1PV3A

Nmr solution structure of the avian fat-domain of focal adhesion kinase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
146
structure length
146
Chain Sequence
GSPGISGGGGGIRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Focal adhesion kinase 1
publication title The Focal Adhesion Targeting Domain of Focal Adhesion Kinase Contains a Hinge Region that Modulates Tyrosine 926 Phosphorylation.
pubmed doi rcsb
source organism Gallus gallus
total genus 52
structure length 146
sequence length 146
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1pv3A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1pv3A02
2KK1A 4XEFA 3SFDC 1WOLA 3BRJA 3AE6C 3AE8C 4NQFA 1UFBA 4XEVA 2WQYC 1YQ4C 2G3AA 1KNYA 1K05A 1WWPA 2JX0A 3U0CA 3MFNA 1K04A 3C8GA 2H88C 2PBEA 2L6GA 3AEAC 3B71A 3O10A 3AECC 3AEFC 4XEKA 1QVXA 3TULA 4R32A 3K7DA 2H89C 3RQFA 4EBJA 1OW6A 1V4AA 3AE1C 3ABVC 3AE3C 1JOGA 3JZ0A 1ZOYC 1OW8A 3AEBC 3L8IA 3GM3A 3AEGC 1KTMA 1YQ3C 3JYYA 2JPUA 3C8GD 3AE5C 3RQGA 3U3FA 2Q00A 1PV3A 1OW7A 1K40A 1WTYA 3C8GB 1O3UA 3GM1A 2L6FA 3L8JA 3AEDC 2L6HA 1ZZPA 3RQEA 3AE9C 3AEEC 3AJMA 3AE2C 4YTPC 1ZP0C 2HSBA 3AE4C 3S9OA 4EBKA 3GM2A 2YWAA 4YXDC 3AE7C 3SFEC 3C18A 2LK4A 5F28E 2FBWC
chains in the Genus database with same CATH superfamily
4BG0A 3RK2B 1L0NK 2I8DA 4DOJA 3Q2YA 4K3AA 4J7TA 1V74B 3CQZA 2D2CC 2OTJP 2SPZA 5DLJA 2BCCD 1CGME 2XKMA 2KB7P 3HE4A 1YQ4C 3QZCA 3OEOA 1SZIA 3ATPA 2EPLX 1NZEA 1U89A 2ETSA 3MYFA 2ZD9A 3MFNA 2O3JA 2G3KA 1YA7O 1BR1A 2QTVA 1DH3A 3I55P 4LLEA 2R9RB 1LNQA 1JRAA 2K1AA 4CIPA 1RMVA 4LACB 3HNJA 1SFCC 3JSEO 3LJBA 1JY2P 5CCHA 2PAJA 5KKZB 2WPRA 3A7OA 3BCCJ 3LIDA 5KYUA 1SQXJ 4YJWA 5L0FA 3L75G 2FFDA 3MHVA 1QLEC 3CXHE 1RKCA 1QVFO 5L0GA 1IFMA 2J9BA 1KQGB 2G8YA 2HFED 1LTJA 2E75D 3LS0A 2A06E 2E74C 3MP7B 2WL8A 1LIHA 4WABA 1T6IA 3C9IA 2YL0A 1FTSA 3DJUB 3AEBC 1ZXGA 2JD3A 3GEIA 1FOSF 2YQYA 5JRAA 1ZU5A 3CCSP 4C46A 1PGQA 1IZNB 3FXEA 3AG3C 3T6BA 4BJ5A 2UUHA 3V4QA 4DCKA 1AFOA 4EUKB 4UDVA 2XDJA 1VQ8P 5DQTA 3G9RA 1SFCD 3LS1A 2I1KA 5CBNA 1SYQA 2WVRA 3L34A 4PJLA 1NTKK 2A0BA 2Y0CA 4GIFA 2R7WA 2P61A 1NTZD 1ZP0C 4Z9JA 5M1BA 1N2DC 1QLED 1GTWA 2FYZA 5BU8B 1VYKA 2VCBA 5KYNA 3UGPA 1KQFB 5BVZA 2FY8A 4DVZA 2LSEA 3SWYA 2C0WA 1L4AB 3GODA 2OQMA 3K6BA 1OZHA 1IK7A 1L0LK 1LTBC 4NY3A 3CCMP 2LCHA 1N73B 4NTBA 3R2PA 2HMQA 1R5ID 1LE4A 3ZVRA 2WQYC 2DI3A 4HE8D 4GKGA 1KORA 4CSAC 1FNTc 2NRGA 1BR2A 1N7SC 2XS1A 1NU1D 1BSNA 2WT7A 2X51A 1A7VA 3O39A 4KHXA 4BJ6A 1N86A 1D0XA 4JVSA 1N1CA 1L0NE 3IHUA 1PGJA 1HTLC 3MBGA 2ZJSE 1ZYRF 2Y9YA 4N78D 1NTZJ 4I1LA 2DB4A 4IOIH 1OKKA 3O10A 2YXQB 1EXIA 3HUSA 1U7JA 2NSFA 2R02A 3A3YB 1NG1A 2KXPB 2E5YA 5BU5A 4IL6X 1ZHZA 4CS7A 4W8KA 2H43A 1JTHB 1RH5B 1VF5C 2VB6A 3M1CB 1SMYF 4DBQA 1SQVE 3K5BA 3L74E 4L73A 3EPVA 1EDLA 1XZQA 2W83C 2EPOA 2IXMA 2D4UA 4OGQD 2IXOA 2WSEJ 4U5EE 3C8GD 4E0HA 3GHGB 1NU1J 1EZVD 1MMDA 2HR3A 4I1MA 3G50A 2K9JB 1DEBA 2KUBA 5AVQB 4PD4H 1RJ9B 1S9KD 1S05A 3L35A 1PL5A 3JSZA 1ZU4A 3AE9C 1QZXA 3AJMA 3M4BA 5L3VA 4CS8C 2I8BA 4CJGA 3JRTA 3M0DC 1VF5D 1VMAA 2NUPA 3EGDB 3IR9A 3B5NB 3EQ2A 1HGVA 2RN0A 1G4US 3W4YA 4YK5A 1MFTA 2Q4FA 1T8ZA 5KJ7C 2IOQA 1Q81Q 3BCCG 3GANA 5A6JA 2A45G 4EOTA 1R8EA 4CS9C 2ZAEB 3V7OA 1X9VA 3TK1A 1CW5A 1GS9A 1EI7A 3MD0A 1PP9D 1NTKE 3GMAA 1URQD 1DIPA 4J32B 3S0XA 3IN6A 2R5DA 1IW7F 2E87A 1VB5A 3T97A 1OVRA 2JWAA 4JKVA 2BCCG 2V4HA 4BXLA 2WITA 3ZDLA 3FHDA 3U0CA 2R05A 4ZLCA 1YYJA 2BC5A 2KLVA 3AQCA 2DGJA 2MYSA 1RF1C 1L0LE 2KW3C 2V7QJ 1GU4A 2YEVA 1Q0DA 1YARO 2LP4A 4IFDK 3ZC4A 3VMAA 4MQ9F 4JYBA 1WGWA 2B88A 4ER9A 1JMBA 4CJOA 1T2KC 5AVYB 3W8HA 3H1JE 4Z9HA 1QKRA 3JRMO 4CSAA 4LERA 4XLNF 4KC9A 3I56P 2WZLA 2WSFJ 1TWAA 3U5SA 2ZT9C 4N3YB 3ZQVA 4BEJA 1XZPA 2NPUA 3ZQYA 2QM7A 3KPEA 4E17A 1G2CB 5DS5A 5AVSB 3K1HA 4GOEA 2Q1KA 1PP9J 2OKUA 1NKZB 3MUDA 2IZ0A 3RFYA 5AW3B 2E75B 5KLVK 4I1OB 1T6AA 3U59A 3LW5H 1Z23A 3TOMA 1LJ2A 3NG1A 1YI2P 4IRUA 1EDKA 1NAFA 1ZHTA 1GGQA 2YXRB 1VQ6P 2YL1A 4CX9A 3RK3D 3GM1A 2OEVA 3C1LA 2XRHA 1EDIA 3NRHA 1OXZA 1YLMA 1EKYA 1SFCB 3VTPC 2E43A 4YT5A 4EIJA 4CDVA 1Y4CA 3AE4C 4JJFA 3ASNC 2VCAA 2W45A 3HD7C 5AW8B 1S5LH 1YZAA 3PH0A 2ZT9D 2EPNA 2IBFA 3EGXB 1NTZG 3WU2H 3GM2A 3CL3D 3H1LD 4QMAA 2KZIA 2Q9CA 2C0XA 5APWA 1Y8AA 3L71D 2XLOA 2XLHA 3FVYA 4PFOA 2M64A 3K1IC 1LTAC 2P0NA 4H13D 1GM5A 1OXKA 1IFDA 3TGUD 2R25A 3AE6C 1HVVA 3VN0A 1VQKP 2JO1A 3I5PA 5E3CA 4FAPB 1Z6AA 3SEOA 2OTLP 2CW0F 3FAJA 4CS8A 4O6MA 3L4FA 1UG7A 1P84I 2HPCB 4WGYA 2OYIA 2X0CA 2RSEB 4DRJB 4I44A 1S5LE 2QJPC 2CCYA 2Q9IA 2W6BA 4N06A 1D1AA 1NU1G 2J5UA 4TLFA 2Q9AA 3HD7D 1A7EA 4DRIB 1CSBA 1GD2E 5FCLA 4CS9A 1RF0C 1HE1A 4G7ZF 4P6IC 1AVOA 3TF5A 5COGA 4EIYA 1NTMK 5KAIE 1VQMP 3B71A 3VP9A 3P8MC 1LWUA 2L81A 2R7UA 5EHHA 1NLXA 4NPEA 4XEKA 2KGOA 5CCGD 4XPYA 3L71J 4I2LC 4G7HF 3ZTZA 3O8ZA 4O6YA 3FGAD 5AGFA 3TGUJ 4LC1A 1TR2A 4KNVA 3JCUQ 2QUPA 3JTLO 4MVZA 4PV1C 2Q7CA 1ZV8A 1RF1A 3M9QA 1D0ZA 2AEJA 3DJNB 3OAKA 2GUSA 1JOGA 3WMM0 1ZOYC 3GM3A 4A7PA 4GDOA 3Q3DA 1VPCA 3L75D 3AE5C 1MQVA 2Q00A 3CCLP 3GWNA 4JBZA 3MGNA 2KZJA 3NXSA 2PX3A 2LIGA 4OGQB 2W90A 3C8GB 1P84H 256BA 1EZVG 2XL6A 2CGEA 1FZCB 2R7QA 2YKZA 2NG1A 4NPDA 2J9VA 3JCUH 3AE2C 1JPNA 2M3EA 5APTA 3Q5SA 1DD4A 3KDPB 1ORJA 1JUNA 1H0TA 2PRRA 5KLVE 1NH4A 3WG7C 2QSIA 2QRXA 3CWBD 2HKVA 1VF5B 4PV1D 3L1MA 2NUTB 5F28E 4AQRD 3V5XA 2JDIH 1BE3E 5APQA 1KU2A 2DYSC 3PHLA 3A9CA 1ZRTE 1Q0FA 4C3BA 3H1HE 4AE4A 1Z5ZA 4C7NA 2P1AA 4DBRA 1P84E 1H88A 1UFBA 3OWTA 5B3SC 4YT2A 2B89A 1D0YA 5B1AC 1SQPK 3JCUE 5KAFH 1KB9H 1PP9G 4WY4A 1S3JA 1K05A 1URQB 3SP1A 1U6HA 3BRTB 1NFOA 1USEA 1NBBA 1M56C 2PP4A 2UWJE 3I5CA 3M9BA 3K1IA 2A0UA 5COMA 1JCDA 1MNEA 1H7IA 2KK7A 4KJMA 2YL3A 