1PV3A

Nmr solution structure of the avian fat-domain of focal adhesion kinase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
146
structure length
146
Chain Sequence
b'GSPGISGGGGGIRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title The Focal Adhesion Targeting Domain of Focal Adhesion Kinase Contains a Hinge Region that Modulates Tyrosine 926 Phosphorylation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 52
structure length 146
sequence length 146
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1pv3A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1pv3A02
4EBJA 1O3UA 3GM2A 1ZP0C 2JX0A 3C8GB 1QVXA 2H89C 3C8GA 1KNYA 2L6GA 3O10A 3AECC 3BRJA 1K05A 4NQFA 3C8GD 3AEBC 2G3AA 1PV3A 3GM1A 1OW6A 1WWPA 1OW8A 3U3FA 4R32A 1OW7A 3AE6C 3ABVC 1ZZPA 3AEEC 4YXDC 1ZOYC 2WQYC 4XEFA 2L6FA 3AE7C 3AE9C 2FBWC 2H88C 3JYYA 1JOGA 3TULA 1KTMA 2L6HA 3AEDC 3AJMA 3JZ0A 3AEGC 1V4AA 3RQFA 1WTYA 3AE1C 3SFEC 3L8IA 4EBKA 2Q00A 1YQ4C 3AEAC 2LK4A 1K04A 3MFNA 1YQ3C 2JPUA 4XEVA 3SFDC 3K7DA 4XEKA 3AEFC 3AE2C 3C18A 3L8JA 2YWAA 3AE8C 3RQEA 3AE3C 1K40A 1UFBA 3S9OA 4YTPC 3B71A 3U0CA 3GM3A 1WOLA 2PBEA 2HSBA 3RQGA 2KK1A 3AE4C 5F28E 3AE5C
chains in the Genus database with same CATH superfamily
5FZTA 1AVOA 3L73D 2EIKC 1Q90D 2FYNC 5K5GB 4E7SA 3X1OA 3GMAA 2HJ3A 4HJGH 3C8ZA 1QGKB 5KLVD 2H89C 3V5YA 3EZIA 1Z56A 5L0GA 2FYUE 3T6GB 2KQ9A 4PK4A 1HW1A 5H2FE 1V54C 5A6BA 3MX3A 3HJCA 2PF4E 3GODA 4JYBA 4QI2A 3VM6A 1FR0A 4NPFX 1I4ZA 1L0NJ 2Z5IA 3O6XA 1JM0A 1PV3A 2QG4A 1GL2B 1IK9A 1WMKA 4C3EA 1NU7D 1CZQA 2WMMA 3QH9A 1SQXJ 4M63A 1EDIA 4A7PA 4YXDC 3N24A 4TLFA 2E74C 3RIPA 1GL2D 1L0LD 1QKRA 4PJLA 3UMIA 1SP4A 2NZ2A 3FDQA 3CD6P 3H1HG 1JEKA 4Z9JA 3Q5PA 1HWTC 1IFNA 1KMIZ 1NKZB 1S9KD 1T6AA 4YJWA 1M1JA 1VK5A 1IFPA 3JRTA 1PGOA 2R7XA 2XM4A 3RFYA 1H9GA 1E79H 3JSZA 3VMYA 1V4AA 2WVOA 2N1TB 2WITA 3KZIE 4ZKPA 3GEEA 3ZQVA 3S0XA 3CL3D 2W8ZA 3M9QA 4EBBA 4D6TE 5KLIB 2Y0CA 2B89A 1N73C 1HF9A 4OD4A 1GW4A 3CCUP 1FU1A 1LTJC 1OCOC 3JC22 5E79H 3UGOA 4CS9C 3S29A 2N1TD 2V3CC 3SXMA 4GOEA 3H1LE 2G8YA 2IDBA 1YYXA 4PV1D 4LDQA 1URQB 3Q6NA 5DJTB 5KYXA 4DXWA 2RD9A 2J5UA 2IXNA 2WZFA 2W6BA 1T6UA 1H6GA 4H44B 1URQD 3NKEA 4KI2A 2O3JA 1V55C 1RKCA 3ASOC 2KC3A 4DVYP 2Y9ZA 2WPRA 3VP8A 3SEOA 2W90A 3A2AA 1SQQD 3O8ZA 4XFJA 4H44D 2KSJA 4GOFA 2LR2A 1YA9A 3ZG1A 2WZ7A 1GK4A 3OEOA 1FZCB 1ZLLA 1M6TA 1M57D 1RE4A 1P84H 2QIWA 5GTHE 3DM5A 1BE3G 1NKNA 1D1BA 1NFOA 3U8VA 4YT2A 1LTAC 1NBBA 1A02F 1T9KA 3GWLA 1BGYG 2G62A 5H2FH 2BEQD 3VP9A 3W8HA 5GTIE 4E0IA 2KYVA 4K7BA 4CBEA 4JRZA 3H2VA 3BRVB 2XL4A 2YO2A 1JO5A 1LGHB 1NU1D 1GL2A 1NH4A 2YKPA 3H1IJ 4CPGA 1OW8A 1K8AQ 2KXPB 3PMRA 3FWNA 1RQVA 3FAPB 2JO1A 4PJNA 3CXHD 1JRAA 1S5LE 3L71G 3HUSC 5KTBA 1UG7A 1RMVA 1J1DB 1T3JA 1LT1A 3KL4A 4IGGA 1X22A 4LLEA 1OXBA 3P8CE 4WWIA 3L73E 1ORYA 5AVQB 2WT7B 1BCCG 3ECSA 5AW5B 5KLVE 2N1TA 2OTLP 5BU5A 4BEMJ 1SQPG 1PD1A 1GU4A 1OIPA 2POHA 4K1OA 3CWBD 2IYPA 3TSIA 1BDDA 3L70G 1NO4A 1AVYA 2M4EA 3NMKA 3C9IA 3F47A 2OEVA 4MTOA 5L0HA 1Q86Q 2KIKA 1FZBA 1S5LX 1URQA 3QVZA 4HEAJ 2GAQA 5CCHC 3CXHI 1VLTA 2R7UA 1O5HA 1YLMA 1NTMD 3TJ6A 1S3JA 2VCCA 2IPPA 1IFDA 1UFBA 1L0LE 4JE9A 1KILB 1NTZD 3OAKA 1VQPP 4CIHA 1Q0MA 5AW1B 1FOSF 2CGEA 5L0DA 3MUDC 3CEXA 2FXMA 1KILD 1M2VB 3MYFA 1FZCA 3Q3DA 3GM2A 1Y8AA 3PHF2 1KNYA 2HFED 5GTHH 4N06A 5DS4A 4BEJA 1FJKA 2Q3IA 1YJ9P 3BATA 1MV8A 2QM8A 1TR2A 1K05A 1MMAA 4Y99B 2Z5HA 3EFFK 2QRXA 2NG1A 2P0NA 3GHGB 5GTIH 1C02A 2XL8A 2YLDA 4GDOA 4JCZA 4ASWA 3DXJF 3RL0C 2R7QA 2A45I 3VMXA 3CPWO 1VQ6P 4I3MA 4RJTA 2NPSC 1S5LH 1SQQE 3DAGA 2RKLA 3AE9C 3B29A 5E2QA 1S72P 3L75G 1I5NA 1JAFA 3ITKA 2KLVA 2Q3EA 1ZV8A 2KB7P 2WT7A 4G7HF 4WY4A 1JUNA 3NFQA 1LTBC 2W4MA 1YI2P 1QQ3A 3D6ZA 2E75C 3ASNC 4U3FD 3WUVA 5A6JA 1FDOA 1PP9D 4KNVA 3E1IA 2HMZA 1NU1E 2YXRB 3NMIA 3G4XA 3WU2E 1KV4A 1EDJA 1NAFA 3H1LJ 2QJYB 1NTKD 3CXHE 4JEAA 1N2DC 5L0JA 1DIPA 2YLIA 1T2KD 2DGJA 3I56P 3HKKA 4XTKA 2OOCA 5DS5A 3P7KA 2P58A 2RSEB 5KYYB 3AGUA 1WOLA 1KILA 2ZYDA 1A0BA 5CBOA 1VQLP 1YTZT 1NSGB 2XLDA 3DM9B 4BJ5A 2WPSA 3K66A 2QUPA 3VMAA 3WUTA 3T97B 2ZPAA 4RBNA 5A6KA 3AE5C 1BGYJ 2IBZI 4ULVA 1D1CA 1M2VA 1MMNA 3IQTA 2Y0DA 5AGFA 1KQGB 2LIGA 4JTDB 4ZLCA 3CMAP 3BEHA 3LJBA 2L6GA 2N9BA 2ZXEB 5BVZA 1Y6DA 4BJ6A 1YYJA 4EOTA 3L71J 2WSFJ 4OD5A 2AEJA 3CC4P 1XTGB 3N0TA 2QVAA 4Q5SF 3GM1A 1NTME 3GHGA 2JEEA 3H1JJ 4DZOA 1LI5A 1WWPA 3IQCA 1NTZE 4AL0A 5JS5A 1CGOA 4MVZA 3A7OA 3KQGA 4MVOA 2O1KA 3SWYA 4C46A 2ZYGA 4W7ZA 3L0IA 1PPJD 5E33A 3CC2P 4FX5A 3BRTB 3WODF 1TWHA 1KILE 2E43A 2QJPC 1G2CB 1OKKD 1IZNB 1R4TA 3SXZA 1E83A 3HLZA 3TULA 2WVQA 2KK7A 2GA0A 3E7KA 3L70J 4W7YA 1X0TA 3NYJA 1MQVA 3Q6MA 4KJMA 2HYNA 3CCSP 3GLMA 3CCRP 3DI5A 3IR9A 3VTPC 1AJYA 3AG3C 3G4ZA 1PZQA 3U2LA 1ZMEC 2VB6A 1N7SB 2V4HA 4N6JA 4JZAA 5T1DB 1T3UA 4LLHA 4GYTA 4E0HA 3P8MC 4E18A 4U5GA 1JCDA 1NHLA 1SVFA 3DZAA 3BCCG 2YIUB 2EILC 1SQXG 1SQBD 5JP7A 3K7DA 2G3VA 1DOVA 1N7SD 1FJPA 5EHHA 3AQCA 2ZFCA 5APSA 1R5ID 5JSLA 4U9DA 3WU2H 2Y3GA 1FDIA 2EPNA 2XKMA 3CXHH 4WB4A 3GM3A 1R5LA 2Q7RA 5KYYA 3RGUA 3WAQA 3M06A 4AL1A 3ZIBA 1LTIC 1HW2A 4CS8A 3R7CA 3L72G 4L76A 2J9UA 3T97A 1YBKA 2QJKB 3TOLA 1KC8Q 1L4AC 2M0BA 1O3UA 4RESB 1TWGA 1HVVA 1RF0A 3TGUJ 2OYHB 2KOGA 1RHZB 1GGQA 2Q4FA 5AW8B 4U3FE 3CCMP 5JRAA 2CK3H 1PP9E 4AK9A 5IY5C 3TDKA 1H0TB 2A0BA 1NAYA 1NYHA 4ER9A 4MVMA 1PGQA 3H32B 1Q7YQ 3WHNA 3V2PA 1FFTC 4JJGA 1HMOA 3AEBC 1NLXA 3H1HD 4LDRA 1NTKE 4YWQA 3VOPA 4IAOA 3S90A 1LM3B 2C9NY 1Q0GA 1CGNA 2QEXP 1GM5A 3RBXA 4HYTB 2Z15A 1VQ7P 2E42A 1D0XA 3U2MA 2LD6A 1M7LA 1OKKA 2ZXPA 2WSCJ 1AQTA 1IJDB 2IXMA 3HTKC 2Q9AA 4R4LA 2A45H 2ASRA 3EZHA 3SYNA 1FC2C 3IEEA 1SR2A 2BCCG 1SQVK 1G2CA 3RF3A 