3KH2A

Crystal structure of the p1 bacteriophage doc toxin (f68s) in complex with the phd antitoxin (l17m/v39a). northeast structural genomics targets er385-er386
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
124
structure length
124
Chain Sequence
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHISNDANKRTALNSALLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Death on curing protein
publication title Crystal Structures of Phd-Doc, HigA, and YeeU Establish Multiple Evolutionary Links between Microbial Growth-Regulating Toxin-Antitoxin Systems.
pubmed doi rcsb
source organism Bacteriophage p1
total genus 50
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1870 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3kh2A00
3DD7A 3K33A 3KH2A
chains in the Genus database with same CATH superfamily
2LFDA 3S27A 2PNOA 3AQCA 4CDAA 3H2UA 4MVSA 3GM3A 2IXNA 1C02A 4BEJA 3ITFA 1FNTc 2XRHA 2PX0A 3ZWIA 4L6RA 3O10A 2OOCA 4H54A 2KNHA 2LP4A 2P1AA 3V5ZA 4ANJA 5B1AC 4XPWA 1FR0A 4JRZA 4P9FA 2EPNA 1TWCA 5GPGB 2E87A 3AGUA 1LPEA 1ORJA 4DRJB 1RKEB 5BQGA 5T1DB 1YVIA 2GAQA 4MVRA 4E7SA 2QLAA 3N0TA 2M64A 3NKEA 2IYLD 3DXJF 2AWCA 2Y69C 4LDRA 2YEVA 4OD4A 2P0NA 1JOGA 1OR2A 1XZPA 4MTOA 5A6BD 1TFOB 4Q5SF 2R7RA 2R9RB 3EH1A 4NC3A 2XXAB 2IXPA 1UFBA 3L8JA 1YAUO 3VYWA 2R7WA 1U6HA 2WL8A 5DS6A 2A6EF 2KW3C 3FMSA 2CDQA 5KYUB 4JURI 4CS9A 4G7HF 2BL2A 2JPUA 5TJ5E 3T4RA 4AL0A 5JLIA 3CEXA 3G4XA 4DVZA 4F4BA 2R7SA 5COFA 3C7JA 1RJ9A 3EZHA 3E9VA 4JC7A 1VMAA 3TOMA 3VAYA 1YYXA 3C18A 3RIPA 3CZ6A 1ZHTA 1G4WR 3GM1A 3TD7A 4C3DA 4O7GA 3IHUA 2W9YA 2YVKA 3LUTB 3GWNA 2XM0A 1E86A 1MNDA 4YWQA 4Q4ZF 2D5RB 4KNVA 3RVYA 2J9VA 3RVZA 3DZAA 1OXKA 2DB4A 4NTFA 3SEOA 4QDLA 1JMWA 1TWHA 2XL8A 5JUAA 2FAPB 2PFDA 3US6A 5AGFA 3SXYA 5BQIA 2HKVA 2NUTA 5BUOA 1KTMA 3JRMO 4BJTA 2GFHA 2XS1A 4MW8A 2YLDA 1SZIA 3NMIA 4JIOA 2NUPB 2IOQA 3EGXB 3FXHA 1HW1A 1DOVA 3RF3A 5E3AA 4B6IA 5JVEA 2R7VA 3EPVA 2GA0A 3PDMP 2HV6A 5K0IA 2I15A 2ICWG 4D4XA 