3V2PA 3IPMO 1CGNA 2H7HA 5CCHC 3RL0C 3C8VA 1KV4A 2AU5A 4KT0J 2QG4A 2PFXA 1Q90D 3AECC 2C9LY 3FDQA 3AEFC 3RGUA 2R7XA 3KYIA 1S2EA 2FFDC 1L2PA 3T4RA 1BCCE 3EHMA 5KAFE 1BDJB 3MZWB 1C03A 3UMIA 2VC9A 3RBZA 1KILE 1LTJC 3HTKB 3S27A 2FGYA 3AG2C 4D6TE 2YRFA 1YYCA 1V54C 2EIKC 3B0PA 3X2QC 5CJ4A 3E7KA 3H1KE 2O1KA 1NTME 3F5HA 3DM5A 1JY3O 3M4CA 3MYIA 1RKEB 3KKBA 2IBZD 5KLIB 4BJ5C 4DZOA 1SR2A 1SQVD 3RL0g 2XLEA 1OW7A 4BRYB 2BASA 2YO3A 1FZGA 2KNCB 4HYTB 5L0IA 5CCHD 3HE5B 3AQBA 3RL0D 2HV7A 1VDFA 4IAOA 1LP1B 1ZHWA 3IF4A 3RK3B 2KP8A 3HLZA 1OR2A 2ZXRA 3LNRA 2XLDA 1ORSC 4JCHA 1YIJP 5E33A 1L0NJ 4U5DE 5CJ0A 3B9QA 1SF8A 3KL4A 2ZT9B 3F46A 2Q3EA 1JB0J 3A11A 4XWJA 5BQGA 3SYNA 2RMZA 3S90A 1SLQA 3O6QA 5IY5C 2K9YA 1CI6B 2IZ1A 3L71G 1EA8A 1MZ9A 3U8PA 4LDQA 3KMIA 4H13B 3TGUG 3TOLA 3I4UA 1M1JB 1SQVJ 3L74J 5H2FH 3LLKA 5CI9A 5GTHE 1HH0A 2LKMA 5T1DB 3BCCD 2VH3A 3ZWIA 2Q5UA 1SQXD 3GEHA 5AW5B 4BJ6C 2KLUA 4PD4D 3IQ6A 2KS1B 3WODF 2Y3HA 1AA0A 4U5CE 3M79A 4O79A 1FR0A 2AVKA 3VMXA 1Q0KA 4PJNA 3DE9A 1N73A 3H2VA 3DD7A 3GF7A 3HD7B 2ITAA 1G1JA 1YA9A 5TISH 1LTIC 3B8EB 2LXBA 1LS4A 3HUSC 1VQOP 5B66E 3CXHH 1IJDB 1QVXA 1SQPE 1EQ1A 1Z63A 2O9XA 1SQBE 5H2FE 2YLIA 3L72E 2YMKA 2R3SA 5DJUB 4NCQA 4XQ1A 3H1JD 4NC3A 1FE6A 3NMIA 1OW8A 2ZVOB 3SXZA 1FAVA 4OVNF 2ZVNB 4WBAA 1GL2D 3MX3A 1YJNP 2NZ2A 1GMJA 3RVYA 1HJBA 2I15A 3SXYA 2Q6QA 1JO5A 3CMAP 4I7ZC 3AGUA 1S4XA 5AW1B 5TISE 5APVA 3G6EP 4JZAA 1NTKJ 1HE9A 3J06A 2D2CD 3V2QA 1FZFA 2A06G 3AG4C 1RXQA 3T6JA 3AEDC 3ABMC 1YDIA 3E70C 1NVOA 3AEEC 4GOFA 4YT4A 2QA4P 4N6CA 3LIEA 3W67A 2XXAB 3B0VC 1L3PA 4XTKA 1L0LJ 2O01H 2XV5A 3GHGA 4TT3H 3S1KA 1V55C 1JOCA 3TD7A 2LK4A 4WWIA 4JIOA 2IPPA 1A02J 3CWBG 4PJJA 2PGDA 1CZQA 1U7MA 3H1JJ 4PV1B 3ZSUA 4L74A 1VOMA 3NMDA 3CCEP 5APSA 4QDLA 4L76A 3SSUA 4OIRF 1WMKA 4U3FE 3EWKA 1YJ9P 3KH2A 4IFMA 3EGDA 2ZXPA 3B5NA 1K8AQ 2QNLA 2IDBA 2IXNA 3O55A 2CYDA 2E74D 5BQHA 2KIKA 2FYNC 1E85A 5JS5A 4YWQA 3FOPA 2E42A 1T01A 2YIUC 1J8MF 2HMZA 4NPFX 3HJCA 1AQ5A 2J8WA 2OG2A 2QM8A 3QW1A 2K3RA 3RW0A 4ZLDA 1ZN5A 3TNUB 3BRVB 3U9MA 3ITFA 4DOZA 3JC22 3CCQP 3M15A 4YL3A 2R7TA 2M5AB 2Z15A 2YKPA 2M8RA 4IAQA 1FJKA 3P8CE 4KNWA 2RD9A 1L0NG 3RQFA 3VMYA 3DZAA 2LQGA 1HGZA 2NPSC 1RQUA 1XTGB 3EHNA 3UMHA 3NYMA 4JEAA 1K73Q 1KFMA 3MUDC 5HSWA 3LW5J 1X8YA 2A45I 3HE4B 4LDRA 1PPJE 2Q3IA 4PJ0E 1G4WR 1HW2A 1E83A 3JYYA 1SP4A 1WN0A 2KSJA 3VM6A 2Z5HA 3VF0A 1A0BA 4FX5A 1ZW3A 2IBZG 3NKEA 1SQVG 2C03A 1J1DC 3L74G 1FFHA 3V2NA 5FZTA 1OR3A 1QQ3A 2OYHB 1ZR4A 2HJ3A 3L8JA 4K35A 3PRJA 2Y9ZA 3EZIA 3DXJF 4RJTA 1N7SD 3RL0B 3H1IE 5L8RJ 2W27A 3ABLC 5AC4A 3QWOC 4EBKA 4K7BA 3VYIA 3W68A 2IXPA 3CMEP 3A0HE 3TYYA 1LTJB 2HZ8A 4MVMA 2MWQA 1NOHA 3F89A 3HNKA 3M9HA 1DD3A 1QL1A 1KQSO 2YVKA 4XLPF 2OYOA 3EZHA 3Q7LA 1I5NA 2HLOA 3H65A 4E0IA 1IO4A 1NTZK 2OYIC 1O87A 4OIQF 2OJED 4L75A 4ASVA 1TQGA 4NTAA 1E5WA 1EDJA 3ZG1A 1NJIQ 4J30B 1VTMP 1P84D 5AW6B 2R03A 1L7CA 1OVVA 1KILC 1LM3B 2ZXEB 1R4TA 1SQXG 4H0LC 2EILC 3L70D 2EIMC 1LWUC 2L9JA 1J1EC 3O6XA 3FXDA 5K0IA 2HPCA 3UNGC 1AV1A 4ANJA 5CBOA 1Q7YQ 4MW3A 4EKWA 2MKVA 3VRCA 2J0XA 4R4MA 4XPWA 1OW6A 3X1OA 2GAQA 4ASWA 1NU1K 1L0LG 2YMYA 2OOCA 5KLVJ 2OQQA 2R7RA 4JURI 2J7PD 2WSSH 1FFTC 1FZEA 5GTIH 1BCCD 3H1JG 1KN7A 1BE3J 3L8IA 1KB9D 1H8AA 5KJ7D 3H1HJ 4QI2A 3Q5PA 3RBXA 1SQQK 2BCCE 2HODB 5BUOA 1GL2B 1BGYE 1JMWA 2N9YB 5DVWA 2AXTE 5AVRB 1S72P 4GODA 4BJ1A 3ZDMA 2QJKC 2L6FA 2XU6A 3KQGA 1VLTA 2NPSA 3L70J 3R7CA 2D2CB 3RQEA 3LLIA 3L73E 3GEEA 2RH0A 1JCCA 4U5GA 3DAFA 5T3WA 1GDTA 1OCCC 4RD9A 4OH8B 2WZGA 5TJHA 4QI0A 2EPMX 2W4BA 3NKDA 1EXJA 4U5FE 5GTIE 2E76C 3KPHA 1R5LA 4YXDC 3V4WA 1LT9C 2FYUD 1TFKB 2FBWC 4D4XA 2UUIA 1EC5A 4W7YA 2KSFA 2FKWB 1SVFA 1FZCA 1T2KD 2YNYA 4BEMJ 1FAPB 3LAYA 1BCCJ 2P10A 4O9BA 2KSEA 2IYOA 4WY4C 1JNMA 2L91A 3PJSK 4IGGA 3L36A 4D6TJ 5AW4B 3E1RA 3OA7A 2BE5F 3NFQA 2WZFA 2N1TA 3CLQA 3EFOB 3H1KJ 4UB6E 1YTZT 2NUTA 3CC4P 1NTMJ 1K04A 3RK2C 3DMDA 2H8PD 4JC7A 1TU3F 5KAIH 2E74B 2CNWA 1GU5A 5DJTB 3S4RA 2YL7A 4HFFB 4MW8A 1OMIA 1EZVI 2O01N 2NUPB 3RIPA 3PHF2 2KYHA 3NTNA 2ZXXA 4OD5A 2FYUJ 3C62A 4PR9A 4YL0A 2AP3A 2I1JA 3E1IA 3VMZA 2OEXA 2PF4E 3K7DA 4HFKB 2H89C 4XFJA 5EFWB 3DWWA 5JT4A 3JSVC 1KILA 4ZMDA 1E2XA 3GLMA 4X0RA 2WVQA 4EDFA 1G1IA 1SQBD 3RK2D 5KKZC 4AL1A 5JLIA 2B9BA 4AL0A 3SXKA 5APUA 2IFNA 3V5ZA 5DS4A 2P7JA 1KYOI 2J59M 1K40A 2FAPB 1WTYA 3H32A 3JT1A 5L0CA 1H9TA 1VQNP 4ULVA 1NU1E 1BDDA 3Q1MA 1NAYA 2GWWA 4JEBA 4PJMA 1YAUO 4CBEA 3PMRA 2WSCH 1PGOA 1YZCA 1U0BB 3S9OA 4C7OA 3CXHD 4N78E 2EINC 1RKEA 1N7SB 2A06D 1SQQE 3FXHA 4BRYA 1FOSE 1NGMB 2OJQA 1PD0A 3NYLA 2KNCA 3FAPB 1SQPJ 4C7RA 3V5BA 1LP1A 3D6ZA 2HS5A 1LKXA 1WT6A 1HMOA 4E7ZA 2FXOA 1SQBJ 2KNHA 1BBHA 3L72J 5E2QA 3UGOA 1TFOB 1VQ4P 1HF9A 1QGKB 2JX0A 1IC2A 3EG9A 1LT9A 1LGHB 3H1HG 1G5ZA 3C8ZA 2L5GB 1EZVE 4U3FD 3WAQA 4H44C 3T6GB 1CI6A 3PDMP 1N73C 1KYOH 1OX3A 3D70A 3V5YA 3D6YA 4JPZB 1S9KE 3L70G 3LUTB 1M8OB 5KYWA 2IYLD 1NKNA 3IFMA 2B87A 2DW3A 3EH1A 5HV9A 1FDOA 1GK6A 1NYHA 1OIPA 4XA4A 3TJ5A 2KS1A 3ABVC 4K1OA 3AE3C 4BWNA 1ZW0A 3JYHA 1OFCX 2AWYA 3QVZA 4HB1A 2OYIB 3AEGC 3GG2A 4Y28J 1KTMA 1KYOE 1WATA 1MV8A 1OWAA 3RQGA 1BCCG 5C39A 1PP9E 4H44D 1L0ND 2QE7H 3TQOA 5L0HA 1Q0MA 2B0JA 1YTZI 5AVWB 2JWDA 1O3UA 5APXA 4U3FJ 3LEVA 5AW9B 4D6TG 4FESA 2WWWA 2XLMA 1VQPP 5AVXB 1AVOB 3SWFA 1IFIA 1NTMG 4IARA 1FMWA 5A69A 2VASA 4EBBA 2O01J 2YKOA 4MVRA 1M56D 2CPBA 3GHGC 3G71P 2E5TA 2YWAA 1BDCA 3L74D 3TK0A 5B5EH 3I5QA 1A02F 1M2VB 2F22A 3V2RA 1WOLA 3BRJA 2FYUG 2ZYGA 1VQ9P 3H1ID 3A5TA 1RF1B 3IQCA 4RDAA 5A6BA 2R32A 4HEAJ 4NQFA 4JW1A 5GTHH 4YXWH 3K66A 2XXAA 3RH3A 1KQLA 1RCPA 2G3AA 4IL6E 3B5NC 2AXCA 1Q0GA 1GQAA 5JVEA 1OQCA 1FU1A 2VCCA 5KTBA 4HKZH 3AG1C 3D71A 4LLCA 4WB4A 