1PV3A

Nmr solution structure of the avian fat-domain of focal adhesion kinase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
146
structure length
146
Chain Sequence
GSPGISGGGGGIRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Focal Adhesion Targeting Domain of Focal Adhesion Kinase Contains a Hinge Region that Modulates Tyrosine 926 Phosphorylation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 52
structure length 146
sequence length 146
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1pv3A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1pv3A02
2L6GA 1JOGA 3AE2C 4XEFA 3L8IA 3AEGC 2G3AA 3RQFA 3AE3C 4EBKA 3GM3A 1WOLA 3AE9C 3SFDC 2Q00A 1WWPA 1WTYA 2H89C 1OW6A 1UFBA 3AEAC 3BRJA 3ABVC 1K05A 3AE8C 1K04A 1KNYA 3AEBC 3SFEC 3AEEC 2WQYC 1YQ3C 4XEVA 3AE6C 1YQ4C 3AEDC 2JPUA 4YTPC 3GM2A 3U0CA 2HSBA 3AEFC 5F28E 3JZ0A 3TULA 1QVXA 2PBEA 3AE4C 1KTMA 2KK1A 1ZOYC 3AECC 1V4AA 1K40A 1ZZPA 3GM1A 1OW8A 1ZP0C 2JX0A 3B71A 3K7DA 1OW7A 3C8GB 3U3FA 1PV3A 4XEKA 3RQEA 2FBWC 2H88C 2LK4A 3RQGA 2L6FA 1O3UA 3O10A 3C18A 2L6HA 3L8JA 4YXDC 4EBJA 4NQFA 2YWAA 3S9OA 3MFNA 4R32A 3AE5C 3AJMA 3C8GD 3AE1C 3JYYA 3AE7C 3C8GA
chains in the Genus database with same CATH superfamily
2Q5UA 1JTHB 1KFNA 5JUAA 2R03A 2E74B 1ORSC 4IFFA 4EI2A 3DE8A 4G0HA 3MTUE 1Q7YQ 5AW7B 2YXRB 2J9VA 3D6ZA 4EOTA 2WPSA 1AFOA 3Q5RA 3ZWIA 3W2WA 1M1KQ 4WVZA 1SQQK 1SQQJ 1NFNA 3U2MA 1NHLA 5BUOA 4YWQA 1L0LG 3OW2O 1X79B 1ZLLA 1EKYA 1E85A 4JE9A 3MX3A 1NTKD 1JRAA 4N6CA 1S4XA 5DS6A 5GPGB 4MVRA 4N4WA 1LT1A 3MBGA 5E2QA 3L72D 1YA7O 3S90A 3O6QA 1CGNA 3IEEA 1KN7A 4O6MA 1A7EA 4LDQA 1BCCD 4IGGA 1KQFB 1SFCC 1HW1A 1S2EA 4WGYA 3L73D 4OGQD 4BRYA 1KTMA 2QLAA 2GFHA 2KNCA 2W6BA 1W5CE 1J1EB 3CCRP 2AXTH 5GTHE 4OIOF 4ONSA 3N4XA 4MNDA 4YPCA 1EC5A 2FGYA 3W2VA 4N3YB 4JRZA 4GKGA 1M57C 1NU1D 1KQSO 3RQGA 4PV1D 1P84H 1MMNA 2IXMA 1EDIA 3VP9A 4HEAJ 3H2UA 3L8JA 3A2AA 5CBNA 3IQ5A 3M0DC 3B9QA 5KYWA 2FYZA 1SQPD 1BGYG 3CD6P 2YKPA 4PJMA 3JYYA 3PTZA 4JCHA 5L3VA 4CDYA 3U3BA 2OGUA 1JAFA 1QKRA 2J9UA 5DVWA 3LS0A 3NYMA 2GDCA 4EBKA 5AW9B 1SQPG 4GODA 4ZLDA 1WTYA 5CCHA 1EZVG 3L4FA 1AQ5A 1URQA 1KD1Q 5BU5A 3RL0B 4Z9HA 2QJKC 5AGFA 1N7SD 2C0WA 2J58A 2RMZA 1LPEA 1NAYA 3U5SA 1H88A 4KNVA 1PD0A 2PX3A 1QLEC 3LEOA 1I5NA 3QH9A 1CW5A 1WASA 2NUTA 2WSFH 1VQMP 1ZN5A 1S3JA 2R7TA 1SQXE 1RQVA 1OXKA 5JVEA 3M4CA 5BU8B 4JEAA 4DOZA 2Y39A 2RN0A 3VOPA 2CPBA 1D0ZA 2KZIA 1ZZPA 4JC7A 3CCQP 1JCDA 1PP9D 3H65A 2DW3A 3PLNA 4JF7A 5KAIE 3SP1A 5BQIA 5CJ0A 1LVKA 1ZHYA 1Q0MA 2A45G 4P9FA 4CDAA 3L74G 5K5GB 3C1LA 3B5NB 2KC3A 3RQEA 3ZDLA 3JT1A 3ZQYA 3G3ZA 2P1JA 2KSFA 3C9IA 4ZLCA 3CEXA 3CC7P 1VMAA 3EPVA 3KXDA 2D2CD 2XDJA 2K9JA 2ZXEB 5KLVG 1N73C 4D6TE 3US6A 4Q5SF 4J30B 5AVTB 3HKKA 2V7QJ 1GS9A 1Q0KA 1M56C 1RJ9A 5APQA 1D0XA 1FZGA 1LI5A 5L0CA 4LLCA 5KAFH 2LFDA 1M8OB 3HE5A 1SR2A 3S0XA 1LI7A 2K9YA 1L0NJ 2JO1A 2IYPA 2R7VA 5HV9A 1LTBC 1RKEA 5KLIC 1NU1E 1UIIA 3AEGC 2XL4A 2R7WA 4C46A 3JYHA 2KB7P 3HTKC 4FWVA 3QW0A 1BCCE 2BCCG 2XLHA 1N73A 3L73G 1APCA 3LLKA 2ZJSE 5BQHA 4CX9A 2E76B 2BC5A 3H1JG 3WUVA 4ER9A 4JKVA 1T6UA 1BE3D 1YLMA 2A45H 2NSFA 3O55A 3PMRA 3H25A 4LACB 2LKMA 3CXHH 3JCUQ 2LR2A 2HUJA 3QTHA 1FBMA 3NFQA 1A7DA 4DVZA 2FXMA 1LE2A 3FOPA 1PZQA 3BATA 3L71G 1PIXA 2KLVA 1FU1A 1ZYRF 1VQKP 4GEHA 2B87A 1SZIA 4L76A 2JPUA 3KMIA 1RF1B 1NTKG 1VQ4P 4TT3H 1ORJA 1OVRA 3MD0A 4DRHB 3O8ZA 3RVZA 3W68A 3M79A 3WUUA 2WT7A 2WITA 2QEXP 5AVQB 3M1CB 2HFIA 1OWAA 4I3MA 1EXIA 5CBOA 1KILE 2BEQD 1WT6A 1J1DC 3SXYA 5KJ7C 2OARA 2JX0A 1JOCA 1PCXA 1FOSF 1D1CA 3KPEA 4K1OA 2KS1A 2OEVA 5KYXB 3LIEA 1OFCX 1NVOA 3BCCE 3U3FA 2ZVOB 3OEOA 3LESA 3UGOA 1BR4A 1R5SA 2XLMA 3I5QA 5DS4A 3L75G 4O9BA 4M63A 1H6GA 2KGOA 3WG7C 2RH0A 3PP5A 3CX5D 3N2ZB 3VYWA 5CCGC 2OTJP 4CSAC 1XZQA 2P1AA 3MLGA 3S29A 4UDVA 3S9OA 1BGYJ 3EFOA 3AE5C 3AJMA 3CPWO 3E9VA 2C9NY 3PHF2 1RHZB 3KH2A 2VH3A 3NDBB 3EG9B 1QSPA 3DAFA 2R25A 3RL0g 1B68A 1HMDA 3DWWA 4H44B 2Y0DA 2W9YA 1JCCA 2HODB 1W2EA 3PH0A 4IJJA 3F46A 4J7YA 1HWTC 3C8ZA 1PPJE 4CS7A 1GM5A 1XWJA 3G4XA 3L70G 2FYUE 2VC9A 1SQPK 3NYJA 2J7PA 2KXPB 4MQ9F 1RH5B 1I4YA 1UFBA 5L0GA 5AC4A 5DJUB 3KL4A 1SQVG 2CW0F 4OH8B 2E75C 3CWBD 5B1AC 2IXOA 3JSVC 2J0XA 2Y3GA 4CSAA 3AEDC 2NPSD 1NTZJ 1U7MA 1I4ZA 5L8RJ 5F28E 1X0TA 3E70C 3JZ0A 1VQ5P 3H1IJ 3A9CA 5JT4A 2KIKA 1AJYA 2YMKA 1QVXA 3UMHA 3AE4C 1Q86Q 2KK1A 1AUEA 1YVIA 4GOFA 5B66E 1LTJC 1OZHA 3U1AA 4IFMA 3L75D 2WPQA 5CCGA 1O87A 4XLPF 1G1JA 3SNHA 1JY2N 1QEXA 4PJJA 3W67A 4BWNA 2OEXA 1NG1A 2OJQA 4OIRF 1PPJD 2YL1A 4U3FD 2W90A 1EQ7A 3Q7LA 2ZT9C 3EG9A 2HFED 2HYNA 1FDMA 4W7ZA 2POHA 2EPKX 2FBWC 5FZTA 3H1KD 2WVNA 1R8EA 1TWGA 3P7KA 1PGJA 1EDLA 1LM3B 2WPRA 1OR3A 2AEMA 3L74E 1IFMA 1W2WA 1LTJA 3UR3C 2NUTB 2YKZA 3TQOA 1BDCA 1S72P 5AW0B 1M2VA 2R7SA 2ZT9B 4EBJA 1Q82Q 3AOUA 3M9BA 3ECSA 5KYNA 5KAIH 5APVA 4R32A 1Y6DA 3C8GD 5L0HA 4YT2A 1VTMP 2PP4A 2O01N 3PHLA 1HE1A 4DXWA 4BEJA 3JRTA 4IWBA 2J59M 3DJUB 4L74A 1J1EC 3BCCD 1H0TB 1NKNA 2WSEJ 4J32B 3TNUA 2YL3A 3VTPC 1V74B 3MGNA 3F47A 1R4TA 1RE4C 1QVFO 3OAKA 2XU6A 5L0IA 1PP9E 4L75A 4I2LC 4AK9A 3CXHI 3IQ6A 2HG5D 1KILD 3CC4P 3DE9A 3JRMO 2G62A 4EBBA 2BCCE 2AEFA 5BVZA 1LTGC 1XTGB 2QE7H 3T4RA 3ABVC 2H8PD 2J7PD 2Y3BA 4JZAA 4JEBA 1U57A 1HJ0A 1GW4A 3GHGA 3RBXA 4DRIB 4JTCB 3S1KA 1LJ2A 3IQTA 1JNMA 3H32A 1O5HA 2YMYA 3TGUD 3HNLA 3E7KA 1LGHB 2G8YA 5E3CA 1RCPA 1V54C 2G3KA 4JCZA 1D0YA 1KB9I 4PJ0E 5H2FE 3TYYA 5APUA 2H7BA 2R7RA 4XE5B 4BJ5A 5D92A 1M90Q 5E3AA 1SLQA 4NC3A 3T97A 1OCZC 1X9VA 4D4NA 2WSEH 1N73B 1RKEB 1S5LX 2KNHA 4IFDK 5TJ5E 5COMA 2R5BA 4AL1A 2IBZE 2W4BA 3FOOA 1UIXA 3OA1A 4DRJB 2OYIB 3UGPA 4U5GA 4MVUA 1JMMA 1NYHA 4O7GA 2WZFA 3RBZA 1IC2A 2KP8A 