1PV3A

Nmr solution structure of the avian fat-domain of focal adhesion kinase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
146
structure length
146
Chain Sequence
GSPGISGGGGGIRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title The Focal Adhesion Targeting Domain of Focal Adhesion Kinase Contains a Hinge Region that Modulates Tyrosine 926 Phosphorylation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 52
structure length 146
sequence length 146
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1pv3A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1pv3A02
3AE6C 1OW6A 2PBEA 1O3UA 3SFDC 1ZZPA 3O10A 3AEGC 3GM1A 2H89C 3C18A 2FBWC 3RQFA 1PV3A 2JPUA 2KK1A 2G3AA 2JX0A 3C8GD 2HSBA 2WQYC 3BRJA 1K04A 1V4AA 3RQEA 4YXDC 1YQ4C 1JOGA 4XEKA 4R32A 1WTYA 2L6GA 1OW8A 5F28E 4EBJA 3JYYA 3TULA 2L6FA 1KTMA 3L8JA 3AEEC 1WOLA 1ZOYC 1WWPA 1OW7A 2L6HA 3K7DA 1YQ3C 3L8IA 1K40A 3AEAC 1QVXA 3U0CA 3AE1C 4EBKA 3AE2C 2LK4A 4XEFA 3AE5C 3AECC 3AE7C 3B71A 3C8GB 3U3FA 3AE4C 2YWAA 3AE3C 3AEBC 1ZP0C 3AEFC 1K05A 3S9OA 3ABVC 3GM3A 1KNYA 4YTPC 3MFNA 3AE8C 2Q00A 3C8GA 3SFEC 1UFBA 3JZ0A 4XEVA 4NQFA 3AE9C 3AEDC 2H88C 3RQGA 3AJMA 3GM2A
chains in the Genus database with same CATH superfamily
4KBLA 2AEFA 1SQXD 2WMMA 4U9DA 4JW1A 3GF7A 1HGVA 2O3JA 4HFFB 3RVZA 4I3MA 3I5PA 2WB7A 3FVYA 3ZTMA 2KJGA 2E5TA 5L0CA 1PV3A 2XDJA 3LS1A 4QI2A 1D0XA 4L75A 3WUUA 3NTNA 2J0XA 1NTMJ 3AG2C 5K0IA 2A0UA 3B0UX 2WSSH 2JO1A 3M9HA 3QVYA 4EDFA 3AOUA 2OYHA 3USSA 3C63A 2ZAEB 3IR9A 3LW5J 3LNRA 2E74D 2ZT9D 1ZYRF 2K88A 5C39A 1S9KD 2L6FA 3C62A 4YXWH 3LNMB 1IZMA 2JD3A 3GHGB 3AGTA 3DJUB 4IB4A 3QMKA 3LEOA 2XRHA 1VF5C 3DE9A 1PGPA 3MP7B 4ANJA 3WAQA 2FYNC 3AE2C 3EFOA 2Q6QA 4CSAA 4HE8D 4CDAA 5AW7B 1FNTc 3HE5A 1BCCG 2XNXA 4UB6H 2PGDA 5CMZA 2BEQD 3C1LA 3FOPA 3H1HJ 5AC5A 2A45I 3S4RA 4IFMA 2AWCA 1Z6AA 3B5ND 4WY4A 5T1DB 1UIXA 1LKXA 1LM3B 3CCJP 3A0BH 1JY2N 1KFNA 4A7PA 1PZQA 1H9GA 2KQ9A 1P84H 2R32A 1M6TA 1O5HA 1K05A 1RE4A 3S9OA 4RO0A 1OCZC 4CBEA 5AVVB 5TISE 1K73Q 4DOZA 4W8KA 2QM8A 1VYKA 3U2MA 1U7JA 1SQVJ 3L75J 1EC5A 1I5NA 3SFEC 2BASA 2QRXA 1AFOA 2NUPA 4FESA 4XLNF 1G1IA 2J59M 3OW2O 1SFCB 3DD7A 3MGNA 2ZFCA 2O01N 2Y69C 2OYIC 4I6MC 1RKEA 1PIXA 1N2DC 2WPVB 5APWA 1QSPA 1TR2A 4G7OF 3IHUA 1NWQA 1WASA 3QW0A 1I4ZA 1KILC 1LP1B 2PRRA 1RF1C 1BE3G 1FDOA 1M1JB 2J7PA 1APCA 1CZQA 3L4FA 4Z9HA 1GL2C 5COMA 5L8RJ 1DX7A 3UMKA 3HD7A 1M8OB 1NTME 3G4SP 1BGYJ 4EUKB 2E42A 3L0IA 2JR8A 2FXPA 1MZ9A 3V2NA 3RK3C 2ZJSE 1OW8A 1NOHA 3U2LA 4N78E 4U3FD 2Z4EA 1PP9G 4C7NB 1WGWA 3H1KJ 2HG5D 3VRCA 4D6TG 3GODA 4C7RA 4IWBA 1NTZD 1S05A 2EIMC 2L7AA 1F1MA 1XTGB 2J58A 3FGAD 4I44A 2I8BA 4EBKA 2H7VC 1K8AQ 1OVRA 4XEFA 2H43A 3M0DA 2A06G 2R7SA 1YITP 2YVKA 1LTSC 4NY3A 3L71D 3Q7GA 2QLAA 1NFOA 2YL0A 1VB5A 3H1HE 1NTZK 2B88A 2O01H 4AE4B 3PRJA 3R2PA 2LD6A 2H8AA 1KYOH 1GD2E 3MUDA 2LXBA 1BDDA 3TGUD 1N73A 1T9KA 3H6PA 3I5QA 2HPCA 1XZPA 4YTPC 3CWBD 3AQCA 2P0NA 1OZHA 5D91A 2BEZF 1MFTA 1VK5A 1EQ1A 3M9BA 2G3VA 2NSGA 4K3AA 1N7SB 1SQVE 3B4SA 5KYXA 3L75E 5CI8A 4AL0A 4YT2A 2PP6A 3ZDLA 3EH2A 3AJMA 2OYHC 2R7UA 2KI7B 1D0ZA 1SQBG 2R7XA 4YL1A 2P58A 1YYJA 1QL2A 1GS9A 3FHDA 3GM1A 2LXCB 4PD4D 2HUJA 4CJGA 2B0JA 1SQQD 3L74J 1FZBA 1M1JA 1FMVA 3SXZA 2QTVA 2FYUD 1LS4A 1AV1A 4U5FE 1FOSE 1KC8Q 1VQ4P 2J9BA 3JCUH 4I2LC 4WGYA 1H8AA 3U1AA 3DKAA 1LWUB 2WVNA 1IFNA 4CSAC 5AW4B 1JCDA 5KLIC 2P1JA 1VQPP 4YK5A 3L70D 4DRHB 1BGYE 3HKKA 1GW3A 1YBKA 3EGDB 2YMKA 1RJ9A 1T2KC 3RL0B 2QG4A 4DVZA 3S84A 4IL6X 1RE4C 3H1KE 5KTBA 2MJZA 256BA 2O1KA 1NTKJ 3GW6A 3VF0A 4RDAA 1CPRA 2IBZD 2KSFA 1S5LE 5JLIA 3HUSC 4XFJA 1U7MA 3CZ6A 2J45A 2Y3BA 2OQQA 3W8HA 2EIJC 2AVKA 5CCGA 2M4EA 1OVVA 3B0PA 4MW8A 5DVWA 3Q6MA 1W2WA 5L0JA 2ZYGA 1EDIA 1HUCA 3NMIA 4KHXA 1MMNA 4IJJA 1H7IA 3NYJA 5BQIA 2LCHA 1H0TB 4EHPA 2A45H 1FE6A 5JP7A 4WJ0A 1SS1A 1LT9B 1UIIA 1JTHB 3A11A 5AGFA 1D1BA 1NU1G 2IM8A 2IFMA 5KLVE 4OWFA 3V6IA 1TWGA 5KYWB 2N1TA 4IGGA 3AE9C 1J1DB 3HD7C 4NTAA 2ZT9B 3LUTB 2WTYA 1JMBA 1M2VA 2W6BA 4N3YB 4GDOA 2WZ7A 4RKUJ 2DB4A 4JYBA 1H88A 2CNWD 2R05A 1JM0A 2PBEA 1O3UA 3S1KA 3O39A 4MTGA 1YJ9P 1KB9I 4LGDE 2R03A 3FXHA 3SZRA 4CDYA 2J46A 3X2QC 3W8IA 2ITAA 4MVUA 2KK1A 1OX3A 2BL2A 1EZVI 3G50A 4WVZA 3U59A 1FBMA 1NO4A 3L74E 5DS5A 4W8PA 3WUTA 3S27A 1PCXA 5AC4A 2JWAA 3KPEA 3NMDA 5AW6B 1C17M 1WN0A 1J8YF 3M0DC 2H8PD 1WTYA 2R44A 3C8ZA 4EBJA 2XKMA 1R5LA 4KT0J 1KTMA 2R7OA 3N0TA 2QJYC 4X0RA 4OGQD 3V4WA 1JB0J 2OARA 3LIEA 3T97A 3F89A 3I5CA 1WWPA 2I15A 2NG1A 1PD0A 3AG4C 1Z23A 3Q7LA 1FS0E 4FWVA 1L4AD 2KZJA 1MV8A 1SQBK 1AUEA 1DIPA 3U0CA 3MUDC 4UB6E 1SLQA 5KJ7D 2DYRC 2OYOA 4K7BA 4EKWA 3ABLC 3MYIA 1NZEA 4J7YA 4J7TA 3TK0A 1FZCA 3EHNA 4J32B 3A0BE 2Q3TA 2N9BA 1JEKA 1NTKE 1P84E 1HVVA 1HE9A 3RK2B 1SFCD 1S5LX 4NCQA 1ZMEC 4IL6H 1E83A 4ZKPA 2EPKX 1T6UA 4PR9A 1MFZA 3L72J 2K9JA 3CX5I 2HV6A 2FY8A 2OYIB 5BQHA 2PFXA 1Q0KA 3LS0A 1KILE 1G4WR 5JS5A 3L73G 2ZXOA 2YKPA 1BSNA 1SQPG 2RKLA 1KILB 3D70A 4O6YA 1PGQA 4KC9A 1JMMA 2R7QA 1NTMD 2Q3EA 1D1CA 4H44C 3CMEP 3ASOC 3X1OA 4ULWA 4N78D 1ZHYA 3RK3E 2HJ3A 1LPEA 2EPMX 2KIKA 2AEMA 3CCEP 3S0XA 5DJUB 1SQXG 1WRGA 3C9IA 3RQFA 4AQRD 1T8ZA 2QSIA 2M3EA 3A2AA 3R7CA 1QLED 3H1JJ 5B1AC 4LERA 3BRTB 1PD1A 2M3BA 3HNLA 4BG0A 3B5NA 1RH5B 3FWNA 5F5HA 4JTDB 3RF3A 3I4UA 1SYQA 3DZAA 3CCQP 3F5HA 3JSEO 3O6QB 3Q2YA 4YPCA 2R5BA 2GFHA 4MVRA 2NPSC 4Z1MH 1LTJA 3EZIA 3H1HD 1OW7A 4BWNA 1H89A 1Q2NA 1Z3IX 2KNCB 4G0HA 3GEIA 2YKQA 4JC7A 3V5ZA 1OIPA 2XV5A 2LSEA 5HSWA 3SXYA 4PV1C 2Q7RA 2YMYA 5AW2B 2A6EF 1TWAA 2FAPB 1N7SD 2WITA 3AE5C 1T3JA 2H7HA 4PFOA 2N1TC 1SQVD 1LTTC 3L75D 2YEVA 3SWYA 2CCYA 3T6GB 1KYOE 1TKNA 1ZHZA 1DOWA 1MMGA 2IYLD 4RBNA 3FOOA 