1PFIA 3LNMB 2R32A 1JOGA 1IO4A 1GMJA 3ZTMA 3LIEA 4N6HA 2QM7A 256BA 1W2WA 1M1JC 1J1EB 2OQQA 3W68A 4AX2A 5KYNA 2Q1KA 2JR8A 3MHVA 4YXWH 5E3CA 2R7TA 2A6EF 4ULWA 1LKXA 4IFMA 1KB9D 1YIJP 3EGXB 1OVRA 2NSFA 2Q00A 4EUKB 4H4KC 1N7SA 1OVUA 3C63A 1QLED 2R5DA 5BQGA 2VCAA 1MZ9A 3AG4C 4XPXA 3R4YA 5F5HA 2OG2A 5AVUB 3LUTB 2OKUA 1TQGA 3EHMA 1ZU4A 3PLNA 3L8JA 1QPUA 2CYDA 3PTZA 2LCHA 3MBGA 1BBHA 1PPJE 3B0PA 1KU2A 2A06G 1BE3D 3G71P 2DYSC 1KZUB 2XU6A 2O01J 2R5BA 3WG7C 2V7QH 1YDIA 1RXQA 2IOQA 2N9YB 2OARA 5AW3B 2DB4A 1DOWA 3L74J 2HKVA 4OIPF 3TNUB 1FOSE 2OYHA 3I5PA 2JX0A 1RE4C 1HE9A 1HH0A 3HRNA 3V2QA 1VQ5P 2NUPB 2ETSA 1H0TA 4EI2A 3LW5H 3H32A 1PD0A 4PACA 1SQBE 2KGOA 2HUJA 2WSSH 4C3BA 1ZRTD 1U6HA 1WATA 2H43A 2R7OA 3SZRA 1G4WR 4R32A 2FY8A 1BCCD 1S2EA 1SS1A 1HBWA 1VYIA 1GL2C 3UIAA 3FXEA 4DCKA 1YARO 4MNDA 1NTZJ 2ZXWC 2EINC 1SQPD 1KORA 4KBLA 1SMYF 1VF5B 3L4FA 1ZHZA 1QSPA 2BEZF 3FXDA 1BR1A 3RVZA 2FYUK 1BDJB 4JIOA 3EGDB 5CCGD 5APQA 4JBZA 2J46A 2L6HA 2R9RB 4ONSA 5CHXA 1WT6A 3JZ0A 1CSBA 4NY3A 2J9BA 1VF5D 3BCCJ 3CSKA 3FOPA 3V7OA 3QVYA 3SFEC 2XLVA 2FYUG 2A68F 2N1TC 3EGXA 2YKQA 1ZW2A 2E76B 3F46A 4P9TA 2OJQA 2KI7B 5KLIC 2WZGA 4PV1C 3IHUA 3H1HE 2J0XA 3IQ5A 3D71A 4N6CA 5BQHA 3ZVRA 1Z6AA 2AEFA 1GK6A 2IFMA 2Q9IA 5CJ4A 3CCQP 2E76D 4BPMA 4H13B 2R7VA 3L72J 5DQZA 2R05A 1URQC 2MYSA 4YPCA 4PJJA 3GORA 4J30B 1BSHA 5L0CA 2OCCC 3M0DA 1U7MA 1E2XA 2YKZA 4H13D 3KYIA 4H44C 1IC2A 1RF1B 1RH5B 4O6NA 2TMVP 3MGNA 2J45A 5KAFE 3GF3A 3G50A 1CPRA 2ZJSE 4XQ1A 2IFNA 2QA4P 2A0UA 1EDLA 5F28E 1M57C 3PJSK 2O1JA 2NPUA 1FZFA 1TKNA 2GWWA 2WZLA 1OCCC 4XPWA 2PNOA 1LE4A 3TNUA 2C9LY 1KB9E 4D6TG 1FZCC 3E1RA 4AYCA 1S4XA 4CDVA 4Z9HA 2QSIA 5AW2B 1HY5A 2NUPA 4JURI 3A11A 3O39A 3M9HA 3H1LG 1R8EA 3KH2A 4QI0A 3VMZA 4OVNF 1YA7O 2XXAB 1YYCA 4U5FE 2D4UA 3L75D 2WVNA 3ITFA 3SNHA 3EG9B 2BCCJ 3A3YB 2IXOA 4PR9A 1BE3E 2HV7A 3C1LA 1LWUB 1AA0A 1QX8A 1A7VA 1ZOYC 3CQZA 5CCGA 3HD7B 1XZPA 1HGZA 4I6MC 4UB8E 2WVRA 4MTGA 1EDKA 4I1LA 2H88C 1SQVJ 1J1DC 2FKWB 1KQFB 4XE5B 3EGDA 2XNDH 3FWLA 1KTMA 3HD7D 3HNLA 1FMVA 3FGAD 3GF7A 4L75A 1JPJA 2V26A 2W83C 4H0LB 2Y9YA 4BXLA 3OWTA 3ZTZA 3U1AA 3B0VC 2W9YA 3DD7A 2H8PD 2ZT9B 3I4UA 4H0LD 3NTNA 3S1KA 3W2WA 1ZRTE 4KC9A 2YZSA 2AWYA 3K1IC 2CCYA 2I8DA 3SXYA 2AWCA 3H1JG 5JUAA 5K0IA 4GODA 2DYRC 4WVZA 2ZT9D 4G78A 2OYOA 3AEFC 4WY4B 3TYYA 4L73A 2B0HA 1ZU5A 1SQPE 4I2LC 4YTPC 3Q1MA 3U0CA 1TWAA 4BJ1A 1T01A 5KLVK 2FXOA 4LC1A 3RL0g 1LS1A 1XZQA 3F5HA 4JCHA 1RF1A 1KILC 4WY4D 3AE4C 3LEVA 1N1CA 3RYLA 3KXDA 3LLKA 2OYIB 5KAFH 1GTWA 2O9XA 2E5TA 3H1KJ 4BJ5C 2K9YA 4C7NB 1FZEA 1HTLC 1HGVA 3T6JA 5TISH 4NC3A 5KLVG 4XPYA 3K33A 1J8YF 1ZVZA 1HMDA 3JTLO 4DOZA 2C03A 1G8XA 5HV9A 1KB9H 4I7ZB 3O10A 2KSEA 4HH2A 4DJ9A 2GUSA 4Q4ZF 1S9KE 1L0LK 1XWJA 4HB1A 2HLOA 3B8EB 2HFIA 5AVZB 4BJ6C 3VF0A 2J58A 1TU3F 2YL1A 3IQ6A 4W8KA 4A2NB 2XXAA 4Y99C 4MTFA 3H2UA 1AQ5A 1EZVD 3EG9A 1ORJA 1X9VA 2D2CB 3GHGC 3AE6C 3U9JA 1EI7A 3C8VA 2ZD9A 2E5YA 2QE7H 1LWUA 3VYIA 1VOMA 3IAOA 4XEFA 3SWKA 3HD7A 2B0JA 3CX5H 3KMIA 2FYUJ 2H8AA 1L0ND 2D2CD 3DAFA 3II6A 3TGUG 1AFOA 1NFNA 4UB8H 4NPEA 1DEEG 1VYKA 3U3BA 3AEDC 1SQXD 4EWCA 2M3BA 1JNMA 3QMKA 4BG0A 3RW0A 1WGWA 1MKMA 3QTHA 2C04A 4DOJA 1Q2NA 2BE5F 1T6IA 2OQMA 2EPLX 4U9EA 1YJWP 4IL6E 2WSFH 3U59A 1H8AA 3MIWA 5AW9B 2M64A 5TJ5E 5APYA 4A4AA 4EIYA 4XLNF 2LXBA 3L75E 1GD2E 1JTHB 4XLPF 2I1KA 2P1JA 1EZVI 5APTA 1SQQK 2YHSA 3SFDC 3MTUE 3BASA 1T2KC 2R7RA 2P7VA 3NXSA 5EK0A 5CBNA 4Z9IA 1JY3N 2LFFA 2QJYC 1R5SA 2Q5UA 1JCCA 1V74B 2XSEA 1VL2A 4D6TJ 4KNWA 5DJUB 3FOOA 1GS9A 2YRFA 3JT1A 4DJGA 2VASA 5JVEA 1HE1A 1JY3P 4W80A 3S84A 4CS8C 2OYIA 4C7NA 2XLEA 1FAVA 4IL6X 1NU1K 3EH1A 1QL2A 1RF0C 3C8GB 1KFMA 2E87A 2FXPA 2RMZA 2WB7A 2I8BA 2IXPA 5GPGB 3KPEA 4OGQB 3JSEO 1JY3O 1NOHA 2HV6A 5F5FA 4NQFA 2A1DD 3C8GD 3TJ5A 1Z23A 3V6IA 1SLQA 1MFTA 4CDYA 1G1JA 4CDAA 2WSEH 5DQTA 3ABLC 3KKBA 5JLIA 4OGQD 4CX9A 1KN7A 1OCZC 5B3SC 3BVHA 3L37A 1OW7A 5KJ7D 3R2PA 3LNRA 3CWBE 1JR8A 1PGJA 2P61A 3NKDA 5A69A 3AE7C 3I5CA 4DVZA 4ZKUA 5CJ0A 3L74G 5L3QA 2P1AA 3LS0A 3IFMA 2XNXA 4PD4D 3S4RA 4CJGA 3H1ID 2XS1A 4XA4A 4U5CE 1N7LA 1OZHA 3B5NB 1Q82Q 1USEA 5KYUB 2KNHA 4JEBA 3RK2B 1NTMK 1VPCA 1SZIA 3CAXA 1FE6A 3JSVC 2FFDB 1OR3A 3AEAC 2M3EA 2A06D 1NTZK 4LDKA 1ZR2A 4JC7A 2ZXOA 3LIDA 4O6MA 3B5ND 2IM8A 4IL6H 1N7SC 3RK2D 1JTHA 3FX0A 2JPUA 1EZVE 1NTMG 2XV5A 2XM0A 3NDBB 4XEKA 3Q5SA 1FBMA 3L73J 2YIUC 5AVWB 1NTZG 3AE2C 1TWCA 3K6BA 4CJOA 2C0XA 3MZWB 5KLVJ 1OX3A 3OJAB 4FAPB 1L0NE 4BRYB 3CCJP 3Q7GA 2ZXXA 3SXKA 1WRGA 1IZMA 3KDPB 4PD4I 1CI6B 1MNDA 1LT9B 2LP4A 1SQXE 2B9BA 2JJLA 1JB0J 2LKMA 3AOUA 1HUCA 2GFHA 3KPHA 5E3AA 2J9VA 2QJKC 2SPZA 3Q2YA 3CZ6A 3C8GA 2K1AA 3JCUQ 2OYHC 4NPDA 2HMQA 3ZDLA 1C03A 5FCLA 1G1IA 1L0LJ 1J8MF 5AW4B 3N4XA 4RO0A 1ZR4A 4IB4A 5KJ7A 3FXHA 1FDMA 4OIQF 4YL0A 3HE4B 3DJUB 2XL6A 3UNGC 4YT4A 1GW3A 1NZEA 1EQ1A 1FZAA 1OXZA 3H65A 4JYCA 5DS6A 3MYIA 4JTAB 5A6AA 4AUWA 1H88A 2MWQA 2HSQA 1GU5A 4NTAA 3TQOA 1SYQA 2L6FA 3PH0A 2L91A 2VCBA 1X8YA 1JMWA 4FWVA 4NCQA 1W2EA 2FBWC 2JP3A 1RY3A 1FFHA 3V5ZA 1NG1A 2IBZG 4P9FA 1QL1A 1YTZI 2OTKE 1ZN5A 2LFDA 4HFFB 4K3AA 4U5DE 1K9MQ 3GG2A 1S7ZA 5DVWA 1VQ9P 1NTKK 1JY2O 1OFCX 3B5NA 1PGPA 4M3LA 2OTJP 2MJZA 1J1EC 5KYUA 3L36A 2YLGA 5T3WA 1QLEC 1D7MA 2FFDA 4ZMDA 2IBFA 3QZCA 1X79B 1L4AB 1T5OA 2K9JB 5KYWB 1SQQJ 4XWJA 4N3YB 1FZGA 1H7IA 3Q7LA 2CW0F 1EQ7A 4MVRA 3RH3A 4GEHA 1ZHWA 3T9OA 3OA1A 3V5XA 2FFHA 2YO3A 3L35A 3RBZA 5KKZB 2PBEA 1SQVG 3PP5A 1M56D 4BRYA 4WBAA 4U5EE 3M0DC 3M91A 4HE8D 4L6RA 3POVA 4PD4E 1CI6A 3H1IE 1LT9A 2GA1A 3H1LD 3DKAA 2HS5A 1E5WA 3G9RA 2P7JA 2YMKA 1LVKA 1A7DA 3SSUA 4IAQA 1NU1J 1ZP0C 1WASA 3DE9A 2D5RB 1QVXA 3ZSUA 5JT4A 2J7PD 2KUBA 2F22A 2A06E 