3WHNA 2DYRC 1VQPP 1PGPA 2A45I 3RL0D 1D1AA 1NU1J 2J0WA 5COGA 3RK2B 1TFOB 2HPCB 4U5DE 1Z56A 2RKLA 1NAFA 4C7RA 2L6HA 3B5NA 2Q9IA 2B0HA 3ZTZA 1PGOA 2AU5A 4EDFA 3BCCJ 4D6TD 3POVA 3EGXB 3Q2YA 3H1LD 1Y9BA 1G4WR 3S84A 1L4AA 3T6GB 3B0UX 2L6GA 4QI2A 4C7NB 1SP4A 4GQHA 4C3BA 5KKZB 3L8IA 1VQ7P 3EFGA 1A7VA 1YHQP 3RQFA 4LDRA 3ASOC 4JTAB 3NXSA 2IBZD 1GL2A 4AYCA 4H54A 4OIPF 3CC2P 5CMZA 4CIPA 4IB4A 2FFDB 2VASA 3DXJF 4CS9A 2QVAA 2OYHA 3I56P 5EK0A 4WBAA 4G7HF 5APXA 4UB8E 4QDLA 3L73E 1ZR2A 1N7SA 3DD7A 1L0LE 2WQYC 4OIQF 3BEHA 1NTZG 2HJ3A 3CI9A 1HGZA 3B5NC 2NPSB 4EWCA 1C02A 1SQQD 2MHRA 4JQ0D 1T01A 3V4WA 2K1AA 3EH2A 4BJ5C 3AG2C 3CCLP 2Y0CA 3H2VA 5AVWB 1KILC 3P8CE 3AGTA 4IL6H 2EPMX 4D6TJ 2VB6A 1G2CB 2MKVA 2N9BA 3GM1A 5EFWB 3SEOA 1LS4A 4HJGH 5K0IA 2M8RA 1NTMG 4PD4I 3D70A 5KYYA 3D71A 2KOGA 3SXKA 2A6HF 2FXPA 1VK5A 3MZWB 1OVVA 2ZAEB 1VQ8P 1SQBD 1YTZT 2XS8A 3H32B 1QPUA 1VDFA 3NMKA 2XL8A 3S28A 3ASNC 1SQPE 4PV1C 3UMKA 1Z7Qc 1SQBK 2JWDA 1LWUB 3QZCA 1L3PA 2PF4E 3H1LJ 2A68F 1WGWA 4I44A 3A0HH 3RK3D 1Z63A 4G78A 4OD4A 4KT0J 1NU9C 2LQGA 2OYHB 3WAQA 1RF0A 1EDJA 2QIWA 1SQXJ 2XS1A 3NYLA 3LIDA 3P8CD 4EIYA 5AVSB 2KNCB 1S7ZA 2E74D 3H1HJ 3ZTMA 3M9QA 1M7LA 1VPCA 3P32A 2G3AA 3HD7A 1GTWA 4U5HA 3QW1A 4YL3A 2IXPA 4U3FE 3CWBG 3A0BE 1L0LJ 4DJ9A 1X22A 3UIAA 2WZ7A 1HH0A 3AG1C 3V6IA 4H0LC 5COFA 2PP6A 1L0LD 4NPEA 1RJ9B 3M9HA 3RYLA 1D1BA 1NTMD 1OW6A 2WZGA 3K1HA 1LP1A 2AEJA 1YARO 2HKVA 1JO5A 1V55C 1MMGA 1AQTA 4OD5A 3SSUA 2OTKE 3NRHA 3VF0A 3HJCA 1JUNA 5TISE 5L3QA 4H4KC 4I1MA 4ZKUA 2W4MA 1BR1A 4JIOA 1F1MA 2HPCA 4BJTA 1FAVA 1VQLP 3FXEA 2V4HA 3DZAA 1JY2P 3AEFC 2IXNA 3FVYA 1J1DB 1ZW2A 3IAOA 1LKXA 3T6JA 2W83C 4OGQB 3TGUJ 3B4SA 3OWTA 2Z15A 1U0BB 5KLVE 4IOIH 1YJGA 1DH3A 4R4MA 1E79H 2CK3H 1E84A 1L7CA 1Z6AA 3W4YA 2C04A 5KLIB 3K33A 1WRGA 3QVYA 1SQBJ 2LFFA 3IHUA 2ZVNB 2YIUC 1LTAC 2FYUD 2WTYA 4L6RA 3HE5B 3L35A 3Q6NA 2WSSH 5KTBA 3VMZA 3II6A 4W80A 2E5YA 1HTLC 3CX5H 2W8ZA 4PJ0H 4K0DA 1PV3A 1SFCD 2K9JB 3A7OA 3AG4C 3GF7A 5KAFE 2RD9A 2IBZG 1BCCG 2L5GB 4AUWA 4IARA 4X0RA 2N1TC 5CI8A 2A69F 1RMVA 3BRVB 1P84I 2QTVA 2GUVA 3KZIH 1FZCC 4C3DA 2M0BA 4ZNCA 3C63A 2HJMA 3EZIA 3LAYA 2R7XA 1YTZI 4PACA 3BRTB 3MFNA 3IFMA 2M4EA 3GLMA 3O39A 1Q0FA 4U9EA 3AE7C 1RF1C 5A6JA 3QMKA 3L71E 3L70J 2HR3A 1PFIA 1VYIA 1ZU4A 1XTCC 1NTZD 3H1KJ 4MS2A 1MMDA 3KYIA 2HV6A 1WATA 3V5ZA 4DT0A 3VAYA 2EIMC 2L9JA 2XLWA 1WOLA 5KYWB 1X8YA 3CWBJ 2GM4A 3SFDC 2QJYC 4N78E 3GMAA 1IZNB 3RFYA 1GK4A 5AW6B 2ZXXA 3IPMO 2NUPB 1OIPA 1J8MF 3HE4A 2N1TD 1SF8A 3KZIE 3FGAD 5E79H 4CS8C 3AG3C 4N6HA 1ZMEC 2ZYAA 4ANJA 1KORA 2WVQA 4I1OB 3V5YA 2Q3TA 3H1ID 2CCYA 2ZT9D 4XWJA 3HE4B 3VYIA 4UB6H 5B5EH 1DIPA 2XLEA 3I5CA 3JSEO 1M1JA 4CS9C 2E75B 3CSKA 2AVKA 3WODF 4AQRD 4DCKA 2XXAB 1LTIC 2O1JA 1PGQA 1ZOYC 2YHSA 5T3TA 1D7MA 1OCCC 5KJ7D 3Q5PA 3FDQA 1GL2B 1KFMA 5E79E 3T9OA 1FZCA 1VQNP 2QY9A 3EGDB 4DOJA 5AW3B 1OMIA 3CLQA 4Z1MH 1M2OA 1OX3A 4XQ1A 2FY8A 3G71P 2EILC 3LNRA 1USEA 3O6QB 2AXCA 2JKVA 3L74D 3TDKA 3VM6A 2KUBA 4XEKA 1IJDB 2IX7C 2LK4A 3ABKC 1T5OA 2Y69C 2PFXA 3AQBA 3Q1MA 2QA4P 3HTKA 1O3UA 3RL0C 1MFTA 1MFZA 3O10A 1LT9B 3C18A 3HRNA 4BJ6A 3ZIBA 3BCCG 1RE3A 4NQFA 1IO4A 1G5ZA 3I55P 2YWAA 5KLVK 1GQAA 3FHDA 4DVYP 1HBWA 2XM4A 1VOMA 5AW2B 1GW3A 3M0DA 2I1KA 4LERA 4P6IC 4E0HA 3EH1A 1SQPJ 2HLOA 2CNWA 4CS8A 1TKNA 2QJPC 3NKEA 4R4LA 1YDIA 3DJNB 3NG1A 1WMKA 3GORA 2QE9A 4U5EE 3GM3A 1MQVA 2OG2A 1R5ID 4XPWA 5H2FH 1YYCA 4NY3A 5CI9A 1JMWA 2H7VC 4O6YA 3SZRA 5D91A 3CWBE 1L4AB 3DI5A 4J7TA 3I5PA 3O6XA 4OVNF 2E5TA 3DMDA 3L71J 3L70E 2PAJA 5CJ4A 1USDA 3AEEC 1AEPA 2YLDA 1EQ1A 4N78D 1KC8Q 3FAPB 4EYYQ 3FX0A 2YL0A 2WL8A 1OR2A 2J46A 4JYBA 1IFJA 3R7CA 2Q9AA 1LP1B 2ASRA 1NTMK 1HF9A 1HUCA 1L0ND 3KPHA 4D6TG 4JW1A 5GTIE 2OYIC 4BXLA 4P9TA 4KI2A 1EA8A 1A0BA 2B88A 2WMMA 1YYXA 3PDMP 3QVZA 2L81A 1CSBA 1TWCA 1L0LK 2YKQA 3RK3E 2K3RA 4GDOA 2R02A 4EHPA 3RH3A 1T3UA 3EQLF 1IFIA 1NO4A 1CPQA 2XKMA 3MYIA 3EQ2A 1S9KE 2MYSA 1AVOB 4ULVA 1NGMB 1TQGA 3X2QC 3DKAA 2WT7B 5L0DA 1YJWP 4YJWA 1VQOP 3JCUH 3ITKA 4K7BA 3V5XA 3HD7C 3K5BA 1MKMA 1SQBE 2QJPB 5EGYA 2FYNC 1P84E 3RK2D 3K6BA 1S1CX 2IOQA 5DQZA 1QLED 3PCVA 1PP9J 2A0UA 3MYFA 4RJTA 1K8AQ 4W8PA 1QGKB 5KYYB 3VMAA 2WSCH 2Z4EA 5JP7A 1TWAA 2GA1A 2GA0A 3JCUE 4B86A 1JM0A 2PX0A 4Y99C 3SXMA 2O1KA 5A6KA 2KYHA 3GW6A 1JMBA 5JS5A 1ZRTD 3FXHA 4JJGA 3AE9C 1SYQA 2XL6A 4M3LA 1W2BO 1YI2P 2QUPA 4DZOA 2BL2A 3N0TA 4MVZA 3WU2E 3GEEA 2KK7A 3CCEP 5IY5C 4OINF 1NU7D 5GTIH 4NTFA 3P8MC 5AW5B 1SQXK 1N7LA 2X51A 3NKDA 3ABMC 1YQ4C 4MW8A 3GF3A 4H13C 5APSA 3WUTA 4YTPC 4HKZH 1BGYD 3L72E 3M4BA 2LIGA 3CCSP 3CXHE 2QSIA 1YJNP 2KLUA 3U9JA 4F4BA 2GWWA 2ZXRA 1VL2A 1XZPA 1NTMJ 1NJIQ 2ZPAA 3VMYA 4CPGA 2Y0EA 4PJNA 4PD4H 1K40A 256BA 3N7NA 1ZRTE 3LJBA 2DI3A 3RVYA 2ZXOA 2KSEA 4CDVA 2E74C 1FJKA 2XNXA 4U3FG 1YAUO 4OGQC 3K1IC 2L7AA 1PPJG 2JD3A 1GMJA 3V2QA 2FYUG 3MP7B 4JPZB 2ETSA 2XLVA 1N7SC 4B6IA 2Y3HA 1KU2A 4WJ0A 5A69A 4O79A 4E7ZA 1MUUA 3B0VC 1FAPB 4RO0A 4RBNA 5AVYB 1BZ4A 3ITFA 2E75D 2WSFJ 3HD7D 3IF4A 2C03A 2QM8A 3KYQA 3AE1C 5A6AA 5DQTA 1LE4A 4I7ZB 1LIHA 1LT9C 3L73J 1DX7A 1PD1A 2OYIA 5HSWA 2YKOA 2R7OA 2N1TB 3U59A 2IYLD 4NTBA 5AW1B 4XTKA 1N86A 3TK1A 2IPPA 4HFKB 3M91A 1SQQE 3D6YA 1Z3IX 5KYUA 1L0NG 1NFOA 4WY4B 3CAXA 1EZVI 2ITAA 3LW5H 3T97B 2YLGA 3CMEP 3TF5A 3PJSK 5JLIA 4XFJA 2IM8A 1YA9A 1T6AA 1QL1A 3K1IA 4NCQA 3L70D 1VLTA 3CZ6A 3ZG1A 1LTTC 5DS5A 2BCCJ 4PFPA 2YO2A 3PRJA 1RF1A 1LT9A 1RQUA 1KNYA 3WU2H 5DLJA 1ZW3A 2Y9YA 3GHGB 2WVOA 4AL0A 4GOEA 2G3VA 4DBRA 2W6AA 3AE6C 1E83A 4KBLA 1H9TA 2R05A 3HNJA 2E42A 3HUSB 2V7QH 1YZCA 3S27A 3E1IA 1NKZB 1GU4A 3GM2A 1FOSE 1TR2A 4K35A 1VF5B 4FAPB 1YYJA 2PGDA 3RW0A 3L72J 1DD3A 5KYXA 1G2CA 2E87A 