1PV3A

Nmr solution structure of the avian fat-domain of focal adhesion kinase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
146
structure length
146
Chain Sequence
GSPGISGGGGGIRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Focal Adhesion Targeting Domain of Focal Adhesion Kinase Contains a Hinge Region that Modulates Tyrosine 926 Phosphorylation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 52
structure length 146
sequence length 146
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1pv3A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1pv3A02
3C8GD 3RQEA 1O3UA 3L8JA 1V4AA 3AE7C 1OW7A 1WOLA 2JX0A 4XEKA 1YQ3C 4EBKA 2KK1A 3BRJA 3C8GA 3AE8C 3B71A 3L8IA 1OW6A 2HSBA 1KNYA 3AE4C 3C8GB 2L6HA 3C18A 3JYYA 3SFEC 2FBWC 2L6GA 1WTYA 3SFDC 3O10A 2PBEA 2Q00A 1ZP0C 1K05A 3TULA 3AEFC 3GM3A 4YXDC 4EBJA 3AEBC 3U3FA 3AE6C 1KTMA 3AE3C 3AE2C 2H89C 3AEGC 1K04A 3RQGA 4NQFA 2WQYC 1JOGA 2G3AA 1UFBA 3K7DA 3AEEC 3S9OA 2L6FA 3AECC 3U0CA 1ZZPA 1K40A 5F28E 4R32A 4YTPC 4XEFA 3AE1C 3ABVC 1ZOYC 3RQFA 3GM2A 1QVXA 3AE5C 2LK4A 1WWPA 3AJMA 1YQ4C 1PV3A 1OW8A 3AEDC 2JPUA 3AE9C 3GM1A 2H88C 3JZ0A 4XEVA 3MFNA 2YWAA 3AEAC
chains in the Genus database with same CATH superfamily
2H7OA 1QEXA 4I7ZB 1WGWA 1ZHXA 4NC3A 3H1JJ 3M1CB 3SSUA 1YZAA 2KXPB 1E84A 1G1IA 1PGPA 2OTJP 1O3UA 4MNDA 4KHXA 3HE4A 3RIPA 4PD4E 1USEA 4GKGA 3I56P 3EFOA 1BDJB 4XEKA 3SEOA 5DQZA 4CDAA 3W8HA 4KC9A 4P6IC 1JPNA 2HJ3A 4L75A 3C8GA 1W2WA 2WSCH 2R44A 4C7OB 3B4SA 5DS4A 2YIUB 4MQ9F 1I4ZA 2R3SA 3C18A 4JQ0D 2M4EA 4QI2A 2YO2A 1RQVA 3O10A 5K5GB 3TJ5A 1OZHA 4WJ0A 1SFCB 2PX3A 1YZCA 1ZN5A 3L1MA 1YYXA 3EG9B 3NMKA 4ANJA 2EPKX 2ZT9C 2RN0A 1HW1A 1DD4A 1L0NG 3AE6C 2D2CD 4HJGH 4KBLA 1G4US 3WODF 2J59M 3TOMA 1NKZB 1LVKA 1PGQA 2FGYA 2PRRA 1K04A 1VQ9P 1KILB 1MKMA 4AL1A 5KLVK 2QY9A 4PJMA 1LTAC 3UGPA 3TGUJ 2R25A 2G3AA 1BDCA 3CCUP 3AECC 4GODA 1QSPA 3BRVB 1L0LE 2YLDA 4RD9A 2YIUC 1ZV8A 3G4ZA 1NTMG 4O9BA 1PP9J 2HMQA 3CCMP 3MIWA 2R7OA 3GMAA 3DM5A 3EHMA 3TOLA 2PGDA 1MMDA 1ZW0A 1ZW2A 1SVFA 2QSIA 3MHVA 1GW4A 1PPJD 5DJUB 3NFQA 1H88A 2BE5F 1G8XA 1V54C 2PFDA 1V74B 4JEAA 1F1MA 2G8YA 3K5BA 4AQRD 2R7RA 2W4BA 2XL6A 1M1JB 5A6AA 1Q7YQ 2H88C 4H13D 1OXKA 3RL0D 4E18A 2VCAA 4WABA 1KILC 1BGYG 1S9KD 2YL3A 1Y47A 1OW7A 2DW3A 4I7ZC 1WOLA 4KNWA 2R7QA 3HTKB 3U9JA 1S9KE 3RVZA 2O9XA 2V3CC 2H43A 3T97A 4FWVA 2VC9A 1CSBA 4RJTA 2GM4A 3V7OA 1E79H 4EDFA 3A0BH 1D1CA 3B71A 2NSFA 3L72G 2O01N 4B6IA 1Q90D 3HNKA 1NFNA 3AG1C 2BCCG 3LIDA 2FBWC 2OG2A 2KOGA 1GU5A 2YXRB 1SQVG 3L70D 5AW4B 4D6TG 1NGMB 3H1LG 3ECSA 4NPDA 2AEMA 4JIOA 1M8OB 4CS9A 2W27A 3ZC4A 3S28A 1AVOB 1FBMA 1HY5A 2Q9BA 5L0IA 5KLVD 3U8PA 1L4AD 2NPSA 2E76C 3RBXA 4IAOA 3EFGA 4DT0A 1TWGA 1YIJP 4LDKA 5DLJA 1DX7A 3FOPA 4ZMDA 2WT7B 2BCCE 4D6TD 1T6QA 2ICWG 4ZLCA 4H54A 1VPCA 3S9OA 5COFA 1VQOP 3DD7A 2V7QH 1BE3D 1Z56A 1Z6AA 3L36A 4OD4A 1G2CA 2LFFA 3K1IC 2HKVA 3HE4B 2LIGA 2HR3A 3EGDB 3L72J 2KP8A 2OYHA 4RBNA 2LK4A 5CHXA 3ABMC 3Q2YA 1BCCD 4DRJB 3JRMO 1SR2A 3EJNA 3X1OA 1AVOA 1IZNB 2BEQD 1EXIA 1M2VB 1TFOB 4TT3H 2GDCA 2QM7A 3MFNA 4IL6E 2NPSB 4JKVA 2O01J 1HBWA 1Y8AA 2KZJA 2AXTH 1FZFA 1IZMA 1DD3A 4PJNA 2Y3GA 5AVTB 2QM8A 3AE7C 4G7OF 1T6AA 1M56D 2FYUJ 1HF9A 3V4QA 1WMKA 2N1TB 1NYHA 3K1IA 2H8PD 4TLFA 1NTKE 1W5CE 3L73G 5AC5A 1SQPK 1DH3A 1T8ZA 3BRJA 1LTIC 5AVRB 1TFKB 1SQVK 1ZR2A 3TK1A 3UR3C 1SS1A 4L73A 2HODB 1G2CB 2GUSA 4UB8H 2AWYA 3I4UA 3ZWIA 2K1AA 2QJKC 3AG2C 2AXCA 3P8CE 4M63A 4IWBA 3L73D 1MV8A 3SXMA 3T4RA 3RK2D 1JY3O 4EOTA 4RKUJ 2JDIH 2C9NY 2K9JB 1GM5A 1T01A 4WY4A 3SWFA 3RBZA 1HMOA 5CJ4A 1YVIA 1CGOA 1TWCA 2A68F 1KILD 4CS9C 1CI6A 4HE8D 1J2JB 3ASNC 4I44A 3W67A 4DVYP 3U1AA 2LSEA 4EI2A 2G3KA 4OIPF 4K3AA 3MBGA 1LI7A 2OTLP 2JP3A 3TJ6A 3JYHA 3PHF2 3O6XA 3OJAB 2XDJA 2QLAA 1XZPA 2FAPB 1UFBA 2YKQA 1MNDA 5CCHD 4LLEA 1G5ZA 1CGNA 4OINF 2HODA 4UB8E 1U7MA 3KMIA 2QVAA 4CPGA 3L70J 1TR2A 3L74E 3N24A 2WSEH 2FYUE 4U3FE 3VM6A 5AGFA 2Y3BA 1ZOYC 2UUHA 1MNEA 3L74D 3HD7C 4HH2A 2ZYGA 3C8VA 4GOEA 1OCRC 2Y9ZA 1HE9A 2R32A 1LT1A 1SFCD 3USSA 1URQB 2ZVOB 4PJ0H 2DB4A 3FXDA 2R9RB 1ZHWA 3HRNA 1MZ9A 3EWKA 2WSFJ 2JPUA 3N7NA 1A7VA 5KAFH 3ABKC 2ZT9B 2KS1A 2KS1B 1K73Q 3TGUE 4O6MA 1NKNA 2D4UA 3LEVA 1VQ6P 4RO0A 3FAPB 3S27A 4I2LC 2IYOA 2IYPA 2LP4A 5K0IA 1QKRA 3CCSP 3M9QA 2WITA 2YKZA 1VQKP 4GOFA 3CXHE 1D0ZA 1OFCX 3Q6MA 4X0RA 4AK9A 3L72D 2DI3A 1VLTA 1SQPE 1XZQA 2PNOA 2VASA 5JUAA 1ZRTD 1DEBA 1L0LG 2NPUA 3CXHD 1PD1A 4Z1MH 1U6HA 1N7SC 3Q1MA 2EPLX 5KYUB 4IARA 1C17M 5KJ7C 2OYIB 3C8GB 1GZLA 2HLOA 1SLQA 4BG0A 3L4FA 2O1JA 3C62A 2NG1A 4YK5A 1VYKA 3E7KA 2LCHA 2D2CC 1H9TA 3JC22 4U5FE 2WVRA 2P7JA 2M64A 1CPQA 3C1LA 3G71P 1HE1A 1JCDA 5AVXB 1ORJA 2AEFA 3QH9A 3H1HD 4I6MC 2YZSA 3Q3DA 1M2OA 4L6RA 2E75C 1LE4A 5KYNA 1LTBC 3U59A 2VB6A 1R4TA 5A6BA 5GTIE 4DJ9A 1YBKA 3CCVP 4OIRF 4XPYA 1VLSA 1WASA 4K0DA 4L74A 4BJTA 3D6YA 1E5WA 3RK3B 2H7HA 1WN0A 4NPFX 4JEBA 3BCCE 2N9YB 4B86A 4D4XA 3M9HA 3H1ID 4WWIA 3RK2C 4D4NA 1EA8A 1JTHB 4ZKPA 1PD0A 3CX5H 5DQTA 1VB5A 2POHA 3AE1C 2WB7A 5KYYB 2OCCC 5KYWA 3EFOB 4C46A 2BCCJ 1NTZE 3IR9A 3H1IG 3POVA 4Z9HA 1P84D 1URQD 3H1IJ 1G1JA 1LTSC 3V5XA 3WUTA 1R5ID 3CSKA 1P84E 3L74J 3DE9A 4IL6H 1JPJA 2Q5UA 1Z3IX 1LP1A 1SQQK 1LP1B 4WVZA 2IBFA 3L71J 3X2QC 1KB9I 4CS8A 5BQGA 4ASWA 4CIHA 2QA4P 4CDYA 2K9JA 3CEXA 1EQ1A 1ZVZA 1XTCC 1HUCA 1BGYE 3CI9A 4W8PA 1JOCA 4MW8A 1ZLLA 4Q4ZF 4ASVA 1GW3A 3AG3C 4YT2A 5AVUB 1LWUC 2A06D 1EI7A 4I3MA 4W7YA 2EILC 1QVFO 2IXMA 1IFJA 2ZYAA 3H1KD 2A06E 1LTGC 4EIJA 1T2KD 1PCXA 3EH2A 4E0HA 3E1IA 1ZHTA 2YHSA 2B87B 3QVYA 2R7SA 1GMJA 5GTHH 3TNUB 1H7IA 1FZEA 2W6JH 3JCUH 3PRJA 1NTZG 2GFHA 1LS4A 5B1BC 1L0NK 4OH8B 1RKEB 2WL8A 3H1LJ 