3SWFA 1VQKP 1RE3A 5AVRB 3CX5D 3G3ZA 2ICWG 3S28A 4N4WA 1BGYD 1DEBA 5APWA 1VQOP 2PX3A 3HE4A 2HG5D 2GM4A 5COFA 1IK7A 2R03A 3U3FA 3W2VA 4N78D 1KB9I 4HKZH 4O79A 1EXJA 4JKVA 2XRHA 5C39A 2JWDA 3L71D 2HODB 3I5QA 3CWBJ 3H1KG 4R4MA 5CCGC 5COMA 4H54A 1RQUA 3JYYA 1CPQA 3ZQYA 2BC5A 2VRSA 1VF5C 3DMDA 2Z4EA 3H1JD 5B5EE 3U5SA 5D92A 1QZXA 2ZAEB 2DI3A 4CSAA 5AVTB 5AVSB 3WUUA 2H7HA 1Z3IX 3IPMO 1LTSC 1NTMJ 2L7AA 5D91A 3CX5I 4C7RA 4EYYQ 4OIRF 2W27A 4PJ0E 2RH0A 1ORSC 3RK3B 5AW6B 2LK4A 1BR2A 1K04A 4U5BE 1L4AA 2K9JA 5KYWA 1SFCB 2E76C 3ATPA 3L70D 1U7JA 5CIVA 1LE2A 3RK3D 3EFOB 3B0UX 4DBQA 1Y9BA 1GQAA 3U1CA 3C18A 3JCUH 3HE5B 1SFCD 1IW7F 4H13C 4Z1MH 2NRGA 1OWAA 4X0RA 5KAIH 3M4CA 1TFKB 2CDQA 1GZLA 2HSBA 3A0BE 4AQRD 1N8RQ 1VLSA 3AGTA 1U0BB 2FYNB 1RF1C 3LAYA 2J7PA 2KZIA 3FHDA 3EHNA 2KJGA 4GKGA 3D70A 2KW3C 4PD4H 2P67A 4L74A 1MMGA 2HPCB 2KLUA 3HTKA 5T3TA 2XLWA 2GDCA 2W45A 3N7NA 3M0AA 1D0ZA 4PFPA 3CCEP 4EHPA 1XTCC 1APCA 1VB5A 3BRJA 2AXTE 1VQNP 2OU6A 3CLQA 2JWAA 4IFFA 2V7QJ 5AVYB 3WMM0 5TISE 2G3AA 3TGUD 2LSEA 3DWWA 2HZ8A 4IWBA 4KHXA 2KS1B 2UUIA 3LLIA 1MFZA 2E74B 3HNJA 1QVFO 3ZC4A 1G5ZA 3TD7A 4PV1B 1OCRC 2WQYC 2XS8A 4UB6E 3L1MA 1FAPB 2Q9BA 4U3FJ 5B1AC 1LWUC 2HODA 3LW5J 2Y3BA 2E74D 1PP9J 4LERA 4MVUA 2EIJC 2EIMC 3HD7C 2R44A 3TOMA 4JVSA 3KHUA 1JPNA 3U8PA 2P2UA 2FAPB 2CPBA 1OQCA 2UWJE 1N73B 1DH3A 2CNWD 4GQHA 4OINF 4RKUJ 1NTKJ 1LTJB 1A02J 1YHQP 1D1AA 5B5EH 1CW5A 1IFIA 2HJMA 3AE1C 1GDTA 1NJIQ 4H0LC 3CX5E 5L0FA 3USSA 5BU8B 2H7VC 3RKOF 3V2RA 1BGYE 1K73Q 4PJ0H 1T8ZA 1Z5ZA 1QVGO 2ZT9C 4Y28J 5HSWA 4YT5A 1SFCA 1E86A 3C62A 3UMKA 1OXKA 1UIXA 4XEVA 2P6VA 2Y3HA 4N78E 4YK5A 3MP7B 1ZHXA 3EFOA 3T4RA 2Y0EA 4IJJA 1NGMB 1LP1B 4OIOF 1K40A 2IYLD 1W5CE 3HE5A 5APVA 1A41A 3L71E 1VQ8P 2AVKA 3G4SP 4FESA 4WY4C 4WGZA 3W67A 1KYOD 3A9CA 4JTCB 3V4WA 3V4QA 2BL2A 2EPOA 2KK1A 4MW3A 1RCPA 3A0BH 4U5HA 2IZ0A 2J8WA 1M8OB 3H1JE 1PL5A 3VN0A 4WABA 4K35A 2A69F 4MS2A 3EWKA 1BCCE 4DT0A 2HPCA 2OYIC 1EXIA 1YZCA 1LJ2A 3KYQA 2UUHA 4AE4B 2YKOA 1HJ0A 4W8PA 3NYMA 4MN4C 1T6QA 1G4US 1H9TA 4G0HA 3A0HE 2IZ1A 2IX7C 1H89A 2P10A 1EKYA 1SQPK 1Q0KA 4C3DA 3L70E 5EGYA 4I7ZC 2CPSA 3L73G 2PX0A 3RK3E 3L74D 2AXTH 4ASVA 2OJED 1QEXA 2MHRA 3MLGA 2Y69C 1E85A 3HUSB 2DW3A 2KS1A 4PFOA 1Q0DA 4QDLA 3KZIH 1KYOI 2C0WA 2XDJA 2FGYA 2R3SA 3W4YA 2D2CC 2Y3DA 5AW7B 4MVQA 3ABMC 2CNWA 2B87B 3K5BA 4UB6H 4RD9A 1FS0E 1LTTC 4I1MA 1SQBJ 4QMAA 1DX7A 1N73A 3AG1C 3ABKC 1WTYA 1LTJA 4B86A 1L0LG 2W6JH 4CS9A 5BQIA 2X51A 1OVVA 2PFXA 1L3PA 2K37A 2YL3A 3E9VA 1PIXA 3UR3C 3TGUE 4LACB 1YZAA 3OA7A 1HJBA 1L7CA 5AVVB 1FNTc 3BCCD 3PRJA 3FVYA 1RKEB 1LP1A 5CCHD 3RQEA 3AE3C 4WJ0A 3FAJA 2LQGA 3VYWA 1LPEA 2AU5A 2J59M 3TF5A 3GWNA 1YJGA 3EJNA 1TFOB 2ZVOB 3RQGA 3H25A 2W6AA 2VH3A 3TK1A 2YNYA 4B6IA 2Q6QA 3V2NA 3EQ2A 5B3IA 5B1BC 4I1OB 1OR2A 3H1HJ 3L72D 2KNCB 4EBJA 3J06A 1E84A 2H7BA 4YN0B 1AUEA 1KQLA 2ZXRA 4AE4A 1YVIA 2PFDA 1U89A 3GEHA 1KQSO 3AECC 3M15A 1SQQG 3JRMO 3CCVP 1CGME 3OW2O 1FTSA 4Q7CA 4J7YA 3A0HH 5APUA 3LS1A 4IRUA 4NTBA 2Y39A 4OGQC 2ITAA 2PGDA 1VTMP 4GT1A 2FYZA 2A6HF 3HNKA 2XLHA 3RL0B 5KJ7C 2IBZD 4EKWA 3HUSA 4MVSA 5B66E 1BDCA 5L0IA 3ABVC 2NPSB 2Q7CA 4IFDK 1ZZPA 2YQYA 1KYOE 3GW6A 2WL8A 3K1IA 3DJNB 3RL0D 3NRHA 4CS7A 5L3VA 3FMSA 1SF8A 4HFKB 2B87A 3Q5RA 2AXCA 1JOCA 3D6YA 5AC5A 2NPSD 2PP4A 2KYHA 1NU1G 1J2JB 2PP6A 2BCCD 3O6QB 2QTVA 3AJMA 3AEGC 2E75B 3EH2A 1JMMA 4ZLDA 2WPQA 4PJMA 2AEMA 2GUVA 4BWNA 3B5NC 1YJNP 4J32B 2B88A 1OMIA 1BE3J 2QY9A 2E75D 2XLMA 3RK2C 3M79A 3EPVA 1SQVD 3MFNA 3L74E 2FFDC 5CCHA 1ST6A 2Q9CA 3LESA 2KSFA 3M9BA 2L81A 1KD1Q 3NG1A 4ANJA 2JKVA 4K0DA 4P6IC 4U7JA 3NYLA 2WTYA 3IN6A 2WWWA 2NUTB 1EA8A 4D4XA 3AE8C 1RKEA 2O01N 1N86A 3CWBG 4IARA 4KT0J 2EPKX 3MUDA 2PRRA 1ZXGA 2QE9A 4IOIH 4YL1A 1YAUO 1VQ4P 1UIIA 1A7EA 2K88A 2ZVNB 5CI8A 2R02A 2EPMX 2KNCA 3M4BA 1LT9C 4EDFA 3QW0A 2XZRA 4G7ZF 5APXA 2L5GB 2L9JA 4J7TA 1Q81Q 1Z7Qc 3U9MA 1YITP 3H6PA 3X2QC 1BCCJ 5EFWB 2W4BA 1B68A 3M1CB 2HR3A 2WSCH 2A45G 1FMWA 4JQ0D 3C7JA 1SQPJ 2H7OA 2K3RA 3PHLA 1RE3C 3E70C 3H1KD 3RVYA 2KZJA 1EZVG 1L0NK 3BCCE 1ZHYA 4BJTA 3QW1A 3F89A 4F4BA 1Y47A 3VRCA 1BSNA 1OW6A 2IYOA 1SQXK 2YEVA 2NPSA 5B66H 4DRHB 4DRJB 4O9BA 1L0NG 2QJPB 2I15A 4OH8B 1Z63A 1KYOH 3ZDMA 2JD3A 1F1MA 1DD4A 2MKVA 3L72E 1JY2N 5TJHA 4JJFA 1Q0FA 3ZWIA 2WSEJ 2X0CA 1NVOA 3V5BA 3O6QA 1P84D 1RJ9B 1BZ4A 5AC4A 3JYHA 5M1BA 2YXQB 1MMDA 3LEOA 5L8RJ 4TT3H 1D0YA 1ZW0A 3L8IA 4CSAC 4EBKA 1YQ4C 3B9QA 1S1CX 3EQLF 5CI9A 1JY2P 2FYUD 2BASA 2R7WA 3GANA 4MQ9F 3EFGA 2O01H 3IF4A 1M1KQ 1PCXA 2OEXA 1Y4CA 2J0WA 2IBZE 5AVXB 1W2BO 1NWQA 1MNEA 2I1JA 2XLOA 3UGPA 1JMBA 4C7OB 1LTGC 3HNIA 2NUTA 1USDA 2M5AB 4I44A 2AP3A 3CI9A 4U3FG 2KP8A 3CMEP 3B71A 1M56C 1PP9G 4LLCA 3O55A 3GEIA 4O7GA 2R25A 1M2OA 5KKZC 1WN0A 3CCLP 3T6BA 3A5TA 3TK0A 3N2ZB 3DE8A 1P84I 2BCCE 1ZW3A 1NTKG 4EIJA 2NSGA 1AVOB 3S27A 2M8RA 1LS4A 3L75J 3JCUE 3AG2C 1L4AD 1IFJA 3MD0A 4ZNCA 5KAIE 3PCVA 1VQMP 4DBRA 4UDVA 5AW0B 4RDAA 4G7OF 2R3CA 4D6TD 4YL3A 2QLAA 1SQVE 2J9WA 3VAYA 1AEPA 3QWOC 2LXCB 3KYJA 1U57A 4LGDE 2VC9A 3NMDA 4D4NA 1M90Q 1NU9C 5A6BD 3SP1A 1MUUA 4DRIB 1O87A 3HTKB 2YVKA 2R7SA 4NTFA 1EC5A 2RN0A 2YMYA 3CC7P 3AEEC 2WPVB 5DLJA 1DD3A 4MW8A 2PAJA 4OWFA 5COGA 4JPZB 2YL7A 1M1JB 3B4SA 3H1IG 1LIHA 3W8IA 3US6A 3G6EP 3RQFA 1RJ9A 1VMAA 5E79E 2Q3TA 4YT8A 3UMHA 1PPJG 1KFNA 3I55P 4CIPA 3P32A 1ZHTA 1LI7A 2YL0A 4JW1A 1S05A 4E7ZA 3H1KE 3L34A 4O6YA 4JF7A 3RK3C 2G3KA 5CMZA 4E17A 1YQ3C 5KYXB 3PDMP 1I4YA 1VDFA 3K1HA 2ZYAA 1SFCC 4WGYA 2QNLA 5BUOA 3NMJA 1IFMA 1ZYRF 1SQBK 3AQBA 4C7OA 2YWAA 3S9OA 2M5AA 2JDIH 1L2PA 1AV1A 1LNQA 1C17M 1BR4A 1SQBG 4GIFA 2OGUA 3P8CD 1P84E
chains in the Genus database with same CATH topology