1M2VB 1OW6A 2Q9BA 4DXWA 3T6JA 2HJ3A 2QY9A 2W4BA 2YL1A 4YJWA 1ORYA 5FCLA 2Y3GA 3S90A 3QVYA 2QTVA 3JT1A 4ULWA 2CW0F 3LNMB 1VYKA 4YL0A 1OKKA 3S29A 4BEMJ 4DJ9A 2LD6A 4Z9JA 3JRTA 5JP7A 4IJJA 3DE8A 4U5CE 1M57C 4FX5A 3AG3C 1RJ9B 1V74B 4GEHA 4BJ5A 2KJGA 1QQ3A 1O5HA 4MTGA 5D91A 3ECSA 3MYIA 5E33A 3X1OA 1Z5ZA 1M2OA 5EK0A 2YL0A 3WAQA 4EIYA 5IY5C 4EUKB 3GANA 3SXZA 4G7ZF 2PX3A 3M1CB 2BC5A 2DYRC 3WHNA 3AGTA 1BR2A 3N24A 2V3CC 5JSLA 1YA9A 5F28E 1HE9A 1I5NA 1MMGA 1ZHWA 1YA7O 3EQLF 2P6VA 5E2QA 3TQOA 4AK9A 5HSWA 1VOMA 1TWAA 3ZC4A 2NUTB 3M4BA 5DVWA 3RQGA 3HNKA 1VLTA 2A68F 3AJMA 3ZTMA 2L81A 1LVKA 4P9TA 1YYJA 3NMJA 4CS8A 4ULVA 4ZLDA 1QPUA 4NY3A 3SXKA 2J9WA 3DJNB 1CPRA 1MMDA 2LSEA 3ZDLA 3IQ5A 3A9CA 2WB7A 4PJJA 4XLPF 4J30B 2WVNA 1IW7F 3EG9A 4ER9A 2KSFA 2XXAA 1PV3A 1ZHXA 2LIGA 3C8GA 5L0CA 3W2VA 1QLEC 2HSQA 4JE9A 4JKVA 1HMOA 2LCHA 1T6QA 2VCAA 3FAPB 4I1MA 1NU9C 3GODA 2CCYA 4KBLA 2YHSA 4EBJA 2A1DD 1AVOB 3ATPA 2X0CA 2J8WA 4E17A 4UDVA 1RMVA 3GORA 3K66A 4PJLA 3U3BA 1APCA 2QE9A 4DVYP 2L9JA 4PK4A 5KYYB 3G4ZA 4U5GA 5B3IA 1YZAA 5AC4A 2XL4A 1AUEA 3K33A 3S28A 4U5DE 3CQZA 4A2NB 2D4UA 2XS8A 2ZPAA 2DGJA 1D0YA 3LESA 2NSGA 5COGA 4MVZA 4YK5A 3TK0A 2QUPA 1NFOA 3UR3C 4DRHB 5A6KA 5JT4A 4KI2A 1G4US 2G3VA 3LS0A 1EA8A 3JYHA 1MNEA 1FMWA 4JVSA 3R7CA 3NG1A 4XTKA 2R7TA 3DWWA 1VYIA 1D1CA 2RD9A 4J32B 4AX2A 4CIPA 1Q0MA 1VK5A 1GGQA 2XLEA 3O6XA 3FVYA 2L6FA 4RD9A 4NTAA 4YT5A 4XQ1A 2ZXPA 3KL4A 2O9XA 1I4ZA 2VH3A 5BQHA 3GEIA 3NKDA 2B0HA 1S05A 1WATA 1WTYA 2RSEB 2J9BA 2EILC 2NSFA 1FFHA 1PD1A 3E70C 4JJFA 3TJ5A 2NUPA 3UNGC 3EGXA 5KYYA 1A7DA 4DOZA 1B68A 3EG9B 1LKXA 4N6HA 2YWAA 2EIKC 3LS1A 4MVUA 4PFOA 2J46A 4DBRA 3C8GB 2OCCC 2XM4A 3IEEA 3K1HA 4PACA 1M2VA 4QI0A 4CX9A 3L0IA 1D1AA 1W2WA 5T3TA 1OW8A 1NZEA 4Z9HA 4ZLCA 4EBBA 4OD5A 3OEOA 1NG1A 4YT4A 1JPNA 1O3UA 1GQAA 1LI7A 1OXBA 4O6YA 2MWQA 3CAXA 5AC5A 4BPMA 1ZU4A 2QNLA 3H2VA 2HUJA 2Y39A 3B0VC 3RFYA 2YZSA 1Z6AA 1SR2A 2XLDA 4U5HA 4X0RA 5A6AA 4LERA 1ZYRF 4CSAC 1QSPA 2Q9CA 5A6BA 1ST6A 3RW0A 