5B5EE 2CDQA 1YYXA 2PBEA 3RF3A 3M91A 3RK3E 1DX7A 4MTGA 1NO4A 5B66H 3WUTA 5JSLA 3CX5I 3A2AA 1MKMA 3ECSA 1YBKA 4JQ0D 1QL2A 1T9KA 2XL4A 1UIIA 1JY2O 2GA0A 4M3LA 2GM4A 1S5LX 1L4AA 5EGYA 4G7OF 3H1IJ 4WVZA 2XM0A 3H1LE 1NTKD 4AX2A 3CPWO 4C7NB 2M4EA 3U1AA 3L71E 4O7GA 4HH2A 2QLAA 3BASA 2Y0EA 1UIXA 3HRNA 4J7YA 2JP3A 1AEPA 3W8IA 2Y0DA 1H6GA 2P67A 1MMGA 2J9WA 3N2ZB 4U9DA 1Q2NA 2JPUA 4Q4ZF 1JM0A 2RKLA 1DOWA 1APCA 1SQBG 4C3EA 1L0LD 2M5AA 4JTAB 3L72G 2PX0A 4MTFA 2A68F 4AUWA 3BEHA 2OARA 5E79E 3U2MA 3EFFK 2TMVP 3US6A 1BR4A 1J8YF 2V3CC 2B0HA 3Q6NA 3RKOF 1R5SA 2E75C 1BGYD 3OW2O 4JCZA 2ZFCA 1RE3A 4KI2A 2KOGA 4IFFA 4LGDE 1YJGA 2WVNA 1ZHYA 2QJPB 1LTGC 3BATA 1CPQA 1VLSA 4MVOA 2ZYAA 4OWFA 1SQVK 1IK9A 3CX5H 3UMKA 4DJ9A 4M63A 2P2UA 1JTHA 3L73D 4MNDA 3DE8A 3GW6A 3TSIA 1E86A 1OKKD 4FWVA 2YLDA 1LT1A 3OA1A 2OYHA 1AUEA 1I4ZA 3HNLA 3PLNA 1WRGA 4DJGA 3S28A 4G0HA 1M90Q 3DAGA 3SNHA 1VYIA 3IQ5A 4EWCA 1D1CA 4IB4A 2VRSA 5CHXA 2EPKX 1JEKA 4U9EA 1XTCC 3L75E 5KYYB 1AJYA 2ZYDA 1ZLLA 2K9JA 1B68A 4ZKPA 2GUVA 4E18A 2R7OA 2J58A 1N7LA 1SS1A 3CX5E 2IBZI 1RJ9A 2BCCJ 2J46A 3SWKA 1BGYJ 4AYCA 4U3FG 1PCXA 3HKKA 4JTDB 3OJAB 1NHLA 1S1CX 4HJGH 4OD4A 2ZPAA 1GZLA 2XZRA 2O1JA 4ONSA 2R7SA 1MNDA 3II6A 3KYQA 4B86A 3L73J 3N7NA 1G8XA 3O6QB 2LD6A 1YJWP 4EBJA 2D5RB 2XLWA 3UR3C 4CPGA 3CWBE 1SQXK 2ZXWC 4MN4C 1LI7A 4MS2A 4PJ0H 5KYXB 1VK5A 2EIJC 1E79H 1YQ3C 3KXDA 3U8VA 4C3DA 3U3FA 3MTUE 3VYWA 3P32A 2WB7A 1HWTC 1HJ0A 3CAXA 1QX8A 1T6UA 3T9OA 4D4NA 1NFNA 4H44B 2R3CA 1FZAA 1KD1Q 4YPCA 2JR8A 2L6HA 3P7KA 3C7JA 1PPJG 1T5OA 1Y47A 1I4YA 5EK0A 4PD4I 4H4KC 2HFIA 2XNXA 1O5HA 4KBLA 1LVKA 1M7LA 2CPSA 3A0HH 4H54A 2P58A 3Q5RA 2M3BA 2W9YA 4W8PA 5AVVB 2HODA 4XE5B 4A4AA 1GL2A 2ICWG 4OGQC 2Y39A 1H89A 2FFHA 3EH2A 3H25A 4XEFA 3EQLF 2QJYC 2P1JA 3SZRA 4ZKUA 1FZCC 3QW0A 2J0WA 3F47A 1G2CA 3WUVA 1OXBA 1OCRC 4LLHA 2JKVA 3AE8C 3H1IG 1LTSC 2A69F 1BSHA 1SQQD 3V6IA 2DYRC 2Z4EA 4Y99C 4Q7CA 1Y9BA 5KYUB 3IAOA 1PD1A 2H7OA 2NPSD 2IYPA 2FFDB 3S84A 2N1TC 2OTKE 4E7SA 2KC3A 4P9TA 1TWGA 2IBZE 3WHNA 3POVA 1PIXA 1C02A 4O6NA 3U2LA 4DRHB 4W80A 1BZ4A 3B29A 1T3JA 1MMNA 4BPMA 1Q86Q 3KZIH 5E3AA 5KLVD 2L6GA 5AW2B 2H7BA 3Q7GA 5F5HA 3AEAC 4JF7A 4PFPA 2IFMA 2Q7RA 2KJGA 1SFCA 1FDIA 3ITKA 2ZXOA 3FX0A 2AEMA 1Y6DA 1LPEA 1BE3D 1A41A 2FXPA 5D92A 3ZIBA 1ZRTD 3EGXA 2KI7B 2H7VC 1URQC 5K5GB 3H1HD 3N4XA 2J45A 1ZR2A 1PGPA 2A45H 3EFOA 3QMKA 1CPRA 4IJJA 5AC5A 4Q5SF 1PFIA 4MVUA 5DS6A 3LEOA 2OGUA 3NYJA 5B1BC 3DKAA 1KZUB 1NTKG 1SQQJ 1W2BO 2QE9A 1N8RQ 2A1DD 2N1TD 1M6TA 3KZIE 2Q9BA 4PACA 4JTCB 3GF3A 3U1CA 1FBMA 1M2OA 2KQ9A 2AXTH 1PZQA 2CNWD 4EHPA 2HUJA 4MTOA 4JE9A 3HNIA 3PTZA 3HTKC 1JR8A 5L0JA 4OINF 1KYOD 2W6JH 3BCCE 2WSCJ 3G4ZA 1SQXE 2PP6A 1J2JB 2HG5D 4PD4E 5TJ5E 4CDYA 3M0AA 3AGTA 3H2UA 3U9JA 2AWCA 3GWLA 2YZSA 5KLIC 3IEEA 2JJLA 4DVYP 1BGYG 1KILD 1DEEG 2WT7B 2ASRA 1KC8Q 3DM9B 4D6TD 4H0LD 2J9UA 2WTYA 5BQIA 1OCOC 4B6IA 3LESA 3SFDC 3H1KD 1NTMD 1VQLP 3L73G 2MJZA 1YITP 2NSGA 3RK3C 4WJ0A 2PFDA 2R7VA 1H9GA 3HUSB 3K33A 3W2WA 1LI5A 1CGOA 2YHSA 4UB6H 4JRZA 2Y3GA 1KNYA 1ZMEC 1N7SA 1DOVA 3CC2P 3C8GA 3QVYA 4EYYQ 3RVZA 2QVAA 1OCZC 2IX7C 2KYVA 4H13C 4MVSA 4UB8H 4MVQA 4EI2A 2XLVA 2OCCC 4BJTA 1M1JC 3G3ZA 3CI9A 4ULWA 4I7ZB 1KFNA 3MLGA 3CCJP 3TULA 3VOPA 3ZTMA 3NDBB 2H8AA 2QEXP 1FS0E 3TDKA 1U57A 3NMKA 4GT1A 1ZHXA 4A2NB 1X22A 2E76D 3FOOA 5L0DA 4U7JA 1GW3A 5L3QA 5F5FA 2LFFA 3GORA 4RBNA 1F1MA 2HSQA 1D1BA 4ZNCA 2W6AA 3B4SA 1NU7D 1IZMA 4DT0A 1Z56A 2C9NY 4UB8E 5AVUB 1NTZE 2WSEH 2BEQD 1URQA 3WUUA 4Z1MH 4W7ZA 3SXMA 1FMVA 1YHQP 1C17M 5CMZA 5CCGC 1HMDA 4U5BE 2AEFA 3TJ6A 4WY4D 3FWNA 1SQPD 3CEXA 3M0DA 3B0UX 3T97B 5AVZB 2CK3H 1MMAA 2J7PA 2LFDA 4U5HA 3L72D 3FMSA 1W5CE 1A7DA 3CCUP 1QEXA 3AE7C 1RHZB 1JY3N 3WU2E 1VQ7P 4G78A 1MUUA 1HBWA 2FYNB 1LE2A 5KJ7A 1S7ZA 4WGZA 4JJGA 2GDCA 2YIUB 1T6QA 4OIOF 1USDA 3HTKA 1LTTC 2XM4A 2QIWA 3ASOC 4CDAA 1FJPA 1XWJA 4RKUJ 3PP5A 4GEHA 2C04A 4XPXA 3H1LJ 4YT8A 5GPGB 3QH9A 1SQQG 1WWPA 5JUAA 4IWBA 2WMMA 5AW7B 2XS8A 3U3BA 2FYUK 1M2VA 1EQ7A 2NPSB 1TWCA 1FZBA 5A6KA 1QVGO 1KB9I 4RO0A 5AW0B 2H88C 1FDMA 3HE5A 4L6RA 2V7QH 5T3TA 2JEEA 1GW4A 4YN0B 4OIPF 5KLVG 3IQTA 3CCVP 3A0BH 4DXWA 1RE4C 5A6BD 4I3MA 2GA1A 3CX5D 4R32A 1RY3A 1BE3G 1L4AC 3M06A 3CD6P 1J1DB 2QJYB 4F4BA 1V4AA 2WPQA 1JY2N 2WSFH 4CIHA 3ABKC 3N24A 1GK4A 1IFJA 3JZ0A 3C63A 4LDKA 1WASA 4Y99B 2LXCB 5AVTB 1E84A 2BL2A 4PK4A 1M1JA 1X79B 1PV3A 1IFPA 2N1TB 1LS1A 2GFHA 2Q3TA 1AQTA 2WPSA 1ORYA 3L0IA 3A0BE 1Z3IX 2Y3DA 5APYA 1JMMA 2W4MA 2N9BA 3R4YA 4P9FA 1HW1A 1ST6A 1FC2C 3NMJA 1ZZPA 3AOUA 4YTPC 3L75J 1YVIA 1L4AD 1RE3C 3HD7A 3P8CD 2K88A 3L70E 2WVOA 1QPUA 1SQBK 1HUCA 1W2EA 3SFEC 3C18A 4YL1A 5JP7A 2M0BA 2KK1A 3BVHA 1RQVA 1KILB 1KMIZ 2FXMA 3LNMB 3USSA 2OYHC 1PPJD 1M57C 5CCGA 4H0LB 1HY5A 2MHRA 3S29A 2V26A 1ZVZA 3E9VA 3H1KG 4IL6H 4XEVA 5DQZA 3FWLA 1LWUB 1J1EB 4I6MC 3CWBJ 2P6VA 1K9MQ 2K37A 2BEZF 3H32B 2XSEA 1KB9E 1AVYA 4NTFA 2YO2A 1TKNA 1NWQA 1JPJA 1D7MA 3L37A 2HYNA 1ZW2A 1Q82Q 3W2VA 5CIVA 3VP8A 2L7AA 5CI8A 5B3IA 1VL2A 1RF0A 4R4LA 4JYCA 2Y3BA 2A6EF 4C7OB 3CCRP 4Z9IA 3EJNA 4N6JA 1M1KQ 3KHUA 2A6HF 4GYTA 4N4WA 2WZ7A 1M57D 1TWHA 2P7VA 2XL8A 2G62A 3G4XA 2QJKB 5COFA 3VAYA 3RYLA 5KYYA 3AE1C 2POHA 3CXHI 3N0TA 2FYUE 1X0TA 4AK9A 2QY9A 2Y69C 1VQ5P 1MFZA 3QTHA 2WPVB 2Z5IA 2XNDH 1H0TB 1OVUA 3CZ6A 3MIWA 1NU9C 1W2WA 5A6AA 2YLGA 4RESB 3CC7P 2E76B 3CSKA 3EFGA 1RE4A 3EG9B 1LT9B 2HV6A 2HJMA 3Q6MA 5E79H 3H1LG 4N6HA 3KYJA 1T3UA 4AE4B 2G3VA 2YKQA 5D91A 1Z7Qc 4K0DA 1JY3P 3B5ND 3UIAA 3G4SP 1NSGB 2IM8A 5KYXA 2HSBA 1JAFA 2OU6A 2R44A 5KYWB 3TGUE 4WY4B 3PCVA 3H6PA 1SQPG 1QSPA 2W8ZA 2B87B 2PNOA 3TNUA 3DI5A 2LR2A 1IFNA 2R5BA 1GL2C 4GQHA
chains in the Genus database with same CATH topology