1JB0J 3D70A 3G9RA 1O3UA 4EBJA 2YMKA 3EWKA 3Q3DA 3GM2A 1Q90D 2FYNC 2QIWA 4IL6X 1EXIA 1ZP0C 2QJKC 2JX0A 3GMAA 3Q2YA 3C8GB 1KQGB 1QVXA 2H89C 3C8GA 1HJ0A 1KNYA 2FXPA 2L6GA 1NYHA 2QSIA 4I7ZB 4OGQB 3O10A 3D6YA 3AECC 2P10A 3BRJA 1K05A 2WSFJ 1U57A 4NQFA 2BEQD 1R8EA 4I7ZC 3C8GD 4OGQC 3AEBC 1TU3F 2V7QJ 3RK3E 2G3AA 1PV3A 3GM1A 4OGQD 4GDOA 1OW6A 1WMKA 1IK7A 1WWPA 1OW8A 3U3FA 2E74B 4R32A 1RQVA 1OW7A 2D2CB 2JO1A 3AE6C 3ABVC 1EXJA 4PV1B 3C8VA 1ZZPA 3AEEC 4YXDC 1ZOYC 3IAOA 2E74C 2WPVB 2WQYC 2WSCJ 4XEFA 1KORA 2D2CC 2L6FA 1DD3A 4R4LA 3AE7C 2NZ2A 3LW5J 1VF5B 2E74D 4R4MA 3AE9C 2FBWC 1KILE 2BEZF 1DD4A 1RQUA 2D2CD 2H88C 1KMIZ 2JP3A 2MKVA 2QJPC 1KQFB 3Q5PA 3JYYA 1JOGA 3TULA 1GMJA 1VF5C 1KTMA 2WSEJ 3AEDC 2L6HA 3FGAD 3GF7A 3AJMA 2OQQA 3AEGC 3O6QA 1V4AA 2E75B 4H0LB 3JZ0A 3RQFA 4RKUJ 1VF5D 5M1BA 1WTYA 1MKMA 5L8RJ 3AE1C 4TT3H 1HF9A 3GLMA 3SFEC 3L8IA 3D6ZA 2E75C 4H0LC 4EBKA 2Q00A 1AJYA 1YQ4C 1S1CX 2ZT9B 3Q5RA 1ZMEC 2E76B 3AEAC 1OMIA 1FDOA 5KLIC 2LK4A 2E75D 4H0LD 4PV1C 1K04A 1ZRTE 3D71A 3MFNA 1PIXA 2ZT9C 2E76C 2G8YA 2IDBA 4Y28J 1YQ3C 4PV1D 2JPUA 3R4YA 1S5LX 1UIXA 4XEVA 3SFDC 2J5UA 3K7DA 2ZT9D 2E76D 4H13B 4U7JA 3Q5SA 4XEKA 1Y9BA 3IN6A 2YIUC 1NGMB 3AEFC 3AE2C 3C18A 1DIPA 2YWAA 3L8JA 3AE8C 3RQEA 3AE3C 4H44B 1FDIA 3S9OA 2QJYC 1K40A 4H13C 4Z1MH 1UFBA 4YTPC 3Q1MA 3B71A 3U0CA 3GM3A 1WOLA 2PBEA 4KT0J 2HSBA 3RL0g 1VL2A 4H13D 4H44C 3RQGA 3H25A 2KK1A 5KKZC 3GF3A 3AE4C 2O01J 4XFJA 4H44D 3T97B 5F28E 1PL5A 3AE5C 2K9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EBJ A;  1O3U A;  3GM2 A;  1ZP0 C;  2JX0 A;  3C8G B;  1QVX A;  2H89 C;  3C8G A;  1KNY A;  2L6G A;  3O10 A;  3AEC C;  3BRJ A;  1K05 A;  4NQF A;  3C8G D;  3AEB C;  2G3A A;  1PV3 A;  3GM1 A;  1OW6 A;  1WWP A;  1OW8 A;  3U3F A;  4R32 A;  1OW7 A;  3AE6 C;  3ABV C;  1ZZP A;  3AEE C;  4YXD C;  1ZOY C;  2WQY C;  4XEF A;  2L6F A;  3AE7 C;  3AE9 C;  2FBW C;  2H88 C;  3JYY A;  1JOG A;  3TUL A;  1KTM A;  2L6H A;  3AED C;  3AJM A;  3JZ0 A;  3AEG C;  1V4A A;  3RQF A;  1WTY A;  3AE1 C;  3SFE C;  3L8I A;  4EBK A;  2Q00 A;  1YQ4 C;  3AEA C;  2LK4 A;  1K04 A;  3MFN A;  1YQ3 C;  2JPU A;  4XEV A;  3SFD C;  3K7D A;  4XEK A;  3AEF C;  3AE2 C;  3C18 A;  3L8J A;  2YWA A;  3AE8 C;  3RQE A;  3AE3 C;  1K40 A;  1UFB A;  3S9O A;  4YTP C;  3B71 A;  3U0C A;  3GM3 A;  1WOL A;  2PBE A;  2HSB A;  3RQG A;  2KK1 A;  3AE4 C;  5F28 E;  3AE5 C; 
#chains in the Genus database with same CATH topology
 5FZT A;  1AVO A;  3L73 D;  2EIK C;  1Q90 D;  2FYN C;  5K5G B;  4E7S A;  3X1O A;  3GMA A;  2HJ3 A;  4HJG H;  3C8Z A;  1QGK B;  5KLV D;  2H89 C;  3V5Y A;  3EZI A;  1Z56 A;  5L0G A;  2FYU E;  3T6G B;  2KQ9 A;  4PK4 A;  1HW1 A;  5H2F E;  1V54 C;  5A6B A;  3MX3 A;  3HJC A;  2PF4 E;  3GOD A;  4JYB A;  4QI2 A;  3VM6 A;  1FR0 A;  4NPF X;  1I4Z A;  1L0N J;  2Z5I A;  3O6X A;  1JM0 A;  1PV3 A;  2QG4 A;  1GL2 B;  1IK9 A;  1WMK A;  4C3E A;  1NU7 D;  1CZQ A;  2WMM A;  3QH9 A;  1SQX J;  4M63 A;  1EDI A;  4A7P A;  4YXD C;  3N24 A;  4TLF A;  2E74 C;  3RIP A;  1GL2 D;  1L0L D;  1QKR A;  4PJL A;  3UMI A;  1SP4 A;  2NZ2 A;  3FDQ A;  3CD6 P;  3H1H G;  1JEK A;  4Z9J A;  3Q5P A;  1HWT C;  1IFN A;  1KMI Z;  1NKZ B;  1S9K D;  1T6A A;  4YJW A;  1M1J A;  1VK5 A;  1IFP A;  3JRT A;  1PGO A;  2R7X A;  2XM4 A;  3RFY A;  1H9G A;  1E79 H;  3JSZ A;  3VMY A;  1V4A A;  2WVO A;  2N1T B;  2WIT A;  3KZI E;  4ZKP A;  3GEE A;  3ZQV A;  3S0X A;  3CL3 D;  2W8Z A;  3M9Q A;  4EBB A;  4D6T E;  5KLI B;  2Y0C A;  2B89 A;  1N73 C;  1HF9 A;  4OD4 A;  1GW4 A;  3CCU P;  1FU1 A;  1LTJ C;  1OCO C;  3JC2 2;  5E79 H;  3UGO A;  4CS9 C;  3S29 A;  2N1T D;  2V3C C;  3SXM A;  4GOE A;  3H1L E;  2G8Y A;  2IDB A;  1YYX A;  4PV1 D;  4LDQ A;  1URQ B;  3Q6N A;  5DJT B;  5KYX A;  4DXW A;  2RD9 A;  2J5U A;  2IXN A;  2WZF A;  2W6B A;  1T6U A;  1H6G A;  4H44 B;  1URQ D;  3NKE A;  4KI2 A;  2O3J A;  1V55 C;  1RKC A;  3ASO C;  2KC3 A;  4DVY P;  2Y9Z A;  2WPR A;  3VP8 A;  3SEO A;  2W90 A;  3A2A A;  1SQQ D;  3O8Z A;  4XFJ A;  4H44 D;  2KSJ A;  4GOF A;  2LR2 A;  1YA9 A;  3ZG1 A;  2WZ7 A;  1GK4 A;  3OEO A;  1FZC B;  1ZLL A;  1M6T A;  1M57 D;  1RE4 A;  1P84 H;  2QIW A;  5GTH E;  3DM5 A;  1BE3 G;  1NKN A;  1D1B A;  1NFO A;  3U8V A;  4YT2 A;  1LTA C;  1NBB A;  1A02 F;  1T9K A;  3GWL A;  1BGY G;  2G62 A;  5H2F H;  2BEQ D;  3VP9 A;  3W8H A;  5GTI E;  4E0I A;  2KYV A;  4K7B A;  4CBE A;  4JRZ A;  3H2V A;  3BRV B;  2XL4 A;  2YO2 A;  1JO5 A;  1LGH B;  1NU1 D;  1GL2 A;  1NH4 A;  2YKP A;  3H1I J;  4CPG A;  1OW8 A;  1K8A Q;  2KXP B;  3PMR A;  3FWN A;  1RQV A;  3FAP B;  2JO1 A;  4PJN A;  3CXH D;  1JRA A;  1S5L E;  3L71 G;  3HUS C;  5KTB A;  1UG7 A;  1RMV A;  1J1D B;  1T3J A;  1LT1 A;  3KL4 A;  4IGG A;  1X22 A;  4LLE A;  1OXB A;  3P8C E;  4WWI A;  3L73 E;  1ORY A;  5AVQ B;  2WT7 B;  1BCC G;  3ECS A;  5AW5 B;  5KLV E;  2N1T A;  2OTL P;  5BU5 A;  4BEM J;  1SQP G;  1PD1 A;  1GU4 A;  1OIP A;  2POH A;  4K1O A;  3CWB D;  2IYP A;  3TSI A;  1BDD A;  3L70 G;  1NO4 A;  1AVY A;  2M4E A;  3NMK A;  3C9I A;  3F47 A;  2OEV A;  4MTO A;  5L0H A;  1Q86 Q;  2KIK A;  1FZB A;  1S5L X;  1URQ A;  3QVZ A;  4HEA J;  2GAQ A;  5CCH C;  3CXH I;  1VLT A;  2R7U A;  1O5H A;  1YLM A;  1NTM D;  3TJ6 A;  1S3J A;  2VCC A;  2IPP A;  1IFD A;  1UFB A;  1L0L E;  4JE9 A;  1KIL B;  1NTZ D;  3OAK A;  1VQP P;  4CIH A;  1Q0M A;  5AW1 B;  1FOS F;  2CGE A;  5L0D A;  3MUD C;  3CEX A;  2FXM A;  1KIL D;  1M2V B;  3MYF A;  1FZC A;  3Q3D A;  3GM2 A;  1Y8A A;  3PHF 2;  1KNY A;  2HFE D;  5GTH H;  4N06 A;  5DS4 A;  4BEJ A;  1FJK A;  2Q3I A;  1YJ9 P;  3BAT A;  1MV8 A;  2QM8 A;  