2OYHC 1AA0A 2Q3IA 1GK6A 2Q6QA 3H1LE 1NTKJ 2YZSA 4U5FE 4HH2A 2N9YB 3TNUB 1Z5ZA 2EIJC 2QJYB 1VB5A 3EWKA 2FFDC 1T6QA 1DEBA 2OU6A 4AX2A 1AV1A 1EZVD 3V2PA 3HLZA 4FESA 3RF3A 4JURI 1OW7A 5L0JA 1KB9E 4BRYB 2D4UA 1U7JA 4LGDE 1QZXA 4NTAA 3H1KE 1BR2A 2O3JA 4E7SA 3NTNA 1PP9G 2MJZA 2OYOA 3TOLA 1HVVA 2NPSC 1QVGO 3MUDC 1LS1A 2DGJA 3W8HA 2WPVB 2JWAA 3U8PA 2FFDA 4IAOA 4YXWH 1ST6A 5C39A 4XPXA 3EFFK 1IFDA 3CCUP 3IQCA 1QL2A 2QG4A 4ZKPA 2L91A 2QNLA 2FYUK 5JSLA 1JOGA 3V4QA 4C3EA 3SXZA 4WGZA 3U2LA 2XLOA 2MWQA 1GGQA 5T1DB 4C7NA 2LP4A 3F89A 3MUDA 1JPNA 1NZEA 5B5EE 2O9XA 1FC2C 1YIJP 3NMDA 2DYSC 1HJBA 2A06G 3EGXA 3TGUE 3LS1A 1J8YF 2Q00A 1URQC 2ZYDA 3CX5I 2P61A 4MTFA 2H89C 1MV8A 5AW4B 3WMM0 2PFDA 2WWWA 3EHNA 3AE8C 1K04A 5F5FA 1N7SB 4LLHA 2X0CA 4YK5A 2OTLP 1CI6A 2BCCD 4PJLA 1OCRC 1SMYF 4XEVA 3RIPA 4LDKA 3RK2C 2E76D 3BVHA 2KSJA 1FMWA 2JEEA 3H1IE 1A02J 3U0CA 2HSBA 1RXQA 4BPMA 4CIHA 2GAQA 4YT4A 2YO3A 3G9RA 4QI0A 3CMAP 2YQYA 3DAGA 3GWNA 2JR8A 1KV4A 3L72G 2H43A 4I1LA 4N6JA 1ZHXA 2VCCA 3L37A 1V4AA 1JY3O 1FZCB 2A6EF 1OW8A 2CDQA 1N8RQ 1H9GA 3A0BH 1SQVK 3EFOB 3GEIA 3A11A 2OJED 1VF5C 2EINC 2R7QA 3K66A 2YXQB 2CYDA 4H13B 3VRCA 4I6MC 5M1BA 1N2DC 1M1JB 1FJPA 3L71D 2XM0A 3FXDA 1S05A 5AVVB 4WABA 2IBFA 1DEEG 4JTDB 2W45A 2LD6A 1FZAA 1KQLA 1BCCJ 2ZXWC 3F5HA 5AVZB 2XSEA 4K3AA 1H89A 4CJGA 1E2XA 1UG7A 1T2KD 4KC9A 4PV1B 1SVFA 2I15A 1YZAA 1Q81Q 2KS1B 2LXBA 4A4AA 3V2RA 2Q9CA 2Y9ZA 3MIWA 1KB9D 1IFNA 4L73A 4UB8H 4G7OF 3S4RA 3UMIA 3C8VA 2IFNA 1G4US 2HSQA 3V2NA 1CPRA 2XV5A 2VCAA 4BEMJ 4WY4D 1ZR4A 4N06A 4I7ZC 2Q9BA 4CBEA 2ZD9A 3LNMB 5EHHA 3FWNA 5AVXB 2TMVP 4Q7CA 2XRHA 3Q5SA 3M06A 1U6HA 2IZ1A 4C7OB 1ZHTA 3EHMA 1L0NK 5E33A 1M2VB 3AEAC 2KYVA 3M0AA 3L34A 5KLVD 4D4XA 1DOVA 4H44D 3NMJA 5KKZC 1NTME 3FWLA 4XA4A 4H44C 3CXHD 2B87B 1BE3E 1TWHA 2OQMA 1YQ3C 1IZMA 4DBQA 4WWIA 2I8DA 1JEKA 3H6PA 2P10A 4ASVA 4PD4E 4RESB 3RK3B 4IAQA 2YNYA 2P2UA 1ZU5A 1KB9H 4OWFA 5APWA 5CIVA 3I4UA 2PBEA 4YL0A 1OKKA 1IK9A 1C03A 2R3CA 5B1BC 3U9MA 1JR8A 1H0TA 2J8WA 1Q2NA 1ZW0A 2P67A 2P58A 5KYUB 3CCMP 3BASA 3KDPB 4YT8A 1LWUC 1ZXGA 2B9BA 2EIKC 2YLIA 3OJAB 1MMAA 5T3WA 3IN6A 2R7UA 3X1OA 1E5WA 1R5LA 2NZ2A 2H8AA 1JB0J 5APYA 3CX5E 2R5DA 5KLVJ 1EXJA 1JY3P 3TSIA 1NBBA 4IRUA 3HNKA 1KYOH 2L6FA 4HE8D 1N1CA 5CHXA 2A06D 4MN4C 3RGUA 2DB4A 1GL2D 2YEVA 2VCBA 5F5HA 3A0HE 1K73Q 4ULWA 3Q6MA 3H1HG 4MVSA 1VF5D 2PNOA 2Q7RA 2JJLA 3RKOF 4AE4B 1SQVD 3U1CA 1S5LE 4ZMDA 4KNWA 3L1MA 1KILB 2FXOA 3VP8A 4Z9JA 3LUTB 3B0PA 2JDIH 1QQ3A 2J45A 3ZVRA 3J06A 2HODA 3ZDMA 1HE9A 1CGME 2QRXA 2QM7A 1S9KD 2J9BA 4BJ6C 2KI7B 2HZ8A 1QX8A 3KYJA 1BSHA 2WVRA 2CNWD 1RE3C 2C0XA 3SWYA 1J2JB 1Z23A 2R44A 1SFCB 2Q7CA 1HMOA 2OCCC 1FFTC 4MW3A 1JTHA 1VLSA 1ZVZA 3CCVP 5CCHC 1Q0DA 1ZHWA 3OA7A 2BE5F 1CI6B 1EDKA 1JY2O 1L0NE 3SWKA 1A02F 4MVQA 1LWUA 2YIUB 2Y3DA 1BGYE 3G4ZA 2B89A 4YN0B 1L2PA 3T6BA 3A3YB 2VRSA 2R9RB 2K88A 1GL2C 3ZC4A 2QJKB 4WB4A 1Q0GA 2P7JA 1A41A 1SQBG 4W8KA 2M5AB 2SPZA 3H1IG 2EPNA 1FE6A 4JBZA 3E1RA 1H8AA 3H1JE 3G4SP 1BE3J 4DJGA 1GDTA 4U3FJ 3FAJA 4TLFA 2Z5IA 1BDJB 3Q7GA 2D5RB 1SS1A 4LLEA 3L75J 1JY3N 2Z5HA 3ZSUA 3B71A 1OXZA 3Q3DA 2P7VA 3B29A 2UUIA 2R3SA 1FMVA 1M56D 1Y8AA 2AP3A 2RSEB 2XXAA 4H13D 3CL3D 2M5AA 3GG2A 2EPLX 3H1LG 2AWYA 1T6IA 4G7ZF 3GEHA 1LNQA 2FAPB 4O6NA 4U7JA 1T8ZA 3B8EB 4EUKB 3L74J 2ICWG 2CPSA 2A0BA 3N24A 4YXDC 1NOHA 1SQXG 4Y28J 2NRGA 3V5BA 2B0JA 4HYTB 1NTKK 2BASA 2J9WA 3GANA 3SYNA 1AVOA 5JRAA 4MTGA 3G6EP 3H1KG 1ZHZA 3EZHA 1P84D 4EKWA 4WY4C 2C9LY 3HNIA 2O01H 4IL6E 1HY5A 3C8GA 2H7HA 1VQ6P 1T3JA 3H1JD 2KQ9A 5TISH 4KHXA 3AE2C 1AVYA 4U5CE 4XEFA 2YL7A 3L36A 1SQXD 4JJFA 4BG0A 2NSGA 2F22A 1FDOA 3AE3C 2H7OA 3KHUA 5DJTB 2M64A 2OOCA 3C7JA 1E86A 3JSZA 3W8IA 2AXTE 5GTHH 3GWLA 3MHVA 2IYOA 1SQQG 3HUSC 2ZXPA 5L0FA 1GZLA 4MVMA 3ATPA 3BRJA 1KILA 3VMXA 1K05A 1OXBA 4YT5A 1RF0C 3AEBC 4HB1A 2J5UA 3SFEC 3H1JJ 3TGUG 2E76C 5AVRB 3ZQVA 3R4YA 4MVOA 4CJOA 3DM5A 2W6JH 2EPOA 5A6BD 2P0NA 4RD9A 2WSCJ 2XZRA 1FZEA 5CCHD 4WY4A 3CCJP 2KW3C 4JVSA 3TK0A 1FNTc 2O01J 3AGUA 2UUHA 1NU1K 1FZFA 4A2NB 2LCHA 2N1TA 2I8BA 2OKUA 1VYKA 4Y99B 2R32A 2IDBA 2V3CC 4EIJA 4XLNF 1SQVE 1RKCA 1GU5A 3CQZA 2P6VA 2FYNB 5B3SC 1MZ9A 1YBKA 1Y4CA 3M15A 2NG1A 5AVUB 2XLDA 1G8XA 3JC22 1NTZE 1KYOD 1EI7A 3ABLC 3C8GB 1FFHA 1OCOC 2AWCA 2A06E 1BSNA 5APTA 3TD7A 1GD2E 2WZLA 1FZBA 2ZFCA 3LEVA 4GYTA 3HTKB 4Q4ZF 4U9DA 1FS0E 1IK7A 1T9KA 2A1DD 4E0IA 1OKKD 1YJ9P 3JTLO 1CZQA 1NU1G 3TJ6A 2HS5A 2HMQA 5B3IA 4PFOA 1URQD 4H0LD 4H0LB 1NH4A 2ZYGA 2FYUJ 4FX5A 1BBHA 3R2PA 4ASWA 1VQ9P 4PK4A 1OVUA 4C7OA 3H1HE 1HGVA 4MTOA 4QMAA 1NLXA 4KJMA 1L4AD 3TJ5A 2WB7A 1KZUB 2V26A 1PL5A 2D2CB 2IZ0A 3EGDA 1H7IA 4E18A 1EZVE 1MNEA 1NWQA 4PR9A 2M3EA 4GIFA 3HD7B 1MNDA 4PD4D 3DM9B 5AW8B 3LLIA 3EJNA 2HMZA 3C62A 3L75E 4RKUJ 1WWPA 4YL1A 2I1JA 3IR9A 1K9MQ 1Y47A 3KQGA 1YITP 2D2CC 2PRRA 4XPYA 3SWFA 2YRFA 1NTKE 4W7YA 1WN0A 4BJ1A 3NMIA 4JYCA 2HV7A 1KYOI 2NPSA 2XNDH 4U5BE 3V7OA 1URQB 1M6TA 2Q4FA 3FMSA 5BQGA 1LTJB 2UWJE 4A7PA 3L0IA 4HFFB 2W27A 1S5LH 1SQVJ 1Q90D 2M3BA 2NUPA 5A6BA 1KQGB 2KZJA 1NTZK 1C17M 2Q1KA 3TULA 1M57D 3A5TA 1FR0A 1BE3G 3GODA 1IFPA 2FFHA 1SFCA 3KKBA 1U89A 2LSEA 3H1HD 3TOMA 1FTSA 2Q3EA 1LTSC 1JPJA 3AECC 2FKWB 2KJGA 4Z9IA 1KMIZ 1OQCA 4RDAA 3G50A 2CGEA 2YVKA 2K37A 1DOWA 1RE4A 1ZV8A 1T2KC 5AC5A 1ZP0C 1BDDA 1DD4A 3RK3C 3LW5J 4NPDA 1L4AC 3K7DA 2IBZI 4GT1A 1ORYA 3HUSA 4UB6E 5TJHA 2BEZF 3B5ND 5CCGD 2H88C 1CGOA 4E17A 4IL6X 1HW2A 1NSGB 3GHGC 2NPUA 2GUSA 3VN0A 4LC1A 3U8VA 4AE4A 3UNGC 2LXCB 1KYOE 2JP3A 2E43A 3QWOC 1IW7F 2IFMA 1G1IA 3AQCA 3USSA 1TFKB 5KJ7A 5FCLA 1M1JC 4NPFX 1TU3F 1FDIA 1RY3A 2OQQA 5B66H
chains in the Genus database with same CATH topology
