB4A 3PHF2 1NZEA 3BEHA 3IPMO 1APCA 3LLKA 2Y3GA 3EFOA 2LQGA 3EHMA 5JS5A 1Z23A 4O7GA 1ZYRF 3ZQYA 2R7OA 4C7OA 3K33A 1A0BA 2OJQA 2XL4A 3E70C 4JCHA 4U5CE 4XEKA 4YT5A 5L0JA 2YVKA 5DLJA 2YLGA 4DVZA 2WZGA 4BEMJ 4OD5A 4FAPB 1M6TA 1HW2A 3TOLA 1NLXA 2XSEA 4JRZA 4K7BA 3KL4A 2G3VA 5L0FA 4IWBA 3UGOA 3MX3A 2R05A 1FTSA 4NC3A 1AVOB 2J7PA 3JCUQ 1E85A 3CAXA 3LJBA 4Z9IA 1JMWA 2YL7A 4G7HF 3DMDA 5FCLA 3NMKA 2ZD9A 3AG2C 3CSKA 3G4ZA 4YL1A 1VMAA 3U8PA 4JKVA 2QUPA 3DM5A 1JR8A 3JT1A 1VLSA 2VCCA 3GEIA 2A1DD 2HMZA 1NBBA 3NMJA 4JVSA 1OR3A 4XWJA 4K1OA 1LS1A 5A6JA 2VCAA 1Y4CA 4PFPA 4RD9A 5EHHA 1TWCA 2XLDA 4E0HA 4L6RA 2IM8A 2VCBA 1RKEB 3EFOB 3EHNA 1QVXA 3EH2A 4C7OB 3C63A 4CX9A 1K04A 1YDIA 2PNOA 2GAQA 4B6IA 3KKBA 2XL8A 4A4AA 3DZAA 2CNWA 3LS1A 4IRUA 5K0IA 1QKRA 4O79A 4Q5SF 1OKKA 3ZWIA 3UMIA 3RVYA 5DQTA 1ZW3A 2YLIA 2Y3BA 2Q7RA 1XZPA 1UFBA 1TWAA 3FOPA 4Z9HA 3RKOF 3SZRA 3W2WA 5D92A 3ZTZA 1ORYA 2OG2A 2R7WA 3HNKA 3W8IA 2OKUA 4LLCA 1M56C 2OEVA 2UUIA 3C8GD 3JRMO 4N6HA 3ZSUA 4CJGA 4E18A 3FDQA 2L9JA 1C03A 1HMOA 3T9OA 5B1BC 3UR3C 2R03A 3EGXB 4BJ1A 1N1CA 2NSGA 3DKAA 2W9YA 4FWVA 3HNIA 3B29A 4YWQA 5KYYA 3B0PA 3U5SA 2WZLA 4JC7A 2PF4E 3QVYA 4MVQA 1M2VB 3U3BA 1ZU4A 3SP1A 3ZTMA 3NMIA 3TJ6A 2HKVA 3LLIA 5L3VA 2M64A 4OINF 1U0BB 4DRIB 1ZHZA 1VYIA 2GA0A 1G4US 3N24A 4IARA 4PFOA 3DWWA 2VH3A 3QMKA 4CS8C 3S90A 5CIVA 4IJJA 1XWJA 2Y69C 3L0IA 2KK1A 4PR9A 1MMAA 5L3QA 1NU9C 3M4BA 3I5QA 3LNMB 3ZVRA 1YLMA 2WZFA 4N4WA 2F22A 2LD6A 5DS5A 3FVYA 5COMA 2DI3A 3DJUB 3RQEA 2LFFA 2NUPA 3EQLF 5T3TA 2XS1A 2GWWA 2I8BA 4KNVA 4DOZA 1V54C 3RF3A 2Q4FA 2OEXA 1GM5A 4J32B 3C62A 1ST6A 4JEBA 1V74B 2IXNA 2J46A 3RFYA 4KI2A 3O6XA 1ZZPA 3VYWA 2ETSA 5KYUA 3KPHA 2VC9A 3S28A 3OWTA 1K40A 1GQAA 5A6BD 2EIMC 4WGYA 3LEOA 1Q0KA 1HY5A 2JPUA 4FX5A 2HSQA 4YT4A 1KU2A 1FFTC 4JZAA 4I1MA 1YA7O 1AUEA 2HJMA 2KQ9A 3L8IA 1RCPA 1BR4A 4BEJA 1ZVZA 4JCZA 5IY5C 3S9OA 2O9XA 2P1AA 2YHSA 2FAPB 3E9VA 3SXZA 5HSWA 1ZHTA 3V5YA 3DD7A 2P0NA 1C02A 1D0YA 1WN0A 1JPJA 2UUHA 2NUPB 4IAOA 1SMYF 2XLWA 3UMKA 1ORSC 1JOGA 4AE4B 4ER9A 5D91A 2OCCC 3ATPA 3DM9B 