1JB0J 2KK1A 3H25A 1RQVA 4XEFA 1NGMB 1IK7A 1KMIZ 2QJYC 1ZRTE 3O6QA 3SFDC 3Q2YA 1R8EA 1WOLA 3BRJA 4H13D 2K9YA 4PV1B 4H0LB 3AE6C 2QIWA 1DD3A 5F28E 2JO1A 2D2CC 3AE8C 3D6ZA 4NQFA 4RKUJ 1UFBA 2P10A 3GMAA 4H13B 1DIPA 4XEVA 1WMKA 3IN6A 3EWKA 2WQYC 1KORA 1YQ4C 2G3AA 1Y9BA 2IDBA 1HF9A 3IAOA 1KNYA 1K05A 1WWPA 2BEZF 1ZMEC 2JX0A 2E74D 2QJPC 3U0CA 3MFNA 2FYNC 1K04A 1AJYA 1PIXA 1TU3F 3D71A 3C8GA 2J5UA 2E74B 2YIUC 4H44C 2H88C 1VL2A 2V7QJ 4H0LC 2PBEA 4R4LA 2L6GA 1OMIA 3RK3E 3D70A 3AEAC 3B71A 3GF7A 4H13C 1FDIA 3D6YA 1MKMA 1S1CX 3O10A 3C8VA 1EXIA 4KT0J 1Q90D 3AECC 2FXPA 4I7ZB 3AEFC 4XEKA 4IL6X 1QVXA 3TULA 4R32A 3K7DA 2MKVA 1FDOA 1VF5C 2WSFJ 1S5LX 2ZT9C 4R4MA 1NYHA 2H89C 4XFJA 1KQGB 1OW6A 3RQFA 2G8YA 3FGAD 4EBJA 1V4AA 1KILE 2YMKA 3AE1C 2E75D 1RQUA 2OQQA 2E74C 1U57A 3ABVC 3AE3C 4PV1C 3GLMA 1JOGA 3JZ0A 2WPVB 3LW5J 1ZOYC 1OW8A 2E75B 3AEBC 2E76D 4U7JA 1UIXA 3L8IA 3GM3A 4GDOA 2JP3A 3AEGC 2NZ2A 1GMJA 4OGQD 4Y28J 1YQ3C 2WSEJ 3GF3A 3Q3DA 1KTMA 5KKZC 3JYYA 2JPUA 3C8GD 3AE5C 3Q5PA 3RQGA 3U3FA 2Q00A 4I7ZC 3RL0g 2E76B 1PV3A 4H44D 1OW7A 2BEQD 1HJ0A 4OGQB 1K40A 4Z1MH 1WTYA 3C8GB 2D2CD 3G9RA 1O3UA 3GM1A 2QJKC 2L6FA 4H44B 3R4YA 3Q1MA 3L8JA 3AEDC 2WSCJ 2L6HA 1PL5A 1ZZPA 2D2CB 3RQEA 3AE9C 3AEEC 3AJMA 3AE2C 4YTPC 1ZP0C 3Q5SA 1DD4A 2E75C 3AE4C 2HSBA 5M1BA 2O01J 3C18A 3S9OA 1VF5D 5L8RJ 2ZT9D 3T97B 4EBKA 1KQFB 2QSIA 5KLIC 3GM2A 1EXJA 2E76C 4TT3H 3Q5RA 2YWAA 4YXDC 1VF5B 3AE7C 4PV1D 2ZT9B 3SFEC 2LK4A 4OGQC 4H0LD 2FBWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KK1 A;  4XEF A;  3SFD C;  1WOL A;  3BRJ A;  3AE6 C;  3AE8 C;  4NQF A;  1UFB A;  4XEV A;  2WQY C;  1YQ4 C;  2G3A A;  1KNY A;  1K05 A;  1WWP A;  2JX0 A;  3U0C A;  3MFN A;  1K04 A;  3C8G A;  2H88 C;  2PBE A;  2L6G A;  3AEA C;  3B71 A;  3O10 A;  3AEC C;  3AEF C;  4XEK A;  1QVX A;  3TUL A;  4R32 A;  3K7D A;  2H89 C;  3RQF A;  4EBJ A;  1OW6 A;  1V4A A;  3AE1 C;  3ABV C;  3AE3 C;  1JOG A;  3JZ0 A;  1ZOY C;  1OW8 A;  3AEB C;  3L8I A;  3GM3 A;  3AEG C;  1KTM A;  1YQ3 C;  3JYY A;  2JPU A;  3C8G D;  3AE5 C;  3RQG A;  3U3F A;  2Q00 A;  1PV3 A;  1OW7 A;  1K40 A;  1WTY A;  3C8G B;  1O3U A;  3GM1 A;  2L6F A;  3L8J A;  3AED C;  2L6H A;  1ZZP A;  3RQE A;  3AE9 C;  3AEE C;  3AJM A;  3AE2 C;  4YTP C;  1ZP0 C;  2HSB A;  3AE4 C;  3S9O A;  4EBK A;  3GM2 A;  2YWA A;  4YXD C;  3AE7 C;  3SFE C;  3C18 A;  2LK4 A;  5F28 E;  2FBW C; 
#chains in the Genus database with same CATH topology
 4BG0 A;  3RK2 B;  1L0N K;  2I8D A;  4DOJ A;  3Q2Y A;  4K3A A;  4J7T A;  1V74 B;  3CQZ A;  2D2C C;  2OTJ P;  2SPZ A;  5DLJ A;  2BCC D;  1CGM E;  2XKM A;  2KB7 P;  3HE4 A;  1YQ4 C;  3QZC A;  3OEO A;  1SZI A;  3ATP A;  2EPL X;  1NZE A;  1U89 A;  2ETS A;  3MYF A;  2ZD9 A;  3MFN A;  2O3J A;  2G3K A;  1YA7 O;  1BR1 A;  2QTV A;  1DH3 A;  3I55 P;  4LLE A;  2R9R B;  1LNQ A;  1JRA A;  2K1A A;  4CIP A;  1RMV A;  4LAC B;  3HNJ A;  1SFC C;  3JSE O;  3LJB A;  1JY2 P;  5CCH A;  2PAJ A;  5KKZ B;  2WPR A;  3A7O A;  3BCC J;  3LID A;  5KYU A;  1SQX J;  4YJW A;  5L0F A;  3L75 G;  2FFD A;  3MHV A;  1QLE C;  3CXH E;  1RKC A;  1QVF O;  5L0G A;  1IFM A;  2J9B A;  1KQG B;  2G8Y A;  2HFE D;  1LTJ A;  2E75 D;  3LS0 A;  2A06 E;  2E74 C;  3MP7 B;  2WL8 A;  1LIH A;  4WAB A;  1T6I A;  3C9I A;  2YL0 A;  1FTS A;  3DJU B;  3AEB C;  1ZXG A;  2JD3 A;  3GEI A;  1FOS F;  2YQY A;  5JRA A;  1ZU5 A;  3CCS P;  4C46 A;  1PGQ A;  1IZN B;  3FXE A;  3AG3 C;  3T6B A;  4BJ5 A;  2UUH A;  3V4Q A;  4DCK A;  1AFO A;  4EUK B;  4UDV A;  2XDJ A;  1VQ8 P;  5DQT A;  3G9R A;  1SFC D;  3LS1 A;  2I1K A;  5CBN A;  1SYQ A;  2WVR A;  3L34 A;  4PJL A;  1NTK K;  2A0B A;  2Y0C A;  4GIF A;  2R7W A;  2P61 A;  1NTZ D;  1ZP0 C;  4Z9J A;  5M1B A;  1N2D C;  1QLE D;  1GTW A;  2FYZ A;  5BU8 B;  1VYK A;  2VCB A;  5KYN A;  3UGP A;  1KQF B;  5BVZ A;  2FY8 A;  4DVZ A;  2LSE A;  3SWY A;  2C0W A;  1L4A B;  3GOD A;  2OQM A;  3K6B A;  1OZH A;  1IK7 A;  1L0L K;  1LTB C;  4NY3 A;  3CCM P;  2LCH A;  1N73 B;  4NTB A;  3R2P A;  2HMQ A;  1R5I D;  1LE4 A;  3ZVR A;  2WQY C;  2DI3 A;  4HE8 D;  4GKG A;  1KOR A;  4CSA C;  1FNT c;  2NRG A;  1BR2 A;  1N7S C;  2XS1 A;  1NU1 D;  1BSN A;  2WT7 A;  2X51 A;  1A7V A;  3O39 A;  4KHX A;  4BJ6 A;  1N86 A;  1D0X A;  4JVS A;  1N1C A;  1L0N E;  3IHU A;  1PGJ A;  1HTL C;  3MBG A;  2ZJS E;  1ZYR F;  2Y9Y A;  4N78 D;  1NTZ J;  4I1L A;  2DB4 A;  4IOI H;  1OKK A;  3O10 A;  2YXQ B;  1EXI A;  3HUS A;  1U7J A;  2NSF A;  2R02 A;  3A3Y B;  1NG1 A;  2KXP B;  2E5Y A;  5BU5 A;  4IL6 X;  1ZHZ A;  4CS7 A;  4W8K A;  2H43 A;  1JTH B;  1RH5 B;  1VF5 C;  2VB6 A;  3M1C B;  1SMY F;  4DBQ A;  1SQV E;  3K5B A;  3L74 E;  4L73 A;  3EPV A;  1EDL A;  1XZQ A;  2W83 C;  2EPO A;  2IXM A;  2D4U A;  4OGQ D;  2IXO A;  2WSE J;  4U5E E;  3C8G D;  4E0H A;  3GHG B;  1NU1 J;  1EZV D;  1MMD A;  2HR3 A;  4I1M A;  3G50 A;  2K9J B;  1DEB A;  2KUB A;  5AVQ B;  4PD4 H;  1RJ9 B;  1S9K D;  1S05 A;  3L35 A;  1PL5 A;  3JSZ A;  1ZU4 A;  3AE9 C;  1QZX A;  3AJM A;  3M4B A;  5L3V A;  4CS8 C;  2I8B A;  4CJG A;  3JRT A;  3M0D C;  1VF5 D;  1VMA A;  2NUP A;  3EGD B;  3IR9 A;  3B5N B;  3EQ2 A;  1HGV A;  2RN0 A;  1G4U S;  3W4Y A;  4YK5 A;  1MFT A;  2Q4F A;  1T8Z A;  5KJ7 C;  2IOQ A;  1Q81 Q;  3BCC G;  3GAN A;  5A6J A;  2A45 G;  4EOT A;  1R8E A;  4CS9 C;  2ZAE B;  3V7O A;  1X9V A;  3TK1 A;  1CW5 A;  1GS9 A;  1EI7 A;  3MD0 A;  1PP9 D;  1NTK E;  3GMA A;  1URQ D;  1DIP A;  4J32 B;  3S0X A;  3IN6 A;  2R5D A;  1IW7 F;  2E87 A;  1VB5 A;  3T97 A;  1OVR A;  2JWA A;  4JKV A;  2BCC G;  2V4H A;  4BXL A;  2WIT A;  3ZDL A;  3FHD A;  3U0C