4PV1B 2JO1A 2L6GA 2QIWA 1JOGA 5KLIC 3AE2C 2E74D 3RL0g 4XEFA 3L8IA 2E74B 3AEGC 4H44B 2QJPC 2G3AA 2WSEJ 1PL5A 3RQFA 4R4LA 2D2CB 1FDOA 3C8VA 3AE3C 1WMKA 3D6ZA 4EBKA 3D6YA 3Q5RA 3GM3A 4I7ZC 1WOLA 3AE9C 2E76B 3SFDC 3T97B 2QJYC 2Q00A 4H0LC 4RKUJ 1WWPA 3GMAA 4XFJA 3Q5SA 1WTYA 2H89C 1OW6A 1UFBA 3H25A 3AEAC 3BRJA 3ABVC 2D2CC 2QJKC 1K05A 3AE8C 1K04A 1U57A 1HJ0A 1KNYA 1RQUA 3AEBC 2J5UA 2E75C 4H44D 5KKZC 3FGAD 4H44C 3SFEC 3AEEC 2WQYC 1YQ3C 1ZMEC 3AE6C 4XEVA 2E76C 1PIXA 1KORA 3R4YA 1YQ4C 2P10A 3GF3A 4H13C 2E76D 2G8YA 3AEDC 3O6QA 3TULA 2JPUA 2ZT9D 4YTPC 3GM2A 3U0CA 5L8RJ 1Q90D 1DIPA 2HSBA 3AEFC 5F28E 1VF5B 3JZ0A 1KQGB 2WSCJ 4TT3H 3IAOA 2E75B 4OGQB 1KQFB 2QSIA 3JYYA 3G9RA 2O01J 4OGQD 2YMKA 1AJYA 1HF9A 1RQVA 3AE4C 1QVXA 1KTMA 2PBEA 1DD3A 2KK1A 1VL2A 4R4MA 1ZOYC 1EXIA 2IDBA 3AECC 1KMIZ 3Q5PA 1KILE 1V4AA 1K40A 3RK3E 2BEQD 2MKVA 1ZZPA 4GDOA 3GM1A 1OW8A 1S5LX 2YIUC 1ZRTE 3IN6A 1ZP0C 3EWKA 1DD4A 2NZ2A 2JX0A 1OMIA 1JB0J 4Z1MH 3D70A 1UIXA 3B71A 3LW5J 3D71A 2E74C 3Q3DA 1NGMB 2ZT9C 3K7DA 1VF5C 1OW7A 2FXPA 1NYHA 1EXJA 4H13D 3C8GB 3U3FA 2BEZF 4H13B 4OGQC 1PV3A 4XEKA 3RQEA 2FBWC 2H88C 5M1BA 2LK4A 4IL6X 3GF7A 1R8EA 3RQGA 2L6FA 4PV1D 3Q1MA 1MKMA 1GMJA 1O3UA 2FYNC 3O10A 1IK7A 4PV1C 3C18A 2JP3A 4U7JA 1S1CX 2D2CD 2L6HA 3L8JA 4YXDC 2ZT9B 4Y28J 4EBJA 2WPVB 2V7QJ 4NQFA 2YWAA 1VF5D 3S9OA 4H0LD 3MFNA 4H0LB 2E75D 2WSFJ 4R32A 3AE5C 3AJMA 3C8GD 1TU3F 1FDIA 3GLMA 3Q2YA 1Y9BA 4KT0J 3AE1C 2OQQA 4I7ZB 3AE7C 3C8GA 2K9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6G A;  1JOG A;  3AE2 C;  4XEF A;  3L8I A;  3AEG C;  2G3A A;  3RQF A;  3AE3 C;  4EBK A;  3GM3 A;  1WOL A;  3AE9 C;  3SFD C;  2Q00 A;  1WWP A;  1WTY A;  2H89 C;  1OW6 A;  1UFB A;  3AEA C;  3BRJ A;  3ABV C;  1K05 A;  3AE8 C;  1K04 A;  1KNY A;  3AEB C;  3SFE C;  3AEE C;  2WQY C;  1YQ3 C;  4XEV A;  3AE6 C;  1YQ4 C;  3AED C;  2JPU A;  4YTP C;  3GM2 A;  3U0C A;  2HSB A;  3AEF C;  5F28 E;  3JZ0 A;  3TUL A;  1QVX A;  2PBE A;  3AE4 C;  1KTM A;  2KK1 A;  1ZOY C;  3AEC C;  1V4A A;  1K40 A;  1ZZP A;  3GM1 A;  1OW8 A;  1ZP0 C;  2JX0 A;  3B71 A;  3K7D A;  1OW7 A;  3C8G B;  3U3F A;  1PV3 A;  4XEK A;  3RQE A;  2FBW C;  2H88 C;  2LK4 A;  3RQG A;  2L6F A;  1O3U A;  3O10 A;  3C18 A;  2L6H A;  3L8J A;  4YXD C;  4EBJ A;  4NQF A;  2YWA A;  3S9O A;  3MFN A;  4R32 A;  3AE5 C;  3AJM A;  3C8G D;  3AE1 C;  3JYY A;  3AE7 C;  3C8G A; 
#chains in the Genus database with same CATH topology
 2Q5U A;  1JTH B;  1KFN A;  5JUA A;  2R03 A;  2E74 B;  1ORS C;  4IFF A;  4EI2 A;  3DE8 A;  4G0H A;  3MTU E;  1Q7Y Q;  5AW7 B;  2YXR B;  2J9V A;  3D6Z A;  4EOT A;  2WPS A;  1AFO A;  3Q5R A;  3ZWI A;  3W2W A;  1M1K Q;  4WVZ A;  1SQQ K;  1SQQ J;  1NFN A;  3U2M A;  1NHL A;  5BUO A;  4YWQ A;  1L0L G;  3OW2 O;  1X79 B;  1ZLL A;  1EKY A;  1E85 A;  4JE9 A;  3MX3 A;  1NTK D;  1JRA A;  4N6C A;  1S4X A;  5DS6 A;  5GPG B;  4MVR A;  4N4W A;  1LT1 A;  3MBG A;  5E2Q A;  3L72 D;  1YA7 O;  3S90 A;  3O6Q A;  1CGN A;  3IEE A;  1KN7 A;  4O6M A;  1A7E A;  4LDQ A;  1BCC D;  4IGG A;  1KQF B;  1SFC C;  1HW1 A;  1S2E A;  4WGY A;  3L73 D;  4OGQ D;  4BRY A;  1KTM A;  2QLA A;  2GFH A;  2KNC A;  2W6B A;  1W5C E;  1J1E B;  3CCR P;  2AXT H;  5GTH E;  4OIO F;  4ONS A;  3N4X A;  4MND A;  4YPC A;  1EC5 A;  2FGY A;  3W2V A;  4N3Y B;  4JRZ A;  4GKG A;  1M57 C;  1NU1 D;  1KQS O;  3RQG A;  4PV1 D;  1P84 H;  1MMN A;  2IXM A;  1EDI A;  3VP9 A;  4HEA J;  3H2U A;  3L8J A;  3A2A A;  5CBN A;  3IQ5 A;  3M0D C;  3B9Q A;  5KYW A;  2FYZ A;  1SQP D;  1BGY G;  3CD6 P;  2YKP A;  4PJM A;  3JYY A;  3PTZ A;  4JCH A;  5L3V A;  4CDY A;  3U3B A;  2OGU A;  1JAF A;  1QKR A;  2J9U A;  5DVW A;  3LS0 A;  3NYM A;  2GDC A;  4EBK A;  5AW9 B;  1SQP G;  4GOD A;  4ZLD A;  1WTY A;  5CCH A;  1EZV G;  3L4F A;  1AQ5 A;  1URQ A;  1KD1 Q;  5BU5 A;  3RL0 B;  4Z9H A;  2QJK C;  5AGF A;  1N7S D;  2C0W A;  2J58 A;  2RMZ A;  1LPE A;  1NAY A;  3U5S A;  1H88 A;  4KNV A;  1PD0 A;  2PX3 A;  1QLE C;  3LEO A;  1I5N A;  3QH9 A;  1CW5 A;  1WAS A;  2NUT A;  2WSF H;  1VQM P;  1ZN5 A;  1S3J A;  2R7T A;  1SQX E;  1RQV A;  1OXK A;  5JVE A;  3M4C A;  5BU8 B;  4JEA A;  4DOZ A;  2Y39 A;  2RN0 A;  3VOP A;  2CPB A;  1D0Z A;  2KZI A;  1ZZP A;  4JC7 A;  3CCQ P;  1JCD A;  1PP9 D;  3H65 A;  2DW3 A;  3PLN A;  4JF7 A;  5KAI E;  3SP1 A;  5BQI A;  5CJ0 A;  1LVK A;  1ZHY A;  1Q0M A;  2A45 G;  4P9F A;  4CDA A;  3L74 G;  5K5G B;  3C1L A;  3B5N B;  2KC3 A;  3RQE A;  3ZDL A;  3JT1 A;  3ZQY A;  3G3Z A;  2P1J A;  2KSF A;  3C9I A;  4ZLC A;  3CEX A;  3CC7 P;  1VMA A;  3EPV A;  3KXD A;  2D2C D;  2XDJ A;  2K9J A;  2ZXE B;  5KLV G;  1N73 C;  4D6T E;  3US6 A;  4Q5S F;  4J30 B;  5AVT B;  3HKK A;  2V7Q J;  1GS9 A;  1Q0K A;  1M56 C;  1RJ9 A;  5APQ A;  1D0X A;  1FZG A;  1LI5 A;  5L0C A;  4LLC A;  5KAF H;  2LFD A;  1M8O B;  3HE5 A;  1SR2 A;  3S0X A;  1LI7 A;  2K9Y A;  1L0N J;  2JO1 A;  2IYP A;  2R7V A;  5HV9 A;  1LTB C;  1RKE A;  5KLI C;  1NU1 E;  1UII A;  3AEG C;  2XL4 A;  2R7W A;  4C46 A;  3JYH A;  2KB7 P;  3HTK C;  4FWV A;  3QW0 A;  1BCC E;  2BCC G;  2XLH A;  1N73 A;  3L73 G;  1APC A;  3LLK A;  2ZJS E;  5BQH A;  4CX9 A;  2E76 B;  2BC5 A;  3H1J G;  3WUV A;  4ER9 A;  4JKV A;  1T6U A;  1BE3 D;  1YLM A;  2A45 H;  2NSF A;  3O55 A;  3PMR A;  3H25 A;  4LAC B;  2LKM A;  3CXH H;  3JCU Q;  2LR2 A;  2HUJ A;  3QTH A;  1FBM A;  3NFQ A;  1A7D A;  4DVZ A;  2FXM A;  1LE2 A;  3FOP A;  1PZQ A;  3BAT A;  3L71 G;  1PIX A;  2KLV A;  1FU1 A;  1ZYR F;  1VQK P;  4GEH A;  2B87 A;  1SZI A;  4L76 A;  2JPU A;  3KMI A;  1RF1 B;  1NTK G;  1VQ4 P;  4TT3 H;  1ORJ A;  1OVR A;  3MD0 A;  4DRH