1ZP0C 5B3SC 1BR4A 3L37A 1VQLP 2KXPB 2OKUA 3U9MA 1PGJA 1ZW0A 5B66E 3L72E 1OKKD 1AVOB 1ZR2A 2D2CC 5AVTB 4MVZA 1HE1A 5L0FA 4MTOA 1GMJA 3QW1A 2E75D 2FFDA 3AQBA 4P9FA 1LI5A 1VQ6P 2I1KA 1IFIA 3MIWA 1LE4A 4Q4ZF 4OIOF 3T6BA 3H2UA 5CCHD 2L81A 3H1LJ 2IPPA 3CC4P 2L5GB 5AVWB 2RD9A 3AG1C 2WPRA 1BGYD 3KYQA 2XM4A 1M57C 4QDLA 1KD1Q 2OU6A 3RL0D 1ZHTA 3TJ6A 3JCUE 1M2OA 4I1MA 1E79H 4XTKA 1VQ9P 1FZAA 3PP5A 3H1KD 4JZAA 1NU7D 4OINF 3NKDA 3CSKA 1HBWA 2J9UA 4PJJA 4OIPF 1PL5A 4HH2A 1Y9BA 1N86A 4Q7CA 2HFED 1FZCC 3H1JE 3K33A 4HEAJ 4A4AA 1SQPK 4Q5SF 5F28E 3HUSB 2VB6A 2CK3H 1Q90D 2YXQB 4JQ0D 3IQCA 3EPVA 1URQA 3K6BA 3TULA 4U7JA 2J0WA 2R25A 3HTKB 1L0NJ 4D6TE 1FAPB 2LIGA 1WOLA 1YZCA 2W4MA 4XE5B 3K66A 3KMIA 2GA1A 4CS9A 2OEXA 2M8RA 3E7KA 3SSUA 2P1AA 1QVFO 1NTZG 5KLVD 2HMZA 3G4XA 2YHSA 3VMZA 4D4XA 3RBXA 2A06E 4ZLCA 1SQXK 3SWFA 1W5CE 3EFFK 3N24A 3HLZA 3V5YA 1D7MA 2F22A 3A5TA 3DMDA 4DT0A 2Y3HA 3TNUA 3Q5PA 2E74C 2AXTH 2C0WA 3D6ZA 2JJLA 3IEEA 1SVFA 2W6AA 3FX0A 5TJHA 3VM6A 1DEEG 3L71G 5JVEA 1NU1J 1B68A 3AEFC 1C02A 2IX7C 1VPCA 3CCRP 3JSZA 2LFDA 4LLCA 1IW7F 3D71A 1L2PA 4JYCA 5GTIH 1AVOA 3GWLA 3W4YA 3TGUG 2HR3A 3L74D 4H13B 1VF5D 1JPJA 2B87A 1A02J 1G2CB 2B9BA 3CX5H 3CWBG 1HTLC 3MLGA 2VASA 3QVZA 2KOGA 2JP3A 1R5ID 3F46A 2YL3A 4HFKB 3SNHA 1DH3A 3NXSA 3UMHA 1LT1A 2WSEH 3C8GD 4OGQB 2HSQA 3H1LE 1CI6B 2XS8A 1ST6A 1L4AB 3U9JA 3DE8A 2G3KA 2C0XA 5KYYB 2PNOA 2QJYB 1CGOA 4XQ1A 1SQQG 3N4XA 1IFDA 3NG1A 1V4AA 1Q0DA 4ASWA 2IXNA 4LDKA 3OA7A 1JOGA 1GDTA 1LTIC 3S90A 3RK2D 1NTKD 4PJ0E 1YA9A 3RIPA 3FAPB 1P84D 1PFIA 2KLUA 3B9QA 1L0LJ 2EIKC 4IAOA 3Q5RA 2Y3DA 5T3WA 4JF7A 3PMRA 1LJ2A 3KHUA 1ZV8A 5TJ5E 5AVUB 1PGOA 2XL6A 3L70G 4N6CA 5DQTA 5JSLA 1X0TA 3M15A 1A7VA 3EQLF 5B1BC 1L0NE 1VL2A 3AE1C 3DXJF 3BRVB 2GWWA 2E76C 5APYA 1GGQA 1KILD 2WZGA 3GEEA 1YJWP 3VMAA 4DBRA 4N6JA 3MYFA 1GL2D 4IL6E 2FFDC 1EQ7A 2DGJA 2XLMA 3G4ZA 1HW1A 4PJLA 5JT4A 2IBZG 3RFYA 2CNWA 3KKBA 3EGXB 3E70C 3GHGA 1TFKB 1FZFA 1N1CA 1IFMA 4RJTA 1RQVA 2FKWB 1YHQP 2QJPC 4LLEA 1ORJA 3KZIH 3HE4B 3B8EB 4H44B 4OIRF 3D6YA 1NKNA 2Y9YA 3ITKA 4M63A 1NU1E 1FFHA 2KNHA 3FMSA 3P8MC 2Z5IA 3H1IJ 3NYLA 4YT8A 4NPDA 4C7OB 3CPWO 1IK9A 2Q7CA 2KW3C 4BXLA 2ZXEB 4AX2A 1IJDB 2YO3A 5B3IA 2O9XA 3RBZA 2QJKB 4MVMA 4XPYA 5D92A 4U9EA 1A02F 3O8ZA 3EQ2A 1RHZB 3HRNA 2YIUC 2R7WA 5KLVJ 3UGPA 2WZLA 4MNDA 1URQC 1VQMP 2XM0A 2Y0CA 1JPNA 2L91A 4QI0A 4IAQA 3P8CE 5KJ7A 2LP4A 4I7ZB 4WWIA 1YYCA 1Q0MA 1K9MQ 5L3VA 2WL8A 5B66H 4Z9JA 2YNYA 1SZIA 4W80A 2HV7A 1S1CX 1SFCA 4AYCA 4OD4A 1OCCC 4EOTA 2Q9AA 2XNDH 3U8PA 3ZWIA 2CYDA 1KYOD 3OEOA 1ZHXA 1EI7A 3QWOC 1LP1A 3F47A 1OVUA 4L76A 5CBOA 1HMOA 2PX0A 1L0LE 4MVOA 5HV9A 1YIJP 2BCCG 2M5AB 4JKVA 1FR0A 3AEAC 3H65A 4I1OB 4IOIH 1FOSF 2E75B 5A69A 4EIYA 3L72D 2R5DA 3RYLA 1RF0A 1JUNA 1J8MF 1JRAA 2KP8A 1DOVA 2R7RA 2DW3A 4BRYB 4B6IA 3CC7P 1RE3A 2VRSA 3B71A 4C7NA 4WY4C 1SQQK 2XU6A 1S7ZA 2HODB 2FYUK 1BDCA 1KFMA 1IK7A 5AVZB 2RH0A 4KJMA 3VYWA 1QX8A 2J9WA 3MD0A 1HH0A 3JCUQ 4O9BA 1OWAA 4GEHA 2WSEJ 4LDRA 1LIHA 1H9TA 1R5SA 2KS1B 1T2KD 3GF3A 2ZXPA 2R7VA 2TMVP 2LQGA 1EDJA 2YKZA 2PFDA 4JTAB 3TQOA 3BCCJ 4YL0A 2ZVNB 3H1IE 2KGOA 3GLMA 3H1JD 4BJ6A 5FCLA 2W6JH 2XLVA 3LESA 3OA1A 4AE4A 1S72P 1HWTC 1NTMG 3AE6C 4LLHA 4GT1A 2WT7B 2YLDA 3V2QA 3K1IA 1HW2A 3SFDC 1KB9E 4OVNF 5AW0B 4LC1A 2R7TA 4JRZA 4D6TD 2H89C 5E3AA 2P6VA 3LLKA 1KU2A 1T3UA 2GUVA 1VDFA 1T6IA 3DM9B 1EZVE 1VQKP 2BC5A 4MN4C 1N7SA 2O1JA 3T9OA 1EDKA 2WQYC 4XPWA 2VC9A 3RQEA 1ZVZA 2Q5UA 1YQ4C 2A06D 5L0HA 4R32A 2X51A 5L0IA 3O55A 3ZSUA 2RSEB 1W2EA 1NHLA 3A9CA 3HD7D 1M56C 4DCKA 1BR1A 3L8IA 3J06A 1VTMP 3I55P 1OKKA 3M79A 2R3SA 3H1HG 1I4YA 3T6JA 3H32B 3WG7C 4QMAA 3JSVC 1LWUA 2AXCA 1VF5B 3JRTA 5L0DA 4XA4A 2WPSA 5CJ0A 3VTPC 2AXTE 4H13D 2K1AA 1M90Q 3NMKA 2FYNB 4B86A 2QE9A 4BRYA 5COGA 2HS5A 1IC2A 5CCHA 1AJYA 2YLIA 4XWJA 3C8GB 3EGDA 2XLHA 2A0BA 2I1JA 3ASNC 4PJ0H 3VYIA 1G4US 1SQVG 2V7QH 5GTIE 3L75G 2MKVA 5AVQB 1RQUA 4IARA 3CAXA 5A6JA 3H1LD 1G8XA 3EZHA 2JEEA 2L9JA 3DAGA 4U5DE 1BCCJ 4YJWA 4EBBA 2UUIA 3CX5E 3W68A 1N73C 2XSEA 4U5BE 3UMIA 1AVYA 3EG9B 1M7LA 5KJ7C 4CDVA 4DXWA 2N9YB 4L6RA 1VQNP 2C9LY 1Y47A 1OXKA 1Z56A 2ZXRA 1ZRTE 1LTBC 2OJED 2PP4A 5A6BD 2WZFA 1EDLA 3US6A 1JCCA 1OCRC 3CCMP 3AEDC 3BCCE 1SFCC 4BJTA 4E18A 2H88C 3E9VA 1FZEA 2VCCA 5T3TA 3FXEA 3BVHA 4H54A 2AU5A 3CCUP 4RD9A 1H0TA 1A7EA 4RESB 3CEXA 1LT9A 5DJTB 1JTHA 1JY2P 1YTZT 3CXHE 5AW3B 3S28A 1VYIA 2IDBA 3WUVA 1M1JC 1BGYG 2OJQA 2R02A 3OAKA 1YA7O 1RF1B 5KYWA 1L0ND 2J8WA 1JR8A 2W8ZA 5K5GB 1GL2B 5KYNA 1PPJE 5E79H 3H1KG 3VP8A 1DD3A 4YXDC 2WVQA 4E0IA 1AEPA 2LFFA 1LTAC 1BE3J 1FAVA 5FZTA 2XLEA 1KQGB 1RE3C 3BATA 1MNEA 3B29A 3CXHI 2LKMA 1OQCA 3RK3B 4L73A 1YYXA 1VQ5P 1GQAA 4H44D 3GMAA 3ZTZA 3PTZA 2IXPA 1TQGA 4C3EA 5B5EE 1E85A 1FFTC 3IF4A 1QVXA 1NU1D 2CW0F 1NTMK 3I56P 4PACA 1NTZE 1VQ8P 1QLEC 4JTCB 1E2XA 3ZQVA 1PP9J 3O6XA 3G71P 1DD4A 2LR2A 5CCGC 1ORYA 3MX3A 2YL7A 2GM4A 4D6TJ 3KZIE 3T4RA 4H0LC 4MVQA 3NDBB 2IOQA 1QQ3A 3CMAP 5APXA 2JDIH 5DS6A 2UUHA 1GTWA 3PJSK 1QEXA 4N06A 2HMQA 4BJ6C 3DAFA 5E33A 3W2VA 3BASA 5APSA 1NBBA 2QM7A 3ABVC 3V5BA 2NPSD 1YJGA 2KSEA 2YIUB 3P8CD 2Q4FA 3TOLA 3EG9A 3UNGC 4G7ZF 1BCCE 3TGUE 4D4NA 4CX9A 3IQ6A 3HNJA 3SWKA 3V7OA 3GWNA 1YAUO 2AP3A 1N7SC 4YT5A 4XLPF 2NSFA 3IFMA 4CIHA 2KK7A 4F4BA 3L74G 3V5XA 1AQ5A 2VH3A 2N1TD 2OYHB 1ZLLA 4DOJA 1OW6A 2P10A 5AW1B 4P9TA 1J1EC 5A6KA 1FJPA 2OYIA 2W27A 1RKCA 1L0LD 1OFCX 1C03A 3ABKC 3VAYA 2ZD9A 5EK0A 1ZU4A 2JPUA 1KILA 2CGEA 2OQMA 2HFIA 1SQVK 2E87A 2EILC 1E84A 3K1HA 3LJBA 3A0HH 1SQBJ 2K37A 1O87A 1GL2A 1LWUC 1MQVA 1Q7YQ 3SEOA 1JY2O 4WABA 4JIOA 5KAIE 3L1MA 1OCOC 2KC3A 3EFOB 3NRHA 3PLNA 5CCHC 2BCCJ 2OCCC 3HE5B 3NYMA 5KLIB 1NTKG 