1TR2 A;  1K05 A;  1MMA A;  4Y99 B;  2Z5H A;  3EFF K;  2QRX A;  2NG1 A;  2P0N A;  3GHG B;  5GTI H;  1C02 A;  2XL8 A;  2YLD A;  4GDO A;  4JCZ A;  4ASW A;  3DXJ F;  3RL0 C;  2R7Q A;  2A45 I;  3VMX A;  3CPW O;  1VQ6 P;  4I3M A;  4RJT A;  2NPS C;  1S5L H;  1SQQ E;  3DAG A;  2RKL A;  3AE9 C;  3B29 A;  5E2Q A;  1S72 P;  3L75 G;  1I5N A;  1JAF A;  3ITK A;  2KLV A;  2Q3E A;  1ZV8 A;  2KB7 P;  2WT7 A;  4G7H F;  4WY4 A;  1JUN A;  3NFQ A;  1LTB C;  2W4M A;  1YI2 P;  1QQ3 A;  3D6Z A;  2E75 C;  3ASN C;  4U3F D;  3WUV A;  5A6J A;  1FDO A;  1PP9 D;  4KNV A;  3E1I A;  2HMZ A;  1NU1 E;  2YXR B;  3NMI A;  3G4X A;  3WU2 E;  1KV4 A;  1EDJ A;  1NAF A;  3H1L J;  2QJY B;  1NTK D;  3CXH E;  4JEA A;  1N2D C;  5L0J A;  1DIP A;  2YLI A;  1T2K D;  2DGJ A;  3I56 P;  3HKK A;  4XTK A;  2OOC A;  5DS5 A;  3P7K A;  2P58 A;  2RSE B;  5KYY B;  3AGU A;  1WOL A;  1KIL A;  2ZYD A;  1A0B A;  5CBO A;  1VQL P;  1YTZ T;  1NSG B;  2XLD A;  3DM9 B;  4BJ5 A;  2WPS A;  3K66 A;  2QUP A;  3VMA A;  3WUT A;  3T97 B;  2ZPA A;  4RBN A;  5A6K A;  3AE5 C;  1BGY J;  2IBZ I;  4ULV A;  1D1C A;  1M2V A;  1MMN A;  3IQT A;  2Y0D A;  5AGF A;  1KQG B;  2LIG A;  4JTD B;  4ZLC A;  3CMA P;  3BEH A;  3LJB A;  2L6G A;  2N9B A;  2ZXE B;  5BVZ A;  1Y6D A;  4BJ6 A;  1YYJ A;  4EOT A;  3L71 J;  2WSF J;  4OD5 A;  2AEJ A;  3CC4 P;  1XTG B;  3N0T A;  2QVA A;  4Q5S F;  3GM1 A;  1NTM E;  3GHG A;  2JEE A;  3H1J J;  4DZO A;  1LI5 A;  1WWP A;  3IQC A;  1NTZ E;  4AL0 A;  5JS5 A;  1CGO A;  4MVZ A;  3A7O A;  3KQG A;  4MVO A;  2O1K A;  3SWY A;  4C46 A;  2ZYG A;  4W7Z A;  3L0I A;  1PPJ D;  5E33 A;  3CC2 P;  4FX5 A;  3BRT B;  3WOD F;  1TWH A;  1KIL E;  2E43 A;  2QJP C;  1G2C B;  1OKK D;  1IZN B;  1R4T A;  3SXZ A;  1E83 A;  3HLZ A;  3TUL A;  2WVQ A;  2KK7 A;  2GA0 A;  3E7K A;  3L70 J;  4W7Y A;  1X0T A;  3NYJ A;  1MQV A;  3Q6M A;  4KJM A;  2HYN A;  3CCS P;  3GLM A;  3CCR P;  3DI5 A;  3IR9 A;  3VTP C;  1AJY A;  3AG3 C;  3G4Z A;  1PZQ A;  3U2L A;  1ZME C;  2VB6 A;  1N7S B;  2V4H A;  4N6J A;  4JZA A;  5T1D B;  1T3U A;  4LLH A;  4GYT A;  4E0H A;  3P8M C;  4E18 A;  4U5G A;  1JCD A;  1NHL A;  1SVF A;  3DZA A;  3BCC G;  2YIU B;  2EIL C;  1SQX G;  1SQB D;  5JP7 A;  3K7D A;  2G3V A;  1DOV A;  1N7S D;  1FJP A;  5EHH A;  3AQC A;  2ZFC A;  5APS A;  1R5I D;  5JSL A;  4U9D A;  3WU2 H;  2Y3G A;  1FDI A;  2EPN A;  2XKM A;  3CXH H;  4WB4 A;  3GM3 A;  1R5L A;  2Q7R A;  5KYY A;  3RGU A;  3WAQ A;  3M06 A;  4AL1 A;  3ZIB A;  1LTI C;  1HW2 A;  4CS8 A;  3R7C A;  3L72 G;  4L76 A;  2J9U A;  3T97 A;  1YBK A;  2QJK B;  3TOL A;  1KC8 Q;  1L4A C;  2M0B A;  1O3U A;  4RES B;  1TWG A;  1HVV A;  1RF0 A;  3TGU J;  2OYH B;  2KOG A;  1RHZ B;  1GGQ A;  2Q4F A;  5AW8 B;  4U3F E;  3CCM P;  5JRA A;  2CK3 H;  1PP9 E;  4AK9 A;  5IY5 C;  3TDK A;  1H0T B;  2A0B A;  1NAY A;  1NYH A;  4ER9 A;  4MVM A;  1PGQ A;  3H32 B;  1Q7Y Q;  3WHN A;  3V2P A;  1FFT C;  4JJG A;  1HMO A;  3AEB C;  1NLX A;  3H1H D;  4LDR A;  1NTK E;  4YWQ A;  3VOP A;  4IAO A;  3S90 A;  1LM3 B;  2C9N Y;  1Q0G A;  1CGN A;  2QEX P;  1GM5 A;  3RBX A;  4HYT B;  2Z15 A;  1VQ7 P;  2E42 A;  1D0X A;  3U2M A;  2LD6 A;  1M7L A;  1OKK A;  2ZXP A;  2WSC J;  1AQT A;  1IJD B;  2IXM A;  3HTK C;  2Q9A A;  4R4L A;  2A45 H;  2ASR A;  3EZH A;  3SYN A;  1FC2 C;  3IEE A;  1SR2 A;  2BCC G;  1SQV K;  1G2C A;  3RF3 A;  1PFI A;  3LNM B;  2R32 A;  1JOG A;  1IO4 A;  1GMJ A;  3ZTM A;  3LIE A;  4N6H A;  2QM7 A;  256B A;  1W2W A;  1M1J C;  1J1E B;  2OQQ A;  3W68 A;  4AX2 A;  5KYN A;  2Q1K A;  2JR8 A;  3MHV A;  4YXW H;  5E3C A;  2R7T A;  2A6E F;  4ULW A;  1LKX A;  4IFM A;  1KB9 D;  1YIJ P;  3EGX B;  1OVR A;  2NSF A;  2Q00 A;  4EUK B;  4H4K C;  1N7S A;  1OVU A;  3C63 A;  1QLE D;  2R5D A;  5BQG A;  2VCA A;  1MZ9 A;  3AG4 C;  4XPX A;  3R4Y A;  5F5H A;  2OG2 A;  5AVU B;  3LUT B;  2OKU A;  1TQG A;  3EHM A;  1ZU4 A;  3PLN A;  3L8J A;  1QPU A;  2CYD A;  3PTZ A;  2LCH A;  3MBG A;  1BBH A;  1PPJ E;  3B0P A;  1KU2 A;  2A06 G;  1BE3 D;  3G71 P;  2DYS C;  1KZU B;  2XU6 A;  2O01 J;  2R5B A;  3WG7 C;  2V7Q H;  1YDI A;  1RXQ A;  2IOQ A;  2N9Y B;  2OAR A;  5AW3 B;  2DB4 A;  1DOW A;  3L74 J;  2HKV A;  4OIP F;  3TNU B;  1FOS E;  2OYH A;  3I5P A;  2JX0 A;  1RE4 C;  1HE9 A;  1HH0 A;  3HRN A;  3V2Q A;  1VQ5 P;  2NUP B;  2ETS A;  1H0T A;  4EI2 A;  3LW5 H;  3H32 A;  1PD0 A;  4PAC A;  1SQB E;  2KGO A;  2HUJ A;  2WSS H;  4C3B A;  1ZRT D;  1U6H A;  1WAT A;  2H43 A;  2R7O A;  3SZR A;  1G4W R;  4R32 A;  2FY8 A;  1BCC D;  1S2E A;  1SS1 A;  1HBW A;  1VYI A;  1GL2 C;  3UIA A;  3FXE A;  4DCK A;  1YAR O;  4MND A;  1NTZ J;  2ZXW C;  2EIN C;  1SQP D;  1KOR A;  4KBL A;  1SMY F;  1VF5 B;  3L4F A;  1ZHZ A;  1QSP A;  2BEZ F;  3FXD A;  1BR1 A;  3RVZ A;  2FYU K;  1BDJ B;  4JIO A;  3EGD B;  5CCG D;  5APQ A;  4JBZ A;  2J46 A;  2L6H A;  2R9R B;  4ONS A;  5CHX A;  1WT6 A;  3JZ0 A;  1CSB A;  4NY3 A;  2J9B A;  1VF5 D;  3BCC J;  3CSK A;  3FOP A;  3V7O A;  3QVY A;  3SFE C;  2XLV A;  2FYU G;  2A68 F;  2N1T C;  3EGX A;  2YKQ A;  1ZW2 A;  2E76 B;  3F46 A;  4P9T A;  2OJQ A;  2KI7 B;  5KLI C;  2WZG A;  4PV1 C;  3IHU A;  3H1H E;  2J0X A;  3IQ5 A;  3D71 A;  4N6C A;  5BQH A;  3ZVR A;  1Z6A A;  2AEF A;  1GK6 A;  2IFM A;  2Q9I A;  5CJ4 A;  3CCQ P;  2E76 D;  4BPM A;  4H13 B;  2R7V A;  3L72 J;  5DQZ A;  2R05 A;  1URQ C;  2MYS A;  4YPC A;  4PJJ A;  3GOR A;  4J30 B;  1BSH A;  5L0C A;  2OCC C;  3M0D A;  1U7M A;  1E2X A;  2YKZ A;  4H13 D;  3KYI A;  4H44 C;  1IC2 A;  1RF1 B;  1RH5 B;  4O6N A;  2TMV P;  3MGN A;  2J45 A;  5KAF E;  3GF3 A;  3G50 A;  1CPR A;  2ZJS E;  4XQ1 A;  