B;  3O8Z A;  3RVZ A;  3W68 A;  3M79 A;  3WUU A;  2WT7 A;  2WIT A;  2QEX P;  5AVQ B;  3M1C B;  2HFI A;  1OWA A;  4I3M A;  1EXI A;  5CBO A;  1KIL E;  2BEQ D;  1WT6 A;  1J1D C;  3SXY A;  5KJ7 C;  2OAR A;  2JX0 A;  1JOC A;  1PCX A;  1FOS F;  1D1C A;  3KPE A;  4K1O A;  2KS1 A;  2OEV A;  5KYX B;  3LIE A;  1OFC X;  1NVO A;  3BCC E;  3U3F A;  2ZVO B;  3OEO A;  3LES A;  3UGO A;  1BR4 A;  1R5S A;  2XLM A;  3I5Q A;  5DS4 A;  3L75 G;  4O9B A;  4M63 A;  1H6G A;  2KGO A;  3WG7 C;  2RH0 A;  3PP5 A;  3CX5 D;  3N2Z B;  3VYW A;  5CCG C;  2OTJ P;  4CSA C;  1XZQ A;  2P1A A;  3MLG A;  3S29 A;  4UDV A;  3S9O A;  1BGY J;  3EFO A;  3AE5 C;  3AJM A;  3CPW O;  3E9V A;  2C9N Y;  3PHF 2;  1RHZ B;  3KH2 A;  2VH3 A;  3NDB B;  3EG9 B;  1QSP A;  3DAF A;  2R25 A;  3RL0 g;  1B68 A;  1HMD A;  3DWW A;  4H44 B;  2Y0D A;  2W9Y A;  1JCC A;  2HOD B;  1W2E A;  3PH0 A;  4IJJ A;  3F46 A;  4J7Y A;  1HWT C;  3C8Z A;  1PPJ E;  4CS7 A;  1GM5 A;  1XWJ A;  3G4X A;  3L70 G;  2FYU E;  2VC9 A;  1SQP K;  3NYJ A;  2J7P A;  2KXP B;  4MQ9 F;  1RH5 B;  1I4Y A;  1UFB A;  5L0G A;  5AC4 A;  5DJU B;  3KL4 A;  1SQV G;  2CW0 F;  4OH8 B;  2E75 C;  3CWB D;  5B1A C;  2IXO A;  3JSV C;  2J0X A;  2Y3G A;  4CSA A;  3AED C;  2NPS D;  1NTZ J;  1U7M A;  1I4Z A;  5L8R J;  5F28 E;  1X0T A;  3E70 C;  3JZ0 A;  1VQ5 P;  3H1I J;  3A9C A;  5JT4 A;  2KIK A;  1AJY A;  2YMK A;  1QVX A;  3UMH A;  3AE4 C;  1Q86 Q;  2KK1 A;  1AUE A;  1YVI A;  4GOF A;  5B66 E;  1LTJ C;  1OZH A;  3U1A A;  4IFM A;  3L75 D;  2WPQ A;  5CCG A;  1O87 A;  4XLP F;  1G1J A;  3SNH A;  1JY2 N;  1QEX A;  4PJJ A;  3W67 A;  4BWN A;  2OEX A;  1NG1 A;  2OJQ A;  4OIR F;  1PPJ D;  2YL1 A;  4U3F D;  2W90 A;  1EQ7 A;  3Q7L A;  2ZT9 C;  3EG9 A;  2HFE D;  2HYN A;  1FDM A;  4W7Z A;  2POH A;  2EPK X;  2FBW C;  5FZT A;  3H1K D;  2WVN A;  1R8E A;  1TWG A;  3P7K A;  1PGJ A;  1EDL A;  1LM3 B;  2WPR A;  1OR3 A;  2AEM A;  3L74 E;  1IFM A;  1W2W A;  1LTJ A;  3UR3 C;  2NUT B;  2YKZ A;  3TQO A;  1BDC A;  1S72 P;  5AW0 B;  1M2V A;  2R7S A;  2ZT9 B;  4EBJ A;  1Q82 Q;  3AOU A;  3M9B A;  3ECS A;  5KYN A;  5KAI H;  5APV A;  4R32 A;  1Y6D A;  3C8G D;  5L0H A;  4YT2 A;  1VTM P;  2PP4 A;  2O01 N;  3PHL A;  1HE1 A;  4DXW A;  4BEJ A;  3JRT A;  4IWB A;  2J59 M;  3DJU B;  4L74 A;  1J1E C;  3BCC D;  1H0T B;  1NKN A;  2WSE J;  4J32 B;  3TNU A;  2YL3 A;  3VTP C;  1V74 B;  3MGN A;  3F47 A;  1R4T A;  1RE4 C;  1QVF O;  3OAK A;  2XU6 A;  5L0I A;  1PP9 E;  4L75 A;  4I2L C;  4AK9 A;  3CXH I;  3IQ6 A;  2HG5 D;  1KIL D;  3CC4 P;  3DE9 A;  3JRM O;  2G62 A;  4EBB A;  2BCC E;  2AEF A;  5BVZ A;  1LTG C;  1XTG B;  2QE7 H;  3T4R A;  3ABV C;  2H8P D;  2J7P D;  2Y3B A;  4JZA A;  4JEB A;  1U57 A;  1HJ0 A;  1GW4 A;  3GHG A;  3RBX A;  4DRI B;  4JTC B;  3S1K A;  1LJ2 A;  3IQT A;  1JNM A;  3H32 A;  1O5H A;  2YMY A;  3TGU D;  3HNL A;  3E7K A;  1LGH B;  2G8Y A;  5E3C A;  1RCP A;  1V54 C;  2G3K A;  4JCZ A;  1D0Y A;  1KB9 I;  4PJ0 E;  5H2F E;  3TYY A;  5APU A;  2H7B A;  2R7R A;  4XE5 B;  4BJ5 A;  5D92 A;  1M90 Q;  5E3A A;  1SLQ A;  4NC3 A;  3T97 A;  1OCZ C;  1X9V A;  4D4N A;  2WSE H;  1N73 B;  1RKE B;  1S5L X;  2KNH A;  4IFD K;  5TJ5 E;  5COM A;  2R5B A;  4AL1 A;  2IBZ E;  2W4B A;  3FOO A;  1UIX A;  3OA1 A;  4DRJ B;  2OYI B;  3UGP A;  4U5G A;  4MVU A;  1JMM A;  1NYH A;  4O7G A;  2WZF A;  3RBZ A;  1IC2 A;  2KP8 A;  3WHN A;  2DYR C;  1VQP P;  1PGP A;  2A45 I;  3RL0 D;  1D1A A;  1NU1 J;  2J0W A;  5COG A;  3RK2 B;  1TFO B;  2HPC B;  4U5D E;  1Z56 A;  2RKL A;  1NAF A;  4C7R A;  2L6H A;  3B5N A;  2Q9I A;  2B0H A;  3ZTZ A;  1PGO A;  2AU5 A;  4EDF A;  3BCC J;  4D6T D;  3POV A;  3EGX B;  3Q2Y A;  3H1L D;  1Y9B A;  1G4W R;  3S84 A;  1L4A A;  3T6G B;  3B0U X;  2L6G A;  4QI2 A;  4C7N B;  1SP4 A;  4GQH A;  4C3B A;  5KKZ B;  3L8I A;  1VQ7 P;  3EFG A;  1A7V A;  1YHQ P;  3RQF A;  4LDR A;  3ASO C;  4JTA B;  3NXS A;  2IBZ D;  1GL2 A;  4AYC A;  4H54 A;  4OIP F;  3CC2 P;  5CMZ A;  4CIP A;  4IB4 A;  2FFD B;  2VAS A;  3DXJ F;  4CS9 A;  2QVA A;  2OYH A;  3I56 P;  5EK0 A;  4WBA A;  4G7H F;  5APX A;  4UB8 E;  4QDL A;  3L73 E;  1ZR2 A;  1N7S A;  3DD7 A;  1L0L E;  2WQY C;  4OIQ F;  3BEH A;  1NTZ G;  2HJ3 A;  3CI9 A;  1HGZ A;  3B5N C;  2NPS B;  4EWC A;  1C02 A;  1SQQ D;  2MHR A;  4JQ0 D;  1T01 A;  3V4W A;  2K1A A;  3EH2 A;  4BJ5 C;  3AG2 C;  3CCL P;  2Y0C A;  3H2V A;  5AVW B;  1KIL C;  3P8C E;  3AGT A;  4IL6 H;  2EPM X;  4D6T J;  2VB6 A;  1G2C B;  2MKV A;  2N9B A;  3GM1 A;  5EFW B;  3SEO A;  1LS4 A;  4HJG H;  5K0I A;  2M8R A;  1NTM G;  4PD4 I;  3D70 A;  5KYY A;  3D71 A;  2KOG A;  3SXK A;  2A6H F;  2FXP A;  1VK5 A;  3MZW B;  1OVV A;  2ZAE B;  1VQ8 P;  1SQB D;  1YTZ T;  2XS8 A;  3H32 B;  1QPU A;  1VDF A;  3NMK A;  2XL8 A;  3S28 A;  3ASN C;  1SQP E;  4PV1 C;  3UMK A;  1Z7Q c;  1SQB K;  2JWD A;  1LWU B;  3QZC A;  1L3P A;  2PF4 E;  3H1L J;  2A68 F;  1WGW A;  4I44 A;  3A0H H;  3RK3 D;  1Z63 A;  4G78 A;  4OD4 A;  4KT0 J;  1NU9 C;  2LQG A;  2OYH B;  3WAQ A;  1RF0 A;  1EDJ A;  2QIW A;  1SQX J;  2XS1 A;  3NYL A;  3LID A;  3P8C D;  4EIY A;  5AVS B;  2KNC B;  1S7Z A;  2E74 D;  3H1H J;  3ZTM A;  3M9Q A;  1M7L A;  1VPC A;  3P32 A;  2G3A A;  3HD7 A;  1GTW A;  4U5H A;  3QW1 A;  4YL3 A;  2IXP A;  4U3F E;  3CWB G;  3A0B E;  1L0L J;  4DJ9 A;  1X22 A;  3UIA A;  2WZ7 A;  1HH0 A;  3AG1 C;  3V6I A;  4H0L C;  5COF A;  2PP6 A;  1L0L D;  4NPE A;  1RJ9 B;  3M9H A;  3RYL A;  1D1B A;  1NTM D;  1OW6 A;  2WZG A;  3K1H A;  1LP1 A;  2AEJ A;  1YAR O;  2HKV A;  1JO5 A;  1V55 C;  1MMG A;  1AQT A;  4OD5 A;  3SSU A;  2OTK E;  3NRH A;  3VF0 A;  3HJC