3K33A 2KLVA 4BJ5A 5CBNA 1NU9C 1RE4C 3ZQYA 4HB1A 2J46A 1USDA 1KORA 1YHQP 2JKVA 2JR8A 1N73B 2HV6A 2YVKA 5EHHA 1S5LH 1LNQA 1SQQG 4DRHB 3C8ZA 2Q7RA 5T1DB 1CPRA 1GDTA 1Q0GA 1JMMA 2P61A 1VQMP 2E74B 1PGJA 1S4XA 3KH2A 2J5UA 2WZGA 1ORYA 3HNLA 4BJ1A 3KZIH 3HNJA 2JD3A 1K9MQ 3GF3A 3FX0A 4CJOA 4K1OA 4EKWA 4C3DA 3JT1A 1PP9E 3VF0A 1SQPJ 2P0NA 5COGA 2WSFH 3DJNB 3H1JD 4JC7A 4JYBA 2W90A 2EPMX 3H6PA 1FMVA 3KKBA 1S1CX 2ETSA 2M8RA 1FR0A 4CS7A 4LGDE 4MTGA 1AQTA 4OGQB 3HUSC 1A7EA 2YNYA 3GEEA 3W8IA 1SF8A 1AUEA 4I1LA 2WSEJ 4H0LD 3J06A 1OKKD 1FC2C 1RQUA 1TQGA 1JM0A 2E75D 4K35A 4XEVA 2Z5HA 2Y0EA 3L71G 3FGAD 2L5GB 1SQBE 4U5EE 4FESA 1X8YA 2KW3C 4O79A 2NUTA 3IN6A 3O6QA 2WZFA 1JNMA 3Q7LA 2XM4A 1GL2D 2EIKC 2A6HF 3OA7A 2HUJA 5JS5A 1J8YF 3Q5SA 1QLED 4XLPF 5EFWB 4OIQF 4H44B 2NUPA 3L71D 3L37A 3EGXB 1M2VA 5T3WA 3W2WA 1SFCA 2Z5IA 3HTKC 1WT6A 2VCCA 4LLCA 4PJLA 2FYNB 1LWUB 1FOSF 1KQLA 4JTDB 4QMAA 1J1DB 5APQA 2Y69C 5KLVJ 1VQ4P 4OGQC 2RSEB 2XU6A 1JMWA 3QTHA 2B9BA 3ZTZA 1KD1Q 2A69F 5L0DA 3OEOA 3CLQA 1ZP0C 3W4YA 3ITFA 1S05A 2PFXA 1FNTc 2A06G 2WSCJ 4G0HA 5APYA 4CX9A 1PL5A 2C04A 2J7PA 1P84I 1GQAA 3PH0A 3GG2A 2QE9A 3UNGC 1RF1C 4BRYA 5KLVE 4YL0A 3B0UX 1U89A 4H44C 5E79H 4XWJA 1OVUA 1UIXA 2E76B 2AEJA 4AE4A 2ZXOA 3K7DA 2FYZA 5A6BD 1NH4A 2P6VA 4L76A 5GPGB 3VMAA 2HZ8A 4R32A 3GANA 1M1KQ 1LPEA 2JWAA 1OCOC 2M5AB 2HJMA 4YJWA 1D1AA 3ABVC 3L75E 4HYTB 2N1TA 4BXLA 1GU4A 5T3TA 3GWNA 3TYYA 3SXZA 3G9RA 1J1EB 3H25A 2ZJSE 3U8VA 5EGYA 1BR1A 5TISE 2LR2A 2G62A 3DZAA 3KL4A 3M15A 4U5DE 2E76D 1KFMA 3WMM0 3IPMO 2EPOA 2KC3A 3AQBA 2YL1A 1XWJA 3ITKA 3RF3A 4PV1B 2KSEA 2J0XA 3C8GD 1Z7Qc 2CNWA 3H1KG 4OWFA 5AVVB 1OMIA 4GIFA 4ULWA 4BJ6C 2P7VA 3MUDC 4GQHA 1NU1K 1PIXA 4CDVA 1RE3C 1OXZA 3TGUG 1SQXK 3EGDA 4N6JA 3CWBJ 1RCPA 3S90A 3F5HA 1LT9C 5L8RJ 1NU1J 2IFMA 4JE9A 4EBKA 2NRGA 2XRHA 1A02F 1OR3A 1NTMJ 2AP3A 1OIPA 4DCKA 4WGYA 2P67A 3PTZA 3MLGA 3L70G 2UWJE 3GHGC 2OEXA 5AVYB 5JVEA 5DS5A 3AE4C 2QJPC 1ZU4A 3RL0B 2R7WA 2A1DD 4H0LC 1IJDB 3C7JA 2IXPA 4JCHA 2OYOA 3LNMB 3L75G 1WRGA 2QJKB 1WTYA 1V55C 4HKZH 1YDIA 4CBEA 2XSEA 3ZSUA 1BE3E 5KYXB 1RKEA 2YLGA 2Q9IA 3HE5B 5L3QA 1I5NA 1ST6A 3US6A 5AC4A 2C03A 1JAFA 3VMXA 1O5HA 2MKVA 5A69A 4PV1C 4IB4A 2RKLA 2A45H 2I1KA 4Y99C 2Y3DA 1GK6A 1SQQJ 2OQQA 4IRUA 2OU6A 2NPSD 1L4AA 4N78D 5BQIA 1YYJA 2XM0A 1L0LK 4YPCA 3H2VA 2Q9CA 3B5NA 1C02A 1CZQA 3CAXA 3DE8A 1SQQD 1RHZB 3M4BA 2R7TA 5E3CA 2KNHA 1JY2P 1Q2NA 4YN0B 1OWAA 2JO1A 2ZVNB 1EZVD 5B1AC 2HV7A 3TNUA 3ZTMA 2ZXWC 1IFDA 2FKWB 1VK5A 5FZTA 2FYUD 1AVYA 3T97B 2KYVA 2XXAB 3CCRP 4KNVA 3VMYA 2K37A 1M6TA 2Q3TA 4P9FA 2L9JA 2R3CA 1X22A 5E33A 3VRCA 1P84H 2GA1A 3ZG1A 4J7TA 1L0NJ 1EDJA 4JVSA 3L73E 4Y99B 2KUBA 4EBBA 2IPPA 3ZVRA 3NMJA 4MVZA 1RJ9A 1NHLA 1SP4A 5DS6A 3IEEA 2Y3HA 1VF5D 2CK3H 2H7VC 1LJ2A 1Q0KA 1Q81Q 3G4XA 3SWYA 1QQ3A 5HV9A 3CCJP 3LW5J 3FAJA 1VQPP 1BSNA 1X0TA 2OTKE 3EGXA 2M3BA 5CCGA 3PLNA 2A45G 2DGJA 1URQA 2H7BA 3QMKA 3O39A 2SPZA 1FDIA 4GT1A 3V2PA 4DBQA 1LT9B 3H1HJ 1HMDA 1KU2A 2DYRC 3NXSA 1KNYA 1IFIA 2I8DA 3EQ2A 5E2QA 1RF0C 2BEZF 2Q3IA 2J8WA 3G4SP 1SQXD 3NKEA 3FXHA 1KQSO 3ZQVA 2JWDA 2OYIC 4RDAA 1JTHA 3OW2O 3CMEP 1HVVA 2FFDB 2UUIA 2FFDA 1BR2A 3I5QA 3WUUA 3OAKA 2XV5A 3C9IA 1MFTA 5D92A 4O6NA 5AVWB 3SNHA 4C7NA 1QX8A 1FZAA 1ZU5A 3P8MC 5JSLA 3OA1A 1W2BO 1D0YA 1QL2A 1YA9A 2Q3EA 1L3PA 3NKDA 5EK0A 2Q7CA 3RK3E 2A0BA 4U5HA 1HGZA 3PJSK 1S3JA 5DVWA 3O8ZA 2E43A 1YARO 3JTLO 2R05A 3RK3D 1E86A 1JY2N 5BU8B 3IQ5A 1JO5A 2XS1A 4C7RA 1M1JA 1RMVA 1PPJG 2HFIA 3M06A 2ZYDA 3R4YA 3A7OA 4GDOA 2D5RB 2KI7B 3F89A 3RK3C 3VP9A 1E2XA 5FCLA 3H1IE 1D7MA 4C7OA 3RFYA 1E83A 3D6ZA 2PP4A 1J1DC 4IFDK 3RH3A 3GM2A 3L72E 5APWA 4EUKB 3TK0A 1FZCA 3M0DA 2Y39A 1GK4A 1KB9E 5TJHA 2XLWA 4D6TJ 3DJUB 5A6KA 2WPQA 2GA0A 4N3YB 3JZ0A 3CX5E 4JF7A 2FXPA 2KK7A 3CPWO 3AGUA 4MVRA 5F5HA 4JJGA 3H1JG 1N8RQ 2B87A 1A02J 3MZWB 1H89A 2KNCA 1L0LD 1JY3N 3UIAA 4H13B 1A0BA 3VTPC 1FZCC 2ZD9A 1VDFA 3CCEP 1OKKA 2FFHA 4E7SA 4JCZA 2V26A 2JX0A 1EXJA 4JTAB 1Q86Q 1YQ3C 1GL2A 1LKXA 1N73A 1Z63A 1T6UA 2AWCA 1AFOA 3T6BA 1KYOE 1M1JC 1VQ5P 3V6IA 2WPRA 1BSHA 1SQVD 4IJJA 1GTWA 3NG1A 2IX7C 2XZRA 2YQYA 2P58A 4ZNCA 1C03A 1SQVE 4ZKUA 3JYYA 2OEVA 1YJ9P 2B88A 1FDMA 2KQ9A 1OXBA 2QJPB 1XTGB 5APSA 2PBEA 3D70A 1AA0A 2XLMA 2A45I 1NTME 3AQCA 2WPVB 2QTVA 2O1KA 4N4WA 3CCLP 5AW1B 3AE3C 3QW0A 1LS1A 1NTMD 2YRFA 3EZHA 1M7LA 2E87A 5AVZB 2CYDA 4YT5A 3VN0A 3LW5H 2H89C 3AEGC 4U5BE 3ZDLA 2FXMA 2OGUA 2R5BA 3JCUE 5BUOA 4DBRA 4CIPA 3WU2H 1S72P 3B8EB 1NTKK 2YO3A 1H0TA 2CPSA 3BEHA 3BVHA 1N7LA 3AEEC 1SQXJ 2L7AA 3U0CA 2HG5D 3L70E 5CCGC 1NTKJ 4K7BA 2G3VA 3VP8A 5KAFE 2ZFCA 3FVYA 2IYLD 1EZVI 3AGTA 3RKOF 1NU1D 4I1MA 2QG4A 3NMDA 2C0WA 3UMIA 1CGME 3IQTA 1X79B 3RL0C 4LC1A 4H4KC 3SXKA 4KT0J 4AL0A 2YXQB 4DOZA 4U3FG 2KSJA 1WWPA 4U5CE 2EIMC 2PAJA 3VAYA 4WBAA 1JY3P 1KYOI 4QDLA 4EIYA 3H1KE 2KYHA 3RL0g 4DRIB 3GEIA 1KQFB 2IBZE 3SWKA 3CQZA 4IL6X 256BA 4CSAC 1UIIA 3E70C 1HGVA 3U5SA 1U57A 2J0WA 1RXQA 4NTAA 3C63A 1BCCG 4YXWH 1L0LJ 2WVQA 3H1LD 2QRXA 1ORSC 1VMAA 1BCCE 1YLMA 3DAFA 1LM3B 3R7CA 1L0ND 1AV1A 2XLVA 2FYUK 2HSBA 4NTFA 1E85A 1M57D 2OOCA 4A7PA 1L4AC 5M1BA 1SQVJ 3GLMA 3SFDC 1GS9A 1BR4A 1K05A 1FU1A 3V2QA 5CCHA 4O6YA 1W2EA 3GWLA 2W9YA 1J8MF 1VQLP 1Y6DA 3I55P 2IOQA 3DKAA 1VF5B 1Z23A 3CC2P 3LEOA 4G78A 3A0BE 1D0XA 1ZW3A 1IFMA 2L91A 1FOSE 3ATPA 3RW0A 4E7ZA 3M0DC 3LESA 5KJ7D 3RGUA 2LD6A 1ZR4A 2GUVA 3UGOA 4Z9JA 5AW9B 4IOIH 3N0TA 3WU2E 2JEEA 2OJED 3FMSA 3T6GB 2LQGA 2K9YA 1K40A 5COMA 3EHNA 1KMIZ 3Q7GA 3U3BA 4Q5SF 2QUPA 2M0BA 4JZAA 3IQ6A 1AJYA 2IXOA 3K6BA 3MYIA 2ZT9D 1LI5A 4IFMA 1YJGA 1T5OA 2R5DA 2B0HA 1RE3A 2YMKA 3LS0A 3S1KA 2P2UA 2WMMA 2X0CA 3P32A 1H9GA 1OCCC 1H0TB 3IQCA 