2IFN A;  2QA4 P;  2A0U A;  1EDL A;  5F28 E;  1M57 C;  3PJS K;  2O1J A;  2NPU A;  1FZF A;  1TKN A;  2GWW A;  2WZL A;  1OCC C;  4XPW A;  2PNO A;  1LE4 A;  3TNU A;  2C9L Y;  1KB9 E;  4D6T G;  1FZC C;  3E1R A;  4AYC A;  1S4X A;  4CDV A;  4Z9H A;  2QSI A;  5AW2 B;  1HY5 A;  2NUP A;  4JUR I;  3A11 A;  3O39 A;  3M9H A;  3H1L G;  1R8E A;  3KH2 A;  4QI0 A;  3VMZ A;  4OVN F;  1YA7 O;  2XXA B;  1YYC A;  4U5F E;  2D4U A;  3L75 D;  2WVN A;  3ITF A;  3SNH A;  3EG9 B;  2BCC J;  3A3Y B;  2IXO A;  4PR9 A;  1BE3 E;  2HV7 A;  3C1L A;  1LWU B;  1AA0 A;  1QX8 A;  1A7V A;  1ZOY C;  3CQZ A;  5CCG A;  3HD7 B;  1XZP A;  1HGZ A;  4I6M C;  4UB8 E;  2WVR A;  4MTG A;  1EDK A;  4I1L A;  2H88 C;  1SQV J;  1J1D C;  2FKW B;  1KQF B;  4XE5 B;  3EGD A;  2XND H;  3FWL A;  1KTM A;  3HD7 D;  3HNL A;  1FMV A;  3FGA D;  3GF7 A;  4L75 A;  1JPJ A;  2V26 A;  2W83 C;  4H0L B;  2Y9Y A;  4BXL A;  3OWT A;  3ZTZ A;  3U1A A;  3B0V C;  2W9Y A;  3DD7 A;  2H8P D;  2ZT9 B;  3I4U A;  4H0L D;  3NTN A;  3S1K A;  3W2W A;  1ZRT E;  4KC9 A;  2YZS A;  2AWY A;  3K1I C;  2CCY A;  2I8D A;  3SXY A;  2AWC A;  3H1J G;  5JUA A;  5K0I A;  4GOD A;  2DYR C;  4WVZ A;  2ZT9 D;  4G78 A;  2OYO A;  3AEF C;  4WY4 B;  3TYY A;  4L73 A;  2B0H A;  1ZU5 A;  1SQP E;  4I2L C;  4YTP C;  3Q1M A;  3U0C A;  1TWA A;  4BJ1 A;  1T01 A;  5KLV K;  2FXO A;  4LC1 A;  3RL0 g;  1LS1 A;  1XZQ A;  3F5H A;  4JCH A;  1RF1 A;  1KIL C;  4WY4 D;  3AE4 C;  3LEV A;  1N1C A;  3RYL A;  3KXD A;  3LLK A;  2OYI B;  5KAF H;  1GTW A;  2O9X A;  2E5T A;  3H1K J;  4BJ5 C;  2K9Y A;  4C7N B;  1FZE A;  1HTL C;  1HGV A;  3T6J A;  5TIS H;  4NC3 A;  5KLV G;  4XPY A;  3K33 A;  1J8Y F;  1ZVZ A;  1HMD A;  3JTL O;  4DOZ A;  2C03 A;  1G8X A;  5HV9 A;  1KB9 H;  4I7Z B;  3O10 A;  2KSE A;  4HH2 A;  4DJ9 A;  2GUS A;  4Q4Z F;  1S9K E;  1L0L K;  1XWJ A;  4HB1 A;  2HLO A;  3B8E B;  2HFI A;  5AVZ B;  4BJ6 C;  3VF0 A;  2J58 A;  1TU3 F;  2YL1 A;  3IQ6 A;  4W8K A;  4A2N B;  2XXA A;  4Y99 C;  4MTF A;  3H2U A;  1AQ5 A;  1EZV D;  3EG9 A;  1ORJ A;  1X9V A;  2D2C B;  3GHG C;  3AE6 C;  3U9J A;  1EI7 A;  3C8V A;  2ZD9 A;  2E5Y A;  2QE7 H;  1LWU A;  3VYI A;  1VOM A;  3IAO A;  4XEF A;  3SWK A;  3HD7 A;  2B0J A;  3CX5 H;  3KMI A;  2FYU J;  2H8A A;  1L0N D;  2D2C D;  3DAF A;  3II6 A;  3TGU G;  1AFO A;  1NFN A;  4UB8 H;  4NPE A;  1DEE G;  1VYK A;  3U3B A;  3AED C;  1SQX D;  4EWC A;  2M3B A;  1JNM A;  3QMK A;  4BG0 A;  3RW0 A;  1WGW A;  1MKM A;  3QTH A;  2C04 A;  4DOJ A;  1Q2N A;  2BE5 F;  1T6I A;  2OQM A;  2EPL X;  4U9E A;  1YJW P;  4IL6 E;  2WSF H;  3U59 A;  1H8A A;  3MIW A;  5AW9 B;  2M64 A;  5TJ5 E;  5APY A;  4A4A A;  4EIY A;  4XLN F;  2LXB A;  3L75 E;  1GD2 E;  1JTH B;  4XLP F;  2I1K A;  2P1J A;  1EZV I;  5APT A;  1SQQ K;  2YHS A;  3SFD C;  3MTU E;  3BAS A;  1T2K C;  2R7R A;  2P7V A;  3NXS A;  5EK0 A;  5CBN A;  4Z9I A;  1JY3 N;  2LFF A;  2QJY C;  1R5S A;  2Q5U A;  1JCC A;  1V74 B;  2XSE A;  1VL2 A;  4D6T J;  4KNW A;  5DJU B;  3FOO A;  1GS9 A;  2YRF A;  3JT1 A;  4DJG A;  2VAS A;  5JVE A;  1HE1 A;  1JY3 P;  4W80 A;  3S84 A;  4CS8 C;  2OYI A;  4C7N A;  2XLE A;  1FAV A;  4IL6 X;  1NU1 K;  3EH1 A;  1QL2 A;  1RF0 C;  3C8G B;  1KFM A;  2E87 A;  2FXP A;  2RMZ A;  2WB7 A;  2I8B A;  2IXP A;  5GPG B;  3KPE A;  4OGQ B;  3JSE O;  1JY3 O;  1NOH A;  2HV6 A;  5F5F A;  4NQF A;  2A1D D;  3C8G D;  3TJ5 A;  1Z23 A;  3V6I A;  1SLQ A;  1MFT A;  4CDY A;  1G1J A;  4CDA A;  2WSE H;  5DQT A;  3ABL C;  3KKB A;  5JLI A;  4OGQ D;  4CX9 A;  1KN7 A;  1OCZ C;  5B3S C;  3BVH A;  3L37 A;  1OW7 A;  5KJ7 D;  3R2P A;  3LNR A;  3CWB E;  1JR8 A;  1PGJ A;  2P61 A;  3NKD A;  5A69 A;  3AE7 C;  3I5C A;  4DVZ A;  4ZKU A;  5CJ0 A;  3L74 G;  5L3Q A;  2P1A A;  3LS0 A;  3IFM A;  2XNX A;  4PD4 D;  3S4R A;  4CJG A;  3H1I D;  2XS1 A;  4XA4 A;  4U5C E;  1N7L A;  1OZH A;  3B5N B;  1Q82 Q;  1USE A;  5KYU B;  2KNH A;  4JEB A;  3RK2 B;  1NTM K;  1VPC A;  1SZI A;  3CAX A;  1FE6 A;  3JSV C;  2FFD B;  1OR3 A;  3AEA C;  2M3E A;  2A06 D;  1NTZ K;  4LDK A;  1ZR2 A;  4JC7 A;  2ZXO A;  3LID A;  4O6M A;  3B5N D;  2IM8 A;  4IL6 H;  1N7S C;  3RK2 D;  1JTH A;  3FX0 A;  2JPU A;  1EZV E;  1NTM G;  2XV5 A;  2XM0 A;  3NDB B;  4XEK A;  3Q5S A;  1FBM A;  3L73 J;  2YIU C;  5AVW B;  1NTZ G;  3AE2 C;  1TWC A;  3K6B A;  4CJO A;  2C0X A;  3MZW B;  5KLV J;  1OX3 A;  3OJA B;  4FAP B;  1L0N E;  4BRY B;  3CCJ P;  3Q7G A;  2ZXX A;  3SXK A;  1WRG A;  1IZM A;  3KDP B;  4PD4 I;  1CI6 B;  1MND A;  1LT9 B;  2LP4 A;  1SQX E;  2B9B A;  2JJL A;  1JB0 J;  2LKM A;  3AOU A;  1HUC A;  2GFH A;  3KPH A;  5E3A A;  2J9V A;  2QJK C;  2SPZ A;  3Q2Y A;  3CZ6 A;  3C8G A;  2K1A A;  3JCU Q;  2OYH C;  4NPD A;  2HMQ A;  3ZDL A;  1C03 A;  5FCL A;  1G1I A;  1L0L J;  1J8M F;  5AW4 B;  3N4X A;  4RO0 A;  1ZR4 A;  4IB4 A;  5KJ7 A;  3FXH A;  1FDM A;  4OIQ F;  4YL0 A;  3HE4 B;  3DJU B;  2XL6 A;  3UNG C;  4YT4 A;  1GW3 A;  1NZE A;  1EQ1 A;  1FZA A;  1OXZ A;  3H65 A;  4JYC A;  5DS6 A;  3MYI A;  4JTA B;  5A6A A;  4AUW A;  1H88 A;  2MWQ A;  2HSQ A;  1GU5 A;  4NTA A;  3TQO A;  1SYQ A;  2L6F A;  3PH0 A;  2L91 A;  2VCB A;  1X8Y A;  1JMW A;  4FWV A;  4NCQ A;  1W2E A;  2FBW C;  2JP3 A;  1RY3 A;  1FFH A;  3V5Z A;  1NG1 A;  2IBZ G;  4P9F A;  1QL1 A;  1YTZ I;  2OTK E;  1ZN5 A;  2LFD A;  4HFF B;  4K3A A;  4U5D E;  1K9M Q;  3GG2 A;  1S7Z A;  5DVW A;  1VQ9 P;  1NTK K;  1JY2 O;  1OFC X;  3B5N A;  1PGP A;  4M3L A;  2OTJ P;  2MJZ A;  1J1E C;  5KYU A;  3L36 A;  2YLG A;  5T3W A;  1QLE C;  1D7M A;  2FFD A;  4ZMD A;  2IBF A;  3QZC A;  1X79 B;  1L4A B;  1T5O A;  2K9J B;  5KYW B;  1SQQ J;  