5DVWA 1EQ1A 2H7VC 2G3KA 4JURI 3U2LA 4EBKA 1MMNA 2CW0F 2KYHA 3GWLA 3GWNA 3AGTA 5JRAA 3QVZA 5KYUB 1MNDA 1HMDA 2L81A 3OA1A 4C3DA 1LVKA 1VK5A 3LNRA 4XLNF 1TR2A 2BE5F 4Z9JA 4CSAC 2IXMA 2QE9A 4P6IC 3W2VA 2AVKA 4YN0B 1Q0MA 1OR2A 2L7AA 1BBHA 1U6HA 2R7SA 3WG7C 4AX2A 3S29A 4D4NA 4BJTA 1YAUO 3M1CB 4OIQF 4I1OB 2XXAB 2J0WA 2J0XA 1HW1A 2WVNA 4BJ5C 2G62A 1H6GA 1O3UA 4JJGA 2Y39A 3IQCA 4XPXA 3TULA 4BPMA 3LUTB 1VB5A 4MVMA 2WVQA 4X0RA 4EIYA 3I4UA 5KYWA 3AG1C 1RMVA 1F1MA 1OW8A 5DS6A 4MQ9F 4XEFA 1HE1A 4H4KC 2FGYA 1LI5A 4JW1A 4KBLA 2YLDA 3KH2A 2QY9A 2IYLD 3H2UA 2HSBA 3RQFA 4AL1A 1PD0A 4DVYP 3ZC4A 3Q7LA 2D4UA 4CDVA 4EWCA 1FNTc 2Y3DA 1NFNA 2J8WA 1FAPB 1PCXA 1M57C 3L8JA 2NUTB 2H7OA 2IXOA 3U9MA 3ZIBA 1LE2A 5L0GA 4LERA 2Q9AA 4OIPF 4YL0A 2HZ8A 1TFOB 4O6YA 4O6NA 3U3FA 3C7JA 2HFIA 5E2QA 4ANJA 3O39A 2MHRA 2A6HF 2DYSC 1UG7A 5BQHA 1J8MF 4EUKB 3N2ZB 4I44A 3EJNA 4YJWA 1ZHYA 3SXYA 4PK4A 4O6MA
chains in the Genus database with same CATH topology
4DRHB 2NPUA 5GPGB 4DRIB 4DRJB 4FAPB 3FAPB 2FAPB 2RSEB 1NSGB 2GAQA 1FAPB 1AUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRH B;  2NPU A;  5GPG B;  4DRI B;  4DRJ B;  4FAP B;  3FAP B;  2FAP B;  2RSE B;  1NSG B;  2GAQ A;  1FAP B;  1AUE A; 
#chains in the Genus database with same CATH topology
 1W2W A;  1MQV A;  3EH1 A;  2NPU A;  5GPG B;  3W8H A;  5B1A C;  5L0D A;  1CPQ A;  3AOU A;  3IQ6 A;  2LIG A;  2R02 A;  3JRT A;  1L3P A;  5KYW B;  1Q0D A;  2V26 A;  4JE9 A;  4UDV A;  3WAQ A;  3WOD F;  2HUJ A;  2IXP A;  3HLZ A;  3AJM A;  1A7D A;  2KJG A;  3Q7G A;  2R7X A;  3C8G A;  4U9D A;  4PJJ A;  2LSE A;  3NKD A;  4U5H A;  1VYK A;  3M4C A;  4WAB A;  2NG1 A;  2EPN A;  5BQG A;  4BJ6 C;  1KNY A;  1EI7 A;  1FFH A;  3NYL A;  3GM3 A;  4W8K A;  2HV6 A;  4JEA A;  3DJN B;  3SNH A;  3EGD A;  3KMI A;  3TD7 A;  3UGP A;  4BJ5 A;  2E87 A;  1R5I D;  2H8A A;  1JRA A;  3PCV A;  2EPO A;  3I5P A;  3TJ5 A;  3VRC A;  1O5H A;  1YVI A;  5F28 E;  1YJG A;  2NSF A;  3HJC A;  3KYI A;  4OIO F;  4G0H A;  1LPE A;  3F47 A;  1RJ9 A;  4NCQ A;  2W4B A;  4E7Z A;  