3TD7A 1EQ7A 3W68A 1LTJA 3HUSB 2I8BA 2JJLA 1VF5C 3HE5A 3AEAC 3IFMA 2AVKA 2J9WA 1EZVG 1QGKB 3W2VA 1L2PA 3T9OA 4HEAJ 5CMZA 3G6EP 2QJYB 1DOVA 1V4AA 3A0HH 1YI2P 3MYFA 1LIHA 5GTHE 1HH0A 3KDPB 3HD7B 5CCGD 5CBOA 5KTBA 4OGQD 1NAYA 1HTLC 3U2LA 3BATA 1FJPA 1URQC 1FAPB 2ITAA 3AE8C 2ZPAA 3HJCA 2I15A 2I1JA 3MP7B 1B68A 3L8IA 4MVUA 2W6AA 1L7CA 3M79A 4BEJA 2LXBA 3IF4A 4EWCA 1Y4CA 1VL2A 2K3RA 2E5TA 5TJ5E 3GHGB 2YKOA 1LTJB 3GODA 3NYLA 2E74D 1MQVA 1IO4A 2MYSA 2IZ1A 1NJIQ 4YL1A 4YWQA 5AW6B 5AW5B 3H1KJ 4A2NB 1BGYJ 5APXA 2CDQA 2XXAA 2VCBA 2M5AA 2CW0F 1QZXA 2YL0A 4W8KA 3V5BA 3CWBG 3JRTA 3H65A 1A41A 3V5YA 2Y0CA 2P1AA 1NVOA 2RMZA 3P7KA 3CC4P 2ZXEB 1SFCC 2QEXP 1ZZPA 3B0VC 4W80A 3V2NA 1VQ8P 1AQ5A 4XEFA 4C3BA 1FZGA 3B5NC 3PMRA 1FDOA 4JURI 2E75B 1ZHZA 5A6JA 1EZVE 2OJQA 3AE5C 2EPNA 4N6CA 3LS1A 1SQBK 1KB9H 2DYSC 1NTMK 1N86A 1CI6B 3SZRA 3CL3D 1MMNA 3L74G 3QVZA 2YL7A 3OWTA 2IXNA 2PX0A 3A9CA 1SZIA 3UMKA 2ZXXA 2Z15A 2HFED 2XS8A 4AX2A 4DJGA 1X9VA 1YTZI 4Q7CA 2W6BA 1KILE 4UB6E 2A6EF 4DXWA 2IDBA 4I1OB 1JUNA 1EC5A 4YL3A 5L0CA 2AXTE 2KB7P 1R8EA 3HNIA 2OKUA 1SQPG 2MWQA 4LACB 3H1HG 1DEEG 3DXJF 4MVSA 4IGGA 2VRSA 5CJ0A 4PV1D 1KC8Q 5KAIH 2CCYA 1R5SA 3I5PA 1RKCA 4JRZA 2WWWA 2VH3A 3O6QB 3Q6NA 4BEMJ 4BJ6A 1SQQE 3EG9A 2FXOA 2J9BA 1BBHA 1QLEC 4IAQA 4H0LB 1N7SD 4PD4D 2XL8A 1EKYA 3CZ6A 2IZ0A 5APTA 4EBJA 3AEBC 1BDDA 2Q9AA 1BE3J 1S2EA 1KTMA 5KYXA 1LTJC 1ZMEC 1TKNA 3AE2C 1G4WR 2HMZA 3Q5PA 1FE6A 3CD6P 4PFOA 4NPEA 3H32B 3H32A 4J7YA 4E0IA 3FWNA 4EYYQ 1J1EC 1T3JA 3JSVC 1NU1G 3CX5I 1BCCJ 2X51A 4MTOA 1KV4A 3JCUQ 5TISH 3I5CA 5L0GA 3E9VA 2QE7H 3EFFK 4R4MA 4IFFA 1O87A 2XNXA 3SYNA 4DZOA 5L0FA 1A7DA 3A0HE 1JR8A 2KSFA 3CXHI 4W7ZA 1AEPA 3B9QA 1QVXA 3II6A 1ZRTE 3TQOA 3MGNA 3L75J 3RVYA 2R02A 3K1HA 2NUPB 4NCQA 4H44D 2AU5A 4C7NB 1BE3G 1HWTC 3V2RA 1IK7A 1OCZC 5CCHC 2WZ7A 2R7UA 3AG4C 3TF5A 1SQXE 1LGHB 1PP9D 1H8AA 3F47A 1KFNA 3A3YB 3RQEA 2LKMA 3L8JA 2KIKA 1NLXA 1WATA 5JLIA 1BZ4A 2YKPA 2PP6A 2Q1KA 2PF4E 1YTZT 4PACA 1IK9A 2R03A 2Y0DA 4H13C 5KKZB 4OVNF 1FZCB 3FHDA 1PPJE 2IBZG 1SQXG 1Y9BA 3BCCJ 3HTKA 3V5ZA 3BCCG 1FS0E 3GORA 2M3EA 1U0BB 1IFPA 1OQCA 5KLIB 2NUTB 1KYOD 3ABLC 2ZAEB 2J45A 1HW2A 3CWBE 2E5YA 5AW0B 1SQBD 3PCVA 3CXHH 4O7GA 3IAOA 3BCCD 3L0IA 1U7JA 4CJGA 3CWBD 1MFZA 4CSAA 2KZIA 2WVNA 3GM3A 2GWWA 4XQ1A 1GGQA 3KHUA 3L71E 3KPHA 3LAYA 3U3FA 3VYIA 1NU7D 1S5LX 2OARA 2FFDC 3ZIBA 2BC5A 1CW5A 1NTZD 4G7ZF 2OYIA 3LUTB 5KYYA 3ZDMA 1KB9D 1H6GA 1JB0J 4BPMA 3NYMA 4FAPB 2IM8A 1RF0A 4MN4C 1SMYF 1IW7F 2YEVA 4DOJA 2QIWA 1TWHA 4RESB 5KJ7A 2WPSA 1OVVA 3A11A 3O55A 1N7SA 4ZLDA 4U9DA 1IC2A 5L0JA 1T3UA 1K8AQ 5L0HA 5CI8A 2XLHA 3S29A 2WZLA 2CGEA 3NYJA 1KN7A 4MVMA 3LJBA 5GTIH 5B3SC 1BGYD 4GEHA 5IY5C 4LERA 1I4YA 1TWAA 4AE4B 1TU3F 2W8ZA 4C3EA 5F5FA 2Z4EA 2FY8A 4PD4H 1Q0MA 3AJMA 1PV3A 3WUVA 3AEDC 2WVOA 3DAGA 3AE9C 4DVZA 4BJ5C 1EDIA 2WSSH 3L35A 3NTNA 3B0PA 1FTSA 4Z9IA 1DIPA 1VQ7P 5KAIE 3KYIA 1YITP 2NSGA 2EIJC 2IBZD 3WG7C 2P1JA 3N4XA 1NFOA 2R7VA 2HPCA 2HPCB 3IHUA 1Q0DA 1Q0FA 1UG7A 4BWNA 4NTBA 3HLZA 1N73C 3GF7A 1GL2C 3BRTB 2Y9YA 3H1LE 1VQNP 3LLKA 1GD2E 1NAFA 1OW6A 2YMYA 3S0XA 3PDMP 1S7ZA 2WTYA 1S5LE 2E74C 4MS2A 1EDKA 2ASRA 4P9TA 1IFNA 1YJWP 1NG1A 3EQLF 1NO4A 1PZQA 2KJGA 5JRAA 1NSGB 2L81A 3DWWA 2IBZI 2XLEA 3AEFC 3TULA 3H1JE 4YXDC 2E42A 1SQBJ 1OR2A 2R7XA 1NTKD 1NU1E 4R4LA 2OYHB 4WY4C 1LTTC 4NY3A 4JTCB 2W4MA 4N06A 4PFPA 2K88A 2RD9A 5AVQB 1FFTC 1NWQA 2KGOA 2BCCD 4D6TE 5C39A 4NQFA 3F46A 4WY4D 1T2KC 2KNCB 2BL2A 1OX3A 1Q82Q 1M56C 3B5ND 4G7HF 2B89A 3KPEA 1GL2B 4KJMA 4U9EA 1PGOA 5APUA 3M0AA 3LNRA 2XLOA 3Q5RA 2RH0A 5AW2B 5BU5A 3M9BA 1HJ0A 1NZEA 3RQFA 3QW1A 4A4AA 3QZCA 3GW6A 1NTZJ 5D91A 3M91A 2GAQA 1T9KA 2XNDH 4ER9A 5AW3B 1L0NE 1NTZK 3NRHA 4GYTA 5B3IA 4XA4A 1YAUO 3GM1A 2Q6QA 2V7QJ 4WY4B 4YT4A 3RK2B 4XFJA 3M4CA 3ASOC 1OVRA 5APVA 1QPUA 2FYUG 4MTFA 1FMWA 2CPBA 4FX5A 1SYQA 2YLIA 3CCQP 5CI9A 3SXYA 1M57C 1ZXGA 3NDBB 2QJYC 1YYCA 1LE2A 4HFKB 2N1TD 3LIEA 2KK1A 3H2UA 3P8CD 5HSWA 1FFHA 2J9UA 2OQMA 3PHLA 4OD5A 4XE5B 1D1BA 2CNWD 1M90Q 1R5LA 2EINC 4J30B 3TGUD 3SFEC 1ZYRF 5KLIC 2L6GA 3U9MA 2Q00A 5L3VA 3R2PA 3EPVA 2HSQA 5B5EE 3AOUA 3KZIE 2W45A 3HD7D 1Z5ZA 4AUWA 3B29A 3BASA 3E1RA 2N9BA 1SQPD 3L75D 1YJNP 3U2MA 1VOMA 2J7PD 3DM9B 2J58A 2ZXRA 2KLUA 3EZIA 3HD7A 4WB4A 3S84A 1EDLA 1HJBA 2NZ2A 4XPXA 4MW3A 2WQYC 1JOGA 1FJKA 5AVSB 3JSEO 3VMZA 3TDKA 3FOOA 5KKZC 2L6FA 4YT8A 1JCCA 1PFIA 1FZBA 1NTKG 4U3FD 3WAQA 5KYWB 3MX3A 4LLHA 5AW7B 4E17A 1VTMP 4JJFA 5BVZA 5CIVA 1QL1A 3T6JA 2XL4A 3A5TA 4EHPA 4BRYB 1KQGB 5H2FE 4HFFB 3VYWA 1JEKA 3G3ZA 1KILA 4U3FJ 3MTUE 3NMIA 1YQ4C 2O3JA 4F4BA 3KYQA 3G50A 3UMHA 1OW8A 2V4HA 4J32B 4MVQA 2YWAA 2HS5A 3LLIA 4MVOA 1RJ9B 4U7JA 3DI5A 3S4RA 3HUSA 1L4AB 5H2FH 4XLNF 4KI2A 1RH5B 2XKMA 1JRAA 3HKKA 1JMBA 4U5GA 3JSZA 1N7SB 3GHGA 3DMDA 4LDRA 5AW8B 1N2DC 5E3AA 5DJTB 4Y28J 1MUUA 2HYNA 3FXEA 3CMAP 4ONSA 4QI0A 2H8AA 1KYOH 2Q4FA 2MJZA 1LT9A 4N78E 3GEHA 2P10A 5KLVG 3D71A 3CX5D 2D2CB 1YA7O 2L6HA 2WT7A 5JT4A 1FAVA 3U1CA 3N2ZB 2LFDA 3FWLA 4PK4A 3MUDA 2LXCB 2BASA 3QWOC 2IFNA 4XTKA 2F22A 5BQHA 2A0UA 4ULVA 3H1HE 4UB6H 4XPWA 2TMVP 3FDQA 1VYIA 3KYJA 3WHNA 1RE4A 5B5EH 1QVGO 5B66E 3RYLA 1SQBG 4WGZA 4LDQA 4UDVA 2C9LY 1ZHYA 3A2AA 4PD4I 2MHRA 5JP7A 1MMGA 2B0JA 3KXDA 1JY2O 2FYNC 5KYUA 4N6HA 3PP5A 3RQGA 2OYHC 2N1TC 2QNLA 4PJJA 4JYCA 1DOWA 5E79E 3CC7P 3SP1A 1T6IA 2O01H 3L73J 1KZUB 1MMAA 2XLDA 3V4WA 2ZXPA 1N1CA 4OIOF 3VOPA 2W83C 5F28E 4JPZB 1APCA 2C0XA 1LWUA 4YTPC 1PP9G 3KQGA 1NOHA 3MD0A 1RF1B 4M3LA 1RF1A 3EH1A 3K66A 1RY3A 3B5NB 3L34A 4PR9A 4CS8C 2NPSC 4JW1A 3TSIA 1NBBA 5B66H 4PJ0E 2J9VA 4JBZA 4AYCA
chains in the Genus database with same CATH topology