1BE3E 1LTGC 1X9VA 3HNIA 5KAFH 4ZNCA 3AEEC 4MW3A 4WY4B 4PD4I 2L6HA 3K7DA 1YQ3C 2K3RA 3Q5SA 3CQZA 5E3CA 1KB9H 1K40A 1M57D 2QNLA 2QE7H 2YLGA 4JCHA 2V7QJ 2W9YA 2YQYA 2FXMA 5CBNA 4PJMA 4I1LA 3AECC 2IBZE 1PP9E 3O6QA 1LVKA 5COFA 3H1ID 5BUOA 4CS8A 3H25A 2XLDA 3M4BA 3E1IA 1EKYA 2IFNA 4U3FG 1D0YA 2NUPB 1BSHA 2KNCA 5GTHH 1S2EA 3CI9A 2C03A 1KB9D 3P32A 1U89A 2FFHA 5KYUB 1QGKB 1LT9C 4Z9IA 1RKEB 3DM5A 3N2ZB 1BDJB 2M0BA 5F5FA 1GK4A 1SR2A 3CCSP 1EZVD 3FDQA 3G6EP 1FMWA 2IBZI 3TK1A 1J1DC 4YL3A 2ZT9C 3JZ0A 4XEVA 3LAYA 4NQFA 2QIWA 1ZW3A 3U3BA 2DI3A 3HD7B 3RVYA 2CPBA 2WSCH 5AVSB 5H2FE 1N8RQ 3GM2A 4E17A 1HGZA 3OWTA 2YZSA 5KLVK 3ITFA 4A2NB 3JTLO 2DYSC 5DQZA 1VOMA 3CL3D 3CC2P 4AL1A 4MTFA 1OR2A 2OTKE 4JVSA 1Y8AA 1KMIZ 1WATA 4JCZA 4NPEA 5JRAA 3TDKA 3KQGA 1IO4A 4GYTA 4YT4A 4BJ1A 1KZUB 1SQBE 3B5NC 4MVSA 4CIPA 1QZXA 3WU2H 3BEHA 5APTA 4DJ9A 1FU1A 2AEJA 2H7OA 4OD5A 5JUAA 3MTUE 4UB8H 3ZVRA 2K9YA 4ZMDA 1LTJC 2QEXP 2W83C 3KDPB 3PHLA 2BCCE 2JWDA 2XS1A 4C46A 3L8JA 2KSJA 4AK9A 2A1DD 2W90A 4WGZA 4NTBA 1QL1A 2HKVA 4DBQA 3CX5D 1Y4CA 3CXHH 3UGOA 2FYUG 1NG1A 4AUWA 1CW5A 3CCLP 1N73B 4JEBA 4ONSA 2WPQA 1X8YA 2HPCB 5KKZC 4U5HA 1ZRTD 1U6HA 3GEHA 2AWYA 3HUSA 3L72G 3RK2C 3AE7C 3C8VA 3SYNA 3LEVA 2E43A 2B89A 4GOEA 3BCCD 5APVA 4LACB 2ZYAA 2EINC 2EPLX 3AE4C 3HTKA 3QTHA 1GM5A 5KYXB 2Q9BA 2P67A 1VQOP 2HJMA 1W2BO 1S4XA 3W2WA 3AEBC 3TOMA 3QH9A 5DS4A 4CS7A 2Y39A 2XL8A 3FWLA 5KYUA 3CXHD 4K0DA 2Q9CA 4JPZB 3C7JA 3TSIA 1YDIA 4N4WA 4HJGH 1NTKK 2X0CA 2Z15A 5B5EH 2Q00A 4CPGA 4PK4A 3POVA 4JJGA 2NZ2A 2Y0DA 1ZN5A 1PPJD 1TWCA 2E76D 1UFBA 4ASVA 5L0GA 3LIDA 3SXMA 3L36A 2B0HA 3W67A 1NJIQ 3ATPA 3IN6A 3S29A 1KORA 3RK3D 1WT6A 3EWKA 4U5EE 3L73J 3IQTA 1SQPJ 3H1JG 1ZZPA 4BJ5A 1GZLA 5E79E 3WHNA 3C18A 4O6NA 3E1RA 2KUBA 3DWWA 1RJ9B 1KQSO 2G3AA 1KN7A 5M1BA 1G2CA 1OXBA 2UWJE 2ICWG 3G9RA 3BRJA 3U5SA 5L3QA 1TU3F 4WB4A 2V26A 2VCBA 1H6GA 2NPUA 1Q0GA 4XEKA 2A6HF 4HB1A 1SQXJ 1A41A 2BE5F 4CJOA 3PDMP 1JY3P 1CGME 2IYPA 1CI6A 5GPGB 1L4AA 4CS8C 1R4TA 4JE9A 1HF9A 4E7SA 3MZWB 4MQ9F 3KXDA 5KYYA 4H0LB 4EWCA 2WVRA 1ZU5A 2A45G 2OEVA 2NPSB 2Q1KA 4NTFA 1V55C 4CS9C 4ZKUA 3H2VA 4G78A 2FXOA 1RXQA 1URQD 2WSFH 3EHMA 5IY5C 1BCCD 1LS1A 4DZOA 5A6BA 4PD4H 1LE2A 4PV1B 1LI7A 4Y28J 1XTCC 2P7VA 2Q3IA 2FYZA 4Y99C 3K5BA 2EPNA 2N1TB 3U3FA 5KAIH 2YWAA 4U5GA 4O7GA 1E86A 2I8DA 3KYIA 2SPZA 2R3CA 3A3YB 1M2VB 4W7ZA 1T6QA 2XXAB 3M91A 3TYYA 3VN0A 3AGUA 4PFPA 1VQ7P 2WSCJ 3GM3A 2V4HA 1KNYA 3IPMO 2E5YA 1IFPA 3H1LG 1LGHB 1TFOB 1J1EB 1FDIA 1Y6DA 3RL0g 3GG2A 1MUUA 1SP4A 4ER9A 4TLFA 1QPUA 2D2CB 3UR3C 5APUA 1U57A 3B0VC 3EGXA 2ZYDA 3KL4A 3II6A 1FZGA 4BEMJ 1NAFA 5AW8B 3M4CA 5AVYB 3RQGA 4KNVA 3HE4A 3M06A 3EH1A 4FAPB 1CGNA 1JOCA 5EFWB 1T01A 3A0HE 1BE3D 3CD6P 2KB7P 4WY4D 3ZG1A 3L73E 2CPSA 2GUSA 1SQPE 1MNDA 4XPXA 2KZIA 1XWJA 3T97B 4C7OA 2JX0A 5BVZA 1ORSC 1CSBA 1SMYF 3ZQYA 1N7LA 3WMM0 3OJAB 2WVOA 1FDMA 1L0NG 3EJNA 1U0BB 2Y0EA 3MBGA 5KAFE 2KYVA 1NLXA 4J30B 1PP9D 1FZCB 2P7JA 3TJ5A 4DRIB 3HJCA 2IBFA 2OTJP 1YJNP 2NUTB 3DJNB 1SQXE 3HTKC 3Q6NA 1D1AA 1EA8A 5H2FH 1JO5A 1M1KQ 3L35A 2NPSA 1BR2A 1ZOYC 4K1OA 4GOFA 3KYJA 5E2QA 3VOPA 1JNMA 5AW9B 3PHF2 3M9QA 3JC22 1JY3O 2HYNA 2RMZA 2K9JB 4M3LA 3EFGA 2J7PD 4UDVA 1Q81Q 1OR3A 5BU8B 4U3FJ 5GTHE 3GHGC 3NKEA 4YWQA 1A0BA 5CIVA 2M5AA 1S9KE 2E74B 3RH3A 1NTZJ 3ECSA 4E0HA 4DRJB 1USEA 2PF4E 2YRFA 1NSGB 3GORA 2XXAA 2XLOA 1ZHWA 1RMVA 4BJ5C 3DI5A 5A6AA 4O79A 3NFQA 1M56D 4GODA 2Y3GA 1IZNB 3V2RA 2IXMA 2VCAA 4GIFA 3WODF 4H13C 1QVGO 3Q3DA 4DVYP 2R9RB 3L71J 5TISH 3ZC4A 3L34A 2IXOA 1SQBD 2HODA 2QVAA 4NC3A 4OGQC 1IFJA 1GK6A 3LLIA 2YKOA 3MHVA 4GKGA 1G1JA 3B5NB 4YN0B 3TGUJ 1L4AC 1KQFB 4C3DA 2M64A 1RCPA 2FGYA 2RN0A 3O10A 2BCCD 2IYOA 2KS1A 1XZQA 3ZDMA 3CWBJ 5AVRB 1LTJB 5CI9A 3WU2E 4BPMA 1L0LG 3JT1A 3N7NA 1E5WA 4R4LA 4UB8E 1K04A 2ETSA 2A68F 3U8VA 2D4UA 4U5CE 2O01J 1A7DA 1L3PA 2W45A 2Z5HA 2WT7A 5APQA 2WSFJ 3R4YA 5DLJA 2C04A 4E7ZA 1CPQA 1ZR4A 5KKZB 1R8EA 2NUTA 5EHHA 2POHA 1SQQJ 4EI2A 2P61A 2YL1A 5AVXB 2FYUJ 4GQHA 1NVOA 4LDQA 4WBAA 2Y9ZA 1LNQA 2A69F 3PCVA 3U1CA 3GANA 4KI2A 1RF0C 2MYSA 1MKMA 3RGUA 2GDCA 1YTZI 3LW5H 2E76B 1HJBA 1Q86Q 4W7YA 3L70J 1YI2P 4NPFX 2OG2A 1P84I 2G8YA 2FFDB 1L7CA 4KNWA 3RW0A 1QKRA 1NYHA 1GW4A 1V54C 4R4MA 3AE3C 4U3FE 1SF8A 1T6AA 1JY3N 2YO2A 1L0NK 1HMDA 3H1IG 1T5OA 2IZ1A 3CLQA 2XLWA 4DJGA 1NKZB 2QJPB 3H32A 2J5UA 2JKVA 2OTLP 1GU4A 3ABMC 1Z7Qc 1DEBA 2KYHA 1Z63A 2HZ8A 1Q82Q 2EPOA 5KLVG 3KPHA 1BZ4A 5CJ4A 3C8GA 4H4KC 4K35A 1EZVG 2QJKC 5AW5B 2G62A 3HNKA 2OGUA 3L71E 3PH0A 4IFDK 1NFNA 1V74B 4N6HA 4OIQF 5CCGD 2QA4P 3Q1MA 3SXKA 4JJFA 3K1IC 1NU1K 1WMKA 1ZXGA 1EXIA 5EGYA 4HYTB 4JBZA 4H0LD 2MWQA 1ZW2A 1AQTA 1Z5ZA 1YARO 3JRMO 1BBHA 3AEGC 3CCVP 1YZAA 3RKOF 4I7ZC 1URQB 3VMYA 1KV4A 2FBWC 1FC2C 3KH2A 4C3BA 1NH4A 2PX3A 2OOCA 2NRGA 4BEJA 2H7BA 3CWBE 2XL4A 1MMDA 5CHXA 4PV1D 3V4QA 1Q0FA 3A7OA 4EYYQ 2HSBA 4MS2A 3ZIBA 1VLSA 4EIJA 3VMXA 4JURI 4IRUA 1OMIA 3NMJA 4FX5A 2ZPAA 2KLVA 3FAJA 3M0AA 1NU9C 1JAFA 2GA0A 2L6GA 4ZLDA 1HJ0A 4PJNA 2Q9IA 2ZXWC 1VLTA 1NAYA 3JYYA 1FTSA 4ULVA 4L74A 2C9NY 2GAQA 3TNUB 4Y99B 4PD4E 4HKZH 3SP1A 1RF1A 1SQQE 3UIAA 2D5RB 5BQGA 2FYUE 3IQ5A 2E75C 4P6IC 1GU5A 3JYHA 2ZVOB 2P2UA 1J2JB 3AG3C 2MHRA 1FJKA 5BU5A 1MMAA 2D2CD 3G3ZA 2LK4A 1AA0A 4IFFA 1OXZA 1L0LK 3P7KA 2W4BA 2B87B 4JEAA 3L70E 1KYOI 3RL0C 1X79B 2QUPA 1NGMB 2J9VA 3FXDA 1S5LH 3TD7A 1G5ZA 1JMWA 1RY3A 2XZRA 2WWWA 3BCCG 1EXJA 2YXRB 1UG7A 3L73D 3TF5A 1VMAA 4O6MA 1SQPD 3VP9A 1TWHA 2QY9A 2IZ0A 1YLMA 3MFNA 3AE8C 3IAOA 4G7HF 4OH8B 4TT3H 2HLOA 3QZCA 2V3CC 1X22A 3V2PA 2ZXXA 1HY5A 1USDA 1S3JA 2PAJA 2CDQA 2ASRA 1KQLA 3M1CB 1PPJG 1YVIA
chains in the Genus database with same CATH topology