4PJM A;  1OCC C;  2EPK X;  3DXJ F;  1Z6A A;  1ZHW A;  4HEA J;  2X0C A;  4DXW A;  4CIP A;  5EGY A;  3AGU A;  5JUA A;  5TJ5 E;  1ZU5 A;  2EIK C;  2Q3T A;  1SZI A;  3Q6M A;  1OW6 A;  3ZDL A;  1O87 A;  3SXK A;  3GEH A;  3ZG1 A;  3V5X A;  1WAT A;  4IGG A;  4AL0 A;  1K05 A;  1LM3 B;  1NG1 A;  5B3S C;  1BR2 A;  4JTA B;  2OOC A;  4YK5 A;  2YWA A;  3FOO A;  4IAQ A;  2QNL A;  2J9W A;  2VAS A;  4LDK A;  3AQC A;  4N06 A;  4JJF A;  3UNG C;  4LAC B;  4LDR A;  3LAY A;  1Y6D A;  4CS9 C;  3K1I C;  3ABL C;  2GDC A;  4U9E A;  5KYY B;  4MVR A;  4C3B A;  3RH3 A;  3G50 A;  3W4Y A;  4KC9 A;  3PMR A;  5A6B A;  1JAF A;  4ZLD A;  2PX0 A;  2Q9C A;  2RD9 A;  4ULV A;  4NQF A;  1CPR A;  1E83 A;  4G78 A;  1Z3I X;  1JPN A;  2B0H A;  3QW0 A;  4XLP F;  3VM6 A;  1MMG A;  1T9K A;  5JP7 A;  2A6E F;  2VB6 A;  3T6G B;  2P61 A;  1XZQ A;  3ECS A;  1QZX A;  3L1M A;  2KNH A;  3X2Q C;  3R2P A;  3DAF A;  1IZM A;  1QPU A;  2ZXP A;  1PV3 A;  2AP3 A;  3JSE O;  3NYM A;  4U5G A;  4ZLC A;  5L0C A;  2CDQ A;  1SF8 A;  3FMS A;  4GEH A;  4MS2 A;  1DOV A;  5A69 A;  1QLE C;  3LS0 A;  3OEO A;  2AU5 A;  3AG4 C;  2EIJ C;  2XLO A;  4WJ0 A;  1D1B A;  3B0U X;  3K7D A;  2WB7 A;  4XTK A;  3GM1 A;  5E3C A;  3S27 A;  3J06 A;  3K1H A;  3JZ0 A;  4E7S A;  2PBE A;  1H7I A;  2A68 F;  2M4E A;  3GAN A;  4CS8 A;  4DBQ A;  1D1A A;  3CZ6 A;  1CGO A;  1LS4 A;  2ZXW C;  1QQ3 A;  1YZC A;  2J9B A;  4DRJ B;  3HNL A;  2Z15 A;  3KYJ A;  5AC5 A;  2ZPA A;  4OIR F;  3M79 A;  3HNJ A;  2R25 A;  1OXK A;  3T6J A;  1A7E A;  2ASR A;  3K6B A;  1EKY A;  1G8X A;  4RBN A;  3S0X A;  2QLA A;  2XS8 A;  4JTC B;  1H9T A;  4CDY A;  3IQT A;  1L7C A;  4CS9 A;  4U5D E;  1FMW A;  1AEP A;  1D0X A;  256B A;  2HV7 A;  3DAG A;  2H7B A;  4NY3 A;  1ZHX A;  5JT4 A;  1KTM A;  4EBJ A;  1A7V A;  2DGJ A;  3NKE A;  2Q9B A;  3EZH A;  4H54 A;  2YZS A;  1HE9 A;  1B68 A;  4XEV A;  1RKC A;  1VOM A;  5KYX A;  2TMV P;  2WL8 A;  3LEV A;  3U0C A;  1T6Q A;  4MVS A;  3HTK C;  4N6C A;  2W45 A;  3AG3 C;  3BRJ A;  4KNW A;  4DJ9 A;  1LIH A;  2V3C C;  