A;  2R05 A;  4ZLC A;  1YYJ A;  2BC5 A;  2KLV A;  3AQC A;  2DGJ A;  2MYS A;  1RF1 C;  1L0L E;  2KW3 C;  2V7Q J;  1GU4 A;  2YEV A;  1Q0D A;  1YAR O;  2LP4 A;  4IFD K;  3ZC4 A;  3VMA A;  4MQ9 F;  4JYB A;  1WGW A;  2B88 A;  4ER9 A;  1JMB A;  4CJO A;  1T2K C;  5AVY B;  3W8H A;  3H1J E;  4Z9H A;  1QKR A;  3JRM O;  4CSA A;  4LER A;  4XLN F;  4KC9 A;  3I56 P;  2WZL A;  2WSF J;  1TWA A;  3U5S A;  2ZT9 C;  4N3Y B;  3ZQV A;  4BEJ A;  1XZP A;  2NPU A;  3ZQY A;  2QM7 A;  3KPE A;  4E17 A;  1G2C B;  5DS5 A;  5AVS B;  3K1H A;  4GOE A;  2Q1K A;  1PP9 J;  2OKU A;  1NKZ B;  3MUD A;  2IZ0 A;  3RFY A;  5AW3 B;  2E75 B;  5KLV K;  4I1O B;  1T6A A;  3U59 A;  3LW5 H;  1Z23 A;  3TOM A;  1LJ2 A;  3NG1 A;  1YI2 P;  4IRU A;  1EDK A;  1NAF A;  1ZHT A;  1GGQ A;  2YXR B;  1VQ6 P;  2YL1 A;  4CX9 A;  3RK3 D;  3GM1 A;  2OEV A;  3C1L A;  2XRH A;  1EDI A;  3NRH A;  1OXZ A;  1YLM A;  1EKY A;  1SFC B;  3VTP C;  2E43 A;  4YT5 A;  4EIJ A;  4CDV A;  1Y4C A;  3AE4 C;  4JJF A;  3ASN C;  2VCA A;  2W45 A;  3HD7 C;  5AW8 B;  1S5L H;  1YZA A;  3PH0 A;  2ZT9 D;  2EPN A;  2IBF A;  3EGX B;  1NTZ G;  3WU2 H;  3GM2 A;  3CL3 D;  3H1L D;  4QMA A;  2KZI A;  2Q9C A;  2C0X A;  5APW A;  1Y8A A;  3L71 D;  2XLO A;  2XLH A;  3FVY A;  4PFO A;  2M64 A;  3K1I C;  1LTA C;  2P0N A;  4H13 D;  1GM5 A;  1OXK A;  1IFD A;  3TGU D;  2R25 A;  3AE6 C;  1HVV A;  3VN0 A;  1VQK P;  2JO1 A;  3I5P A;  5E3C A;  4FAP B;  1Z6A A;  3SEO A;  2OTL P;  2CW0 F;  3FAJ A;  4CS8 A;  4O6M A;  3L4F A;  1UG7 A;  1P84 I;  2HPC B;  4WGY A;  2OYI A;  2X0C A;  2RSE B;  4DRJ B;  4I44 A;  1S5L E;  2QJP C;  2CCY A;  2Q9I A;  2W6B A;  4N06 A;  1D1A A;  1NU1 G;  2J5U A;  4TLF A;  2Q9A A;  3HD7 D;  1A7E A;  4DRI B;  1CSB A;  1GD2 E;  5FCL A;  4CS9 A;  1RF0 C;  1HE1 A;  4G7Z F;  4P6I C;  1AVO A;  3TF5 A;  5COG A;  4EIY A;  1NTM K;  5KAI E;  1VQM P;  3B71 A;  3VP9 A;  3P8M C;  1LWU A;  2L81 A;  2R7U A;  5EHH A;  1NLX A;  4NPE A;  4XEK A;  2KGO A;  5CCG D;  4XPY A;  3L71 J;  4I2L C;  4G7H F;  3ZTZ A;  3O8Z A;  4O6Y A;  3FGA D;  5AGF A;  3TGU J;  4LC1 A;  1TR2 A;  4KNV A;  3JCU Q;  2QUP A;  3JTL O;  4MVZ A;  4PV1 C;  2Q7C A;  1ZV8 A;  1RF1 A;  3M9Q A;  1D0Z A;  2AEJ A;  3DJN B;  3OAK A;  2GUS A;  1JOG A;  3WMM 0;  1ZOY C;  3GM3 A;  4A7P A;  4GDO A;  3Q3D A;  1VPC A;  3L75 D;  3AE5 C;  1MQV A;  2Q00 A;  3CCL P;  3GWN A;  4JBZ A;  3MGN A;  2KZJ A;  3NXS A;  2PX3 A;  2LIG A;  4OGQ B;  2W90 A;  3C8G B;  1P84 H;  256B A;  1EZV G;  2XL6 A;  2CGE A;  1FZC B;  2R7Q A;  2YKZ A;  2NG1 A;  4NPD A;  2J9V A;  3JCU H;  3AE2 C;  1JPN A;  2M3E A;  5APT A;  3Q5S A;  1DD4 A;  3KDP B;  1ORJ A;  1JUN A;  1H0T A;  2PRR A;  5KLV E;  1NH4 A;  3WG7 C;  2QSI A;  2QRX A;  3CWB D;  2HKV A;  1VF5 B;  4PV1 D;  3L1M A;  2NUT B;  5F28 E;  4AQR D;  3V5X A;  2JDI H;  1BE3 E;  5APQ A;  1KU2 A;  2DYS C;  3PHL A;  3A9C A;  1ZRT E;  1Q0F A;  4C3B A;  3H1H E;  4AE4 A;  1Z5Z A;  4C7N A;  2P1A A;  4DBR A;  1P84 E;  1H88 A;  1UFB A;  3OWT A;  5B3S C;  4YT2 A;  2B89 A;  1D0Y A;  5B1A C;  1SQP K;  3JCU E;  5KAF H;  1KB9 H;  1PP9 G;  4WY4 A;  1S3J A;  1K05 A;  1URQ B;  3SP1 A;  1U6H A;  3BRT B;  1NFO A;  1USE A;  1NBB A;  1M56 C;  2PP4 A;  2UWJ E;  3I5C A;  3M9B A;  3K1I A;  2A0U A;  5COM A;  1JCD A;  1MNE A;  1H7I A;  2KK7 A;  4KJM A;  2YL3 A;  3V2P A;  3IPM O;  1CGN A;  2H7H A;  5CCH C;  3RL0 C;  3C8V A;  1KV4 A;  2AU5 A;  4KT0 J;  2QG4 A;  2PFX A;  1Q90 D;  3AEC C;  2C9L Y;  3FDQ A;  3AEF C;  3RGU A;  2R7X A;  3KYI A;  1S2E A;  2FFD C;  1L2P A;  3T4R A;  1BCC E;  3EHM A;  5KAF E;  1BDJ B;  3MZW B;  1C03 A;  3UMI A;  2VC9 A;  3RBZ A;  1KIL E;  1LTJ C;  3HTK B;  3S27 A;  2FGY A;  3AG2 C;  4D6T E;  2YRF A;  1YYC A;  1V54 C;  2EIK C;  3B0P A;  3X2Q C;  5CJ4 A;  3E7K A;  3H1K E;  2O1K A;  1NTM E;  3F5H A;  3DM5 A;  1JY3 O;  3M4C A;  3MYI A;  1RKE B;  3KKB A;  2IBZ D;  5KLI B;  4BJ5 C;  4DZO A;  1SR2 A;  1SQV D;  3RL0 g;  2XLE A;  1OW7 A;  4BRY B;  2BAS A;  2YO3 A;  1FZG A;  2KNC B;  4HYT B;  5L0I A;  5CCH D;  3HE5 B;  3AQB A;  3RL0 D;  2HV7 A;  1VDF A;  4IAO A;  1LP1 B;  1ZHW A;  3IF4 A;  3RK3 B;  2KP8 A;  3HLZ A;  1OR2 A;  2ZXR A;  3LNR A;  2XLD A;  1ORS C;  4JCH A;  1YIJ P;  5E33 A;  1L0N J;  4U5D E;  5CJ0 A;  3B9Q A;  1SF8 A;  3KL4 A;  2ZT9 B;  3F46 A;  2Q3E A;  1JB0 J;  3A11 A;  4XWJ A;  5BQG A;  3SYN A;  2RMZ A;  3S90 A;  1SLQ A;  3O6Q A;  5IY5 C;  2K9Y A;  1CI6 B;  2IZ1 A;  3L71 G;  1EA8 A;  1MZ9 A;  3U8P A;  4LDQ A;  3KMI A;  4H13 B;  3TGU G;  3TOL A;  3I4U A;  1M1J B;  1SQV J;  3L74 J;  5H2F H;  3LLK A;  5CI9 A;  5GTH E;  1HH0 A;  2LKM A;  5T1D B;  3BCC D;  2VH3 A;  3ZWI A;  2Q5U A;  1SQX D;  3GEH A;  5AW5 B;  4BJ6 C;  2KLU A;  4PD4 D;  3IQ6 A;  2KS1 B;  3WOD F;  2Y3H A;  1AA0 A;  4U5C E;  3M79 A;  4O79 A;  1FR0 A;  2AVK A;  3VMX A;  1Q0K A;  4PJN A;  3DE9 A;  1N73 A;  3H2V A;  3DD7 A;  3GF7 A;  3HD7 B;  2ITA A;  1G1J A;  1YA9 A;  5TIS H;  1LTI C;  3B8E B;  2LXB A;  1LS4 A;  3HUS C;  1VQO P;  5B66 E;  3CXH H;  1IJD B;  1QVX A;  1SQP E;  1EQ1 A;  1Z63 A;  2O9X A;  1SQB E;  5H2F E;  2YLI A;  3L72 E;  2YMK A;  2R3S A;  5DJU B;  4NCQ A;  4XQ1 A;  3H1J D;  4NC3 A;  1FE6 A;  3NMI A;  1OW8 A;  2ZVO B;  3SXZ A;  1FAV A;  4OVN F;  2ZVN B;  4WBA A;  1GL2 D;  3MX3 A;  1YJN P;  2NZ2 A;  1GMJ A;  3RVY A;  1HJB A;  2I15 A;  3SXY A;  2Q6Q A;  1JO5 A;  3CMA P;  4I7Z C;  3AGU A;  1S4X A;  5AW1 B;  5TIS E;  5APV A;  3G6E P;  4JZA A;  1NTK J;  1HE9 A;  3J06 A;  2D2C D;  3V2Q A;  1FZF A;  2A06 G;  3AG4 C;  1RXQ A;  3T6J A;  3AED C;  3ABM C;  1YDI A;  3E70 C;  1NVO A;  3AEE C;  