4I7ZB 4IL6X 4XFJA 4PV1B 4U7JA 1DIPA 3C8GD 1DD3A 3IN6A 3O6QA 3RQEA 1OMIA 4H13B 1VF5D 1O3UA 3L8JA 1V4AA 3Q5SA 1PIXA 1U57A 3AE7C 1OW7A 4I7ZC 1HF9A 1WOLA 4H44B 1WMKA 2JX0A 1NYHA 1KILE 3LW5J 1EXJA 4H13C 4OGQD 4XEKA 2QJYC 1YQ3C 5L8RJ 4EBKA 2IDBA 2KK1A 3BRJA 1Y9BA 4Z1MH 4Y28J 3C8GA 3AE8C 3GF7A 1R8EA 3Q1MA 1FDIA 2QJKC 2P10A 3B71A 3L8IA 3D71A 1OW6A 2HSBA 2D2CB 1KNYA 3AE4C 2QJPC 2L6HA 3C8GB 4PV1D 1Q90D 2BEZF 4H0LC 2E74C 3C18A 3JYYA 4OGQC 4RKUJ 1GMJA 5M1BA 3IAOA 3SFEC 1VL2A 2FBWC 5KLIC 2L6GA 1RQVA 3GLMA 1WTYA 3SFDC 3O10A 2D2CC 2PBEA 2Q00A 1ZP0C 1K05A 4H0LB 2E74D 1NGMB 3D70A 3TULA 3AEFC 3GM3A 2WSCJ 4YXDC 4EBJA 3AEBC 3U3FA 2WPVB 2ZT9C 1DD4A 3AE6C 2D2CD 1S5LX 2MKVA 1PL5A 4PV1C 1KORA 1KTMA 3AE3C 4R4LA 1VF5B 1ZMEC 3AE2C 3Q3DA 3Q5PA 2E76C 2OQQA 2E75C 2H89C 3AEGC 1K04A 2FYNC 2JP3A 1JB0J 1MKMA 3RQGA 4NQFA 4H44C 3RK3E 2NZ2A 2E74B 2WQYC 1UIXA 3FGAD 2E76B 2QIWA 1JOGA 2J5UA 3D6YA 2G3AA 1UFBA 3K7DA 3AEEC 3GF3A 3S9OA 5KKZC 2L6FA 3AECC 3U0CA 2K9YA 1ZZPA 1K40A 1KMIZ 4R32A 5F28E 2YIUC 3R4YA 4R4MA 1AJYA 4GDOA 4YTPC 2JO1A 4XEFA 3AE1C 3Q5RA 2ZT9D 3GMAA 3D6ZA 1FDOA 1S1CX 3ABVC 1ZOYC 1HJ0A 2YMKA 2E75B 3RQFA 1KQGB 3GM2A 2QSIA 4KT0J 3T97B 1QVXA 3AE5C 1ZRTE 1WWPA 2LK4A 3C8VA 4OGQB 3G9RA 3Q2YA 1TU3F 3H25A 3AJMA 1YQ4C 1PV3A 2G8YA 2WSEJ 4H0LD 4H44D 1RQUA 2E76D 1OW8A 3AEDC 2E75D 3EWKA 2WSFJ 3AE9C 2BEQD 3RL0g 1EXIA 2JPUA 3GM1A 2H88C 2V7QJ 4H13D 3JZ0A 1IK7A 4TT3H 1VF5C 2FXPA 1KQFB 2YWAA 3AEAC 3MFNA 4XEVA 2ZT9B 2O01J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8G D;  3RQE A;  1O3U A;  3L8J A;  1V4A A;  3AE7 C;  1OW7 A;  1WOL A;  2JX0 A;  4XEK A;  1YQ3 C;  4EBK A;  2KK1 A;  3BRJ A;  3C8G A;  3AE8 C;  3B71 A;  3L8I A;  1OW6 A;  2HSB A;  1KNY A;  3AE4 C;  3C8G B;  2L6H A;  3C18 A;  3JYY A;  3SFE C;  2FBW C;  2L6G A;  1WTY A;  3SFD C;  3O10 A;  2PBE A;  2Q00 A;  1ZP0 C;  1K05 A;  3TUL A;  3AEF C;  3GM3 A;  4YXD C;  4EBJ A;  3AEB C;  3U3F A;  3AE6 C;  1KTM A;  3AE3 C;  3AE2 C;  2H89 C;  3AEG C;  1K04 A;  3RQG A;  4NQF A;  2WQY C;  1JOG A;  2G3A A;  1UFB A;  3K7D A;  3AEE C;  3S9O A;  2L6F A;  3AEC C;  3U0C A;  1ZZP A;  1K40 A;  5F28 E;  4R32 A;  4YTP C;  4XEF A;  3AE1 C;  3ABV C;  1ZOY C;  3RQF A;  3GM2 A;  1QVX A;  3AE5 C;  2LK4 A;  1WWP A;  3AJM A;  1YQ4 C;  1PV3 A;  1OW8 A;  3AED C;  2JPU A;  3AE9 C;  3GM1 A;  2H88 C;  3JZ0 A;  4XEV A;  3MFN A;  2YWA A;  3AEA C; 
#chains in the Genus database with same CATH topology
 2H7O A;  1QEX A;  4I7Z B;  1WGW A;  1ZHX A;  4NC3 A;  3H1J J;  3M1C B;  3SSU A;  1YZA A;  2KXP B;  1E84 A;  1G1I A;  1PGP A;  2OTJ P;  1O3U A;  4MND A;  4KHX A;  3HE4 A;  3RIP A;  4PD4 E;  1USE A;  4GKG A;  3I56 P;  3EFO A;  1BDJ B;  4XEK A;  3SEO A;  5DQZ A;  4CDA A;  3W8H A;  4KC9 A;  4P6I C;  1JPN A;  2HJ3 A;  4L75 A;  3C8G A;  1W2W A;  2WSC H;  2R44 A;  4C7O B;  3B4S A;  5DS4 A;  2YIU B;  4MQ9 F;  1I4Z A;  2R3S A;  3C18 A;  4JQ0 D;  2M4E A;  4QI2 A;  2YO2 A;  1RQV A;  3O10 A;  5K5G B;  3TJ5 A;  1OZH A;  4WJ0 A;  1SFC B;  2PX3 A;  1YZC A;  1ZN5 A;  3L1M A;  1YYX A;  3EG9 B;  3NMK A;  4ANJ A;  2EPK X;  2ZT9 C;  2RN0 A;  1HW1 A;  1DD4 A;  1L0N G;  3AE6 C;  2D2C D;  4HJG H;  4KBL A;  1G4U S;  3WOD F;  2J59 M;  3TOM A;  1NKZ B;  1LVK A;  1PGQ A;  2FGY A;  2PRR A;  1K04 A;  1VQ9 P;  1KIL B;  1MKM A;  4AL1 A;  5KLV K;  2QY9 A;  4PJM A;  1LTA C;  3UGP A;  3TGU J;  2R25 A;  2G3A A;  1BDC A;  3CCU P;  3AEC C;  4GOD A;  1QSP A;  3BRV B;  1L0L E;  2YLD A;  4RD9 A;  2YIU C;  1ZV8 A;  3G4Z A;  1NTM G;  4O9B A;  1PP9 J;  2HMQ A;  3CCM P;  3MIW A;  2R7O A;  3GMA A;  3DM5 A;  3EHM A;  3TOL A;  2PGD A;  1MMD A;  1ZW0 A;  1ZW2 A;  1SVF A;  2QSI A;  3MHV A;  1GW4 A;  1PPJ D;  5DJU B;  3NFQ A;  1H88 A;  2BE5 F;  1G8X A;  1V54 C;  2PFD A;  1V74 B;  4JEA A;  1F1M A;  2G8Y A;  3K5B A;  4AQR D;  2R7R A;  2W4B A;  2XL6 A;  1M1J B;  5A6A A;  1Q7Y Q;  2H88 C;  4H13 D;  1OXK A;  3RL0 D;  4E18 A;  2VCA A;  4WAB A;  1KIL C;  1BGY G;  1S9K D;  2YL3 A;  1Y47 A;  1OW7 A;  2DW3 A;  4I7Z C;  1WOL A;  4KNW A;  2R7Q A;  3HTK B;  3U9J A;  1S9K E;  3RVZ A;  2O9X A;  2V3C C;  2H43 A;  3T97 A;  4FWV A;  2VC9 A;  1CSB A;  4RJT A;  2GM4 A;  3V7O A;  1E79 H;  4EDF A;  3A0B H;  1D1C A;  3B71 A;  2NSF A;  3L72 G;  2O01 N;  4B6I A;  1Q90 D;  3HNK A;  1NFN A;  3AG1 C;  2BCC G;  3LID A;  2FBW C;  2OG2 A;  2KOG A;  1GU5 A;  2YXR B;  1SQV G;  3L70 D;  5AW4 B;  4D6T G;  1NGM B;  3H1L G;  3ECS A;  4NPD A;  2AEM A;  4JIO A;  1M8O B;  4CS9 A;  2W27 A;  3ZC4 A;  3S28 A;  1AVO B;  1FBM A;  1HY5 A;  2Q9B A;  5L0I A;  5KLV D;  3U8P A;  1L4A D;  2NPS A;  2E76 C;  3RBX A;  4IAO A;  3EFG A;  4DT0 A;  1TWG A;  1YIJ P;  4LDK A;  5DLJ A;  1DX7 A;  3FOP A;  4ZMD A;  2WT7 B;  2BCC E;  4D6T D;  1T6Q A;  2ICW G;  4ZLC A;  4H54 A;  1VPC A;  3S9O A;  5COF A;  1VQO P;  3DD7 A;  2V7Q H;  1BE3 D;  1Z56 A;  1Z6A A;  3L36 A;  4OD4 A;  1G2C A;  2LFF A;  3K1I C;  2HKV A;  3HE4 B;  2LIG A;  2HR3 A;  3EGD B;  3L72 J;  2KP8 A;  2OYH A;  4RBN A;  2LK4 A;  5CHX A;  3ABM C;  3Q2Y A;  1BCC D;  4DRJ B;  3JRM O;  1SR2 A;  3EJN A;  3X1O A;  1AVO A;  1IZN B;  2BEQ D;  1EXI A;  1M2V B;  1TFO B;  4TT3 H;  2GDC A;  2QM7 A;  3MFN A;  4IL6 E;  2NPS B;  4JKV A;  2O01 J;  1HBW A;  1Y8A A;  2KZJ A;  2AXT H;  1FZF A;  1IZM A;  1DD3 A;  4PJN A;  2Y3G A;  5AVT B;  2QM8 A;  3AE7 C;  4G7O F;  1T6A A;  1M56 D;  2FYU J;  1HF9 A;  3V4Q A;  1WMK A;  2N1T B;  1NYH A;  3K1I A;  2H8P D;  4TLF A;  1NTK E;  1W5C E;  3L73 G;  5AC5 A;  1SQP K;  1DH3 A;  1T8Z A;  3BRJ A;  1LTI C;  5AVR B;  1TFK B;  1SQV K;  1ZR2 A;  3TK1 A;  3UR3 C;  1SS1 A;  4L73 