1WMKA 1EXIA 3AE6C 2YIUC 4H0LD 1OW6A 2P10A 1KQFB 3SFDC 3RK3E 1O3UA 1ZZPA 1PIXA 2WPVB 2PBEA 3O10A 3AEGC 3GF7A 3GM1A 2IDBA 2H89C 4I7ZC 3C18A 2FBWC 3RQFA 1PV3A 2JPUA 1FDOA 4I7ZB 2KK1A 2G3AA 3T97B 5M1BA 2QSIA 2JX0A 1KMIZ 5L8RJ 4OGQB 4R4LA 4PV1D 2HSBA 2WQYC 3G9RA 1K04A 3BRJA 1V4AA 1TU3F 3RQEA 1PL5A 1DD3A 4YXDC 1YQ4C 1JOGA 1Y9BA 1S1CX 2JO1A 2O01J 4XEKA 4R32A 1OMIA 2WSFJ 2FXPA 3R4YA 5KLIC 1WTYA 1KQGB 2L6GA 1OW8A 3LW5J 3GM2A 1R8EA 2E74D 1HJ0A 1Q90D 2ZT9D 2K9YA 3Q5RA 5F28E 4EBJA 1HF9A 3Q2YA 3JYYA 4KT0J 3TULA 2L6FA 1KTMA 2YMKA 4U7JA 2QJYC 4H0LB 4OGQD 4Z1MH 1JB0J 3L8JA 4H44D 3AEEC 3GMAA 1WOLA 1ZOYC 1WWPA 1OW7A 2L6HA 3K7DA 1YQ3C 3Q5SA 3L8IA 1K40A 4IL6X 3AEAC 1VF5C 1VL2A 2E75C 3FGAD 1DIPA 1QVXA 3U0CA 3AE1C 2V7QJ 2E76C 1VF5B 2E75B 1MKMA 4PV1C 4EBKA 2D2CD 4H13D 2E76B 2FYNC 3AE2C 2LK4A 4PV1B 1DD4A 4Y28J 4XFJA 5KKZC 4XEFA 2OQQA 3AE5C 3AECC 1AJYA 3AE7C 3C8VA 3O6QA 4H0LC 2G8YA 2BEQD 3B71A 3C8GB 1NYHA 3H25A 3U3FA 3AE4C 3Q5PA 2E74C 2YWAA 4R4MA 3AE3C 3D6ZA 1NGMB 1RQVA 1UIXA 2E74B 1IK7A 1S5LX 2MKVA 3AEBC 1ZMEC 2QJPC 1RQUA 1ZP0C 1EXJA 3AEFC 1K05A 4H44B 2J5UA 3S9OA 3ABVC 3D6YA 2WSCJ 2WSEJ 3GM3A 1KNYA 1FDIA 3GF3A 4YTPC 3D71A 1KILE 3AE8C 3IAOA 3RL0g 2Q00A 3MFNA 2D2CC 4H13C 4TT3H 3Q3DA 1GMJA 1ZRTE 1VF5D 2BEZF 2D2CB 2E75D 2NZ2A 4H13B 3D70A 3C8GA 3SFEC 1U57A 2E76D 2ZT9C 1UFBA 3JZ0A 4XEVA 4NQFA 2QJKC 3AE9C 2QIWA 3AEDC 2JP3A 2ZT9B 3GLMA 2H88C 4OGQC 3IN6A 4GDOA 4H44C 4RKUJ 3AJMA 3RQGA 1KORA 3Q1MA 3C8GD 3EWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE6 C;  1OW6 A;  2PBE A;  1O3U A;  3SFD C;  1ZZP A;  3O10 A;  3AEG C;  3GM1 A;  2H89 C;  3C18 A;  2FBW C;  3RQF A;  1PV3 A;  2JPU A;  2KK1 A;  2G3A A;  2JX0 A;  3C8G D;  2HSB A;  2WQY C;  3BRJ A;  1K04 A;  1V4A A;  3RQE A;  4YXD C;  1YQ4 C;  1JOG A;  4XEK A;  4R32 A;  1WTY A;  2L6G A;  1OW8 A;  5F28 E;  4EBJ A;  3JYY A;  3TUL A;  2L6F A;  1KTM A;  3L8J A;  3AEE C;  1WOL A;  1ZOY C;  1WWP A;  1OW7 A;  2L6H A;  3K7D A;  1YQ3 C;  3L8I A;  1K40 A;  3AEA C;  1QVX A;  3U0C A;  3AE1 C;  4EBK A;  3AE2 C;  2LK4 A;  4XEF A;  3AE5 C;  3AEC C;  3AE7 C;  3B71 A;  3C8G B;  3U3F A;  3AE4 C;  2YWA A;  3AE3 C;  3AEB C;  1ZP0 C;  3AEF C;  1K05 A;  3S9O A;  3ABV C;  3GM3 A;  1KNY A;  4YTP C;  3MFN A;  3AE8 C;  2Q00 A;  3C8G A;  3SFE C;  1UFB A;  3JZ0 A;  4XEV A;  4NQF A;  3AE9 C;  3AED C;  2H88 C;  3RQG A;  3AJM A;  3GM2 A; 
#chains in the Genus database with same CATH topology
 4KBL A;  2AEF A;  1SQX D;  2WMM A;  4U9D A;  4JW1 A;  3GF7 A;  1HGV A;  2O3J A;  4HFF B;  3RVZ A;  4I3M A;  3I5P A;  2WB7 A;  3FVY A;  3ZTM A;  2KJG A;  2E5T A;  5L0C A;  1PV3 A;  2XDJ A;  3LS1 A;  4QI2 A;  1D0X A;  4L75 A;  3WUU A;  3NTN A;  2J0X A;  1NTM J;  3AG2 C;  5K0I A;  2A0U A;  3B0U X;  2WSS H;  2JO1 A;  3M9H A;  3QVY A;  4EDF A;  3AOU A;  2OYH A;  3USS A;  3C63 A;  2ZAE B;  3IR9 A;  3LW5 J;  3LNR A;  2E74 D;  2ZT9 D;  1ZYR F;  2K88 A;  5C39 A;  1S9K D;  2L6F A;  3C62 A;  4YXW H;  3LNM B;  1IZM A;  2JD3 A;  3GHG B;  3AGT A;  3DJU B;  4IB4 A;  3QMK A;  3LEO A;  2XRH A;  1VF5 C;  3DE9 A;  1PGP A;  3MP7 B;  4ANJ A;  3WAQ A;  2FYN C;  3AE2 C;  3EFO A;  2Q6Q A;  4CSA A;  4HE8 D;  4CDA A;  5AW7 B;  1FNT c;  3HE5 A;  1BCC G;  2XNX A;  4UB6 H;  2PGD A;  5CMZ A;  2BEQ D;  3C1L A;  3FOP A;  3H1H J;  5AC5 A;  2A45 I;  3S4R A;  4IFM A;  2AWC A;  1Z6A A;  3B5N D;  4WY4 A;  5T1D B;  1UIX A;  1LKX A;  1LM3 B;  3CCJ P;  3A0B H;  1JY2 N;  1KFN A;  4A7P A;  1PZQ A;  1H9G A;  2KQ9 A;  1P84 H;  2R32 A;  1M6T A;  1O5H A;  1K05 A;  1RE4 A;  3S9O A;  4RO0 A;  1OCZ C;  4CBE A;  5AVV B;  5TIS E;  1K73 Q;  4DOZ A;  4W8K A;  2QM8 A;  1VYK A;  3U2M A;  1U7J A;  1SQV J;  3L75 J;  1EC5 A;  1I5N A;  3SFE C;  2BAS A;  2QRX A;  1AFO A;  2NUP A;  4FES A;  4XLN F;  1G1I A;  2J59 M;  3OW2 O;  1SFC B;  3DD7 A;  3MGN A;  2ZFC A;  2O01 N;  2Y69 C;  2OYI C;  4I6M C;  1RKE A;  1PIX A;  1N2D C;  2WPV B;  5APW A;  1QSP A;  1TR2 A;  4G7O F;  3IHU A;  1NWQ A;  1WAS A;  3QW0 A;  1I4Z A;  1KIL C;  1LP1 B;  2PRR A;  1RF1 C;  1BE3 G;  1FDO A;  1M1J B;  2J7P A;  1APC A;  1CZQ A;  3L4F A;  4Z9H A;  1GL2 C;  5COM A;  5L8R J;  1DX7 A;  3UMK A;  3HD7 A;  1M8O B;  1NTM E;  3G4S P;  1BGY J;  4EUK B;  2E42 A;  3L0I A;  2JR8 A;  2FXP A;  1MZ9 A;  3V2N A;  3RK3 C;  2ZJS E;  1OW8 A;  1NOH A;  3U2L A;  4N78 E;  4U3F D;  2Z4E A;  1PP9 G;  4C7N B;  1WGW A;  3H1K J;  2HG5 D;  3VRC A;  4D6T G;  3GOD A;  4C7R A;  4IWB A;  1NTZ D;  1S05 A;  2EIM C;  2L7A A;  1F1M A;  1XTG B;  2J58 A;  3FGA D;  4I44 A;  2I8B A;  4EBK A;  2H7V C;  1K8A Q;  1OVR A;  4XEF A;  2H43 A;  3M0D A;  2A06 G;  2R7S A;  1YIT P;  2YVK A;  1LTS C;  4NY3 A;  3L71 D;  3Q7G A;  2QLA A;  1NFO A;  2YL0 A;  1VB5 A;  3H1H E;  1NTZ K;  2B88 A;  2O01 H;  4AE4 B;  3PRJ A;  3R2P A;  2LD6 A;  2H8A A;  1KYO H;  1GD2 E;  3MUD A;  2LXB A;  1BDD A;  3TGU D;  1N73 A;  1T9K A;  3H6P A;  3I5Q A;  2HPC A;  1XZP A;  4YTP C;  3CWB D;  3AQC A;  2P0N A;  1OZH A;  5D91 A;  2BEZ F;  1MFT A;  1VK5 A;  1EQ1 A;  3M9B A;  2G3V A;  2NSG A;  4K3A A;  1N7S B;  1SQV E;  3B4S A;  5KYX A;  3L75 E;  5CI8 A;  4AL0 A;  4YT2 A;  2PP6 A;  3ZDL A;  3EH2 A;  3AJM A;  2OYH C;  2R7U A;  2KI7 B;  1D0Z A;  1SQB G;  2R7X A;  4YL1 A;  2P58 A;  1YYJ A;  1QL2 A;  1GS9 A;  3FHD A;  3GM1 A;  2LXC B;  4PD4 D;  2HUJ A;  4CJG A;  2B0J A;  1SQQ D;  3L74 J;  1FZB A;  1M1J A;  1FMV A;  3SXZ A;  2QTV A;  2FYU D;  1LS4 A;  1AV1 A;  4U5F E;  1FOS E;  1KC8 Q;  1VQ4 P;  2J9B A;  3JCU H;  4I2L C;  4WGY A;  1H8A A;  3U1A A;  3DKA A;  1LWU B;  2WVN A;  1IFN A;  4CSA C;  5AW4 B;  1JCD A;  