2BL2 A;  2R7V A;  1M2O A;  2C03 A;  4NTF A;  5E33 A;  2R7U A;  5F5F A;  2XL6 A;  3GEE A;  2MYS A;  2AWY A;  3CEX A;  2DB4 A;  1NFO A;  2I15 A;  3QW1 A;  1CGN A;  1YZA A;  1TFK B;  1G4W R;  1RKE A;  4JIO A;  5CI8 A;  2W4M A;  2XRH A;  4K0D A;  1BR1 A;  3ABM C;  4MTF A;  1J8Y F;  3TQO A;  2HS5 A;  2A0B A;  4JTD B;  4U5E E;  1T6U A;  4J7Y A;  2D5R B;  2B0J A;  2YL0 A;  1MNE A;  2OJE D;  4HFK B;  5A6K A;  3Q6N A;  3NDB B;  5T1D B;  5FZT A;  1C17 M;  3FAP B;  2XLV A;  3ASN C;  2Y3H A;  1QSP A;  3TOM A;  4U5F E;  3ABK C;  4AK9 A;  5DS4 A;  4LDQ A;  1FR0 A;  5JVE A;  4HFF B;  2EIL C;  5F5H A;  1LKX A;  1FMV A;  1WAS A;  2J7P D;  3RQG A;  1WGW A;  3LES A;  4OD4 A;  1SYQ A;  4W8P A;  5KYX B;  2LFD A;  3MYI A;  4NTA A;  2XLE A;  2J45 A;  2LK4 A;  3DI5 A;  1ZW2 A;  2XM0 A;  3QTH A;  1I4Y A;  1BDJ B;  3L34 A;  3R7C A;  4MW8 A;  3C8Z A;  1Q0G A;  4QI2 A;  1YYX A;  2HJ3 A;  1OCZ C;  3T6B A;  1TKN A;  2CYD A;  3EGX A;  3IHU A;  2PX3 A;  1A41 A;  4CSA A;  3EG9 A;  3B71 A;  2PP4 A;  3RW0 A;  2ICW G;  4GYT A;  3T4R A;  1T01 A;  5L0I A;  1TQG A;  1M2V A;  2P6V A;  4C3E A;  5AC4 A;  2KSF A;  4MTO A;  3MLG A;  2YRF A;  3UMH A;  3ZQV A;  3AQB A;  4CDA A;  4MVO A;  2HMQ A;  2OU6 A;  1E84 A;  3NYJ A;  2RSE B;  4M63 A;  2J9U A;  4MVZ A;  5AGF A;  1GGQ A;  1YAR O;  2CCY A;  4CBE A;  1CGM E;  3V7O A;  2YKZ A;  2CNW D;  3NRH A;  2JD3 A;  3RYL A;  1OKK D;  2P7V A;  1S05 A;  2XLH A;  2C04 A;  3ASO C;  3X1O A;  1D0Z A;  4MND A;  1ORJ A;  4EBB A;  3SXM A;  5JLI A;  2LCH A;  1TWG A;  2JX0 A;  4EHP A;  4QI0 A;  1NSG B;  1WOL A;  5CI9 A;  5BQI A;  3ITF A;  1DOW A;  3IEE A;  5DQZ A;  3O10 A;  2A69 F;  3CQZ A;  3C8G B;  4NTB A;  1R4T A;  4CS7 A;  2KC3 A;  3EG9 B;  3U2M A;  1MMD A;  3FHD A;  2PFD A;  3FXH A;  4YT2 A;  2ZXO A;  1H9G A;  1OXB A;  2GFH A;  3DE9 A;  3VAY A;  2R7R A;  3B0V C;  1Z63 A;  3N0T A;  1OCR C;  2EIN C;  1V4A A;  2EPM X;  4J7T A;  3EGD B;  4Q7C A;  3US6 A;  3B9Q A;  3MYF A;  4LLE A;  2YEV A;  3A11 A;  4F4B A;  1OCO C;  2X51 A;  5T3W A;  3SEO