A;  1JUN A;  5TIS E;  5L3Q A;  4H4K C;  4I1M A;  4ZKU A;  2W4M A;  1BR1 A;  4JIO A;  1F1M A;  2HPC A;  4BJT A;  1FAV A;  1VQL P;  3FXE A;  2V4H A;  3DZA A;  1JY2 P;  3AEF C;  2IXN A;  3FVY A;  1J1D B;  1ZW2 A;  3IAO A;  1LKX A;  3T6J A;  2W83 C;  4OGQ B;  3TGU J;  3B4S A;  3OWT A;  2Z15 A;  1U0B B;  5KLV E;  4IOI H;  1YJG A;  1DH3 A;  4R4M A;  1E79 H;  2CK3 H;  1E84 A;  1L7C A;  1Z6A A;  3W4Y A;  2C04 A;  5KLI B;  3K33 A;  1WRG A;  3QVY A;  1SQB J;  2LFF A;  3IHU A;  2ZVN B;  2YIU C;  1LTA C;  2FYU D;  2WTY A;  4L6R A;  3HE5 B;  3L35 A;  3Q6N A;  2WSS H;  5KTB A;  3VMZ A;  3II6 A;  4W80 A;  2E5Y A;  1HTL C;  3CX5 H;  2W8Z A;  4PJ0 H;  4K0D A;  1PV3 A;  1SFC D;  2K9J B;  3A7O A;  3AG4 C;  3GF7 A;  5KAF E;  2RD9 A;  2IBZ G;  1BCC G;  2L5G B;  4AUW A;  4IAR A;  4X0R A;  2N1T C;  5CI8 A;  2A69 F;  1RMV A;  3BRV B;  1P84 I;  2QTV A;  2GUV A;  3KZI H;  1FZC C;  4C3D A;  2M0B A;  4ZNC A;  3C63 A;  2HJM A;  3EZI A;  3LAY A;  2R7X A;  1YTZ I;  4PAC A;  3BRT B;  3MFN A;  3IFM A;  2M4E A;  3GLM A;  3O39 A;  1Q0F A;  4U9E A;  3AE7 C;  1RF1 C;  5A6J A;  3QMK A;  3L71 E;  3L70 J;  2HR3 A;  1PFI A;  1VYI A;  1ZU4 A;  1XTC C;  1NTZ D;  3H1K J;  4MS2 A;  1MMD A;  3KYI A;  2HV6 A;  1WAT A;  3V5Z A;  4DT0 A;  3VAY A;  2EIM C;  2L9J A;  2XLW A;  1WOL A;  5KYW B;  1X8Y A;  3CWB J;  2GM4 A;  3SFD C;  2QJY C;  4N78 E;  3GMA A;  1IZN B;  3RFY A;  1GK4 A;  5AW6 B;  2ZXX A;  3IPM O;  2NUP B;  1OIP A;  1J8M F;  3HE4 A;  2N1T D;  1SF8 A;  3KZI E;  3FGA D;  5E79 H;  4CS8 C;  3AG3 C;  4N6H A;  1ZME C;  2ZYA A;  4ANJ A;  1KOR A;  2WVQ A;  4I1O B;  3V5Y A;  2Q3T A;  3H1I D;  2CCY A;  2ZT9 D;  4XWJ A;  3HE4 B;  3VYI A;  4UB6 H;  5B5E H;  1DIP A;  2XLE A;  3I5C A;  3JSE O;  1M1J A;  4CS9 C;  2E75 B;  3CSK A;  2AVK A;  3WOD F;  4AQR D;  4DCK A;  2XXA B;  1LTI C;  2O1J A;  1PGQ A;  1ZOY C;  2YHS A;  5T3T A;  1D7M A;  1OCC C;  5KJ7 D;  3Q5P A;  3FDQ A;  1GL2 B;  1KFM A;  5E79 E;  3T9O A;  1FZC A;  1VQN P;  2QY9 A;  3EGD B;  4DOJ A;  5AW3 B;  1OMI A;  3CLQ A;  4Z1M H;  1M2O A;  1OX3 A;  4XQ1 A;  2FY8 A;  3G71 P;  2EIL C;  3LNR A;  1USE A;  3O6Q B;  2AXC A;  2JKV A;  3L74 D;  3TDK A;  3VM6 A;  2KUB A;  4XEK A;  1IJD B;  2IX7 C;  2LK4 A;  3ABK C;  1T5O A;  2Y69 C;  2PFX A;  3AQB A;  3Q1M A;  2QA4 P;  3HTK A;  1O3U A;  3RL0 C;  1MFT A;  1MFZ A;  3O10 A;  1LT9 B;  3C18 A;  3HRN A;  4BJ6 A;  3ZIB A;  3BCC G;  1RE3 A;  4NQF A;  1IO4 A;  1G5Z A;  3I55 P;  2YWA A;  5KLV K;  1GQA A;  3FHD A;  4DVY P;  1HBW A;  2XM4 A;  1VOM A;  5AW2 B;  1GW3 A;  3M0D A;  2I1K A;  4LER A;  4P6I C;  4E0H A;  3EH1 A;  1SQP J;  2HLO A;  2CNW A;  4CS8 A;  1TKN A;  2QJP C;  3NKE A;  4R4L A;  1YDI A;  3DJN B;  3NG1 A;  1WMK A;  3GOR A;  2QE9 A;  4U5E E;  3GM3 A;  1MQV A;  2OG2 A;  1R5I D;  4XPW A;  5H2F H;  1YYC A;  4NY3 A;  5CI9 A;  1JMW A;  2H7V C;  4O6Y A;  3SZR A;  5D91 A;  3CWB E;  1L4A B;  3DI5 A;  4J7T A;  3I5P A;  3O6X A;  4OVN F;  2E5T A;  3DMD A;  3L71 J;  3L70 E;  2PAJ A;  5CJ4 A;  1USD A;  3AEE C;  1AEP A;  2YLD A;  1EQ1 A;  4N78 D;  1KC8 Q;  3FAP B;  4EYY Q;  3FX0 A;  2YL0 A;  2WL8 A;  1OR2 A;  2J46 A;  4JYB A;  1IFJ A;  3R7C A;  2Q9A A;  1LP1 B;  2ASR A;  1NTM K;  1HF9 A;  1HUC A;  1L0N D;  3KPH A;  4D6T G;  4JW1 A;  5GTI E;  2OYI C;  4BXL A;  4P9T A;  4KI2 A;  1EA8 A;  1A0B A;  2B88 A;  2WMM A;  1YYX A;  3PDM P;  3QVZ A;  2L81 A;  1CSB A;  1TWC A;  1L0L K;  2YKQ A;  3RK3 E;  2K3R A;  4GDO A;  2R02 A;  4EHP A;  3RH3 A;  1T3U A;  3EQL F;  1IFI A;  1NO4 A;  1CPQ A;  2XKM A;  3MYI A;  3EQ2 A;  1S9K E;  2MYS A;  1AVO B;  4ULV A;  1NGM B;  1TQG A;  3X2Q C;  3DKA A;  2WT7 B;  5L0D A;  1YJW P;  4YJW A;  1VQO P;  3JCU H;  3ITK A;  4K7B A;  3V5X A;  3HD7 C;  3K5B A;  1MKM A;  1SQB E;  2QJP B;  5EGY A;  2FYN C;  1P84 E;  3RK2 D;  3K6B A;  1S1C X;  2IOQ A;  5DQZ A;  1QLE D;  3PCV A;  1PP9 J;  2A0U A;  3MYF A;  4RJT A;  1K8A Q;  4W8P A;  1QGK B;  5KYY B;  3VMA A;  2WSC H;  2Z4E A;  5JP7 A;  1TWA A;  2GA1 A;  2GA0 A;  3JCU E;  4B86 A;  1JM0 A;  2PX0 A;  4Y99 C;  3SXM A;  2O1K A;  5A6K A;  2KYH A;  3GW6 A;  1JMB A;  5JS5 A;  1ZRT D;  3FXH A;  4JJG A;  3AE9 C;  1SYQ A;  2XL6 A;  4M3L A;  1W2B O;  1YI2 P;  2QUP A;  4DZO A;  2BL2 A;  3N0T A;  4MVZ A;  3WU2 E;  3GEE A;  2KK7 A;  3CCE P;  5IY5 C;  4OIN F;  1NU7 D;  5GTI H;  4NTF A;  3P8M C;  5AW5 B;  1SQX K;  1N7L A;  2X51 A;  3NKD A;  3ABM C;  1YQ4 C;  4MW8 A;  3GF3 A;  4H13 C;  5APS A;  3WUT A;  4YTP C;  4HKZ H;  1BGY D;  3L72 E;  3M4B A;  2LIG A;  3CCS P;  3CXH E;  2QSI A;  1YJN P;  2KLU A;  3U9J A;  4F4B A;  2GWW A;  2ZXR A;  1VL2 A;  1XZP A;  1NTM J;  1NJI Q;  2ZPA A;  3VMY A;  4CPG A;  2Y0E A;  4PJN A;  4PD4 H;  1K40 A;  256B A;  3N7N A;  1ZRT E;  3LJB A;  2DI3 A;  3RVY A;  2ZXO A;  2KSE A;  4CDV A;  2E74 C;  1FJK A;  2XNX A;  4U3F G;  1YAU O;  4OGQ C;  3K1I C;  2L7A A;  1PPJ G;  2JD3 A;  1GMJ A;  3V2Q A;  2FYU G;  3MP7 B;  4JPZ B;  2ETS A;  2XLV A;  1N7S C;  4B6I A;  2Y3H A;  1KU2 A;  4WJ0 A;  5A69 A;  4O79 A;  4E7Z A;  1MUU A;  3B0V C;  1FAP B;  4RO0 A;  4RBN A;  5AVY B;  1BZ4 A;  3ITF A;  2E75 D;  2WSF J;  3HD7 D;  3IF4 A;  2C03 A;  2QM8 A;  3KYQ A;  3AE1 C;  5A6A A;  5DQT A;  1LE4 A;  4I7Z B;  1LIH A;  1LT9 C;  3L73 J;  1DX7 A;  1PD1 A;  2OYI A;  5HSW A;  2YKO A;  2R7O A;  2N1T B;  3U59 A;  2IYL D;  4NTB A;  5AW1 B;  4XTK A;  1N86 A;  3TK1 A;  2IPP A;  4HFK B;  3M91 A;  1SQQ E;  3D6Y A;  1Z3I X;  5KYU A;  1L0N G;  1NFO A;  4WY4 B;  3CAX A;  1EZV I;  2ITA A;  3LW5 H;  3T97 B;  2YLG A;  3CME P;  3TF5 A;  3PJS K;  5JLI A;  