5KLI C;  2P1J A;  1VQP P;  4YK5 A;  3L70 D;  4DRH B;  1BGY E;  3HKK A;  1GW3 A;  1YBK A;  3EGD B;  2YMK A;  1RJ9 A;  1T2K C;  3RL0 B;  2QG4 A;  4DVZ A;  3S84 A;  4IL6 X;  1RE4 C;  3H1K E;  5KTB A;  2MJZ A;  256B A;  2O1K A;  1NTK J;  3GW6 A;  3VF0 A;  4RDA A;  1CPR A;  2IBZ D;  2KSF A;  1S5L E;  5JLI A;  3HUS C;  4XFJ A;  1U7M A;  3CZ6 A;  2J45 A;  2Y3B A;  2OQQ A;  3W8H A;  2EIJ C;  2AVK A;  5CCG A;  2M4E A;  1OVV A;  3B0P A;  4MW8 A;  5DVW A;  3Q6M A;  1W2W A;  5L0J A;  2ZYG A;  1EDI A;  1HUC A;  3NMI A;  4KHX A;  1MMN A;  4IJJ A;  1H7I A;  3NYJ A;  5BQI A;  2LCH A;  1H0T B;  4EHP A;  2A45 H;  1FE6 A;  5JP7 A;  4WJ0 A;  1SS1 A;  1LT9 B;  1UII A;  1JTH B;  3A11 A;  5AGF A;  1D1B A;  1NU1 G;  2IM8 A;  2IFM A;  5KLV E;  4OWF A;  3V6I A;  1TWG A;  5KYW B;  2N1T A;  4IGG A;  3AE9 C;  1J1D B;  3HD7 C;  4NTA A;  2ZT9 B;  3LUT B;  2WTY A;  1JMB A;  1M2V A;  2W6B A;  4N3Y B;  4GDO A;  2WZ7 A;  4RKU J;  2DB4 A;  4JYB A;  1H88 A;  2CNW D;  2R05 A;  1JM0 A;  2PBE A;  1O3U A;  3S1K A;  3O39 A;  4MTG A;  1YJ9 P;  1KB9 I;  4LGD E;  2R03 A;  3FXH A;  3SZR A;  4CDY A;  2J46 A;  3X2Q C;  3W8I A;  2ITA A;  4MVU A;  2KK1 A;  1OX3 A;  2BL2 A;  1EZV I;  3G50 A;  4WVZ A;  3U59 A;  1FBM A;  1NO4 A;  3L74 E;  5DS5 A;  4W8P A;  3WUT A;  3S27 A;  1PCX A;  5AC4 A;  2JWA A;  3KPE A;  3NMD A;  5AW6 B;  1C17 M;  1WN0 A;  1J8Y F;  3M0D C;  2H8P D;  1WTY A;  2R44 A;  3C8Z A;  4EBJ A;  2XKM A;  1R5L A;  4KT0 J;  1KTM A;  2R7O A;  3N0T A;  2QJY C;  4X0R A;  4OGQ D;  3V4W A;  1JB0 J;  2OAR A;  3LIE A;  3T97 A;  3F89 A;  3I5C A;  1WWP A;  2I15 A;  2NG1 A;  1PD0 A;  3AG4 C;  1Z23 A;  3Q7L A;  1FS0 E;  4FWV A;  1L4A D;  2KZJ A;  1MV8 A;  1SQB K;  1AUE A;  1DIP A;  3U0C A;  3MUD C;  4UB6 E;  1SLQ A;  5KJ7 D;  2DYR C;  2OYO A;  4K7B A;  4EKW A;  3ABL C;  3MYI A;  1NZE A;  4J7Y A;  4J7T A;  3TK0 A;  1FZC A;  3EHN A;  4J32 B;  3A0B E;  2Q3T A;  2N9B A;  1JEK A;  1NTK E;  1P84 E;  1HVV A;  1HE9 A;  3RK2 B;  1SFC D;  1S5L X;  4NCQ A;  1ZME C;  4IL6 H;  1E83 A;  4ZKP A;  2EPK X;  1T6U A;  4PR9 A;  1MFZ A;  3L72 J;  2K9J A;  3CX5 I;  2HV6 A;  2FY8 A;  2OYI B;  5BQH A;  2PFX A;  1Q0K A;  3LS0 A;  1KIL E;  1G4W R;  5JS5 A;  3L73 G;  2ZXO A;  2YKP A;  1BSN A;  1SQP G;  2RKL A;  1KIL B;  3D70 A;  4O6Y A;  1PGQ A;  4KC9 A;  1JMM A;  2R7Q A;  1NTM D;  2Q3E A;  1D1C A;  4H44 C;  3CME P;  3ASO C;  3X1O A;  4ULW A;  4N78 D;  1ZHY A;  3RK3 E;  2HJ3 A;  1LPE A;  2EPM X;  2KIK A;  2AEM A;  3CCE P;  3S0X A;  5DJU B;  1SQX G;  1WRG A;  3C9I A;  3RQF A;  4AQR D;  1T8Z A;  2QSI A;  2M3E A;  3A2A A;  3R7C A;  1QLE D;  3H1J J;  5B1A C;  4LER A;  3BRT B;  1PD1 A;  2M3B A;  3HNL A;  4BG0 A;  3B5N A;  1RH5 B;  3FWN A;  5F5H A;  4JTD B;  3RF3 A;  3I4U A;  1SYQ A;  3DZA A;  3CCQ P;  3F5H A;  3JSE O;  3O6Q B;  3Q2Y A;  4YPC A;  2R5B A;  2GFH A;  4MVR A;  2NPS C;  4Z1M H;  1LTJ A;  3EZI A;  3H1H D;  1OW7 A;  4BWN A;  1H89 A;  1Q2N A;  1Z3I X;  2KNC B;  4G0H A;  3GEI A;  2YKQ A;  4JC7 A;  3V5Z A;  1OIP A;  2XV5 A;  2LSE A;  5HSW A;  3SXY A;  4PV1 C;  2Q7R A;  2YMY A;  5AW2 B;  2A6E F;  1TWA A;  2FAP B;  1N7S D;  2WIT A;  3AE5 C;  1T3J A;  2H7H A;  4PFO A;  2N1T C;  1SQV D;  1LTT C;  3L75 D;  2YEV A;  3SWY A;  2CCY A;  3T6G B;  1KYO E;  1TKN A;  1ZHZ A;  1DOW A;  1MMG A;  2IYL D;  4RBN A;  3FOO A;  1ZP0 C;  5B3S C;  1BR4 A;  3L37 A;  1VQL P;  2KXP B;  2OKU A;  3U9M A;  1PGJ A;  1ZW0 A;  5B66 E;  3L72 E;  1OKK D;  1AVO B;  1ZR2 A;  2D2C C;  5AVT B;  4MVZ A;  1HE1 A;  5L0F A;  4MTO A;  1GMJ A;  3QW1 A;  2E75 D;  2FFD A;  3AQB A;  4P9F A;  1LI5 A;  1VQ6 P;  2I1K A;  1IFI A;  3MIW A;  1LE4 A;  4Q4Z F;  4OIO F;  3T6B A;  3H2U A;  5CCH D;  2L81 A;  3H1L J;  2IPP A;  3CC4 P;  2L5G B;  5AVW B;  2RD9 A;  3AG1 C;  2WPR A;  1BGY D;  3KYQ A;  2XM4 A;  1M57 C;  4QDL A;  1KD1 Q;  2OU6 A;  3RL0 D;  1ZHT A;  3TJ6 A;  3JCU E;  1M2O A;  4I1M A;  1E79 H;  4XTK A;  1VQ9 P;  1FZA A;  3PP5 A;  3H1K D;  4JZA A;  1NU7 D;  4OIN F;  3NKD A;  3CSK A;  1HBW A;  2J9U A;  4PJJ A;  4OIP F;  1PL5 A;  4HH2 A;  1Y9B A;  1N86 A;  4Q7C A;  2HFE D;  1FZC C;  3H1J E;  3K33 A;  4HEA J;  4A4A A;  1SQP K;  4Q5S F;  5F28 E;  3HUS B;  2VB6 A;  2CK3 H;  1Q90 D;  2YXQ B;  4JQ0 D;  3IQC A;  3EPV A;  1URQ A;  3K6B A;  3TUL A;  4U7J A;  2J0W A;  2R25 A;  3HTK B;  1L0N J;  4D6T E;  1FAP B;  2LIG A;  1WOL A;  1YZC A;  2W4M A;  4XE5 B;  3K66 A;  3KMI A;  2GA1 A;  4CS9 A;  2OEX A;  2M8R A;  3E7K A;  3SSU A;  2P1A A;  1QVF O;  1NTZ G;  5KLV D;  2HMZ A;  3G4X A;  2YHS A;  3VMZ A;  4D4X A;  3RBX A;  2A06 E;  4ZLC A;  1SQX K;  3SWF A;  1W5C E;  3EFF K;  3N24 A;  3HLZ A;  3V5Y A;  1D7M A;  2F22 A;  3A5T A;  3DMD A;  4DT0 A;  2Y3H A;  3TNU A;  3Q5P A;  2E74 C;  2AXT H;  2C0W A;  3D6Z A;  2JJL A;  3IEE A;  1SVF A;  2W6A A;  3FX0 A;  5TJH A;  3VM6 A;  1DEE G;  3L71 G;  5JVE A;  1NU1 J;  1B68 A;  3AEF C;  1C02 A;  2IX7 C;  1VPC A;  3CCR P;  3JSZ A;  2LFD A;  4LLC A;  1IW7 F;  3D71 A;  1L2P A;  4JYC A;  5GTI H;  1AVO A;  3GWL A;  3W4Y A;  3TGU G;  2HR3 A;  3L74 D;  4H13 B;  1VF5 D;  1JPJ A;  2B87 A;  1A02 J;  1G2C B;  2B9B A;  3CX5 H;  3CWB G;  1HTL C;  3MLG A;  2VAS A;  3QVZ A;  2KOG A;  2JP3 A;  1R5I D;  3F46 A;  2YL3 A;  4HFK B;  3SNH A;  1DH3 A;  3NXS A;  3UMH A;  1LT1 A;  2WSE H;  3C8G D;  4OGQ B;  2HSQ A;  3H1L E;  1CI6 B;  2XS8 A;  1ST6 A;  1L4A B;  3U9J A;  3DE8 A;  2G3K A;  2C0X A;  5KYY B;  2PNO A;  2QJY B;  1CGO A;  4XQ1 A;  1SQQ G;  3N4X A;  1IFD A;  3NG1 A;  1V4A A;  1Q0D A;  4ASW A;  2IXN A;  4LDK A;  3OA7 A;  1JOG A;  1GDT A;  