4GOF A;  4YT4 A;  2QA4 P;  4N6C A;  3LIE A;  3W67 A;  2XXA B;  3B0V C;  1L3P A;  4XTK A;  1L0L J;  2O01 H;  2XV5 A;  3GHG A;  4TT3 H;  3S1K A;  1V55 C;  1JOC A;  3TD7 A;  2LK4 A;  4WWI A;  4JIO A;  2IPP A;  1A02 J;  3CWB G;  4PJJ A;  2PGD A;  1CZQ A;  1U7M A;  3H1J J;  4PV1 B;  3ZSU A;  4L74 A;  1VOM A;  3NMD A;  3CCE P;  5APS A;  4QDL A;  4L76 A;  3SSU A;  4OIR F;  1WMK A;  4U3F E;  3EWK A;  1YJ9 P;  3KH2 A;  4IFM A;  3EGD A;  2ZXP A;  3B5N A;  1K8A Q;  2QNL A;  2IDB A;  2IXN A;  3O55 A;  2CYD A;  2E74 D;  5BQH A;  2KIK A;  2FYN C;  1E85 A;  5JS5 A;  4YWQ A;  3FOP A;  2E42 A;  1T01 A;  2YIU C;  1J8M F;  2HMZ A;  4NPF X;  3HJC A;  1AQ5 A;  2J8W A;  2OG2 A;  2QM8 A;  3QW1 A;  2K3R A;  3RW0 A;  4ZLD A;  1ZN5 A;  3TNU B;  3BRV B;  3U9M A;  3ITF A;  4DOZ A;  3JC2 2;  3CCQ P;  3M15 A;  4YL3 A;  2R7T A;  2M5A B;  2Z15 A;  2YKP A;  2M8R A;  4IAQ A;  1FJK A;  3P8C E;  4KNW A;  2RD9 A;  1L0N G;  3RQF A;  3VMY A;  3DZA A;  2LQG A;  1HGZ A;  2NPS C;  1RQU A;  1XTG B;  3EHN A;  3UMH A;  3NYM A;  4JEA A;  1K73 Q;  1KFM A;  3MUD C;  5HSW A;  3LW5 J;  1X8Y A;  2A45 I;  3HE4 B;  4LDR A;  1PPJ E;  2Q3I A;  4PJ0 E;  1G4W R;  1HW2 A;  1E83 A;  3JYY A;  1SP4 A;  1WN0 A;  2KSJ A;  3VM6 A;  2Z5H A;  3VF0 A;  1A0B A;  4FX5 A;  1ZW3 A;  2IBZ G;  3NKE A;  1SQV G;  2C03 A;  1J1D C;  3L74 G;  1FFH A;  3V2N A;  5FZT A;  1OR3 A;  1QQ3 A;  2OYH B;  1ZR4 A;  2HJ3 A;  3L8J A;  4K35 A;  3PRJ A;  2Y9Z A;  3EZI A;  3DXJ F;  4RJT A;  1N7S D;  3RL0 B;  3H1I E;  5L8R J;  2W27 A;  3ABL C;  5AC4 A;  3QWO C;  4EBK A;  4K7B A;  3VYI A;  3W68 A;  2IXP A;  3CME P;  3A0H E;  3TYY A;  1LTJ B;  2HZ8 A;  4MVM A;  2MWQ A;  1NOH A;  3F89 A;  3HNK A;  3M9H A;  1DD3 A;  1QL1 A;  1KQS O;  2YVK A;  4XLP F;  2OYO A;  3EZH A;  3Q7L A;  1I5N A;  2HLO A;  3H65 A;  4E0I A;  1IO4 A;  1NTZ K;  2OYI C;  1O87 A;  4OIQ F;  2OJE D;  4L75 A;  4ASV A;  1TQG A;  4NTA A;  1E5W A;  1EDJ A;  3ZG1 A;  1NJI Q;  4J30 B;  1VTM P;  1P84 D;  5AW6 B;  2R03 A;  1L7C A;  1OVV A;  1KIL C;  1LM3 B;  2ZXE B;  1R4T A;  1SQX G;  4H0L C;  2EIL C;  3L70 D;  2EIM C;  1LWU C;  2L9J A;  1J1E C;  3O6X A;  3FXD A;  5K0I A;  2HPC A;  3UNG C;  1AV1 A;  4ANJ A;  5CBO A;  1Q7Y Q;  4MW3 A;  4EKW A;  2MKV A;  3VRC A;  2J0X A;  4R4M A;  4XPW A;  1OW6 A;  3X1O A;  2GAQ A;  4ASW A;  1NU1 K;  1L0L G;  2YMY A;  2OOC A;  5KLV J;  2OQQ A;  2R7R A;  4JUR I;  2J7P D;  2WSS H;  1FFT C;  1FZE A;  5GTI H;  1BCC D;  3H1J G;  1KN7 A;  1BE3 J;  3L8I A;  1KB9 D;  1H8A A;  5KJ7 D;  3H1H J;  4QI2 A;  3Q5P A;  3RBX A;  1SQQ K;  2BCC E;  2HOD B;  5BUO A;  1GL2 B;  1BGY E;  1JMW A;  2N9Y B;  5DVW A;  2AXT E;  5AVR B;  1S72 P;  4GOD A;  4BJ1 A;  3ZDM A;  2QJK C;  2L6F A;  2XU6 A;  3KQG A;  1VLT A;  2NPS A;  3L70 J;  3R7C A;  2D2C B;  3RQE A;  3LLI A;  3L73 E;  3GEE A;  2RH0 A;  1JCC A;  4U5G A;  3DAF A;  5T3W A;  1GDT A;  1OCC C;  4RD9 A;  4OH8 B;  2WZG A;  5TJH A;  4QI0 A;  2EPM X;  2W4B A;  3NKD A;  1EXJ A;  4U5F E;  5GTI E;  2E76 C;  3KPH A;  1R5L A;  4YXD C;  3V4W A;  1LT9 C;  2FYU D;  1TFK B;  2FBW C;  4D4X A;  2UUI A;  1EC5 A;  4W7Y A;  2KSF A;  2FKW B;  1SVF A;  1FZC A;  1T2K D;  2YNY A;  4BEM J;  1FAP B;  3LAY A;  1BCC J;  2P10 A;  4O9B A;  2KSE A;  2IYO A;  4WY4 C;  1JNM A;  2L91 A;  3PJS K;  4IGG A;  3L36 A;  4D6T J;  5AW4 B;  3E1R A;  3OA7 A;  2BE5 F;  3NFQ A;  2WZF A;  2N1T A;  3CLQ A;  3EFO B;  3H1K J;  4UB6 E;  1YTZ T;  2NUT A;  3CC4 P;  1NTM J;  1K04 A;  3RK2 C;  3DMD A;  2H8P D;  4JC7 A;  1TU3 F;  5KAI H;  2E74 B;  2CNW A;  1GU5 A;  5DJT B;  3S4R A;  2YL7 A;  4HFF B;  4MW8 A;  1OMI A;  1EZV I;  2O01 N;  2NUP B;  3RIP A;  3PHF 2;  2KYH A;  3NTN A;  2ZXX A;  4OD5 A;  2FYU J;  3C62 A;  4PR9 A;  4YL0 A;  2AP3 A;  2I1J A;  3E1I A;  3VMZ A;  2OEX A;  2PF4 E;  3K7D A;  4HFK B;  2H89 C;  4XFJ A;  5EFW B;  3DWW A;  5JT4 A;  3JSV C;  1KIL A;  4ZMD A;  1E2X A;  3GLM A;  4X0R A;  2WVQ A;  4EDF A;  1G1I A;  1SQB D;  3RK2 D;  5KKZ C;  4AL1 A;  5JLI A;  2B9B A;  4AL0 A;  3SXK A;  5APU A;  2IFN A;  3V5Z A;  5DS4 A;  2P7J A;  1KYO I;  2J59 M;  1K40 A;  2FAP B;  1WTY A;  3H32 A;  3JT1 A;  5L0C A;  1H9T A;  1VQN P;  4ULV A;  1NU1 E;  1BDD A;  3Q1M A;  1NAY A;  2GWW A;  4JEB A;  4PJM A;  1YAU O;  4CBE A;  3PMR A;  2WSC H;  1PGO A;  1YZC A;  1U0B B;  3S9O A;  4C7O A;  3CXH D;  4N78 E;  2EIN C;  1RKE A;  1N7S B;  2A06 D;  1SQQ E;  3FXH A;  4BRY A;  1FOS E;  1NGM B;  2OJQ A;  1PD0 A;  3NYL A;  2KNC A;  3FAP B;  1SQP J;  4C7R A;  3V5B A;  1LP1 A;  3D6Z A;  2HS5 A;  1LKX A;  1WT6 A;  1HMO A;  4E7Z A;  2FXO A;  1SQB J;  2KNH A;  1BBH A;  3L72 J;  5E2Q A;  3UGO A;  1TFO B;  1VQ4 P;  1HF9 A;  1QGK B;  2JX0 A;  1IC2 A;  3EG9 A;  1LT9 A;  1LGH B;  3H1H G;  1G5Z A;  3C8Z A;  2L5G B;  1EZV E;  4U3F D;  3WAQ A;  4H44 C;  3T6G B;  1CI6 A;  3PDM P;  1N73 C;  1KYO H;  1OX3 A;  3D70 A;  3V5Y A;  3D6Y A;  4JPZ B;  1S9K E;  3L70 G;  3LUT B;  1M8O B;  5KYW A;  2IYL D;  1NKN A;  3IFM A;  2B87 A;  2DW3 A;  3EH1 A;  5HV9 A;  1FDO A;  1GK6 A;  1NYH A;  1OIP A;  4XA4 A;  3TJ5 A;  2KS1 A;  3ABV C;  4K1O A;  3AE3 C;  4BWN A;  1ZW0 A;  3JYH A;  1OFC X;  2AWY A;  3QVZ A;  4HB1 A;  2OYI B;  3AEG C;  3GG2 A;  4Y28 J;  1KTM A;  1KYO E;  1WAT A;  1MV8 A;  1OWA A;  3RQG A;  1BCC G;  5C39 A;  1PP9 E;  4H44 D;  1L0N D;  2QE7 H;  3TQO A;  5L0H A;  1Q0M A;  2B0J A;  1YTZ I;  5AVW B;  2JWD A;  1O3U A;  5APX A;  4U3F J;  3LEV A;  5AW9 B;  4D6T G;  4FES A;  2WWW A;  2XLM A;  1VQP P;  5AVX B;  1AVO B;  3SWF A;  1IFI A;  1NTM G;  4IAR A;  1FMW A;  5A69 A;  2VAS A;  4EBB A;  2O01 