A;  2HOD B;  1G2C B;  2GUS A;  4UB8 H;  2AWY A;  3I4U A;  3ZWI A;  2K1A A;  2QJK C;  3AG2 C;  2AXC A;  3P8C E;  4M63 A;  4IWB A;  3L73 D;  1MV8 A;  3SXM A;  3T4R A;  3RK2 D;  1JY3 O;  4EOT A;  4RKU J;  2JDI H;  2C9N Y;  2K9J B;  1GM5 A;  1T01 A;  4WY4 A;  3SWF A;  3RBZ A;  1HMO A;  5CJ4 A;  1YVI A;  1CGO A;  1TWC A;  2A68 F;  1KIL D;  4CS9 C;  1CI6 A;  4HE8 D;  1J2J B;  3ASN C;  4I44 A;  3W67 A;  4DVY P;  3U1A A;  2LSE A;  4EI2 A;  2G3K A;  4OIP F;  4K3A A;  3MBG A;  1LI7 A;  2OTL P;  2JP3 A;  3TJ6 A;  3JYH A;  3PHF 2;  3O6X A;  3OJA B;  2XDJ A;  2QLA A;  1XZP A;  2FAP B;  1UFB A;  2YKQ A;  1MND A;  5CCH D;  4LLE A;  1G5Z A;  1CGN A;  4OIN F;  2HOD A;  4UB8 E;  1U7M A;  3KMI A;  2QVA A;  4CPG A;  3L70 J;  1TR2 A;  3L74 E;  3N24 A;  2WSE H;  2FYU E;  4U3F E;  3VM6 A;  5AGF A;  2Y3B A;  1ZOY C;  2UUH A;  1MNE A;  3L74 D;  3HD7 C;  4HH2 A;  2ZYG A;  3C8V A;  4GOE A;  1OCR C;  2Y9Z A;  1HE9 A;  2R32 A;  1LT1 A;  1SFC D;  3USS A;  1URQ B;  2ZVO B;  4PJ0 H;  2DB4 A;  3FXD A;  2R9R B;  1ZHW A;  3HRN A;  1MZ9 A;  3EWK A;  2WSF J;  2JPU A;  3N7N A;  1A7V A;  5KAF H;  3ABK C;  2ZT9 B;  2KS1 A;  2KS1 B;  1K73 Q;  3TGU E;  4O6M A;  1NKN A;  2D4U A;  3LEV A;  1VQ6 P;  4RO0 A;  3FAP B;  3S27 A;  4I2L C;  2IYO A;  2IYP A;  2LP4 A;  5K0I A;  1QKR A;  3CCS P;  3M9Q A;  2WIT A;  2YKZ A;  1VQK P;  4GOF A;  3CXH E;  1D0Z A;  1OFC X;  3Q6M A;  4X0R A;  4AK9 A;  3L72 D;  2DI3 A;  1VLT A;  1SQP E;  1XZQ A;  2PNO A;  2VAS A;  5JUA A;  1ZRT D;  1DEB A;  1L0L G;  2NPU A;  3CXH D;  1PD1 A;  4Z1M H;  1U6H A;  1N7S C;  3Q1M A;  2EPL X;  5KYU B;  4IAR A;  1C17 M;  5KJ7 C;  2OYI B;  3C8G B;  1GZL A;  2HLO A;  1SLQ A;  4BG0 A;  3L4F A;  2O1J A;  3C62 A;  2NG1 A;  4YK5 A;  1VYK A;  3E7K A;  2LCH A;  2D2C C;  1H9T A;  3JC2 2;  4U5F E;  2WVR A;  2P7J A;  2M64 A;  1CPQ A;  3C1L A;  3G71 P;  1HE1 A;  1JCD A;  5AVX B;  1ORJ A;  2AEF A;  3QH9 A;  3H1H D;  4I6M C;  2YZS A;  3Q3D A;  1M2O A;  4L6R A;  2E75 C;  1LE4 A;  5KYN A;  1LTB C;  3U59 A;  2VB6 A;  1R4T A;  5A6B A;  5GTI E;  4DJ9 A;  1YBK A;  3CCV P;  4OIR F;  4XPY A;  1VLS A;  1WAS A;  4K0D A;  4L74 A;  4BJT A;  3D6Y A;  1E5W A;  3RK3 B;  2H7H A;  1WN0 A;  4NPF X;  4JEB A;  3BCC E;  2N9Y B;  4B86 A;  4D4X A;  3M9H A;  3H1I D;  4WWI A;  3RK2 C;  4D4N A;  1EA8 A;  1JTH B;  4ZKP A;  1PD0 A;  3CX5 H;  5DQT A;  1VB5 A;  2POH A;  3AE1 C;  2WB7 A;  5KYY B;  2OCC C;  5KYW A;  3EFO B;  4C46 A;  2BCC J;  1NTZ E;  3IR9 A;  3H1I G;  3POV A;  4Z9H A;  1P84 D;  1URQ D;  3H1I J;  1G1J A;  1LTS C;  3V5X A;  3WUT A;  1R5I D;  3CSK A;  1P84 E;  3L74 J;  3DE9 A;  4IL6 H;  1JPJ A;  2Q5U A;  1Z3I X;  1LP1 A;  1SQQ K;  1LP1 B;  4WVZ A;  2IBF A;  3L71 J;  3X2Q C;  1KB9 I;  4CS8 A;  5BQG A;  4ASW A;  4CIH A;  2QA4 P;  4CDY A;  2K9J A;  3CEX A;  1EQ1 A;  1ZVZ A;  1XTC C;  1HUC A;  1BGY E;  3CI9 A;  4W8P A;  1JOC A;  4MW8 A;  1ZLL A;  4Q4Z F;  4ASV A;  1GW3 A;  3AG3 C;  4YT2 A;  5AVU B;  1LWU C;  2A06 D;  1EI7 A;  4I3M A;  4W7Y A;  2EIL C;  1QVF O;  2IXM A;  1IFJ A;  2ZYA A;  3H1K D;  2A06 E;  1LTG C;  4EIJ A;  1T2K D;  1PCX A;  3EH2 A;  4E0H A;  3E1I A;  1ZHT A;  2YHS A;  2B87 B;  3QVY A;  2R7S A;  1GMJ A;  5GTH H;  3TNU B;  1H7I A;  1FZE A;  2W6J H;  3JCU H;  3PRJ A;  1NTZ G;  2GFH A;  1LS4 A;  5B1B C;  1L0N K;  4OH8 B;  1RKE B;  2WL8 A;  3H1L J;  3K33 A;  2KLV A;  4BJ5 A;  5CBN A;  1NU9 C;  1RE4 C;  3ZQY A;  4HB1 A;  2J46 A;  1USD A;  1KOR A;  1YHQ P;  2JKV A;  2JR8 A;  1N73 B;  2HV6 A;  2YVK A;  5EHH A;  1S5L H;  1LNQ A;  1SQQ G;  4DRH B;  3C8Z A;  2Q7R A;  5T1D B;  1CPR A;  1GDT A;  1Q0G A;  1JMM A;  2P61 A;  1VQM P;  2E74 B;  1PGJ A;  1S4X A;  3KH2 A;  2J5U A;  2WZG A;  1ORY A;  3HNL A;  4BJ1 A;  3KZI H;  3HNJ A;  2JD3 A;  1K9M Q;  3GF3 A;  3FX0 A;  4CJO A;  4K1O A;  4EKW A;  4C3D A;  3JT1 A;  1PP9 E;  3VF0 A;  1SQP J;  2P0N A;  5COG A;  2WSF H;  3DJN B;  3H1J D;  4JC7 A;  4JYB A;  2W90 A;  2EPM X;  3H6P A;  1FMV A;  3KKB A;  1S1C X;  2ETS A;  2M8R A;  1FR0 A;  4CS7 A;  4LGD E;  4MTG A;  1AQT A;  4OGQ B;  3HUS C;  1A7E A;  2YNY A;  3GEE A;  3W8I A;  1SF8 A;  1AUE A;  4I1L A;  2WSE J;  4H0L D;  3J06 A;  1OKK D;  1FC2 C;  1RQU A;  1TQG A;  1JM0 A;  2E75 D;  4K35 A;  4XEV A;  2Z5H A;  2Y0E A;  3L71 G;  3FGA D;  2L5G B;  1SQB E;  4U5E E;  4FES A;  1X8Y A;  2KW3 C;  4O79 A;  2NUT A;  3IN6 A;  3O6Q A;  2WZF A;  1JNM A;  3Q7L A;  2XM4 A;  1GL2 D;  2EIK C;  2A6H F;  3OA7 A;  2HUJ A;  5JS5 A;  1J8Y F;  3Q5S A;  1QLE D;  4XLP F;  5EFW B;  4OIQ F;  4H44 B;  2NUP A;  3L71 D;  3L37 A;  3EGX B;  1M2V A;  5T3W A;  3W2W A;  1SFC A;  2Z5I A;  3HTK C;  1WT6 A;  2VCC A;  4LLC A;  4PJL A;  2FYN B;  1LWU B;  1FOS F;  1KQL A;  4JTD B;  4QMA A;  1J1D B;  5APQ A;  2Y69 C;  5KLV J;  1VQ4 P;  4OGQ C;  2RSE B;  2XU6 A;  1JMW A;  3QTH A;  2B9B A;  3ZTZ A;  1KD1 Q;  2A69 F;  5L0D A;  3OEO A;  3CLQ A;  1ZP0 C;  3W4Y A;  3ITF A;  1S05 A;  2PFX A;  1FNT c;  2A06 G;  2WSC J;  4G0H A;  5APY A;  4CX9 A;  1PL5 A;  2C04 A;  2J7P A;  1P84 I;  1GQA A;  3PH0 A;  3GG2 A;  2QE9 A;  3UNG C;  1RF1 C;  4BRY A;  5KLV E;  4YL0 A;  3B0U X;  1U89 A;  4H44 C;  5E79 H;  4XWJ A;  1OVU A;  1UIX A;  2E76 B;  2AEJ A;  4AE4 A;  2ZXO A;  3K7D A;  2FYZ A;  5A6B D;  1NH4 A;  2P6V A;  4L76 A;  5GPG B;  3VMA A;  2HZ8 A;  4R32 A;  3GAN A;  1M1K Q;  1LPE A;  2JWA A;  1OCO C;  2M5A B;  2HJM A;  4YJW A;  1D1A A;  3ABV C;  3L75 E;  4HYT B;  2N1T A;  4BXL A;  1GU4 A;  5T3T A;  3GWN A;  3TYY A;  3SXZ A;  3G9R A;  1J1E B;  3H25 A;  2ZJS E;  3U8V A;  5EGY A;  1BR1 A;  5TIS E;  2LR2 