1LTI C;  3S90 A;  3RK2 D;  1NTK D;  4PJ0 E;  1YA9 A;  3RIP A;  3FAP B;  1P84 D;  1PFI A;  2KLU A;  3B9Q A;  1L0L J;  2EIK C;  4IAO A;  3Q5R A;  2Y3D A;  5T3W A;  4JF7 A;  3PMR A;  1LJ2 A;  3KHU A;  1ZV8 A;  5TJ5 E;  5AVU B;  1PGO A;  2XL6 A;  3L70 G;  4N6C A;  5DQT A;  5JSL A;  1X0T A;  3M15 A;  1A7V A;  3EQL F;  5B1B C;  1L0N E;  1VL2 A;  3AE1 C;  3DXJ F;  3BRV B;  2GWW A;  2E76 C;  5APY A;  1GGQ A;  1KIL D;  2WZG A;  3GEE A;  1YJW P;  3VMA A;  4DBR A;  4N6J A;  3MYF A;  1GL2 D;  4IL6 E;  2FFD C;  1EQ7 A;  2DGJ A;  2XLM A;  3G4Z A;  1HW1 A;  4PJL A;  5JT4 A;  2IBZ G;  3RFY A;  2CNW A;  3KKB A;  3EGX B;  3E70 C;  3GHG A;  1TFK B;  1FZF A;  1N1C A;  1IFM A;  4RJT A;  1RQV A;  2FKW B;  1YHQ P;  2QJP C;  4LLE A;  1ORJ A;  3KZI H;  3HE4 B;  3B8E B;  4H44 B;  4OIR F;  3D6Y A;  1NKN A;  2Y9Y A;  3ITK A;  4M63 A;  1NU1 E;  1FFH A;  2KNH A;  3FMS A;  3P8M C;  2Z5I A;  3H1I J;  3NYL A;  4YT8 A;  4NPD A;  4C7O B;  3CPW O;  1IK9 A;  2Q7C A;  2KW3 C;  4BXL A;  2ZXE B;  4AX2 A;  1IJD B;  2YO3 A;  5B3I A;  2O9X A;  3RBZ A;  2QJK B;  4MVM A;  4XPY A;  5D92 A;  4U9E A;  1A02 F;  3O8Z A;  3EQ2 A;  1RHZ B;  3HRN A;  2YIU C;  2R7W A;  5KLV J;  3UGP A;  2WZL A;  4MND A;  1URQ C;  1VQM P;  2XM0 A;  2Y0C A;  1JPN A;  2L91 A;  4QI0 A;  4IAQ A;  3P8C E;  5KJ7 A;  2LP4 A;  4I7Z B;  4WWI A;  1YYC A;  1Q0M A;  1K9M Q;  5L3V A;  2WL8 A;  5B66 H;  4Z9J A;  2YNY A;  1SZI A;  4W80 A;  2HV7 A;  1S1C X;  1SFC A;  4AYC A;  4OD4 A;  1OCC C;  4EOT A;  2Q9A A;  2XND H;  3U8P A;  3ZWI A;  2CYD A;  1KYO D;  3OEO A;  1ZHX A;  1EI7 A;  3QWO C;  1LP1 A;  3F47 A;  1OVU A;  4L76 A;  5CBO A;  1HMO A;  2PX0 A;  1L0L E;  4MVO A;  5HV9 A;  1YIJ P;  2BCC G;  2M5A B;  4JKV A;  1FR0 A;  3AEA C;  3H65 A;  4I1O B;  4IOI H;  1FOS F;  2E75 B;  5A69 A;  4EIY A;  3L72 D;  2R5D A;  3RYL A;  1RF0 A;  1JUN A;  1J8M F;  1JRA A;  2KP8 A;  1DOV A;  2R7R A;  2DW3 A;  4BRY B;  4B6I A;  3CC7 P;  1RE3 A;  2VRS A;  3B71 A;  4C7N A;  4WY4 C;  1SQQ K;  2XU6 A;  1S7Z A;  2HOD B;  2FYU K;  1BDC A;  1KFM A;  1IK7 A;  5AVZ B;  2RH0 A;  4KJM A;  3VYW A;  1QX8 A;  2J9W A;  3MD0 A;  1HH0 A;  3JCU Q;  4O9B A;  1OWA A;  4GEH A;  2WSE J;  4LDR A;  1LIH A;  1H9T A;  1R5S A;  2KS1 B;  1T2K D;  3GF3 A;  2ZXP A;  2R7V A;  2TMV P;  2LQG A;  1EDJ A;  2YKZ A;  2PFD A;  4JTA B;  3TQO A;  3BCC J;  4YL0 A;  2ZVN B;  3H1I E;  2KGO A;  3GLM A;  3H1J D;  4BJ6 A;  5FCL A;  2W6J H;  2XLV A;  3LES A;  3OA1 A;  4AE4 A;  1S72 P;  1HWT C;  1NTM G;  3AE6 C;  4LLH A;  4GT1 A;  2WT7 B;  2YLD A;  3V2Q A;  3K1I A;  1HW2 A;  3SFD C;  1KB9 E;  4OVN F;  5AW0 B;  4LC1 A;  2R7T A;  4JRZ A;  4D6T D;  2H89 C;  5E3A A;  2P6V A;  3LLK A;  1KU2 A;  1T3U A;  2GUV A;  1VDF A;  1T6I A;  3DM9 B;  1EZV E;  1VQK P;  2BC5 A;  4MN4 C;  1N7S A;  2O1J A;  3T9O A;  1EDK A;  2WQY C;  4XPW A;  2VC9 A;  3RQE A;  1ZVZ A;  2Q5U A;  1YQ4 C;  2A06 D;  5L0H A;  4R32 A;  2X51 A;  5L0I A;  3O55 A;  3ZSU A;  2RSE B;  1W2E A;  1NHL A;  3A9C A;  3HD7 D;  1M56 C;  4DCK A;  1BR1 A;  3L8I A;  3J06 A;  1VTM P;  3I55 P;  1OKK A;  3M79 A;  2R3S A;  3H1H G;  1I4Y A;  3T6J A;  3H32 B;  3WG7 C;  4QMA A;  3JSV C;  1LWU A;  2AXC A;  1VF5 B;  3JRT A;  5L0D A;  4XA4 A;  2WPS A;  5CJ0 A;  3VTP C;  2AXT E;  4H13 D;  2K1A A;  1M90 Q;  3NMK A;  2FYN B;  4B86 A;  2QE9 A;  4BRY A;  5COG A;  2HS5 A;  1IC2 A;  5CCH A;  1AJY A;  2YLI A;  4XWJ A;  3C8G B;  3EGD A;  2XLH A;  2A0B A;  2I1J A;  3ASN C;  4PJ0 H;  3VYI A;  1G4U S;  1SQV G;  2V7Q H;  5GTI E;  3L75 G;  2MKV A;  5AVQ B;  1RQU A;  4IAR A;  3CAX A;  5A6J A;  3H1L D;  1G8X A;  3EZH A;  2JEE A;  2L9J A;  3DAG A;  4U5D E;  1BCC J;  4YJW A;  4EBB A;  2UUI A;  3CX5 E;  3W68 A;  1N73 C;  2XSE A;  4U5B E;  3UMI A;  1AVY A;  3EG9 B;  1M7L A;  5KJ7 C;  4CDV A;  4DXW A;  2N9Y B;  4L6R A;  1VQN P;  2C9L Y;  1Y47 A;  1OXK A;  1Z56 A;  2ZXR A;  1ZRT E;  1LTB C;  2OJE D;  2PP4 A;  5A6B D;  2WZF A;  1EDL A;  3US6 A;  1JCC A;  1OCR C;  3CCM P;  3AED C;  3BCC E;  1SFC C;  4BJT A;  4E18 A;  2H88 C;  3E9V A;  1FZE A;  2VCC A;  5T3T A;  3FXE A;  3BVH A;  4H54 A;  2AU5 A;  3CCU P;  4RD9 A;  1H0T A;  1A7E A;  4RES B;  3CEX A;  1LT9 A;  5DJT B;  1JTH A;  1JY2 P;  1YTZ T;  3CXH E;  5AW3 B;  3S28 A;  1VYI A;  2IDB A;  3WUV A;  1M1J C;  1BGY G;  2OJQ A;  2R02 A;  3OAK A;  1YA7 O;  1RF1 B;  5KYW A;  1L0N D;  2J8W A;  1JR8 A;  2W8Z A;  5K5G B;  1GL2 B;  5KYN A;  1PPJ E;  5E79 H;  3H1K G;  3VP8 A;  1DD3 A;  4YXD C;  2WVQ A;  4E0I A;  1AEP A;  2LFF A;  1LTA C;  1BE3 J;  1FAV A;  5FZT A;  2XLE A;  1KQG B;  1RE3 C;  3BAT A;  1MNE A;  3B29 A;  3CXH I;  2LKM A;  1OQC A;  3RK3 B;  4L73 A;  1YYX A;  1VQ5 P;  1GQA A;  4H44 D;  3GMA A;  3ZTZ A;  3PTZ A;  2IXP A;  1TQG A;  4C3E A;  5B5E E;  1E85 A;  1FFT C;  3IF4 A;  1QVX A;  1NU1 D;  2CW0 F;  1NTM K;  3I56 P;  4PAC A;  1NTZ E;  1VQ8 P;  1QLE C;  4JTC B;  1E2X A;  3ZQV A;  1PP9 J;  3O6X A;  3G71 P;  1DD4 A;  2LR2 A;  5CCG C;  1ORY A;  3MX3 A;  2YL7 A;  2GM4 A;  4D6T J;  3KZI E;  3T4R A;  4H0L C;  4MVQ A;  3NDB B;  2IOQ A;  1QQ3 A;  3CMA P;  5APX A;  2JDI H;  5DS6 A;  2UUH A;  1GTW A;  3PJS K;  1QEX A;  4N06 A;  2HMQ A;  4BJ6 C;  3DAF A;  5E33 A;  3W2V A;  3BAS A;  5APS A;  1NBB A;  2QM7 A;  3ABV C;  3V5B A;  2NPS D;  1YJG A;  2KSE A;  2YIU B;  3P8C D;  2Q4F A;  3TOL A;  3EG9 A;  3UNG C;  4G7Z F;  1BCC E;  3TGU E;  4D4N A;  4CX9 A;  3IQ6 A;  3HNJ A;  3SWK A;  3V7O A;  3GWN A;  1YAU O;  2AP3 A;  1N7S C;  4YT5 A;  4XLP F;  2NSF A;  3IFM A;  4CIH A;  2KK7 A;  4F4B A;  3L74 G;  3V5X A;  1AQ5 A;  2VH3 A;  