4XWJ A;  4N3Y B;  1FZG A;  1H7I A;  3Q7L A;  2CW0 F;  1EQ7 A;  4MVR A;  3RH3 A;  4GEH A;  1ZHW A;  3T9O A;  3OA1 A;  3V5X A;  2FFH A;  2YO3 A;  3L35 A;  3RBZ A;  5KKZ B;  2PBE A;  1SQV G;  3PP5 A;  1M56 D;  4BRY A;  4WBA A;  4U5E E;  3M0D C;  3M91 A;  4HE8 D;  4L6R A;  3POV A;  4PD4 E;  1CI6 A;  3H1I E;  1LT9 A;  2GA1 A;  3H1L D;  3DKA A;  2HS5 A;  1E5W A;  3G9R A;  2P7J A;  2YMK A;  1LVK A;  1A7D A;  3SSU A;  4IAQ A;  1NU1 J;  1ZP0 C;  1WAS A;  3DE9 A;  2D5R B;  1QVX A;  3ZSU A;  5JT4 A;  2J7P D;  2KUB A;  2F22 A;  2A06 E;  3SWF A;  1VQK P;  1RE3 A;  5AVR B;  3CX5 D;  3G3Z A;  2ICW G;  3S28 A;  4N4W A;  1BGY D;  1DEB A;  5APW A;  1VQO P;  2PX3 A;  3HE4 A;  2HG5 D;  2GM4 A;  5COF A;  1IK7 A;  2R03 A;  3U3F A;  3W2V A;  4N78 D;  1KB9 I;  4HKZ H;  4O79 A;  1EXJ A;  4JKV A;  2XRH A;  5C39 A;  2JWD A;  3L71 D;  2HOD B;  3I5Q A;  3CWB J;  3H1K G;  4R4M A;  5CCG C;  5COM A;  4H54 A;  1RQU A;  3JYY A;  1CPQ A;  3ZQY A;  2BC5 A;  2VRS A;  1VF5 C;  3DMD A;  2Z4E A;  3H1J D;  5B5E E;  3U5S A;  5D92 A;  1QZX A;  2ZAE B;  2DI3 A;  4CSA A;  5AVT B;  5AVS B;  3WUU A;  2H7H A;  1Z3I X;  3IPM O;  1LTS C;  1NTM J;  2L7A A;  5D91 A;  3CX5 I;  4C7R A;  4EYY Q;  4OIR F;  2W27 A;  4PJ0 E;  2RH0 A;  1ORS C;  3RK3 B;  5AW6 B;  2LK4 A;  1BR2 A;  1K04 A;  4U5B E;  1L4A A;  2K9J A;  5KYW A;  1SFC B;  2E76 C;  3ATP A;  3L70 D;  1U7J A;  5CIV A;  1LE2 A;  3RK3 D;  3EFO B;  3B0U X;  4DBQ A;  1Y9B A;  1GQA A;  3U1C A;  3C18 A;  3JCU H;  3HE5 B;  1SFC D;  1IW7 F;  4H13 C;  4Z1M H;  2NRG A;  1OWA A;  4X0R A;  5KAI H;  3M4C A;  1TFK B;  2CDQ A;  1GZL A;  2HSB A;  3A0B E;  4AQR D;  1N8R Q;  1VLS A;  3AGT A;  1U0B B;  2FYN B;  1RF1 C;  3LAY A;  2J7P A;  2KZI A;  3FHD A;  3EHN A;  2KJG A;  4GKG A;  3D70 A;  2KW3 C;  4PD4 H;  2P67 A;  4L74 A;  1MMG A;  2HPC B;  2KLU A;  3HTK A;  5T3T A;  2XLW A;  2GDC A;  2W45 A;  3N7N A;  3M0A A;  1D0Z A;  4PFP A;  3CCE P;  4EHP A;  1XTC C;  1APC A;  1VB5 A;  3BRJ A;  2AXT E;  1VQN P;  2OU6 A;  3CLQ A;  2JWA A;  4IFF A;  2V7Q J;  5AVY B;  3WMM 0;  5TIS E;  2G3A A;  3TGU D;  2LSE A;  3DWW A;  2HZ8 A;  4IWB A;  4KHX A;  2KS1 B;  2UUI A;  3LLI A;  1MFZ A;  2E74 B;  3HNJ A;  1QVF O;  3ZC4 A;  1G5Z A;  3TD7 A;  4PV1 B;  1OCR C;  2WQY C;  2XS8 A;  4UB6 E;  3L1M A;  1FAP B;  2Q9B A;  4U3F J;  5B1A C;  1LWU C;  2HOD A;  3LW5 J;  2Y3B A;  2E74 D;  1PP9 J;  4LER A;  4MVU A;  2EIJ C;  2EIM C;  3HD7 C;  2R44 A;  3TOM A;  4JVS A;  3KHU A;  1JPN A;  3U8P A;  2P2U A;  2FAP B;  2CPB A;  1OQC A;  2UWJ E;  1N73 B;  1DH3 A;  2CNW D;  4GQH A;  4OIN F;  4RKU J;  1NTK J;  1LTJ B;  1A02 J;  1YHQ P;  1D1A A;  5B5E H;  1CW5 A;  1IFI A;  2HJM A;  3AE1 C;  1GDT A;  1NJI Q;  4H0L C;  3CX5 E;  5L0F A;  3USS A;  5BU8 B;  2H7V C;  3RKO F;  3V2R A;  1BGY E;  1K73 Q;  4PJ0 H;  1T8Z A;  1Z5Z A;  1QVG O;  2ZT9 C;  4Y28 J;  5HSW A;  4YT5 A;  1SFC A;  1E86 A;  3C62 A;  3UMK A;  1OXK A;  1UIX A;  4XEV A;  2P6V A;  2Y3H A;  4N78 E;  4YK5 A;  3MP7 B;  1ZHX A;  3EFO A;  3T4R A;  2Y0E A;  4IJJ A;  1NGM B;  1LP1 B;  4OIO F;  1K40 A;  2IYL D;  1W5C E;  3HE5 A;  5APV A;  1A41 A;  3L71 E;  1VQ8 P;  2AVK A;  3G4S P;  4FES A;  4WY4 C;  4WGZ A;  3W67 A;  1KYO D;  3A9C A;  4JTC B;  3V4W A;  3V4Q A;  2BL2 A;  2EPO A;  2KK1 A;  4MW3 A;  1RCP A;  3A0B H;  4U5H A;  2IZ0 A;  2J8W A;  1M8O B;  3H1J E;  1PL5 A;  3VN0 A;  4WAB A;  4K35 A;  2A69 F;  4MS2 A;  3EWK A;  1BCC E;  4DT0 A;  2HPC A;  2OYI C;  1EXI A;  1YZC A;  1LJ2 A;  3KYQ A;  2UUH A;  4AE4 B;  2YKO A;  1HJ0 A;  4W8P A;  3NYM A;  4MN4 C;  1T6Q A;  1G4U S;  1H9T A;  4G0H A;  3A0H E;  2IZ1 A;  2IX7 C;  1H89 A;  2P10 A;  1EKY A;  1SQP K;  1Q0K A;  4C3D A;  3L70 E;  5EGY A;  4I7Z C;  2CPS A;  3L73 G;  2PX0 A;  3RK3 E;  3L74 D;  2AXT H;  4ASV A;  2OJE D;  1QEX A;  2MHR A;  3MLG A;  2Y69 C;  1E85 A;  3HUS B;  2DW3 A;  2KS1 A;  4PFO A;  1Q0D A;  4QDL A;  3KZI H;  1KYO I;  2C0W A;  2XDJ A;  2FGY A;  2R3S A;  3W4Y A;  2D2C C;  2Y3D A;  5AW7 B;  4MVQ A;  3ABM C;  2CNW A;  2B87 B;  3K5B A;  4UB6 H;  4RD9 A;  1FS0 E;  1LTT C;  4I1M A;  1SQB J;  4QMA A;  1DX7 A;  1N73 A;  3AG1 C;  3ABK C;  1WTY A;  1LTJ A;  4B86 A;  1L0L G;  2W6J H;  4CS9 A;  5BQI A;  2X51 A;  1OVV A;  2PFX A;  1L3P A;  2K37 A;  2YL3 A;  3E9V A;  1PIX A;  3UR3 C;  3TGU E;  4LAC B;  1YZA A;  3OA7 A;  1HJB A;  1L7C A;  5AVV B;  1FNT c;  3BCC D;  3PRJ A;  3FVY A;  1RKE B;  1LP1 A;  5CCH D;  3RQE A;  3AE3 C;  4WJ0 A;  3FAJ A;  2LQG A;  3VYW A;  1LPE A;  2AU5 A;  2J59 M;  3TF5 A;  3GWN A;  1YJG A;  3EJN A;  1TFO B;  2ZVO B;  3RQG A;  3H25 A;  2W6A A;  2VH3 A;  3TK1 A;  2YNY A;  4B6I A;  2Q6Q A;  3V2N A;  3EQ2 A;  5B3I A;  5B1B C;  4I1O B;  1OR2 A;  3H1H J;  3L72 D;  2KNC B;  4EBJ A;  3J06 A;  1E84 A;  2H7B A;  4YN0 B;  1AUE A;  1KQL A;  2ZXR A;  4AE4 A;  1YVI A;  2PFD A;  1U89 A;  3GEH A;  1KQS O;  3AEC C;  3M15 A;  1SQQ G;  3JRM O;  3CCV P;  1CGM E;  3OW2 O;  1FTS A;  4Q7C A;  4J7Y A;  3A0H H;  5APU A;  3LS1 A;  4IRU A;  4NTB A;  2Y39 A;  4OGQ C;  2ITA A;  2PGD A;  1VTM P;  4GT1 A;  2FYZ A;  2A6H F;  3HNK A;  2XLH A;  3RL0 B;  5KJ7 C;  2IBZ D;  4EKW A;  3HUS A;  4MVS A;  5B66 E;  1BDC A;  5L0I A;  3ABV C;  2NPS B;  2Q7C A;  4IFD K;  1ZZP A;  2YQY A;  1KYO E;  3GW6 A;  2WL8 A;  3K1I A;  3DJN B;  3RL0 D;  3NRH A;  4CS7 A;  5L3V A;  3FMS A;  1SF8 A;  4HFK B;  2B87 A;  3Q5R A;  2AXC A;  1JOC A;  3D6Y A;  5AC5 A;  2NPS D;  2PP4 A;  2KYH A;  1NU1 G;  1J2J B;  2PP6 A;  2BCC D;  3O6Q B;  2QTV A;  3AJM A;  3AEG C;  2E75 B;  3EH2 A;  1JMM A;  4ZLD A;  2WPQ A;  4PJM