1T9KA 3U5SA 4N4WA 1MQVA 2VASA 3A11A 4HFKB 4WGYA 4WABA 1TKNA 5L3VA 2R03A 1M56C 4G0HA 1Z63A 5CI9A 2ZXWC 3ZG1A 1VB5A 4PJNA 3HNJA 2EPLX 4MVMA 4WJ0A 3UMKA 3W4YA 3CSKA 3EFOA 3T6BA 3B0PA 1BZ4A 3LLIA 1Z3IX 1LE2A 2OJED 2YLGA 4I3MA 3V5YA 1HW2A 1T5OA 3MX3A 1J8YF 1MMAA 1M6TA 2KC3A 3GWLA 3HTKC 4LDQA 3T9OA 5L3QA 1H7IA 2Y3BA 3LNRA 1R4TA 1WWPA 2R25A 5D92A 3TULA 2R02A 4AE4A 4YT2A 5A6JA 2VCBA 2DI3A 1E84A 3U2MA 1JPJA 2CYDA 2P61A 2Z15A 4EKWA 4C3EA 2A69F 2EIMC 3K1IA 4PJMA 3DMDA 3ZQVA 4D4NA 2IXMA 4H4KC 5DS4A 3NYMA 3LJBA 5L0JA 3NDBB 2WVOA 4JW1A 2KYHA 2ZXOA 2HZ8A 3ASOC 2CNWD 2BE5F 2LQGA 3EGDB 4Q7CA 3U9JA 1K40A 3B9QA 2ASRA 1FMVA 1JR8A 1L7CA 2M4EA 2XLVA 1RXQA 5F5HA 2OQMA 2I8BA 4PR9A 3DD7A 3QMKA 2GDCA 3I5QA 1LS1A 3DAGA 4A4AA 3HJCA 3Q7LA 4FESA 2G3KA 2R7UA 5L0DA 2JD3A 4R32A 3W8IA 4XPXA 3EFOB 3L34A 1YDIA 3SP1A 4IWBA 4OIPF 1D0XA 5EHHA 1Q0GA 4BJ6C 2OEXA 3MYFA 1ZVZA 4U5EE 4CDVA 3B71A 4MTFA 2ZXRA 3EJNA 1V54C 4E0IA 1EKYA 1SF8A 4JTDB 4MW3A 4J7TA 4CJOA 4HFFB 2HV7A 2H7VC 3K7DA 3OWTA 3M4CA 3SZRA 1XWJA 3DM5A 4KC9A 3RQFA 1G8XA 1HE1A 3V7OA 5EGYA 1TR2A 4E18A 3U3FA 4I44A 3SXMA 4JEAA 3RQEA 3ASNC 1ZHZA 1U89A 1VLSA 3BEHA 4GQHA 4IRUA 2YL3A 1S7ZA 2DYSC 4J7YA 3VF0A 5KYXA 1C17M 5COMA 3VRCA 1DOWA 1AEPA 3JZ0A 1SYQA 3SNHA 2V26A 5JS5A 2J0XA 2A0BA 3EHNA 3J06A 3L1MA 4JJGA 4K7BA 1ZHYA 1QVXA 1RCPA 5KYNA 3M15A 3NYJA 4ONSA 4U9DA 4W8PA 2WVQA 4FWVA 256BA 1L3PA 1D1BA 1Y6DA 2OU6A 2YKZA 3IQ6A 1H9TA 4OINF 4E7ZA 2LFFA 1BR1A 1I4YA 3OA1A 2C04A 1CGOA 4LACB 2TMVP 5DS5A 3HNIA 4JEBA 3AQBA 3LLKA 2HFIA 3M79A 3QZCA 4LLCA 5JRAA 1Q0DA 1VTMP 3JSEO 3QVZA 5T3WA 4XLNF 2CGEA 3VM6A 2UUIA 5FZTA 1CGME 1FTSA 1HMDA 1NBBA 2AWYA 4OIQF 3R2PA 3U9MA 2Q4FA 4O6MA 3RH3A 4YT8A 2EPMX 5DQTA 5CIVA 2XLMA 2VB6A 3X2QC 3N2ZB 2OJQA 2XLWA 1T6UA 4DRIB 2EIJC 2OG2A 2PBEA 2C03A 3F46A 4K1OA 4K0DA 4XWJA 4NQFA 4NTBA 1EI7A 2H7BA 2Q3TA 3LAYA 2FFHA 1A7EA 2MYSA 2R7OA 4PFPA 5CI8A 4NCQA 1J8MF 3BRJA 5L0GA 4WGZA 1A0BA 1GM5A 4I1OB 3LEVA 3LEOA 4C7OA 1Y4CA 4JZAA 3AG1C 1XZQA 4C3BA 2WZGA 2GWWA 