J;  2YKO A;  4MVR A;  1M56 D;  2CPB A;  3GHG C;  3G71 P;  2E5T A;  2YWA A;  1BDC A;  3L74 D;  3TK0 A;  5B5E H;  3I5Q A;  1A02 F;  1M2V B;  2F22 A;  3V2R A;  1WOL A;  3BRJ A;  2FYU G;  2ZYG A;  1VQ9 P;  3H1I D;  3A5T A;  1RF1 B;  3IQC A;  4RDA A;  5A6B A;  2R32 A;  4HEA J;  4NQF A;  4JW1 A;  5GTH H;  4YXW H;  3K66 A;  2XXA A;  3RH3 A;  1KQL A;  1RCP A;  2G3A A;  4IL6 E;  3B5N C;  2AXC A;  1Q0G A;  1GQA A;  5JVE A;  1OQC A;  1FU1 A;  2VCC A;  5KTB A;  4HKZ H;  3AG1 C;  3D71 A;  4LLC A;  4WB4 A;  5B5E E;  2CDQ A;  1YYX A;  2PBE A;  3RF3 A;  3M91 A;  3RK3 E;  1DX7 A;  4MTG A;  1NO4 A;  5B66 H;  3WUT A;  5JSL A;  3CX5 I;  3A2A A;  1MKM A;  3ECS A;  1YBK A;  4JQ0 D;  1QL2 A;  1T9K A;  2XL4 A;  1UII A;  1JY2 O;  2GA0 A;  4M3L A;  2GM4 A;  1S5L X;  1L4A A;  5EGY A;  4G7O F;  3H1I J;  4WVZ A;  2XM0 A;  3H1L E;  1NTK D;  4AX2 A;  3CPW O;  4C7N B;  2M4E A;  3U1A A;  3L71 E;  4O7G A;  4HH2 A;  2QLA A;  3BAS A;  2Y0E A;  1UIX A;  3HRN A;  4J7Y A;  2JP3 A;  1AEP A;  3W8I A;  2Y0D A;  1H6G A;  2P67 A;  1MMG A;  2J9W A;  3N2Z B;  4U9D A;  1Q2N A;  2JPU A;  4Q4Z F;  1JM0 A;  2RKL A;  1DOW A;  1APC A;  1SQB G;  4C3E A;  1L0L D;  2M5A A;  4JTA B;  3L72 G;  2PX0 A;  4MTF A;  2A68 F;  4AUW A;  3BEH A;  2OAR A;  5E79 E;  3U2M A;  3EFF K;  2TMV P;  3US6 A;  1BR4 A;  1J8Y F;  2V3C C;  2B0H A;  3Q6N A;  3RKO F;  1R5S A;  2E75 C;  1BGY D;  3OW2 O;  4JCZ A;  2ZFC A;  1RE3 A;  4KI2 A;  2KOG A;  4IFF A;  4LGD E;  1YJG A;  2WVN A;  1ZHY A;  2QJP B;  1LTG C;  3BAT A;  1CPQ A;  1VLS A;  4MVO A;  2ZYA A;  4OWF A;  1SQV K;  1IK9 A;  3CX5 H;  3UMK A;  4DJ9 A;  4M63 A;  2P2U A;  1JTH A;  3L73 D;  4MND A;  3DE8 A;  3GW6 A;  3TSI A;  1E86 A;  1OKK D;  4FWV A;  2YLD A;  1LT1 A;  3OA1 A;  2OYH A;  1AUE A;  1I4Z A;  3HNL A;  3PLN A;  1WRG A;  4DJG A;  3S28 A;  4G0H A;  1M90 Q;  3DAG A;  3SNH A;  1VYI A;  3IQ5 A;  4EWC A;  1D1C A;  4IB4 A;  2VRS A;  5CHX A;  2EPK X;  1JEK A;  4U9E A;  1XTC C;  3L75 E;  5KYY B;  1AJY A;  2ZYD A;  1ZLL A;  2K9J A;  1B68 A;  4ZKP A;  2GUV A;  4E18 A;  2R7O A;  2J58 A;  1N7L A;  1SS1 A;  3CX5 E;  2IBZ I;  1RJ9 A;  2BCC J;  2J46 A;  3SWK A;  1BGY J;  4AYC A;  4U3F G;  1PCX A;  3HKK A;  4JTD B;  3OJA B;  1NHL A;  1S1C X;  4HJG H;  4OD4 A;  2ZPA A;  1GZL A;  2XZR A;  2O1J A;  4ONS A;  2R7S A;  1MND A;  3II6 A;  3KYQ A;  4B86 A;  3L73 J;  3N7N A;  1G8X A;  3O6Q B;  2LD6 A;  1YJW P;  4EBJ A;  2D5R B;  2XLW A;  3UR3 C;  4CPG A;  3CWB E;  1SQX K;  2ZXW C;  4MN4 C;  1LI7 A;  4MS2 A;  4PJ0 H;  5KYX B;  1VK5 A;  2EIJ C;  1E79 H;  1YQ3 C;  3KXD A;  3U8V A;  4C3D A;  3U3F A;  3MTU E;  3VYW A;  3P32 A;  2WB7 A;  1HWT C;  1HJ0 A;  3CAX A;  1QX8 A;  1T6U A;  3T9O A;  4D4N A;  1NFN A;  4H44 B;  2R3C A;  1FZA A;  1KD1 Q;  4YPC A;  2JR8 A;  2L6H A;  3P7K A;  3C7J A;  1PPJ G;  1T5O A;  1Y47 A;  1I4Y A;  5EK0 A;  4PD4 I;  4H4K C;  2HFI A;  2XNX A;  1O5H A;  4KBL A;  1LVK A;  1M7L A;  2CPS A;  3A0H H;  4H54 A;  2P58 A;  3Q5R A;  2M3B A;  2W9Y A;  4W8P A;  5AVV B;  2HOD A;  4XE5 B;  4A4A A;  1GL2 A;  2ICW G;  4OGQ C;  2Y39 A;  1H89 A;  2FFH A;  3EH2 A;  3H25 A;  4XEF A;  3EQL F;  2QJY C;  2P1J A;  3SZR A;  4ZKU A;  1FZC C;  3QW0 A;  2J0W A;  3F47 A;  1G2C A;  3WUV A;  1OXB A;  1OCR C;  4LLH A;  2JKV A;  3AE8 C;  3H1I G;  1LTS C;  2A69 F;  1BSH A;  1SQQ D;  3V6I A;  2DYR C;  2Z4E A;  4Y99 C;  4Q7C A;  1Y9B A;  5KYU B;  3IAO A;  1PD1 A;  2H7O A;  2NPS D;  2IYP A;  2FFD B;  3S84 A;  2N1T C;  2OTK E;  4E7S A;  2KC3 A;  4P9T A;  1TWG A;  2IBZ E;  3WHN A;  3POV A;  1PIX A;  1C02 A;  4O6N A;  3U2L A;  4DRH B;  4W80 A;  1BZ4 A;  3B29 A;  1T3J A;  1MMN A;  4BPM A;  1Q86 Q;  3KZI H;  5E3A A;  5KLV D;  2L6G A;  5AW2 B;  2H7B A;  3Q7G A;  5F5H A;  3AEA C;  4JF7 A;  4PFP A;  2IFM A;  2Q7R A;  2KJG A;  1SFC A;  1FDI A;  3ITK A;  2ZXO A;  3FX0 A;  2AEM A;  1Y6D A;  1LPE A;  1BE3 D;  1A41 A;  2FXP A;  5D92 A;  3ZIB A;  1ZRT D;  3EGX A;  2KI7 B;  2H7V C;  1URQ C;  5K5G B;  3H1H D;  3N4X A;  2J45 A;  1ZR2 A;  1PGP A;  2A45 H;  3EFO A;  3QMK A;  1CPR A;  4IJJ A;  5AC5 A;  4Q5S F;  1PFI A;  4MVU A;  5DS6 A;  3LEO A;  2OGU A;  3NYJ A;  5B1B C;  3DKA A;  1KZU B;  1NTK G;  1SQQ J;  1W2B O;  2QE9 A;  1N8R Q;  2A1D D;  2N1T D;  1M6T A;  3KZI E;  2Q9B A;  4PAC A;  4JTC B;  3GF3 A;  3U1C A;  1FBM A;  1M2O A;  2KQ9 A;  2AXT H;  1PZQ A;  2CNW D;  4EHP A;  2HUJ A;  4MTO A;  4JE9 A;  3HNI A;  3PTZ A;  3HTK C;  1JR8 A;  5L0J A;  4OIN F;  1KYO D;  2W6J H;  3BCC E;  2WSC J;  3G4Z A;  1SQX E;  2PP6 A;  1J2J B;  2HG5 D;  4PD4 E;  5TJ5 E;  4CDY A;  3M0A A;  3AGT A;  3H2U A;  3U9J A;  2AWC A;  3GWL A;  2YZS A;  5KLI C;  3IEE A;  2JJL A;  4DVY P;  1BGY G;  1KIL D;  1DEE G;  2WT7 B;  2ASR A;  1KC8 Q;  3DM9 B;  4D6T D;  4H0L D;  2J9U A;  2WTY A;  5BQI A;  1OCO C;  4B6I A;  3LES A;  3SFD C;  3H1K D;  1NTM D;  1VQL P;  3L73 G;  2MJZ A;  1YIT P;  2NSG A;  3RK3 C;  4WJ0 A;  2PFD A;  2R7V A;  1H9G A;  3HUS B;  3K33 A;  3W2W A;  1LI5 A;  1CGO A;  2YHS A;  4UB6 H;  4JRZ A;  2Y3G A;  1KNY A;  1ZME C;  1N7S A;  1DOV A;  3CC2 P;  3C8G A;  3QVY A;  4EYY Q;  3RVZ A;  2QVA A;  1OCZ C;  2IX7 C;  2KYV A;  4H13 C;  4MVS A;  4UB8 H;  4MVQ A;  4EI2 A;  2XLV A;  2OCC C;  4BJT A;  1M1J C;  3G3Z A;  3CI9 A;  4ULW A;  4I7Z B;  1KFN A;  3MLG A;  3CCJ P;  3TUL A;  3VOP A;  3ZTM A;  3NDB B;  2H8A A;  2QEX P;  1FS0 E;  3TDK A;  1U57 A;  3NMK A;  4GT1 A;  1ZHX A;  4A2N B;  1X22 A;  2E76 D;  3FOO A;  5L0D A;  4U7J A;  1GW3 A;  5L3Q A;  5F5F A;  2LFF A;  3GOR A;  4RBN A;  1F1M A;  2HSQ A;  1D1B A;  4ZNC A;  2W6A A;  