A;  2G62 A;  3DZA A;  3KL4 A;  3M15 A;  4U5D E;  2E76 D;  1KFM A;  3WMM 0;  3IPM O;  2EPO A;  2KC3 A;  3AQB A;  2YL1 A;  1XWJ A;  3ITK A;  3RF3 A;  4PV1 B;  2KSE A;  2J0X A;  3C8G D;  1Z7Q c;  2CNW A;  3H1K G;  4OWF A;  5AVV B;  1OMI A;  4GIF A;  4ULW A;  4BJ6 C;  2P7V A;  3MUD C;  4GQH A;  1NU1 K;  1PIX A;  4CDV A;  1RE3 C;  1OXZ A;  3TGU G;  1SQX K;  3EGD A;  4N6J A;  3CWB J;  1RCP A;  3S90 A;  3F5H A;  1LT9 C;  5L8R J;  1NU1 J;  2IFM A;  4JE9 A;  4EBK A;  2NRG A;  2XRH A;  1A02 F;  1OR3 A;  1NTM J;  2AP3 A;  1OIP A;  4DCK A;  4WGY A;  2P67 A;  3PTZ A;  3MLG A;  3L70 G;  2UWJ E;  3GHG C;  2OEX A;  5AVY B;  5JVE A;  5DS5 A;  3AE4 C;  2QJP C;  1ZU4 A;  3RL0 B;  2R7W A;  2A1D D;  4H0L C;  1IJD B;  3C7J A;  2IXP A;  4JCH A;  2OYO A;  3LNM B;  3L75 G;  1WRG A;  2QJK B;  1WTY A;  1V55 C;  4HKZ H;  1YDI A;  4CBE A;  2XSE A;  3ZSU A;  1BE3 E;  5KYX B;  1RKE A;  2YLG A;  2Q9I A;  3HE5 B;  5L3Q A;  1I5N A;  1ST6 A;  3US6 A;  5AC4 A;  2C03 A;  1JAF A;  3VMX A;  1O5H A;  2MKV A;  5A69 A;  4PV1 C;  4IB4 A;  2RKL A;  2A45 H;  2I1K A;  4Y99 C;  2Y3D A;  1GK6 A;  1SQQ J;  2OQQ A;  4IRU A;  2OU6 A;  2NPS D;  1L4A A;  4N78 D;  5BQI A;  1YYJ A;  2XM0 A;  1L0L K;  4YPC A;  3H2V A;  2Q9C A;  3B5N A;  1C02 A;  1CZQ A;  3CAX A;  3DE8 A;  1SQQ D;  1RHZ B;  3M4B A;  2R7T A;  5E3C A;  2KNH A;  1JY2 P;  1Q2N A;  4YN0 B;  1OWA A;  2JO1 A;  2ZVN B;  1EZV D;  5B1A C;  2HV7 A;  3TNU A;  3ZTM A;  2ZXW C;  1IFD A;  2FKW B;  1VK5 A;  5FZT A;  2FYU D;  1AVY A;  3T97 B;  2KYV A;  2XXA B;  3CCR P;  4KNV A;  3VMY A;  2K37 A;  1M6T A;  2Q3T A;  4P9F A;  2L9J A;  2R3C A;  1X22 A;  5E33 A;  3VRC A;  1P84 H;  2GA1 A;  3ZG1 A;  4J7T A;  1L0N J;  1EDJ A;  4JVS A;  3L73 E;  4Y99 B;  2KUB A;  4EBB A;  2IPP A;  3ZVR A;  3NMJ A;  4MVZ A;  1RJ9 A;  1NHL A;  1SP4 A;  5DS6 A;  3IEE A;  2Y3H A;  1VF5 D;  2CK3 H;  2H7V C;  1LJ2 A;  1Q0K A;  1Q81 Q;  3G4X A;  3SWY A;  1QQ3 A;  5HV9 A;  3CCJ P;  3LW5 J;  3FAJ A;  1VQP P;  1BSN A;  1X0T A;  2OTK E;  3EGX A;  2M3B A;  5CCG A;  3PLN A;  2A45 G;  2DGJ A;  1URQ A;  2H7B A;  3QMK A;  3O39 A;  2SPZ A;  1FDI A;  4GT1 A;  3V2P A;  4DBQ A;  1LT9 B;  3H1H J;  1HMD A;  1KU2 A;  2DYR C;  3NXS A;  1KNY A;  1IFI A;  2I8D A;  3EQ2 A;  5E2Q A;  1RF0 C;  2BEZ F;  2Q3I A;  2J8W A;  3G4S P;  1SQX D;  3NKE A;  3FXH A;  1KQS O;  3ZQV A;  2JWD A;  2OYI C;  4RDA A;  1JTH A;  3OW2 O;  3CME P;  1HVV A;  2FFD B;  2UUI A;  2FFD A;  1BR2 A;  3I5Q A;  3WUU A;  3OAK A;  2XV5 A;  3C9I A;  1MFT A;  5D92 A;  4O6N A;  5AVW B;  3SNH A;  4C7N A;  1QX8 A;  1FZA A;  1ZU5 A;  3P8M C;  5JSL A;  3OA1 A;  1W2B O;  1D0Y A;  1QL2 A;  1YA9 A;  2Q3E A;  1L3P A;  3NKD A;  5EK0 A;  2Q7C A;  3RK3 E;  2A0B A;  4U5H A;  1HGZ A;  3PJS K;  1S3J A;  5DVW A;  3O8Z A;  2E43 A;  1YAR O;  3JTL O;  2R05 A;  3RK3 D;  1E86 A;  1JY2 N;  5BU8 B;  3IQ5 A;  1JO5 A;  2XS1 A;  4C7R A;  1M1J A;  1RMV A;  1PPJ G;  2HFI A;  3M06 A;  2ZYD A;  3R4Y A;  3A7O A;  4GDO A;  2D5R B;  2KI7 B;  3F89 A;  3RK3 C;  3VP9 A;  1E2X A;  5FCL A;  3H1I E;  1D7M A;  4C7O A;  3RFY A;  1E83 A;  3D6Z A;  2PP4 A;  1J1D C;  4IFD K;  3RH3 A;  3GM2 A;  3L72 E;  5APW A;  4EUK B;  3TK0 A;  1FZC A;  3M0D A;  2Y39 A;  1GK4 A;  1KB9 E;  5TJH A;  2XLW A;  4D6T J;  3DJU B;  5A6K A;  2WPQ A;  2GA0 A;  4N3Y B;  3JZ0 A;  3CX5 E;  4JF7 A;  2FXP A;  2KK7 A;  3CPW O;  3AGU A;  4MVR A;  5F5H A;  4JJG A;  3H1J G;  1N8R Q;  2B87 A;  1A02 J;  3MZW B;  1H89 A;  2KNC A;  1L0L D;  1JY3 N;  3UIA A;  4H13 B;  1A0B A;  3VTP C;  1FZC C;  2ZD9 A;  1VDF A;  3CCE P;  1OKK A;  2FFH A;  4E7S A;  4JCZ A;  2V26 A;  2JX0 A;  1EXJ A;  4JTA B;  1Q86 Q;  1YQ3 C;  1GL2 A;  1LKX A;  1N73 A;  1Z63 A;  1T6U A;  2AWC A;  1AFO A;  3T6B A;  1KYO E;  1M1J C;  1VQ5 P;  3V6I A;  2WPR A;  1BSH A;  1SQV D;  4IJJ A;  1GTW A;  3NG1 A;  2IX7 C;  2XZR A;  2YQY A;  2P58 A;  4ZNC A;  1C03 A;  1SQV E;  4ZKU A;  3JYY A;  2OEV A;  1YJ9 P;  2B88 A;  1FDM A;  2KQ9 A;  1OXB A;  2QJP B;  1XTG B;  5APS A;  2PBE A;  3D70 A;  1AA0 A;  2XLM A;  2A45 I;  1NTM E;  3AQC A;  2WPV B;  2QTV A;  2O1K A;  4N4W A;  3CCL P;  5AW1 B;  3AE3 C;  3QW0 A;  1LS1 A;  1NTM D;  2YRF A;  3EZH A;  1M7L A;  2E87 A;  5AVZ B;  2CYD A;  4YT5 A;  3VN0 A;  3LW5 H;  2H89 C;  3AEG C;  4U5B E;  3ZDL A;  2FXM A;  2OGU A;  2R5B A;  3JCU E;  5BUO A;  4DBR A;  4CIP A;  3WU2 H;  1S72 P;  3B8E B;  1NTK K;  2YO3 A;  1H0T A;  2CPS A;  3BEH A;  3BVH A;  1N7L A;  3AEE C;  1SQX J;  2L7A A;  3U0C A;  2HG5 D;  3L70 E;  5CCG C;  1NTK J;  4K7B A;  2G3V A;  3VP8 A;  5KAF E;  2ZFC A;  3FVY A;  2IYL D;  1EZV I;  3AGT A;  3RKO F;  1NU1 D;  4I1M A;  2QG4 A;  3NMD A;  2C0W A;  3UMI A;  1CGM E;  3IQT A;  1X79 B;  3RL0 C;  4LC1 A;  4H4K C;  3SXK A;  4KT0 J;  4AL0 A;  2YXQ B;  4DOZ A;  4U3F G;  2KSJ A;  1WWP A;  4U5C E;  2EIM C;  2PAJ A;  3VAY A;  4WBA A;  1JY3 P;  1KYO I;  4QDL A;  4EIY A;  3H1K E;  2KYH A;  3RL0 g;  4DRI B;  3GEI A;  1KQF B;  2IBZ E;  3SWK A;  3CQZ A;  4IL6 X;  256B A;  4CSA C;  1UII A;  3E70 C;  1HGV A;  3U5S A;  1U57 A;  2J0W A;  1RXQ A;  4NTA A;  3C63 A;  1BCC G;  4YXW H;  1L0L J;  2WVQ A;  3H1L D;  2QRX A;  1ORS C;  1VMA A;  1BCC E;  1YLM A;  3DAF A;  1LM3 B;  3R7C A;  1L0N D;  1AV1 A;  2XLV A;  2FYU K;  2HSB A;  4NTF A;  1E85 A;  1M57 D;  2OOC A;  4A7P A;  1L4A C;  5M1B A;  1SQV J;  3GLM A;  3SFD C;  1GS9 A;  1BR4 A;  1K05 A;  1FU1 A;  3V2Q A;  5CCH A;  4O6Y A;  1W2E A;  3GWL A;  2W9Y A;  1J8M F;  1VQL P;  1Y6D A;  3I55 P;  2IOQ A;  3DKA A;  1VF5 B;  1Z23 A;  3CC2 P;  3LEO A;  4G78 A;  3A0B E;  1D0X