4KNWA 5KYXB 1A7VA 3C63A 4G78A 1BDJB 1YJGA 3I4UA 4EBKA 2F22A 1H6GA 2VC9A 3KMIA 2WZLA 4RDAA 3POVA 1O87A 3DI5A 4JCHA 3S9OA 3H65A 1WGWA 1JAFA 3WG7C 2HS5A 1Q0KA 4RBNA 3DE9A 3EGDA 3O55A 1LIHA 4U9EA 2R7QA 3U8PA 4DBQA 2J45A 1A41A 1D0ZA 2LK4A 3U8VA 2HMZA 2Y3DA 3U0CA 2KK1A 1NFNA 3JYYA 3QW1A 3ZTZA 3KH2A 4FAPB 3UGOA 4CDYA 3KYIA 1K04A 1Z23A 1ZW2A 5KYWB 1OCZC 2JX0A 4O79A 3IPMO 3RKOF 2NPUA 3RYLA 5A69A 2EINC 2X51A 4N6CA 1ORSC 1T01A 3WODF 2IBFA 3MLGA 4IAQA 3V5XA 4AE4B 2FGYA 1NU7D 1UG7A 3DJUB 1Z7Qc 4CIHA 3W8HA 4EHPA 3Q6NA 2PF4E 1OCOC 3FHDA 4JTCB 3UMIA 3K1IC 3QTHA 4BJ1A 3ZVRA 1PD0A 1OW7A 1KNYA 2W4MA 3B29A 3JSZA 4XPYA 4P6IC 1WOLA 2NG1A 4MQ9F 3FOOA 1YLMA 1E2XA 4C7OB 1OKKD 4QI2A 2ZD9A 1LM3B 4BJ5C 2UUHA 4IB4A 4XEFA 1CPQA 3W2WA 3ZIBA 1BBHA 5L0IA 3TJ6A 4LDKA 3S84A 2VCCA 1QZXA 3KKBA 2XLHA 1N1CA 4CS7A 2L6HA 1YARO 4CSAA 1TQGA 3UGPA 3UMHA 2HMQA 2Q00A 3L8IA 4MNDA 4W8KA 3ZSUA 2YQYA 1OCCC 3EH2A 1SMYF 2Q9AA 2XSEA 3I5PA 2H7OA 3KPHA 3TOLA 2KQ9A 2YRFA 3FOPA 1G5ZA 2XLOA 3O39A 1BR4A 3NYLA 2EPOA 1MMNA 1NSGB 3MFNA 4YL3A 2XL6A 3FAJA 4HE8D 1V55C 3HKKA 4O6NA 4JCZA 2P7VA 5E3CA 1C03A 2KGOA 1CGNA 2H8AA 1Q0FA 3HNLA 3NRHA 4N06A 4BG0A 1LS4A 2B0JA 4CS8C 2R7XA 1ZU5A 2A6HF 5HV9A 2YLIA 2PP4A 4OIOF 2R05A 3PHF2 2G62A 3DM9B 3C8ZA 2L7AA 1TWGA 1KU2A 3T6GB 2J0WA 2J7PD 3F47A 1FFTC 3EHMA 1LE4A 1OCRC 1PCXA 2EPKX 3ABKC 1QKRA 1R5ID 3JCUQ 4IGGA 4U5FE 3KYJA 4YN0B 1NLXA 3ABLC 4U5BE 5L0HA 3S0XA 5B3SC 4IAOA 2W45A 2Q7RA 2ETSA 3Q6MA 4MVQA 3AOUA 4MVOA 3Q7GA 2CNWA 3NMKA 3JTLO 3C8GD 1RKCA 5KYWA 4HEAJ 2YL7A 4EWCA 1F1MA 5B1BC 4AL1A 2A0UA 2OKUA 3C62A 3HLZA 4XEVA 4CBEA 1WASA 1GS9A 4GYTA 4MS2A 3U2LA 2WZFA 3ABMC 1RKEA 2HSBA 3AG2C 2AP3A 3AG4C 1HY5A 2IM8A 4OIRF 3SYNA 1U0BB 1V4AA 2IXOA 3QW0A 3IQCA 2J7PA 3MBGA 4CS9C 2AVKA 3PCVA 2J9UA 3B0UX 4YL1A 1FAPB 4BJ6A 1E85A 3EZIA 1EQ1A 1OR3A 4M63A 4Z9IA 4CJGA 3FDQA 1IZMA 5DQZA 1K05A 1ZW3A 5DLJA 3DAFA 3DKAA 1T6IA 5F5FA 3G50A 3GM2A 2OEVA 2Y3HA 4G7OF 4LLEA 4JTAB 2L6GA 1WN0A 3ZQYA 3K6BA 1LI5A 3GEHA 5KYUA 1OQCA 5L0FA 1ZZPA 2HJMA 3GEEA 2MHRA 1H9GA 2AU5A 3IQTA 3PMRA 1YZCA 1JRAA 4IARA 4XEKA 4E0HA 1E83A 1TFKB