4XFJ A;  2IM8 A;  1YA9 A;  1T6A A;  1QL1 A;  3K1I A;  4NCQ A;  3L70 D;  1VLT A;  3CZ6 A;  3ZG1 A;  1LTT C;  5DS5 A;  2BCC J;  4PFP A;  2YO2 A;  3PRJ A;  1RF1 A;  1LT9 A;  1RQU A;  1KNY A;  3WU2 H;  5DLJ A;  1ZW3 A;  2Y9Y A;  3GHG B;  2WVO A;  4AL0 A;  4GOE A;  2G3V A;  4DBR A;  2W6A A;  3AE6 C;  1E83 A;  4KBL A;  1H9T A;  2R05 A;  3HNJ A;  2E42 A;  3HUS B;  2V7Q H;  1YZC A;  3S27 A;  3E1I A;  1NKZ B;  1GU4 A;  3GM2 A;  1FOS E;  1TR2 A;  4K35 A;  1VF5 B;  4FAP B;  1YYJ A;  2PGD A;  3RW0 A;  3L72 J;  1DD3 A;  5KYX A;  1G2C A;  2E87 A;  2OYH C;  1AA0 A;  2Q3I A;  1GK6 A;  2Q6Q A;  3H1L E;  1NTK J;  2YZS A;  4U5F E;  4HH2 A;  2N9Y B;  3TNU B;  1Z5Z A;  2EIJ C;  2QJY B;  1VB5 A;  3EWK A;  2FFD C;  1T6Q A;  1DEB A;  2OU6 A;  4AX2 A;  1AV1 A;  1EZV D;  3V2P A;  3HLZ A;  4FES A;  3RF3 A;  4JUR I;  1OW7 A;  5L0J A;  1KB9 E;  4BRY B;  2D4U A;  1U7J A;  4LGD E;  1QZX A;  4NTA A;  3H1K E;  1BR2 A;  2O3J A;  4E7S A;  3NTN A;  1PP9 G;  2MJZ A;  2OYO A;  3TOL A;  1HVV A;  2NPS C;  1QVG O;  3MUD C;  1LS1 A;  2DGJ A;  3W8H A;  2WPV B;  2JWA A;  3U8P A;  2FFD A;  4IAO A;  4YXW H;  1ST6 A;  5C39 A;  4XPX A;  3EFF K;  1IFD A;  3CCU P;  3IQC A;  1QL2 A;  2QG4 A;  4ZKP A;  2L91 A;  2QNL A;  2FYU K;  5JSL A;  1JOG A;  3V4Q A;  4C3E A;  3SXZ A;  4WGZ A;  3U2L A;  2XLO A;  2MWQ A;  1GGQ A;  5T1D B;  4C7N A;  2LP4 A;  3F89 A;  3MUD A;  1JPN A;  1NZE A;  5B5E E;  2O9X A;  1FC2 C;  1YIJ P;  3NMD A;  2DYS C;  1HJB A;  2A06 G;  3EGX A;  3TGU E;  3LS1 A;  1J8Y F;  2Q00 A;  1URQ C;  2ZYD A;  3CX5 I;  2P61 A;  4MTF A;  2H89 C;  1MV8 A;  5AW4 B;  3WMM 0;  2PFD A;  2WWW A;  3EHN A;  3AE8 C;  1K04 A;  5F5F A;  1N7S B;  4LLH A;  2X0C A;  4YK5 A;  2OTL P;  1CI6 A;  2BCC D;  4PJL A;  1OCR C;  1SMY F;  4XEV A;  3RIP A;  4LDK A;  3RK2 C;  2E76 D;  3BVH A;  2KSJ A;  1FMW A;  2JEE A;  3H1I E;  1A02 J;  3U0C A;  2HSB A;  1RXQ A;  4BPM A;  4CIH A;  2GAQ A;  4YT4 A;  2YO3 A;  3G9R A;  4QI0 A;  3CMA P;  2YQY A;  3DAG A;  3GWN A;  2JR8 A;  1KV4 A;  3L72 G;  2H43 A;  4I1L A;  4N6J A;  1ZHX A;  2VCC A;  3L37 A;  1V4A A;  1JY3 O;  1FZC B;  2A6E F;  1OW8 A;  2CDQ A;  1N8R Q;  1H9G A;  3A0B H;  1SQV K;  3EFO B;  3GEI A;  3A11 A;  2OJE D;  1VF5 C;  2EIN C;  2R7Q A;  3K66 A;  2YXQ B;  2CYD A;  4H13 B;  3VRC A;  4I6M C;  5M1B A;  1N2D C;  1M1J B;  1FJP A;  3L71 D;  2XM0 A;  3FXD A;  1S05 A;  5AVV B;  4WAB A;  2IBF A;  1DEE G;  4JTD B;  2W45 A;  2LD6 A;  1FZA A;  1KQL A;  1BCC J;  2ZXW C;  3F5H A;  5AVZ B;  2XSE A;  4K3A A;  1H89 A;  4CJG A;  1E2X A;  1UG7 A;  1T2K D;  4KC9 A;  4PV1 B;  1SVF A;  2I15 A;  1YZA A;  1Q81 Q;  2KS1 B;  2LXB A;  4A4A A;  3V2R A;  2Q9C A;  2Y9Z A;  3MIW A;  1KB9 D;  1IFN A;  4L73 A;  4UB8 H;  4G7O F;  3S4R A;  3UMI A;  3C8V A;  2IFN A;  1G4U S;  2HSQ A;  3V2N A;  1CPR A;  2XV5 A;  2VCA A;  4BEM J;  4WY4 D;  1ZR4 A;  4N06 A;  4I7Z C;  2Q9B A;  4CBE A;  2ZD9 A;  3LNM B;  5EHH A;  3FWN A;  5AVX B;  2TMV P;  4Q7C A;  2XRH A;  3Q5S A;  3M06 A;  1U6H A;  2IZ1 A;  4C7O B;  1ZHT A;  3EHM A;  1L0N K;  5E33 A;  1M2V B;  3AEA C;  2KYV A;  3M0A A;  3L34 A;  5KLV D;  4D4X A;  1DOV A;  4H44 D;  3NMJ A;  5KKZ C;  1NTM E;  3FWL A;  4XA4 A;  4H44 C;  3CXH D;  2B87 B;  1BE3 E;  1TWH A;  2OQM A;  1YQ3 C;  1IZM A;  4DBQ A;  4WWI A;  2I8D A;  1JEK A;  3H6P A;  2P10 A;  4ASV A;  4PD4 E;  4RES B;  3RK3 B;  4IAQ A;  2YNY A;  2P2U A;  1ZU5 A;  1KB9 H;  4OWF A;  5APW A;  5CIV A;  3I4U A;  2PBE A;  4YL0 A;  1OKK A;  1IK9 A;  1C03 A;  2R3C A;  5B1B C;  3U9M A;  1JR8 A;  1H0T A;  2J8W A;  1Q2N A;  1ZW0 A;  2P67 A;  2P58 A;  5KYU B;  3CCM P;  3BAS A;  3KDP B;  4YT8 A;  1LWU C;  1ZXG A;  2B9B A;  2EIK C;  2YLI A;  3OJA B;  1MMA A;  5T3W A;  3IN6 A;  2R7U A;  3X1O A;  1E5W A;  1R5L A;  2NZ2 A;  2H8A A;  1JB0 J;  5APY A;  3CX5 E;  2R5D A;  5KLV J;  1EXJ A;  1JY3 P;  3TSI A;  1NBB A;  4IRU A;  3HNK A;  1KYO H;  2L6F A;  4HE8 D;  1N1C A;  5CHX A;  2A06 D;  4MN4 C;  3RGU A;  2DB4 A;  1GL2 D;  2YEV A;  2VCB A;  5F5H A;  3A0H E;  1K73 Q;  4ULW A;  3Q6M A;  3H1H G;  4MVS A;  1VF5 D;  2PNO A;  2Q7R A;  2JJL A;  3RKO F;  4AE4 B;  1SQV D;  3U1C A;  1S5L E;  4ZMD A;  4KNW A;  3L1M A;  1KIL B;  2FXO A;  3VP8 A;  4Z9J A;  3LUT B;  3B0P A;  2JDI H;  1QQ3 A;  2J45 A;  3ZVR A;  3J06 A;  2HOD A;  3ZDM A;  1HE9 A;  1CGM E;  2QRX A;  2QM7 A;  1S9K D;  2J9B A;  4BJ6 C;  2KI7 B;  2HZ8 A;  1QX8 A;  3KYJ A;  1BSH A;  2WVR A;  2CNW D;  1RE3 C;  2C0X A;  3SWY A;  1J2J B;  1Z23 A;  2R44 A;  1SFC B;  2Q7C A;  1HMO A;  2OCC C;  1FFT C;  4MW3 A;  1JTH A;  1VLS A;  1ZVZ A;  3CCV P;  5CCH C;  1Q0D A;  1ZHW A;  3OA7 A;  2BE5 F;  1CI6 B;  1EDK A;  1JY2 O;  1L0N E;  3SWK A;  1A02 F;  4MVQ A;  1LWU A;  2YIU B;  2Y3D A;  1BGY E;  3G4Z A;  2B89 A;  4YN0 B;  1L2P A;  3T6B A;  3A3Y B;  2VRS A;  2R9R B;  2K88 A;  1GL2 C;  3ZC4 A;  2QJK B;  4WB4 A;  1Q0G A;  2P7J A;  1A41 A;  1SQB G;  4W8K A;  2M5A B;  2SPZ A;  3H1I G;  2EPN A;  1FE6 A;  4JBZ A;  3E1R A;  1H8A A;  3H1J E;  3G4S P;  1BE3 J;  4DJG A;  1GDT A;  4U3F J;  3FAJ A;  4TLF A;  2Z5I A;  1BDJ B;  3Q7G A;  2D5R B;  1SS1 A;  4LLE A;  3L75 J;  1JY3 N;  2Z5H A;  3ZSU A;  3B71 A;  1OXZ A;  3Q3D A;  2P7V A;  3B29 A;  2UUI A;  2R3S A;  1FMV A;  1M56 D;  1Y8A A;  2AP3 A;  2RSE B;  2XXA A;  4H13 D;  3CL3 D;  2M5A A;  3GG2 A;  2EPL X;  3H1L G;  2AWY A;  1T6I A;  4G7Z F;  3GEH A;  1LNQ A;  2FAP B;  4O6N A;  4U7J A;  1T8Z A;  3B8E B;  4EUK B;  3L74 J;  2ICW G;  2CPS A;  2A0B A;  3N24 A;  4YXD C;  1NOH A;  1SQX G;  4Y28 J;  2NRG A;  3V5B A;  2B0J A;  4HYT B;  1NTK K;  