A;  1ZW3 A;  1IFM A;  2L91 A;  1FOS E;  3ATP A;  3RW0 A;  4E7Z A;  3M0D C;  3LES A;  5KJ7 D;  3RGU A;  2LD6 A;  1ZR4 A;  2GUV A;  3UGO A;  4Z9J A;  5AW9 B;  4IOI H;  3N0T A;  3WU2 E;  2JEE A;  2OJE D;  3FMS A;  3T6G B;  2LQG A;  2K9Y A;  1K40 A;  5COM A;  3EHN A;  1KMI Z;  3Q7G A;  3U3B A;  4Q5S F;  2QUP A;  2M0B A;  4JZA A;  3IQ6 A;  1AJY A;  2IXO A;  3K6B A;  3MYI A;  2ZT9 D;  1LI5 A;  4IFM A;  1YJG A;  1T5O A;  2R5D A;  2B0H A;  1RE3 A;  2YMK A;  3LS0 A;  3S1K A;  2P2U A;  2WMM A;  2X0C A;  3P32 A;  1H9G A;  1OCC C;  1H0T B;  3IQC A;  3TD7 A;  1EQ7 A;  3W68 A;  1LTJ A;  3HUS B;  2I8B A;  2JJL A;  1VF5 C;  3HE5 A;  3AEA C;  3IFM A;  2AVK A;  2J9W A;  1EZV G;  1QGK B;  3W2V A;  1L2P A;  3T9O A;  4HEA J;  5CMZ A;  3G6E P;  2QJY B;  1DOV A;  1V4A A;  3A0H H;  1YI2 P;  3MYF A;  1LIH A;  5GTH E;  1HH0 A;  3KDP B;  3HD7 B;  5CCG D;  5CBO A;  5KTB A;  4OGQ D;  1NAY A;  1HTL C;  3U2L A;  3BAT A;  1FJP A;  1URQ C;  1FAP B;  2ITA A;  3AE8 C;  2ZPA A;  3HJC A;  2I15 A;  2I1J A;  3MP7 B;  1B68 A;  3L8I A;  4MVU A;  2W6A A;  1L7C A;  3M79 A;  4BEJ A;  2LXB A;  3IF4 A;  4EWC A;  1Y4C A;  1VL2 A;  2K3R A;  2E5T A;  5TJ5 E;  3GHG B;  2YKO A;  1LTJ B;  3GOD A;  3NYL A;  2E74 D;  1MQV A;  1IO4 A;  2MYS A;  2IZ1 A;  1NJI Q;  4YL1 A;  4YWQ A;  5AW6 B;  5AW5 B;  3H1K J;  4A2N B;  1BGY J;  5APX A;  2CDQ A;  2XXA A;  2VCB A;  2M5A A;  2CW0 F;  1QZX A;  2YL0 A;  4W8K A;  3V5B A;  3CWB G;  3JRT A;  3H65 A;  1A41 A;  3V5Y A;  2Y0C A;  2P1A A;  1NVO A;  2RMZ A;  3P7K A;  3CC4 P;  2ZXE B;  1SFC C;  2QEX P;  1ZZP A;  3B0V C;  4W80 A;  3V2N A;  1VQ8 P;  1AQ5 A;  4XEF A;  4C3B A;  1FZG A;  3B5N C;  3PMR A;  1FDO A;  4JUR I;  2E75 B;  1ZHZ A;  5A6J A;  1EZV E;  2OJQ A;  3AE5 C;  2EPN A;  4N6C A;  3LS1 A;  1SQB K;  1KB9 H;  2DYS C;  1NTM K;  1N86 A;  1CI6 B;  3SZR A;  3CL3 D;  1MMN A;  3L74 G;  3QVZ A;  2YL7 A;  3OWT A;  2IXN A;  2PX0 A;  3A9C A;  1SZI A;  3UMK A;  2ZXX A;  2Z15 A;  2HFE D;  2XS8 A;  4AX2 A;  4DJG A;  1X9V A;  1YTZ I;  4Q7C A;  2W6B A;  1KIL E;  4UB6 E;  2A6E F;  4DXW A;  2IDB A;  4I1O B;  1JUN A;  1EC5 A;  4YL3 A;  5L0C A;  2AXT E;  2KB7 P;  1R8E A;  3HNI A;  2OKU A;  1SQP G;  2MWQ A;  4LAC B;  3H1H G;  1DEE G;  3DXJ F;  4MVS A;  4IGG A;  2VRS A;  5CJ0 A;  4PV1 D;  1KC8 Q;  5KAI H;  2CCY A;  1R5S A;  3I5P A;  1RKC A;  4JRZ A;  2WWW A;  2VH3 A;  3O6Q B;  3Q6N A;  4BEM J;  4BJ6 A;  1SQQ E;  3EG9 A;  2FXO A;  2J9B A;  1BBH A;  1QLE C;  4IAQ A;  4H0L B;  1N7S D;  4PD4 D;  2XL8 A;  1EKY A;  3CZ6 A;  2IZ0 A;  5APT A;  4EBJ A;  3AEB C;  1BDD A;  2Q9A A;  1BE3 J;  1S2E A;  1KTM A;  5KYX A;  1LTJ C;  1ZME C;  1TKN A;  3AE2 C;  1G4W R;  2HMZ A;  3Q5P A;  1FE6 A;  3CD6 P;  4PFO A;  4NPE A;  3H32 B;  3H32 A;  4J7Y A;  4E0I A;  3FWN A;  4EYY Q;  1J1E C;  1T3J A;  3JSV C;  1NU1 G;  3CX5 I;  1BCC J;  2X51 A;  4MTO A;  1KV4 A;  3JCU Q;  5TIS H;  3I5C A;  5L0G A;  3E9V A;  2QE7 H;  3EFF K;  4R4M A;  4IFF A;  1O87 A;  2XNX A;  3SYN A;  4DZO A;  5L0F A;  1A7D A;  3A0H E;  1JR8 A;  2KSF A;  3CXH I;  4W7Z A;  1AEP A;  3B9Q A;  1QVX A;  3II6 A;  1ZRT E;  3TQO A;  3MGN A;  3L75 J;  3RVY A;  2R02 A;  3K1H A;  2NUP B;  4NCQ A;  4H44 D;  2AU5 A;  4C7N B;  1BE3 G;  1HWT C;  3V2R A;  1IK7 A;  1OCZ C;  5CCH C;  2WZ7 A;  2R7U A;  3AG4 C;  3TF5 A;  1SQX E;  1LGH B;  1PP9 D;  1H8A A;  3F47 A;  1KFN A;  3A3Y B;  3RQE A;  2LKM A;  3L8J A;  2KIK A;  1NLX A;  1WAT A;  5JLI A;  1BZ4 A;  2YKP A;  2PP6 A;  2Q1K A;  2PF4 E;  1YTZ T;  4PAC A;  1IK9 A;  2R03 A;  2Y0D A;  4H13 C;  5KKZ B;  4OVN F;  1FZC B;  3FHD A;  1PPJ E;  2IBZ G;  1SQX G;  1Y9B A;  3BCC J;  3HTK A;  3V5Z A;  3BCC G;  1FS0 E;  3GOR A;  2M3E A;  1U0B B;  1IFP A;  1OQC A;  5KLI B;  2NUT B;  1KYO D;  3ABL C;  2ZAE B;  2J45 A;  1HW2 A;  3CWB E;  2E5Y A;  5AW0 B;  1SQB D;  3PCV A;  3CXH H;  4O7G A;  3IAO A;  3BCC D;  3L0I A;  1U7J A;  4CJG A;  3CWB D;  1MFZ A;  4CSA A;  2KZI A;  2WVN A;  3GM3 A;  2GWW A;  4XQ1 A;  1GGQ A;  3KHU A;  3L71 E;  3KPH A;  3LAY A;  3U3F A;  3VYI A;  1NU7 D;  1S5L X;  2OAR A;  2FFD C;  3ZIB A;  2BC5 A;  1CW5 A;  1NTZ D;  4G7Z F;  2OYI A;  3LUT B;  5KYY A;  3ZDM A;  1KB9 D;  1H6G A;  1JB0 J;  4BPM A;  3NYM A;  4FAP B;  2IM8 A;  1RF0 A;  4MN4 C;  1SMY F;  1IW7 F;  2YEV A;  4DOJ A;  2QIW A;  1TWH A;  4RES B;  5KJ7 A;  2WPS A;  1OVV A;  3A11 A;  3O55 A;  1N7S A;  4ZLD A;  4U9D A;  1IC2 A;  5L0J A;  1T3U A;  1K8A Q;  5L0H A;  5CI8 A;  2XLH A;  3S29 A;  2WZL A;  2CGE A;  3NYJ A;  1KN7 A;  4MVM A;  3LJB A;  5GTI H;  5B3S C;  1BGY D;  4GEH A;  5IY5 C;  4LER A;  1I4Y A;  1TWA A;  4AE4 B;  1TU3 F;  2W8Z A;  4C3E A;  5F5F A;  2Z4E A;  2FY8 A;  4PD4 H;  1Q0M A;  3AJM A;  1PV3 A;  3WUV A;  3AED C;  2WVO A;  3DAG A;  3AE9 C;  4DVZ A;  4BJ5 C;  1EDI A;  2WSS H;  3L35 A;  3NTN A;  3B0P A;  1FTS A;  4Z9I A;  1DIP A;  1VQ7 P;  5KAI E;  3KYI A;  1YIT P;  2NSG A;  2EIJ C;  2IBZ D;  3WG7 C;  2P1J A;  3N4X A;  1NFO A;  2R7V A;  2HPC A;  2HPC B;  3IHU A;  1Q0D A;  1Q0F A;  1UG7 A;  4BWN A;  4NTB A;  3HLZ A;  1N73 C;  3GF7 A;  1GL2 C;  3BRT B;  2Y9Y A;  3H1L E;  1VQN P;  3LLK A;  1GD2 E;  1NAF A;  1OW6 A;  2YMY A;  3S0X A;  3PDM P;  1S7Z A;  2WTY A;  1S5L E;  2E74 C;  4MS2 A;  1EDK A;  2ASR A;  4P9T A;  1IFN A;  1YJW P;  1NG1 A;  3EQL F;  1NO4 A;  1PZQ A;  2KJG A;  5JRA A;  1NSG B;  2L81 A;  3DWW A;  2IBZ I;  2XLE A;  3AEF C;  3TUL A;  3H1J E;  4YXD C;  2E42 A;  1SQB J;  1OR2 A;  2R7X A;  1NTK D;  1NU1 E;  4R4L A;  2OYH B;  4WY4 C;  1LTT C;  4NY3 A;  4JTC B;  2W4M A;  4N06 A;  4PFP A;  2K88 A;  