2N1T D;  2OYH B;  1ZLL A;  4DOJ A;  1OW6 A;  2P10 A;  5AW1 B;  4P9T A;  1J1E C;  5A6K A;  1FJP A;  2OYI A;  2W27 A;  1RKC A;  1L0L D;  1OFC X;  1C03 A;  3ABK C;  3VAY A;  2ZD9 A;  5EK0 A;  1ZU4 A;  2JPU A;  1KIL A;  2CGE A;  2OQM A;  2HFI A;  1SQV K;  2E87 A;  2EIL C;  1E84 A;  3K1H A;  3LJB A;  3A0H H;  1SQB J;  2K37 A;  1O87 A;  1GL2 A;  1LWU C;  1MQV A;  1Q7Y Q;  3SEO A;  1JY2 O;  4WAB A;  4JIO A;  5KAI E;  3L1M A;  1OCO C;  2KC3 A;  3EFO B;  3NRH A;  3PLN A;  5CCH C;  2BCC J;  2OCC C;  3HE5 B;  3NYM A;  5KLI B;  1NTK G;  1BE3 E;  1LTG C;  1X9V A;  3HNI A;  5KAF H;  4ZNC A;  3AEE C;  4MW3 A;  4WY4 B;  4PD4 I;  2L6H A;  3K7D A;  1YQ3 C;  2K3R A;  3Q5S A;  3CQZ A;  5E3C A;  1KB9 H;  1K40 A;  1M57 D;  2QNL A;  2QE7 H;  2YLG A;  4JCH A;  2V7Q J;  2W9Y A;  2YQY A;  2FXM A;  5CBN A;  4PJM A;  4I1L A;  3AEC C;  2IBZ E;  1PP9 E;  3O6Q A;  1LVK A;  5COF A;  3H1I D;  5BUO A;  4CS8 A;  3H25 A;  2XLD A;  3M4B A;  3E1I A;  1EKY A;  2IFN A;  4U3F G;  1D0Y A;  2NUP B;  1BSH A;  2KNC A;  5GTH H;  1S2E A;  3CI9 A;  2C03 A;  1KB9 D;  3P32 A;  1U89 A;  2FFH A;  5KYU B;  1QGK B;  1LT9 C;  4Z9I A;  1RKE B;  3DM5 A;  3N2Z B;  1BDJ B;  2M0B A;  5F5F A;  1GK4 A;  1SR2 A;  3CCS P;  1EZV D;  3FDQ A;  3G6E P;  1FMW A;  2IBZ I;  3TK1 A;  1J1D C;  4YL3 A;  2ZT9 C;  3JZ0 A;  4XEV A;  3LAY A;  4NQF A;  2QIW A;  1ZW3 A;  3U3B A;  2DI3 A;  3HD7 B;  3RVY A;  2CPB A;  2WSC H;  5AVS B;  5H2F E;  1N8R Q;  3GM2 A;  4E17 A;  1HGZ A;  3OWT A;  2YZS A;  5KLV K;  3ITF A;  4A2N B;  3JTL O;  2DYS C;  5DQZ A;  1VOM A;  3CL3 D;  3CC2 P;  4AL1 A;  4MTF A;  1OR2 A;  2OTK E;  4JVS A;  1Y8A A;  1KMI Z;  1WAT A;  4JCZ A;  4NPE A;  5JRA A;  3TDK A;  3KQG A;  1IO4 A;  4GYT A;  4YT4 A;  4BJ1 A;  1KZU B;  1SQB E;  3B5N C;  4MVS A;  4CIP A;  1QZX A;  3WU2 H;  3BEH A;  5APT A;  4DJ9 A;  1FU1 A;  2AEJ A;  2H7O A;  4OD5 A;  5JUA A;  3MTU E;  4UB8 H;  3ZVR A;  2K9Y A;  4ZMD A;  1LTJ C;  2QEX P;  2W83 C;  3KDP B;  3PHL A;  2BCC E;  2JWD A;  2XS1 A;  4C46 A;  3L8J A;  2KSJ A;  4AK9 A;  2A1D D;  2W90 A;  4WGZ A;  4NTB A;  1QL1 A;  2HKV A;  4DBQ A;  3CX5 D;  1Y4C A;  3CXH H;  3UGO A;  2FYU G;  1NG1 A;  4AUW A;  1CW5 A;  3CCL P;  1N73 B;  4JEB A;  4ONS A;  2WPQ A;  1X8Y A;  2HPC B;  5KKZ C;  4U5H A;  1ZRT D;  1U6H A;  3GEH A;  2AWY A;  3HUS A;  3L72 G;  3RK2 C;  3AE7 C;  3C8V A;  3SYN A;  3LEV A;  2E43 A;  2B89 A;  4GOE A;  3BCC D;  5APV A;  4LAC B;  2ZYA A;  2EIN C;  2EPL X;  3AE4 C;  3HTK A;  3QTH A;  1GM5 A;  5KYX B;  2Q9B A;  2P67 A;  1VQO P;  2HJM A;  1W2B O;  1S4X A;  3W2W A;  3AEB C;  3TOM A;  3QH9 A;  5DS4 A;  4CS7 A;  2Y39 A;  2XL8 A;  3FWL A;  5KYU A;  3CXH D;  4K0D A;  2Q9C A;  4JPZ B;  3C7J A;  3TSI A;  1YDI A;  4N4W A;  4HJG H;  1NTK K;  2X0C A;  2Z15 A;  5B5E H;  2Q00 A;  4CPG A;  4PK4 A;  3POV A;  4JJG A;  2NZ2 A;  2Y0D A;  1ZN5 A;  1PPJ D;  1TWC A;  2E76 D;  1UFB A;  4ASV A;  5L0G A;  3LID A;  3SXM A;  3L36 A;  2B0H A;  3W67 A;  1NJI Q;  3ATP A;  3IN6 A;  3S29 A;  1KOR A;  3RK3 D;  1WT6 A;  3EWK A;  4U5E E;  3L73 J;  3IQT A;  1SQP J;  3H1J G;  1ZZP A;  4BJ5 A;  1GZL A;  5E79 E;  3WHN A;  3C18 A;  4O6N A;  3E1R A;  2KUB A;  3DWW A;  1RJ9 B;  1KQS O;  2G3A A;  1KN7 A;  5M1B A;  1G2C A;  1OXB A;  2UWJ E;  2ICW G;  3G9R A;  3BRJ A;  3U5S A;  5L3Q A;  1TU3 F;  4WB4 A;  2V26 A;  2VCB A;  1H6G A;  2NPU A;  1Q0G A;  4XEK A;  2A6H F;  4HB1 A;  1SQX J;  1A41 A;  2BE5 F;  4CJO A;  3PDM P;  1JY3 P;  1CGM E;  2IYP A;  1CI6 A;  5GPG B;  1L4A A;  4CS8 C;  1R4T A;  4JE9 A;  1HF9 A;  4E7S A;  3MZW B;  4MQ9 F;  3KXD A;  5KYY A;  4H0L B;  4EWC A;  2WVR A;  1ZU5 A;  2A45 G;  2OEV A;  2NPS B;  2Q1K A;  4NTF A;  1V55 C;  4CS9 C;  4ZKU A;  3H2V A;  4G78 A;  2FXO A;  1RXQ A;  1URQ D;  2WSF H;  3EHM A;  5IY5 C;  1BCC D;  1LS1 A;  4DZO A;  5A6B A;  4PD4 H;  1LE2 A;  4PV1 B;  1LI7 A;  4Y28 J;  1XTC C;  2P7V A;  2Q3I A;  2FYZ A;  4Y99 C;  3K5B A;  2EPN A;  2N1T B;  3U3F A;  5KAI H;  2YWA A;  4U5G A;  4O7G A;  1E86 A;  2I8D A;  3KYI A;  2SPZ A;  2R3C A;  3A3Y B;  1M2V B;  4W7Z A;  1T6Q A;  2XXA B;  3M91 A;  3TYY A;  3VN0 A;  3AGU A;  4PFP A;  1VQ7 P;  2WSC J;  3GM3 A;  2V4H A;  1KNY A;  3IPM O;  2E5Y A;  1IFP A;  3H1L G;  1LGH B;  1TFO B;  1J1E B;  1FDI A;  1Y6D A;  3RL0 g;  3GG2 A;  1MUU A;  1SP4 A;  4ER9 A;  4TLF A;  1QPU A;  2D2C B;  3UR3 C;  5APU A;  1U57 A;  3B0V C;  3EGX A;  2ZYD A;  3KL4 A;  3II6 A;  1FZG A;  4BEM J;  1NAF A;  5AW8 B;  3M4C A;  5AVY B;  3RQG A;  4KNV A;  3HE4 A;  3M06 A;  3EH1 A;  4FAP B;  1CGN A;  1JOC A;  5EFW B;  1T01 A;  3A0H E;  1BE3 D;  3CD6 P;  2KB7 P;  4WY4 D;  3ZG1 A;  3L73 E;  2CPS A;  2GUS A;  1SQP E;  1MND A;  4XPX A;  2KZI A;  1XWJ A;  3T97 B;  4C7O A;  2JX0 A;  5BVZ A;  1ORS C;  1CSB A;  1SMY F;  3ZQY A;  1N7L A;  3WMM 0;  3OJA B;  2WVO A;  1FDM A;  1L0N G;  3EJN A;  1U0B B;  2Y0E A;  3MBG A;  5KAF E;  2KYV A;  1NLX A;  4J30 B;  1PP9 D;  1FZC B;  2P7J A;  3TJ5 A;  4DRI B;  3HJC A;  2IBF A;  2OTJ P;  1YJN P;  2NUT B;  3DJN B;  1SQX E;  3HTK C;  3Q6N A;  1D1A A;  1EA8 A;  5H2F H;  1JO5 A;  1M1K Q;  3L35 A;  2NPS A;  1BR2 A;  1ZOY C;  4K1O A;  4GOF A;  3KYJ A;  5E2Q A;  3VOP A;  1JNM A;  5AW9 B;  3PHF 2;  3M9Q A;  3JC2 2;  1JY3 O;  2HYN A;  2RMZ A;  2K9J B;  4M3L A;  3EFG A;  2J7P D;  4UDV A;  1Q81 Q;  1OR3 A;  5BU8 B;  4U3F J;  5GTH E;  3GHG C;  3NKE A;  4YWQ A;  1A0B A;  5CIV A;  2M5A A;  1S9K E;  2E74 B;  3RH3 A;  1NTZ J;  3ECS A;  4E0H A;  4DRJ B;  1USE A;  2PF4 E;  2YRF A;  1NSG B;  3GOR A;  2XXA A;  2XLO A;  1ZHW A;  1RMV A;  4BJ5 C;  3DI5 A;  