A;  2AEM A;  2GUV A;  4BWN A;  3B5N C;  1YJN P;  4J32 B;  2B88 A;  1OMI A;  1BE3 J;  2QY9 A;  2E75 D;  2XLM A;  3RK2 C;  3M79 A;  3EPV A;  1SQV D;  3MFN A;  3L74 E;  2FFD C;  5CCH A;  1ST6 A;  2Q9C A;  3LES A;  2KSF A;  3M9B A;  2L81 A;  1KD1 Q;  3NG1 A;  4ANJ A;  2JKV A;  4K0D A;  4P6I C;  4U7J A;  3NYL A;  2WTY A;  3IN6 A;  2WWW A;  2NUT B;  1EA8 A;  4D4X A;  3AE8 C;  1RKE A;  2O01 N;  1N86 A;  3CWB G;  4IAR A;  4KT0 J;  2EPK X;  3MUD A;  2PRR A;  1ZXG A;  2QE9 A;  4IOI H;  4YL1 A;  1YAU O;  1VQ4 P;  1UII A;  1A7E A;  2K88 A;  2ZVN B;  5CI8 A;  2R02 A;  2EPM X;  2KNC A;  3M4B A;  1LT9 C;  4EDF A;  3QW0 A;  2XZR A;  4G7Z F;  5APX A;  2L5G B;  2L9J A;  4J7T A;  1Q81 Q;  1Z7Q c;  3U9M A;  1YIT P;  3H6P A;  3X2Q C;  1BCC J;  5EFW B;  2W4B A;  1B68 A;  3M1C B;  2HR3 A;  2WSC H;  2A45 G;  1FMW A;  4JQ0 D;  3C7J A;  1SQP J;  2H7O A;  2K3R A;  3PHL A;  1RE3 C;  3E70 C;  3H1K D;  3RVY A;  2KZJ A;  1EZV G;  1L0N K;  3BCC E;  1ZHY A;  4BJT A;  3QW1 A;  3F89 A;  4F4B A;  1Y47 A;  3VRC A;  1BSN A;  1OW6 A;  2IYO A;  1SQX K;  2YEV A;  2NPS A;  5B66 H;  4DRH B;  4DRJ B;  4O9B A;  1L0N G;  2QJP B;  2I15 A;  4OH8 B;  1Z63 A;  1KYO H;  3ZDM A;  2JD3 A;  1F1M A;  1DD4 A;  2MKV A;  3L72 E;  1JY2 N;  5TJH A;  4JJF A;  1Q0F A;  3ZWI A;  2WSE J;  2X0C A;  1NVO A;  3V5B A;  3O6Q A;  1P84 D;  1RJ9 B;  1BZ4 A;  5AC4 A;  3JYH A;  5M1B A;  2YXQ B;  1MMD A;  3LEO A;  5L8R J;  4TT3 H;  1D0Y A;  1ZW0 A;  3L8I A;  4CSA C;  4EBK A;  1YQ4 C;  3B9Q A;  1S1C X;  3EQL F;  5CI9 A;  1JY2 P;  2FYU D;  2BAS A;  2R7W A;  3GAN A;  4MQ9 F;  3EFG A;  2O01 H;  3IF4 A;  1M1K Q;  1PCX A;  2OEX A;  1Y4C A;  2J0W A;  2IBZ E;  5AVX B;  1W2B O;  1NWQ A;  1MNE A;  2I1J A;  2XLO A;  3UGP A;  1JMB A;  4C7O B;  1LTG C;  3HNI A;  2NUT A;  1USD A;  2M5A B;  4I44 A;  2AP3 A;  3CI9 A;  4U3F G;  2KP8 A;  3CME P;  3B71 A;  1M56 C;  1PP9 G;  4LLC A;  3O55 A;  3GEI A;  4O7G A;  2R25 A;  1M2O A;  5KKZ C;  1WN0 A;  3CCL P;  3T6B A;  3A5T A;  3TK0 A;  3N2Z B;  3DE8 A;  1P84 I;  2BCC E;  1ZW3 A;  1NTK G;  4EIJ A;  2NSG A;  1AVO B;  3S27 A;  2M8R A;  1LS4 A;  3L75 J;  3JCU E;  3AG2 C;  1L4A D;  1IFJ A;  3MD0 A;  4ZNC A;  5KAI E;  3PCV A;  1VQM P;  4DBR A;  4UDV A;  5AW0 B;  4RDA A;  4G7O F;  2R3C A;  4D6T D;  4YL3 A;  2QLA A;  1SQV E;  2J9W A;  3VAY A;  1AEP A;  3QWO C;  2LXC B;  3KYJ A;  1U57 A;  4LGD E;  2VC9 A;  3NMD A;  4D4N A;  1M90 Q;  1NU9 C;  5A6B D;  3SP1 A;  1MUU A;  4DRI B;  1O87 A;  3HTK B;  2YVK A;  2R7S A;  4NTF A;  1EC5 A;  2RN0 A;  2YMY A;  3CC7 P;  3AEE C;  2WPV B;  5DLJ A;  1DD3 A;  4MW8 A;  2PAJ A;  4OWF A;  5COG A;  4JPZ B;  2YL7 A;  1M1J B;  3B4S A;  3H1I G;  1LIH A;  3W8I A;  3US6 A;  3G6E P;  3RQF A;  1RJ9 A;  1VMA A;  5E79 E;  2Q3T A;  4YT8 A;  3UMH A;  1PPJ G;  1KFN A;  3I55 P;  4CIP A;  3P32 A;  1ZHT A;  1LI7 A;  2YL0 A;  4JW1 A;  1S05 A;  4E7Z A;  3H1K E;  3L34 A;  4O6Y A;  4JF7 A;  3RK3 C;  2G3K A;  5CMZ A;  4E17 A;  1YQ3 C;  5KYX B;  3PDM P;  1I4Y A;  1VDF A;  3K1H A;  2ZYA A;  1SFC C;  4WGY A;  2QNL A;  5BUO A;  3NMJ A;  1IFM A;  1ZYR F;  1SQB K;  3AQB A;  4C7O A;  2YWA A;  3S9O A;  2M5A A;  2JDI H;  1L2P A;  1AV1 A;  1LNQ A;  1C17 M;  1BR4 A;  1SQB G;  4GIF A;  2OGU A;  3P8C D;  1P84 E; 
#chains in the Genus database with same CATH homology
 1JB0 J;  3D70 A;  3G9R A;  1O3U A;  4EBJ A;  2YMK A;  3EWK A;  3Q3D A;  3GM2 A;  1Q90 D;  2FYN C;  2QIW A;  4IL6 X;  1EXI A;  1ZP0 C;  2QJK C;  2JX0 A;  3GMA A;  3Q2Y A;  3C8G B;  1KQG B;  1QVX A;  2H89 C;  3C8G A;  1HJ0 A;  1KNY A;  2FXP A;  2L6G A;  1NYH A;  2QSI A;  4I7Z B;  4OGQ B;  3O10 A;  3D6Y A;  3AEC C;  2P10 A;  3BRJ A;  1K05 A;  2WSF J;  1U57 A;  4NQF A;  2BEQ D;  1R8E A;  4I7Z C;  3C8G D;  4OGQ C;  3AEB C;  1TU3 F;  2V7Q J;  3RK3 E;  2G3A A;  1PV3 A;  3GM1 A;  4OGQ D;  4GDO A;  1OW6 A;  1WMK A;  1IK7 A;  1WWP A;  1OW8 A;  3U3F A;  2E74 B;  4R32 A;  1RQV A;  1OW7 A;  2D2C B;  2JO1 A;  3AE6 C;  3ABV C;  1EXJ A;  4PV1 B;  3C8V A;  1ZZP A;  3AEE C;  4YXD C;  1ZOY C;  3IAO A;  2E74 C;  2WPV B;  2WQY C;  2WSC J;  4XEF A;  1KOR A;  2D2C C;  2L6F A;  1DD3 A;  4R4L A;  3AE7 C;  2NZ2 A;  3LW5 J;  1VF5 B;  2E74 D;  4R4M A;  3AE9 C;  2FBW C;  1KIL E;  2BEZ F;  1DD4 A;  1RQU A;  2D2C D;  2H88 C;  1KMI Z;  2JP3 A;  2MKV A;  2QJP C;  1KQF B;  3Q5P A;  3JYY A;  1JOG A;  3TUL A;  1GMJ A;  1VF5 C;  1KTM A;  2WSE J;  3AED C;  2L6H A;  3FGA D;  3GF7 A;  3AJM A;  2OQQ A;  3AEG C;  3O6Q A;  1V4A A;  2E75 B;  4H0L B;  3JZ0 A;  3RQF A;  4RKU J;  1VF5 D;  5M1B A;  1WTY A;  1MKM A;  5L8R J;  3AE1 C;  4TT3 H;  1HF9 A;  3GLM A;  3SFE C;  3L8I A;  3D6Z A;  2E75 C;  4H0L C;  4EBK A;  2Q00 A;  1AJY A;  1YQ4 C;  1S1C X;  2ZT9 B;  3Q5R A;  1ZME C;  2E76 B;  3AEA C;  1OMI A;  1FDO A;  5KLI C;  2LK4 A;  2E75 D;  4H0L D;  4PV1 C;  1K04 A;  1ZRT E;  3D71 A;  3MFN A;  1PIX A;  2ZT9 C;  2E76 C;  2G8Y A;  2IDB A;  4Y28 J;  1YQ3 C;  4PV1 D;  2JPU A;  3R4Y A;  1S5L X;  1UIX A;  4XEV A;  3SFD C;  2J5U A;  3K7D A;  2ZT9 D;  2E76 D;  4H13 B;  4U7J A;  3Q5S A;  4XEK A;  1Y9B A;  3IN6 A;  2YIU C;  1NGM B;  3AEF C;  3AE2 C;  3C18 A;  1DIP A;  2YWA A;  3L8J A;  3AE8 C;  3RQE A;  3AE3 C;  4H44 B;  1FDI A;  3S9O A;  2QJY C;  1K40 A;  4H13 C;  4Z1M H;  1UFB A;  4YTP C;  3Q1M A;  3B71 A;  3U0C A;  3GM3 A;  1WOL A;  2PBE A;  4KT0 J;  2HSB A;  3RL0 g;  1VL2 A;  4H13 D;  4H44 C;  3RQG A;  3H25 A;  2KK1 A;  5KKZ C;  3GF3 A;  3AE4 C;  2O01 J;  4XFJ A;  4H44 D;  3T97 B;  5F28 E;  1PL5 A;  3AE5 C;  2K9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...