2RD9 A;  5AVQ B;  1FFT C;  1NWQ A;  2KGO A;  2BCC D;  4D6T E;  5C39 A;  4NQF A;  3F46 A;  4WY4 D;  1T2K C;  2KNC B;  2BL2 A;  1OX3 A;  1Q82 Q;  1M56 C;  3B5N D;  4G7H F;  2B89 A;  3KPE A;  1GL2 B;  4KJM A;  4U9E A;  1PGO A;  5APU A;  3M0A A;  3LNR A;  2XLO A;  3Q5R A;  2RH0 A;  5AW2 B;  5BU5 A;  3M9B A;  1HJ0 A;  1NZE A;  3RQF A;  3QW1 A;  4A4A A;  3QZC A;  3GW6 A;  1NTZ J;  5D91 A;  3M91 A;  2GAQ A;  1T9K A;  2XND H;  4ER9 A;  5AW3 B;  1L0N E;  1NTZ K;  3NRH A;  4GYT A;  5B3I A;  4XA4 A;  1YAU O;  3GM1 A;  2Q6Q A;  2V7Q J;  4WY4 B;  4YT4 A;  3RK2 B;  4XFJ A;  3M4C A;  3ASO C;  1OVR A;  5APV A;  1QPU A;  2FYU G;  4MTF A;  1FMW A;  2CPB A;  4FX5 A;  1SYQ A;  2YLI A;  3CCQ P;  5CI9 A;  3SXY A;  1M57 C;  1ZXG A;  3NDB B;  2QJY C;  1YYC A;  1LE2 A;  4HFK B;  2N1T D;  3LIE A;  2KK1 A;  3H2U A;  3P8C D;  5HSW A;  1FFH A;  2J9U A;  2OQM A;  3PHL A;  4OD5 A;  4XE5 B;  1D1B A;  2CNW D;  1M90 Q;  1R5L A;  2EIN C;  4J30 B;  3TGU D;  3SFE C;  1ZYR F;  5KLI C;  2L6G A;  3U9M A;  2Q00 A;  5L3V A;  3R2P A;  3EPV A;  2HSQ A;  5B5E E;  3AOU A;  3KZI E;  2W45 A;  3HD7 D;  1Z5Z A;  4AUW A;  3B29 A;  3BAS A;  3E1R A;  2N9B A;  1SQP D;  3L75 D;  1YJN P;  3U2M A;  1VOM A;  2J7P D;  3DM9 B;  2J58 A;  2ZXR A;  2KLU A;  3EZI A;  3HD7 A;  4WB4 A;  3S84 A;  1EDL A;  1HJB A;  2NZ2 A;  4XPX A;  4MW3 A;  2WQY C;  1JOG A;  1FJK A;  5AVS B;  3JSE O;  3VMZ A;  3TDK A;  3FOO A;  5KKZ C;  2L6F A;  4YT8 A;  1JCC A;  1PFI A;  1FZB A;  1NTK G;  4U3F D;  3WAQ A;  5KYW B;  3MX3 A;  4LLH A;  5AW7 B;  4E17 A;  1VTM P;  4JJF A;  5BVZ A;  5CIV A;  1QL1 A;  3T6J A;  2XL4 A;  3A5T A;  4EHP A;  4BRY B;  1KQG B;  5H2F E;  4HFF B;  3VYW A;  1JEK A;  3G3Z A;  1KIL A;  4U3F J;  3MTU E;  3NMI A;  1YQ4 C;  2O3J A;  4F4B A;  3KYQ A;  3G50 A;  3UMH A;  1OW8 A;  2V4H A;  4J32 B;  4MVQ A;  2YWA A;  2HS5 A;  3LLI A;  4MVO A;  1RJ9 B;  4U7J A;  3DI5 A;  3S4R A;  3HUS A;  1L4A B;  5H2F H;  4XLN F;  4KI2 A;  1RH5 B;  2XKM A;  1JRA A;  3HKK A;  1JMB A;  4U5G A;  3JSZ A;  1N7S B;  3GHG A;  3DMD A;  4LDR A;  5AW8 B;  1N2D C;  5E3A A;  5DJT B;  4Y28 J;  1MUU A;  2HYN A;  3FXE A;  3CMA P;  4ONS A;  4QI0 A;  2H8A A;  1KYO H;  2Q4F A;  2MJZ A;  1LT9 A;  4N78 E;  3GEH A;  2P10 A;  5KLV G;  3D71 A;  3CX5 D;  2D2C B;  1YA7 O;  2L6H A;  2WT7 A;  5JT4 A;  1FAV A;  3U1C A;  3N2Z B;  2LFD A;  3FWL A;  4PK4 A;  3MUD A;  2LXC B;  2BAS A;  3QWO C;  2IFN A;  4XTK A;  2F22 A;  5BQH A;  2A0U A;  4ULV A;  3H1H E;  4UB6 H;  4XPW A;  2TMV P;  3FDQ A;  1VYI A;  3KYJ A;  3WHN A;  1RE4 A;  5B5E H;  1QVG O;  5B66 E;  3RYL A;  1SQB G;  4WGZ A;  4LDQ A;  4UDV A;  2C9L Y;  1ZHY A;  3A2A A;  4PD4 I;  2MHR A;  5JP7 A;  1MMG A;  2B0J A;  3KXD A;  1JY2 O;  2FYN C;  5KYU A;  4N6H A;  3PP5 A;  3RQG A;  2OYH C;  2N1T C;  2QNL A;  4PJJ A;  4JYC A;  1DOW A;  5E79 E;  3CC7 P;  3SP1 A;  1T6I A;  2O01 H;  3L73 J;  1KZU B;  1MMA A;  2XLD A;  3V4W A;  2ZXP A;  1N1C A;  4OIO F;  3VOP A;  2W83 C;  5F28 E;  4JPZ B;  1APC A;  2C0X A;  1LWU A;  4YTP C;  1PP9 G;  3KQG A;  1NOH A;  3MD0 A;  1RF1 B;  4M3L A;  1RF1 A;  3EH1 A;  3K66 A;  1RY3 A;  3B5N B;  3L34 A;  4PR9 A;  4CS8 C;  2NPS C;  4JW1 A;  3TSI A;  1NBB A;  5B66 H;  4PJ0 E;  2J9V A;  4JBZ A;  4AYC A; 
#chains in the Genus database with same CATH homology
 4I7Z B;  4IL6 X;  4XFJ A;  4PV1 B;  4U7J A;  1DIP A;  3C8G D;  1DD3 A;  3IN6 A;  3O6Q A;  3RQE A;  1OMI A;  4H13 B;  1VF5 D;  1O3U A;  3L8J A;  1V4A A;  3Q5S A;  1PIX A;  1U57 A;  3AE7 C;  1OW7 A;  4I7Z C;  1HF9 A;  1WOL A;  4H44 B;  1WMK A;  2JX0 A;  1NYH A;  1KIL E;  3LW5 J;  1EXJ A;  4H13 C;  4OGQ D;  4XEK A;  2QJY C;  1YQ3 C;  5L8R J;  4EBK A;  2IDB A;  2KK1 A;  3BRJ A;  1Y9B A;  4Z1M H;  4Y28 J;  3C8G A;  3AE8 C;  3GF7 A;  1R8E A;  3Q1M A;  1FDI A;  2QJK C;  2P10 A;  3B71 A;  3L8I A;  3D71 A;  1OW6 A;  2HSB A;  2D2C B;  1KNY A;  3AE4 C;  2QJP C;  2L6H A;  3C8G B;  4PV1 D;  1Q90 D;  2BEZ F;  4H0L C;  2E74 C;  3C18 A;  3JYY A;  4OGQ C;  4RKU J;  1GMJ A;  5M1B A;  3IAO A;  3SFE C;  1VL2 A;  2FBW C;  5KLI C;  2L6G A;  1RQV A;  3GLM A;  1WTY A;  3SFD C;  3O10 A;  2D2C C;  2PBE A;  2Q00 A;  1ZP0 C;  1K05 A;  4H0L B;  2E74 D;  1NGM B;  3D70 A;  3TUL A;  3AEF C;  3GM3 A;  2WSC J;  4YXD C;  4EBJ A;  3AEB C;  3U3F A;  2WPV B;  2ZT9 C;  1DD4 A;  3AE6 C;  2D2C D;  1S5L X;  2MKV A;  1PL5 A;  4PV1 C;  1KOR A;  1KTM A;  3AE3 C;  4R4L A;  1VF5 B;  1ZME C;  3AE2 C;  3Q3D A;  3Q5P A;  2E76 C;  2OQQ A;  2E75 C;  2H89 C;  3AEG C;  1K04 A;  2FYN C;  2JP3 A;  1JB0 J;  1MKM A;  3RQG A;  4NQF A;  4H44 C;  3RK3 E;  2NZ2 A;  2E74 B;  2WQY C;  1UIX A;  3FGA D;  2E76 B;  2QIW A;  1JOG A;  2J5U A;  3D6Y A;  2G3A A;  1UFB A;  3K7D A;  3AEE C;  3GF3 A;  3S9O A;  5KKZ C;  2L6F A;  3AEC C;  3U0C A;  2K9Y A;  1ZZP A;  1K40 A;  1KMI Z;  4R32 A;  5F28 E;  2YIU C;  3R4Y A;  4R4M A;  1AJY A;  4GDO A;  4YTP C;  2JO1 A;  4XEF A;  3AE1 C;  3Q5R A;  2ZT9 D;  3GMA A;  3D6Z A;  1FDO A;  1S1C X;  3ABV C;  1ZOY C;  1HJ0 A;  2YMK A;  2E75 B;  3RQF A;  1KQG B;  3GM2 A;  2QSI A;  4KT0 J;  3T97 B;  1QVX A;  3AE5 C;  1ZRT E;  1WWP A;  2LK4 A;  3C8V A;  4OGQ B;  3G9R A;  3Q2Y A;  1TU3 F;  3H25 A;  3AJM A;  1YQ4 C;  1PV3 A;  2G8Y A;  2WSE J;  4H0L D;  4H44 D;  1RQU A;  2E76 D;  1OW8 A;  3AED C;  2E75 D;  3EWK A;  2WSF J;  3AE9 C;  2BEQ D;  3RL0 g;  1EXI A;  2JPU A;  3GM1 A;  2H88 C;  2V7Q J;  4H13 D;  3JZ0 A;  1IK7 A;  4TT3 H;  1VF5 C;  2FXP A;  1KQF B;  2YWA A;  3AEA C;  3MFN A;  4XEV A;  2ZT9 B;  2O01 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...