A;  3EPV A;  5COG A;  1GS9 A;  3GOD A;  4P9T A;  3PDM P;  4E0I A;  1SR2 A;  2OQM A;  2R9R B;  4G7Z F;  4EKW A;  2CGE A;  1VLT A;  1RJ9 B;  2KGO A;  2FFH A;  4U5B E;  1E2X A;  2IBF A;  3G4X A;  1LI7 A;  4PJL A;  1YA9 A;  3U8V A;  1EA8 A;  3DE8 A;  3O55 A;  2XLM A;  2WVO A;  4PJN A;  1OW7 A;  5E3A A;  3SYN A;  4BJ6 A;  5B3I A;  2Q00 A;  4XQ1 A;  2LP4 A;  1U89 A;  2EPL X;  3NG1 A;  2YL1 A;  4P9F A;  4QDL A;  1LE4 A;  2IOQ A;  3MFN A;  5EK0 A;  4AE4 A;  3V5Z A;  4MW3 A;  4MTG A;  4GQH A;  2BC5 A;  1BZ4 A;  3EZI A;  3QZC A;  4J30 B;  2YL3 A;  4WGZ A;  5HV9 A;  3JYH A;  1Q0F A;  4E17 A;  1TWH A;  3M15 A;  4DBR A;  1RXQ A;  3JTL O;  1Z7Q c;  1PD1 A;  3HKK A;  4R32 A;  4BG0 A;  4HE8 D;  5BUO A;  5L0H A;  4XPY A;  3JYY A;  4Q4Z F;  2DYR C;  4D4X A;  3POV A;  4G7O F;  1VTM P;  4ONS A;  3S84 A;  5JSL A;  1YYJ A;  4FES A;  2AWC A;  1I4Z A;  2QTV A;  2MWQ A;  1WWP A;  1Z5Z A;  4CIH A;  4YL3 A;  2KW3 C;  3C18 A;  1T6I A;  2XXA A;  3RVZ A;  3K66 A;  3A9C A;  3TK0 A;  3U9J A;  1G5Z A;  4A2N B;  1D1C A;  1V55 C;  4I3M A;  2L6H A;  1NU7 D;  2L6F A;  3K1I A;  4RDA A;  2J9V A;  3JSZ A;  3WHN A;  3F46 A;  3FAJ A;  3H65 A;  5KYN A;  1T5O A;  3MBG A;  4XPW A;  2A0U A;  4ULW A;  1IW7 F;  1OQC A;  1WTY A;  2YQY A;  1I5N A;  4MVU A;  2R7Q A;  3H2V A;  5A6A A;  5COF A;  3GM2 A;  3RIP A;  3VF0 A;  4CJO A;  2L6G A;  2ZXR A;  4YT8 A;  3GOR A;  4DRH B;  3IQ5 A;  2R7T A;  1E86 A;  2NUT A;  4PAC A;  1S7Z A;  2XM4 A;  4IB4 A;  3PHF 2;  1NZE A;  3BEH A;  3IPM O;  1APC A;  3LLK A;  2Y3G A;  3EFO A;  2LQG A;  3EHM A;  5JS5 A;  1Z23 A;  4O7G A;  1ZYR F;  3ZQY A;  2R7O A;  4C7O A;  3K33 A;  1A0B A;  2OJQ A;  2XL4 A;  3E70 C;  4JCH A;  4U5C E;  4XEK A;  4YT5 A;  5L0J A;  2YVK A;  5DLJ A;  2YLG A;  4DVZ A;  2WZG A;  4BEM J;  4OD5 A;  4FAP B;  1M6T A;  1HW2 A;  3TOL A;  1NLX A;  2XSE A;  4JRZ A;  4K7B A;  3KL4 A;  2G3V A;  5L0F A;  4IWB A;  3UGO A;  3MX3 A;  2R05 A;  1FTS A;  4NC3 A;  1AVO B;  2J7P A;  3JCU Q;  1E85 A;  3CAX A;  3LJB A;  4Z9I A;  1JMW A;  2YL7 A;  