5A6A A;  4O79 A;  3NFQ A;  1M56 D;  4GOD A;  2Y3G A;  1IZN B;  3V2R A;  2IXM A;  2VCA A;  4GIF A;  3WOD F;  4H13 C;  1QVG O;  3Q3D A;  4DVY P;  2R9R B;  3L71 J;  5TIS H;  3ZC4 A;  3L34 A;  2IXO A;  1SQB D;  2HOD A;  2QVA A;  4NC3 A;  4OGQ C;  1IFJ A;  1GK6 A;  3LLI A;  2YKO A;  3MHV A;  4GKG A;  1G1J A;  3B5N B;  4YN0 B;  3TGU J;  1L4A C;  1KQF B;  4C3D A;  2M64 A;  1RCP A;  2FGY A;  2RN0 A;  3O10 A;  2BCC D;  2IYO A;  2KS1 A;  1XZQ A;  3ZDM A;  3CWB J;  5AVR B;  1LTJ B;  5CI9 A;  3WU2 E;  4BPM A;  1L0L G;  3JT1 A;  3N7N A;  1E5W A;  4R4L A;  4UB8 E;  1K04 A;  2ETS A;  2A68 F;  3U8V A;  2D4U A;  4U5C E;  2O01 J;  1A7D A;  1L3P A;  2W45 A;  2Z5H A;  2WT7 A;  5APQ A;  2WSF J;  3R4Y A;  5DLJ A;  2C04 A;  4E7Z A;  1CPQ A;  1ZR4 A;  5KKZ B;  1R8E A;  2NUT A;  5EHH A;  2POH A;  1SQQ J;  4EI2 A;  2P61 A;  2YL1 A;  5AVX B;  2FYU J;  4GQH A;  1NVO A;  4LDQ A;  4WBA A;  2Y9Z A;  1LNQ A;  2A69 F;  3PCV A;  3U1C A;  3GAN A;  4KI2 A;  1RF0 C;  2MYS A;  1MKM A;  3RGU A;  2GDC A;  1YTZ I;  3LW5 H;  2E76 B;  1HJB A;  1Q86 Q;  4W7Y A;  3L70 J;  1YI2 P;  4NPF X;  2OG2 A;  1P84 I;  2G8Y A;  2FFD B;  1L7C A;  4KNW A;  3RW0 A;  1QKR A;  1NYH A;  1GW4 A;  1V54 C;  4R4M A;  3AE3 C;  4U3F E;  1SF8 A;  1T6A A;  1JY3 N;  2YO2 A;  1L0N K;  1HMD A;  3H1I G;  1T5O A;  2IZ1 A;  3CLQ A;  2XLW A;  4DJG A;  1NKZ B;  2QJP B;  3H32 A;  2J5U A;  2JKV A;  2OTL P;  1GU4 A;  3ABM C;  1Z7Q c;  1DEB A;  2KYH A;  1Z63 A;  2HZ8 A;  1Q82 Q;  2EPO A;  5KLV G;  3KPH A;  1BZ4 A;  5CJ4 A;  3C8G A;  4H4K C;  4K35 A;  1EZV G;  2QJK C;  5AW5 B;  2G62 A;  3HNK A;  2OGU A;  3L71 E;  3PH0 A;  4IFD K;  1NFN A;  1V74 B;  4N6H A;  4OIQ F;  5CCG D;  2QA4 P;  3Q1M A;  3SXK A;  4JJF A;  3K1I C;  1NU1 K;  1WMK A;  1ZXG A;  1EXI A;  5EGY A;  4HYT B;  4JBZ A;  4H0L D;  2MWQ A;  1ZW2 A;  1AQT A;  1Z5Z A;  1YAR O;  3JRM O;  1BBH A;  3AEG C;  3CCV P;  1YZA A;  3RKO F;  4I7Z C;  1URQ B;  3VMY A;  1KV4 A;  2FBW C;  1FC2 C;  3KH2 A;  4C3B A;  1NH4 A;  2PX3 A;  2OOC A;  2NRG A;  4BEJ A;  2H7B A;  3CWB E;  2XL4 A;  1MMD A;  5CHX A;  4PV1 D;  3V4Q A;  1Q0F A;  3A7O A;  4EYY Q;  2HSB A;  4MS2 A;  3ZIB A;  1VLS A;  4EIJ A;  3VMX A;  4JUR I;  4IRU A;  1OMI A;  3NMJ A;  4FX5 A;  2ZPA A;  2KLV A;  3FAJ A;  3M0A A;  1NU9 C;  1JAF A;  2GA0 A;  2L6G A;  4ZLD A;  1HJ0 A;  4PJN A;  2Q9I A;  2ZXW C;  1VLT A;  1NAY A;  3JYY A;  1FTS A;  4ULV A;  4L74 A;  2C9N Y;  2GAQ A;  3TNU B;  4Y99 B;  4PD4 E;  4HKZ H;  3SP1 A;  1RF1 A;  1SQQ E;  3UIA A;  2D5R B;  5BQG A;  2FYU E;  3IQ5 A;  2E75 C;  4P6I C;  1GU5 A;  3JYH A;  2ZVO B;  2P2U A;  1J2J B;  3AG3 C;  2MHR A;  1FJK A;  5BU5 A;  1MMA A;  2D2C D;  3G3Z A;  2LK4 A;  1AA0 A;  4IFF A;  1OXZ A;  1L0L K;  3P7K A;  2W4B A;  2B87 B;  4JEA A;  3L70 E;  1KYO I;  3RL0 C;  1X79 B;  2QUP A;  1NGM B;  2J9V A;  3FXD A;  1S5L H;  3TD7 A;  1G5Z A;  1JMW A;  1RY3 A;  2XZR A;  2WWW A;  3BCC G;  1EXJ A;  2YXR B;  1UG7 A;  3L73 D;  3TF5 A;  1VMA A;  4O6M A;  1SQP D;  3VP9 A;  1TWH A;  2QY9 A;  2IZ0 A;  1YLM A;  3MFN A;  3AE8 C;  3IAO A;  4G7H F;  4OH8 B;  4TT3 H;  2HLO A;  3QZC A;  2V3C C;  1X22 A;  3V2P A;  2ZXX A;  1HY5 A;  1USD A;  1S3J A;  2PAJ A;  2CDQ A;  2ASR A;  1KQL A;  3M1C B;  1PPJ G;  1YVI A; 
#chains in the Genus database with same CATH homology
 1WMK A;  1EXI A;  3AE6 C;  2YIU C;  4H0L D;  1OW6 A;  2P10 A;  1KQF B;  3SFD C;  3RK3 E;  1O3U A;  1ZZP A;  1PIX A;  2WPV B;  2PBE A;  3O10 A;  3AEG C;  3GF7 A;  3GM1 A;  2IDB A;  2H89 C;  4I7Z C;  3C18 A;  2FBW C;  3RQF A;  1PV3 A;  2JPU A;  1FDO A;  4I7Z B;  2KK1 A;  2G3A A;  3T97 B;  5M1B A;  2QSI A;  2JX0 A;  1KMI Z;  5L8R J;  4OGQ B;  4R4L A;  4PV1 D;  2HSB A;  2WQY C;  3G9R A;  1K04 A;  3BRJ A;  1V4A A;  1TU3 F;  3RQE A;  1PL5 A;  1DD3 A;  4YXD C;  1YQ4 C;  1JOG A;  1Y9B A;  1S1C X;  2JO1 A;  2O01 J;  4XEK A;  4R32 A;  1OMI A;  2WSF J;  2FXP A;  3R4Y A;  5KLI C;  1WTY A;  1KQG B;  2L6G A;  1OW8 A;  3LW5 J;  3GM2 A;  1R8E A;  2E74 D;  1HJ0 A;  1Q90 D;  2ZT9 D;  2K9Y A;  3Q5R A;  5F28 E;  4EBJ A;  1HF9 A;  3Q2Y A;  3JYY A;  4KT0 J;  3TUL A;  2L6F A;  1KTM A;  2YMK A;  4U7J A;  2QJY C;  4H0L B;  4OGQ D;  4Z1M H;  1JB0 J;  3L8J A;  4H44 D;  3AEE C;  3GMA A;  1WOL A;  1ZOY C;  1WWP A;  1OW7 A;  2L6H A;  3K7D A;  1YQ3 C;  3Q5S A;  3L8I A;  1K40 A;  4IL6 X;  3AEA C;  1VF5 C;  1VL2 A;  2E75 C;  3FGA D;  1DIP A;  1QVX A;  3U0C A;  3AE1 C;  2V7Q J;  2E76 C;  1VF5 B;  2E75 B;  1MKM A;  4PV1 C;  4EBK A;  2D2C D;  4H13 D;  2E76 B;  2FYN C;  3AE2 C;  2LK4 A;  4PV1 B;  1DD4 A;  4Y28 J;  4XFJ A;  5KKZ C;  4XEF A;  2OQQ A;  3AE5 C;  3AEC C;  1AJY A;  3AE7 C;  3C8V A;  3O6Q A;  4H0L C;  2G8Y A;  2BEQ D;  3B71 A;  3C8G B;  1NYH A;  3H25 A;  3U3F A;  3AE4 C;  3Q5P A;  2E74 C;  2YWA A;  4R4M A;  3AE3 C;  3D6Z A;  1NGM B;  1RQV A;  1UIX A;  2E74 B;  1IK7 A;  1S5L X;  2MKV A;  3AEB C;  1ZME C;  2QJP C;  1RQU A;  1ZP0 C;  1EXJ A;  3AEF C;  1K05 A;  4H44 B;  2J5U A;  3S9O A;  3ABV C;  3D6Y A;  2WSC J;  2WSE J;  3GM3 A;  1KNY A;  1FDI A;  3GF3 A;  4YTP C;  3D71 A;  1KIL E;  3AE8 C;  3IAO A;  3RL0 g;  2Q00 A;  3MFN A;  2D2C C;  4H13 C;  4TT3 H;  3Q3D A;  1GMJ A;  1ZRT E;  1VF5 D;  2BEZ F;  2D2C B;  2E75 D;  2NZ2 A;  4H13 B;  3D70 A;  3C8G A;  3SFE C;  1U57 A;  2E76 D;  2ZT9 C;  1UFB A;  3JZ0 A;  4XEV A;  4NQF A;  2QJK C;  3AE9 C;  2QIW A;  3AED C;  2JP3 A;  2ZT9 B;  3GLM A;  2H88 C;  4OGQ C;  3IN6 A;  4GDO A;  4H44 C;  4RKU J;  3AJM A;  3RQG A;  1KOR A;  3Q1M A;  3C8G D;  3EWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...