2BAS A;  2J9W A;  3GAN A;  3SYN A;  1AVO A;  5JRA A;  4MTG A;  3G6E P;  3H1K G;  1ZHZ A;  3EZH A;  1P84 D;  4EKW A;  4WY4 C;  2C9L Y;  3HNI A;  2O01 H;  4IL6 E;  1HY5 A;  3C8G A;  2H7H A;  1VQ6 P;  1T3J A;  3H1J D;  2KQ9 A;  5TIS H;  4KHX A;  3AE2 C;  1AVY A;  4U5C E;  4XEF A;  2YL7 A;  3L36 A;  1SQX D;  4JJF A;  4BG0 A;  2NSG A;  2F22 A;  1FDO A;  3AE3 C;  2H7O A;  3KHU A;  5DJT B;  2M64 A;  2OOC A;  3C7J A;  1E86 A;  3JSZ A;  3W8I A;  2AXT E;  5GTH H;  3GWL A;  3MHV A;  2IYO A;  1SQQ G;  3HUS C;  2ZXP A;  5L0F A;  1GZL A;  4MVM A;  3ATP A;  3BRJ A;  1KIL A;  3VMX A;  1K05 A;  1OXB A;  4YT5 A;  1RF0 C;  3AEB C;  4HB1 A;  2J5U A;  3SFE C;  3H1J J;  3TGU G;  2E76 C;  5AVR B;  3ZQV A;  3R4Y A;  4MVO A;  4CJO A;  3DM5 A;  2W6J H;  2EPO A;  5A6B D;  2P0N A;  4RD9 A;  2WSC J;  2XZR A;  1FZE A;  5CCH D;  4WY4 A;  3CCJ P;  2KW3 C;  4JVS A;  3TK0 A;  1FNT c;  2O01 J;  3AGU A;  2UUH A;  1NU1 K;  1FZF A;  4A2N B;  2LCH A;  2N1T A;  2I8B A;  2OKU A;  1VYK A;  4Y99 B;  2R32 A;  2IDB A;  2V3C C;  4EIJ A;  4XLN F;  1SQV E;  1RKC A;  1GU5 A;  3CQZ A;  2P6V A;  2FYN B;  5B3S C;  1MZ9 A;  1YBK A;  1Y4C A;  3M15 A;  2NG1 A;  5AVU B;  2XLD A;  1G8X A;  3JC2 2;  1NTZ E;  1KYO D;  1EI7 A;  3ABL C;  3C8G B;  1FFH A;  1OCO C;  2AWC A;  2A06 E;  1BSN A;  5APT A;  3TD7 A;  1GD2 E;  2WZL A;  1FZB A;  2ZFC A;  3LEV A;  4GYT A;  3HTK B;  4Q4Z F;  4U9D A;  1FS0 E;  1IK7 A;  1T9K A;  2A1D D;  4E0I A;  1OKK D;  1YJ9 P;  3JTL O;  1CZQ A;  1NU1 G;  3TJ6 A;  2HS5 A;  2HMQ A;  5B3I A;  4PFO A;  1URQ D;  4H0L D;  4H0L B;  1NH4 A;  2ZYG A;  2FYU J;  4FX5 A;  1BBH A;  3R2P A;  4ASW A;  1VQ9 P;  4PK4 A;  1OVU A;  4C7O A;  3H1H E;  1HGV A;  4MTO A;  4QMA A;  1NLX A;  4KJM A;  1L4A D;  3TJ5 A;  2WB7 A;  1KZU B;  2V26 A;  1PL5 A;  2D2C B;  2IZ0 A;  3EGD A;  1H7I A;  4E18 A;  1EZV E;  1MNE A;  1NWQ A;  4PR9 A;  2M3E A;  4GIF A;  3HD7 B;  1MND A;  4PD4 D;  3DM9 B;  5AW8 B;  3LLI A;  3EJN A;  2HMZ A;  3C62 A;  3L75 E;  4RKU J;  1WWP A;  4YL1 A;  2I1J A;  3IR9 A;  1K9M Q;  1Y47 A;  3KQG A;  1YIT P;  2D2C C;  2PRR A;  4XPY A;  3SWF A;  2YRF A;  1NTK E;  4W7Y A;  1WN0 A;  4BJ1 A;  3NMI A;  4JYC A;  2HV7 A;  1KYO I;  2NPS A;  2XND H;  4U5B E;  3V7O A;  1URQ B;  1M6T A;  2Q4F A;  3FMS A;  5BQG A;  1LTJ B;  2UWJ E;  4A7P A;  3L0I A;  4HFF B;  2W27 A;  1S5L H;  1SQV J;  1Q90 D;  2M3B A;  2NUP A;  5A6B A;  1KQG B;  2KZJ A;  1NTZ K;  1C17 M;  2Q1K A;  3TUL A;  1M57 D;  3A5T A;  1FR0 A;  1BE3 G;  3GOD A;  1IFP A;  2FFH A;  1SFC A;  3KKB A;  1U89 A;  2LSE A;  3H1H D;  3TOM A;  1FTS A;  2Q3E A;  1LTS C;  1JPJ A;  3AEC C;  2FKW B;  2KJG A;  4Z9I A;  1KMI Z;  1OQC A;  4RDA A;  3G50 A;  2CGE A;  2YVK A;  2K37 A;  1DOW A;  1RE4 A;  1ZV8 A;  1T2K C;  5AC5 A;  1ZP0 C;  1BDD A;  1DD4 A;  3RK3 C;  3LW5 J;  4NPD A;  1L4A C;  3K7D A;  2IBZ I;  4GT1 A;  1ORY A;  3HUS A;  4UB6 E;  5TJH A;  2BEZ F;  3B5N D;  5CCG D;  2H88 C;  1CGO A;  4E17 A;  4IL6 X;  1HW2 A;  1NSG B;  3GHG C;  2NPU A;  2GUS A;  3VN0 A;  4LC1 A;  3U8V A;  4AE4 A;  3UNG C;  2LXC B;  1KYO E;  2JP3 A;  2E43 A;  3QWO C;  1IW7 F;  2IFM A;  1G1I A;  3AQC A;  3USS A;  1TFK B;  5KJ7 A;  5FCL A;  1M1J C;  4NPF X;  1TU3 F;  1FDI A;  1RY3 A;  2OQQ A;  5B66 H; 
#chains in the Genus database with same CATH homology
 4PV1 B;  2JO1 A;  2L6G A;  2QIW A;  1JOG A;  5KLI C;  3AE2 C;  2E74 D;  3RL0 g;  4XEF A;  3L8I A;  2E74 B;  3AEG C;  4H44 B;  2QJP C;  2G3A A;  2WSE J;  1PL5 A;  3RQF A;  4R4L A;  2D2C B;  1FDO A;  3C8V A;  3AE3 C;  1WMK A;  3D6Z A;  4EBK A;  3D6Y A;  3Q5R A;  3GM3 A;  4I7Z C;  1WOL A;  3AE9 C;  2E76 B;  3SFD C;  3T97 B;  2QJY C;  2Q00 A;  4H0L C;  4RKU J;  1WWP A;  3GMA A;  4XFJ A;  3Q5S A;  1WTY A;  2H89 C;  1OW6 A;  1UFB A;  3H25 A;  3AEA C;  3BRJ A;  3ABV C;  2D2C C;  2QJK C;  1K05 A;  3AE8 C;  1K04 A;  1U57 A;  1HJ0 A;  1KNY A;  1RQU A;  3AEB C;  2J5U A;  2E75 C;  4H44 D;  5KKZ C;  3FGA D;  4H44 C;  3SFE C;  3AEE C;  2WQY C;  1YQ3 C;  1ZME C;  3AE6 C;  4XEV A;  2E76 C;  1PIX A;  1KOR A;  3R4Y A;  1YQ4 C;  2P10 A;  3GF3 A;  4H13 C;  2E76 D;  2G8Y A;  3AED C;  3O6Q A;  3TUL A;  2JPU A;  2ZT9 D;  4YTP C;  3GM2 A;  3U0C A;  5L8R J;  1Q90 D;  1DIP A;  2HSB A;  3AEF C;  5F28 E;  1VF5 B;  3JZ0 A;  1KQG B;  2WSC J;  4TT3 H;  3IAO A;  2E75 B;  4OGQ B;  1KQF B;  2QSI A;  3JYY A;  3G9R A;  2O01 J;  4OGQ D;  2YMK A;  1AJY A;  1HF9 A;  1RQV A;  3AE4 C;  1QVX A;  1KTM A;  2PBE A;  1DD3 A;  2KK1 A;  1VL2 A;  4R4M A;  1ZOY C;  1EXI A;  2IDB A;  3AEC C;  1KMI Z;  3Q5P A;  1KIL E;  1V4A A;  1K40 A;  3RK3 E;  2BEQ D;  2MKV A;  1ZZP A;  4GDO A;  3GM1 A;  1OW8 A;  1S5L X;  2YIU C;  1ZRT E;  3IN6 A;  1ZP0 C;  3EWK A;  1DD4 A;  2NZ2 A;  2JX0 A;  1OMI A;  1JB0 J;  4Z1M H;  3D70 A;  1UIX A;  3B71 A;  3LW5 J;  3D71 A;  2E74 C;  3Q3D A;  1NGM B;  2ZT9 C;  3K7D A;  1VF5 C;  1OW7 A;  2FXP A;  1NYH A;  1EXJ A;  4H13 D;  3C8G B;  3U3F A;  2BEZ F;  4H13 B;  4OGQ C;  1PV3 A;  4XEK A;  3RQE A;  2FBW C;  2H88 C;  5M1B A;  2LK4 A;  4IL6 X;  3GF7 A;  1R8E A;  3RQG A;  2L6F A;  4PV1 D;  3Q1M A;  1MKM A;  1GMJ A;  1O3U A;  2FYN C;  3O10 A;  1IK7 A;  4PV1 C;  3C18 A;  2JP3 A;  4U7J A;  1S1C X;  2D2C D;  2L6H A;  3L8J A;  4YXD C;  2ZT9 B;  4Y28 J;  4EBJ A;  2WPV B;  2V7Q J;  4NQF A;  2YWA A;  1VF5 D;  3S9O A;  4H0L D;  3MFN A;  4H0L B;  2E75 D;  2WSF J;  4R32 A;  3AE5 C;  3AJM A;  3C8G D;  1TU3 F;  1FDI A;  3GLM A;  3Q2Y A;  1Y9B A;  4KT0 J;  3AE1 C;  2OQQ A;  4I7Z B;  3AE7 C;  3C8G A;  2K9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...