4G7H F;  3DMD A;  5FCL A;  3NMK A;  2ZD9 A;  3AG2 C;  3CSK A;  3G4Z A;  4YL1 A;  1VMA A;  3U8P A;  4JKV A;  2QUP A;  3DM5 A;  1JR8 A;  3JT1 A;  1VLS A;  2VCC A;  3GEI A;  2A1D D;  2HMZ A;  1NBB A;  3NMJ A;  4JVS A;  1OR3 A;  4XWJ A;  4K1O A;  1LS1 A;  5A6J A;  2VCA A;  1Y4C A;  4PFP A;  4RD9 A;  5EHH A;  1TWC A;  2XLD A;  4E0H A;  4L6R A;  2IM8 A;  2VCB A;  1RKE B;  3EFO B;  3EHN A;  1QVX A;  3EH2 A;  4C7O B;  3C63 A;  4CX9 A;  1K04 A;  1YDI A;  2PNO A;  2GAQ A;  4B6I A;  3KKB A;  2XL8 A;  4A4A A;  3DZA A;  2CNW A;  3LS1 A;  4IRU A;  5K0I A;  1QKR A;  4O79 A;  4Q5S F;  1OKK A;  3ZWI A;  3UMI A;  3RVY A;  5DQT A;  1ZW3 A;  2YLI A;  2Y3B A;  2Q7R A;  1XZP A;  1UFB A;  1TWA A;  3FOP A;  4Z9H A;  3RKO F;  3SZR A;  3W2W A;  5D92 A;  3ZTZ A;  1ORY A;  2OG2 A;  2R7W A;  3HNK A;  3W8I A;  2OKU A;  4LLC A;  1M56 C;  2OEV A;  2UUI A;  3C8G D;  3JRM O;  4N6H A;  3ZSU A;  4CJG A;  4E18 A;  3FDQ A;  2L9J A;  1C03 A;  1HMO A;  3T9O A;  5B1B C;  3UR3 C;  2R03 A;  3EGX B;  4BJ1 A;  1N1C A;  2NSG A;  3DKA A;  2W9Y A;  4FWV A;  3HNI A;  3B29 A;  4YWQ A;  5KYY A;  3B0P A;  3U5S A;  2WZL A;  4JC7 A;  2PF4 E;  3QVY A;  4MVQ A;  1M2V B;  3U3B A;  1ZU4 A;  3SP1 A;  3ZTM A;  3NMI A;  3TJ6 A;  2HKV A;  3LLI A;  5L3V A;  2M64 A;  4OIN F;  1U0B B;  4DRI B;  1ZHZ A;  1VYI A;  2GA0 A;  1G4U S;  3N24 A;  4IAR A;  4PFO A;  3DWW A;  2VH3 A;  3QMK A;  4CS8 C;  3S90 A;  5CIV A;  4IJJ A;  1XWJ A;  2Y69 C;  3L0I A;  2KK1 A;  4PR9 A;  1MMA A;  5L3Q A;  1NU9 C;  3M4B A;  3I5Q A;  3LNM B;  3ZVR A;  1YLM A;  2WZF A;  4N4W A;  2F22 A;  2LD6 A;  5DS5 A;  3FVY A;  5COM A;  2DI3 A;  3DJU B;  3RQE A;  2LFF A;  2NUP A;  3EQL F;  5T3T A;  2XS1 A;  2GWW A;  2I8B A;  4KNV A;  4DOZ A;  1V54 C;  3RF3 A;  2Q4F A;  2OEX A;  1GM5 A;  4J32 B;  3C62 A;  1ST6 A;  4JEB A;  1V74 B;  2IXN A;  2J46 A;  3RFY A;  4KI2 A;  3O6X A;  1ZZP A;  3VYW A;  2ETS A;  5KYU A;  3KPH A;  2VC9 A;  3S28 A;  3OWT A;  1K40 A;  1GQA A;  5A6B D;  2EIM C;  4WGY A;  3LEO A;  1Q0K A;  1HY5 A;  2JPU A;  4FX5 