3B4S A;  1NU7 D;  1IZM A;  4DT0 A;  1Z56 A;  2C9N Y;  4UB8 E;  5AVU B;  1NTZ E;  2WSE H;  2BEQ D;  1URQ A;  3WUU A;  4Z1M H;  4W7Z A;  3SXM A;  1FMV A;  1YHQ P;  1C17 M;  5CMZ A;  5CCG C;  1HMD A;  4U5B E;  2AEF A;  3TJ6 A;  4WY4 D;  3FWN A;  1SQP D;  3CEX A;  3M0D A;  3B0U X;  3T97 B;  5AVZ B;  2CK3 H;  1MMA A;  2J7P A;  2LFD A;  4U5H A;  3L72 D;  3FMS A;  1W5C E;  1A7D A;  3CCU P;  1QEX A;  3AE7 C;  1RHZ B;  1JY3 N;  3WU2 E;  1VQ7 P;  4G78 A;  1MUU A;  1HBW A;  2FYN B;  1LE2 A;  5KJ7 A;  1S7Z A;  4WGZ A;  4JJG A;  2GDC A;  2YIU B;  1T6Q A;  4OIO F;  1USD A;  3HTK A;  1LTT C;  2XM4 A;  2QIW A;  3ASO C;  4CDA A;  1FJP A;  1XWJ A;  4RKU J;  3PP5 A;  4GEH A;  2C04 A;  4XPX A;  3H1L J;  4YT8 A;  5GPG B;  3QH9 A;  1SQQ G;  1WWP A;  5JUA A;  4IWB A;  2WMM A;  5AW7 B;  2XS8 A;  3U3B A;  2FYU K;  1M2V A;  1EQ7 A;  2NPS B;  1TWC A;  1FZB A;  5A6K A;  1QVG O;  1KB9 I;  4RO0 A;  5AW0 B;  2H88 C;  1FDM A;  3HE5 A;  4L6R A;  2V7Q H;  5T3T A;  2JEE A;  1GW4 A;  4YN0 B;  4OIP F;  5KLV G;  3IQT A;  3CCV P;  3A0B H;  4DXW A;  1RE4 C;  5A6B D;  4I3M A;  2GA1 A;  3CX5 D;  4R32 A;  1RY3 A;  1BE3 G;  1L4A C;  3M06 A;  3CD6 P;  1J1D B;  2QJY B;  4F4B A;  1V4A A;  2WPQ A;  1JY2 N;  2WSF H;  4CIH A;  3ABK C;  3N24 A;  1GK4 A;  1IFJ A;  3JZ0 A;  3C63 A;  4LDK A;  1WAS A;  4Y99 B;  2LXC B;  5AVT B;  1E84 A;  2BL2 A;  4PK4 A;  1M1J A;  1X79 B;  1PV3 A;  1IFP A;  2N1T B;  1LS1 A;  2GFH A;  2Q3T A;  1AQT A;  2WPS A;  1ORY A;  3L0I A;  3A0B E;  1Z3I X;  2Y3D A;  5APY A;  1JMM A;  2W4M A;  2N9B A;  3R4Y A;  4P9F A;  1HW1 A;  1ST6 A;  1FC2 C;  3NMJ A;  1ZZP A;  3AOU A;  4YTP C;  3L75 J;  1YVI A;  1L4A D;  1RE3 C;  3HD7 A;  3P8C D;  2K88 A;  3L70 E;  2WVO A;  1QPU A;  1SQB K;  1HUC A;  1W2E A;  3SFE C;  3C18 A;  4YL1 A;  5JP7 A;  2M0B A;  2KK1 A;  3BVH A;  1RQV A;  1KIL B;  1KMI Z;  2FXM A;  3LNM B;  3USS A;  2OYH C;  1PPJ D;  1M57 C;  5CCG A;  4H0L B;  1HY5 A;  2MHR A;  3S29 A;  2V26 A;  1ZVZ A;  3E9V A;  3H1K G;  4IL6 H;  4XEV A;  5DQZ A;  3FWL A;  1LWU B;  1J1E B;  4I6M C;  3CWB J;  2P6V A;  1K9M Q;  2K37 A;  2BEZ F;  3H32 B;  2XSE A;  1KB9 E;  1AVY A;  4NTF A;  2YO2 A;  1TKN A;  1NWQ A;  1JPJ A;  1D7M A;  3L37 A;  2HYN A;  1ZW2 A;  1Q82 Q;  3W2V A;  5CIV A;  3VP8 A;  2L7A A;  5CI8 A;  5B3I A;  1VL2 A;  1RF0 A;  4R4L A;  4JYC A;  2Y3B A;  2A6E F;  4C7O B;  3CCR P;  4Z9I A;  3EJN A;  4N6J A;  1M1K Q;  3KHU A;  2A6H F;  4GYT A;  4N4W A;  2WZ7 A;  1M57 D;  1TWH A;  2P7V A;  2XL8 A;  2G62 A;  3G4X A;  2QJK B;  5COF A;  3VAY A;  3RYL A;  5KYY A;  3AE1 C;  2POH A;  3CXH I;  3N0T A;  2FYU E;  1X0T A;  4AK9 A;  2QY9 A;  2Y69 C;  1VQ5 P;  1MFZ A;  3QTH A;  2WPV B;  2Z5I A;  2XND H;  1H0T B;  1OVU A;  3CZ6 A;  3MIW A;  1NU9 C;  1W2W A;  5A6A A;  2YLG A;  4RES B;  3CC7 P;  2E76 B;  3CSK A;  3EFG A;  1RE4 A;  3EG9 B;  1LT9 B;  2HV6 A;  2HJM A;  3Q6M A;  5E79 H;  3H1L G;  4N6H A;  3KYJ A;  1T3U A;  4AE4 B;  2G3V A;  2YKQ A;  5D91 A;  1Z7Q c;  4K0D A;  1JY3 P;  3B5N D;  3UIA A;  3G4S P;  1NSG B;  2IM8 A;  5KYX A;  2HSB A;  1JAF A;  2OU6 A;  2R44 A;  5KYW B;  3TGU E;  4WY4 B;  3PCV A;  3H6P A;  1SQP G;  1QSP A;  2W8Z A;  2B87 B;  2PNO A;  3TNU A;  3DI5 A;  2LR2 A;  1IFN A;  2R5B A;  1GL2 C;  4GQH A; 
#chains in the Genus database with same CATH homology
 1JB0 J;  2KK1 A;  3H25 A;  1RQV A;  4XEF A;  1NGM B;  1IK7 A;  1KMI Z;  2QJY C;  1ZRT E;  3O6Q A;  3SFD C;  3Q2Y A;  1R8E A;  1WOL A;  3BRJ A;  4H13 D;  2K9Y A;  4PV1 B;  4H0L B;  3AE6 C;  2QIW A;  1DD3 A;  5F28 E;  2JO1 A;  2D2C C;  3AE8 C;  3D6Z A;  4NQF A;  4RKU J;  1UFB A;  2P10 A;  3GMA A;  4H13 B;  1DIP A;  4XEV A;  1WMK A;  3IN6 A;  3EWK A;  2WQY C;  1KOR A;  1YQ4 C;  2G3A A;  1Y9B A;  2IDB A;  1HF9 A;  3IAO A;  1KNY A;  1K05 A;  1WWP A;  2BEZ F;  1ZME C;  2JX0 A;  2E74 D;  2QJP C;  3U0C A;  3MFN A;  2FYN C;  1K04 A;  1AJY A;  1PIX A;  1TU3 F;  3D71 A;  3C8G A;  2J5U A;  2E74 B;  2YIU C;  4H44 C;  2H88 C;  1VL2 A;  2V7Q J;  4H0L C;  2PBE A;  4R4L A;  2L6G A;  1OMI A;  3RK3 E;  3D70 A;  3AEA C;  3B71 A;  3GF7 A;  4H13 C;  1FDI A;  3D6Y A;  1MKM A;  1S1C X;  3O10 A;  3C8V A;  1EXI A;  4KT0 J;  1Q90 D;  3AEC C;  2FXP A;  4I7Z B;  3AEF C;  4XEK A;  4IL6 X;  1QVX A;  3TUL A;  4R32 A;  3K7D A;  2MKV A;  1FDO A;  1VF5 C;  2WSF J;  1S5L X;  2ZT9 C;  4R4M A;  1NYH A;  2H89 C;  4XFJ A;  1KQG B;  1OW6 A;  3RQF A;  2G8Y A;  3FGA D;  4EBJ A;  1V4A A;  1KIL E;  2YMK A;  3AE1 C;  2E75 D;  1RQU A;  2OQQ A;  2E74 C;  1U57 A;  3ABV C;  3AE3 C;  4PV1 C;  3GLM A;  1JOG A;  3JZ0 A;  2WPV B;  3LW5 J;  1ZOY C;  1OW8 A;  2E75 B;  3AEB C;  2E76 D;  4U7J A;  1UIX A;  3L8I A;  3GM3 A;  4GDO A;  2JP3 A;  3AEG C;  2NZ2 A;  1GMJ A;  4OGQ D;  4Y28 J;  1YQ3 C;  2WSE J;  3GF3 A;  3Q3D A;  1KTM A;  5KKZ C;  3JYY A;  2JPU A;  3C8G D;  3AE5 C;  3Q5P A;  3RQG A;  3U3F A;  2Q00 A;  4I7Z C;  3RL0 g;  2E76 B;  1PV3 A;  4H44 D;  1OW7 A;  2BEQ D;  1HJ0 A;  4OGQ B;  1K40 A;  4Z1M H;  1WTY A;  3C8G B;  2D2C D;  3G9R A;  1O3U A;  3GM1 A;  2QJK C;  2L6F A;  4H44 B;  3R4Y A;  3Q1M A;  3L8J A;  3AED C;  2WSC J;  2L6H A;  1PL5 A;  1ZZP A;  2D2C B;  3RQE A;  3AE9 C;  3AEE C;  3AJM A;  3AE2 C;  4YTP C;  1ZP0 C;  3Q5S A;  1DD4 A;  2E75 C;  3AE4 C;  2HSB A;  5M1B A;  2O01 J;  3C18 A;  3S9O A;  1VF5 D;  5L8R J;  2ZT9 D;  3T97 B;  4EBK A;  1KQF B;  2QSI A;  5KLI C;  3GM2 A;  1EXJ A;  2E76 C;  4TT3 H;  3Q5R A;  2YWA A;  4YXD C;  1VF5 B;  3AE7 C;  4PV1 D;  2ZT9 B;  3SFE C;  2LK4 A;  4OGQ C;  4H0L D;  2FBW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...