A;  2HSQ A;  4YT4 A;  1KU2 A;  1FFT C;  4JZA A;  4I1M A;  1YA7 O;  1AUE A;  2HJM A;  2KQ9 A;  3L8I A;  1RCP A;  1BR4 A;  4BEJ A;  1ZVZ A;  4JCZ A;  5IY5 C;  3S9O A;  2O9X A;  2P1A A;  2YHS A;  2FAP B;  3E9V A;  3SXZ A;  5HSW A;  1ZHT A;  3V5Y A;  3DD7 A;  2P0N A;  1C02 A;  1D0Y A;  1WN0 A;  1JPJ A;  2UUH A;  2NUP B;  4IAO A;  1SMY F;  2XLW A;  3UMK A;  1ORS C;  1JOG A;  4AE4 B;  4ER9 A;  5D91 A;  2OCC C;  3ATP A;  3DM9 B;  5DVW A;  1EQ1 A;  2H7V C;  2G3K A;  4JUR I;  3U2L A;  4EBK A;  1MMN A;  2CW0 F;  2KYH A;  3GWL A;  3GWN A;  3AGT A;  5JRA A;  3QVZ A;  5KYU B;  1MND A;  1HMD A;  2L81 A;  3OA1 A;  4C3D A;  1LVK A;  1VK5 A;  3LNR A;  4XLN F;  1TR2 A;  2BE5 F;  4Z9J A;  4CSA C;  2IXM A;  2QE9 A;  4P6I C;  3W2V A;  2AVK A;  4YN0 B;  1Q0M A;  1OR2 A;  2L7A A;  1BBH A;  1U6H A;  2R7S A;  3WG7 C;  4AX2 A;  3S29 A;  4D4N A;  4BJT A;  1YAU O;  3M1C B;  4OIQ F;  4I1O B;  2XXA B;  2J0W A;  2J0X A;  1HW1 A;  2WVN A;  4BJ5 C;  2G62 A;  1H6G A;  1O3U A;  4JJG A;  2Y39 A;  3IQC A;  4XPX A;  3TUL A;  4BPM A;  3LUT B;  1VB5 A;  4MVM A;  2WVQ A;  4X0R A;  4EIY A;  3I4U A;  5KYW A;  3AG1 C;  1RMV A;  1F1M A;  1OW8 A;  5DS6 A;  4MQ9 F;  4XEF A;  1HE1 A;  4H4K C;  2FGY A;  1LI5 A;  4JW1 A;  4KBL A;  2YLD A;  3KH2 A;  2QY9 A;  2IYL D;  3H2U A;  2HSB A;  3RQF A;  4AL1 A;  1PD0 A;  4DVY P;  3ZC4 A;  3Q7L A;  2D4U A;  4CDV A;  4EWC A;  1FNT c;  2Y3D A;  1NFN A;  2J8W A;  1FAP B;  1PCX A;  1M57 C;  3L8J A;  2NUT B;  2H7O A;  2IXO A;  3U9M A;  3ZIB A;  1LE2 A;  5L0G A;  4LER A;  2Q9A A;  4OIP F;  4YL0 A;  2HZ8 A;  1TFO B;  4O6Y A;  4O6N A;  3U3F A;  3C7J A;  2HFI A;  5E2Q A;  4ANJ A;  3O39 A;  2MHR A;  2A6H F;  2DYS C;  1UG7 A;  5BQH A;  1J8M F;  4EUK B;  3N2Z B;  4I44 A;  3EJN A;  4YJW A;  1ZHY A;  3SXY A;  4PK4 A;  4O6M A; 
#chains in the Genus database with same CATH homology
 4DRH B;  2NPU A;  5GPG B;  4DRI B;  4DRJ B;  4FAP B;  3FAP B;  2FAP B;  2RSE B;  1NSG B;  2GAQ A;  1FAP B;  1AUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...