chains in the Genus database with same CATH topology
3S27A 3AQCA 2IXNA 4BEJA 3ITFA 2XRHA 2PX0A 2KNHA 4ANJA 5B1AC 1TWCA 2E87A 5T1DB 4E7SA 3N0TA 3NKEA 2IYLD 3DXJF 2Y69C 2YEVA 4OD4A 4Q5SF 2R7RA 3EH1A 2XXAB 2IXPA 2R7WA 3VYWA 2WL8A 5DS6A 2A6EF 2KW3C 2CDQA 5KYUB 4JURI 4CS9A 4G7HF 3T4RA 4F4BA 4DVZA 2R7SA 1RJ9A 3EZHA 3E9VA 1VMAA 3VAYA 3RIPA 3CZ6A 1ZHTA 3TD7A 4C3DA 4O7GA 2W9YA 1MNDA 4YWQA 4Q4ZF 2D5RB 4KNVA 2J9VA 3DZAA 3SEOA 4QDLA 1TWHA 2PFDA 2NUTA 5BUOA 4BJTA 2GFHA 1SZIA 2NUPB 2IOQA 3EGXB 5KYYB 4B6IA 5E3AA 2R7VA 3EPVA 2HV6A 1M2VB 2Q9BA 5FCLA 3T6JA 2QY9A 2W4BA 4YJWA 2Y3GA 4ULWA 2QTVA 3JT1A 2CW0F 1VYKA 3S29A 1OKKA 3JRTA 4IJJA 4U5CE 1M57C 4FX5A 3AG3C 1RJ9B 4GEHA 4BJ5A 2KJGA 1O5HA 5D91A 3ECSA 5E33A 3X1OA 1Z5ZA 1M2OA 5IY5C 3GANA 4G7ZF 2PX3A 3M1CB 2DYRC 1BR2A 3N24A 2V3CC 1MMGA 1ZHWA 3EQLF 4AK9A 2P6VA 5E2QA 5HSWA 1VOMA 1TWAA 3ZC4A 2NUTB 5DVWA 2A68F 4CS8A 2L81A 1LVKA 4ZLDA 4NY3A 2J9WA 3DJNB 2LSEA 1MMDA 2WB7A 4PJJA 4XLPF 4J30B 2WVNA 1IW7F 3EG9A 2XXAA 1ZHXA 3W2VA 1QLEC 4I1MA 1NU9C 3GODA 4KBLA 2YHSA 2A1DD 3K66A 4PJLA 4DVYP 2L9JA 4PK4A 4U5GA 2XL4A 3K33A 3S28A 4U5DE 3CQZA 4A2NB 2ZPAA 2DGJA 1D0YA 3LESA 4KI2A 3UR3C 3LS0A 2G3VA 3JYHA 1MNEA 1FMWA 4JVSA 3NG1A 4XTKA 2R7TA 1VYIA 1D1CA 4AX2A 4J32B 1VK5A 4YT5A 4RD9A 3O6XA 3FVYA 2ZXPA 3KL4A 2O9XA 2VH3A 3NKDA 5EHHA 3W8HA 2EILC 1FFHA 1PD1A 3E70C 4JJFA 2NUPA 3UNGC 3EGXA 5KYYA 4DOZA 3EG9B 1LKXA 2EIKC 3LS1A 4PFOA 2J46A 4DBRA 2OCCC 3IEEA 4QI0A 3K1HA 1M2VA 3L0IA 1D1AA 1W2WA 5T3TA 4ZLCA 1NZEA 4EBBA 4OD5A 3OEOA 1NG1A 4YT4A 1JPNA 4O6YA 2MWQA 1ZU4A 2Y39A 3B0VC 3RFYA 2YZSA 1Z6AA 4U5HA 4X0RA 4LERA 1ZYRF 4CSAC 2Q9CA 1ST6A 2VASA 4HFKB 1TKNA 5L3VA 4G0HA 1M56C 1Z63A 5CI9A 2ZXWC 3ZG1A 4PJNA 4WJ0A 3UMKA 3CSKA 3EFOA 3T6BA 3B0PA 3LLIA 1Z3IX 4I3MA 3MX3A 1J8YF 1MMAA 5L3QA 3HTKC 2Y3BA 3LNRA 5D92A 4YT2A 1JPJA 2Z15A 4C3EA 2A69F 2EIMC 4PJMA 3DMDA 2IXMA 4H4KC 5DS4A 3NYMA 3LJBA 3NDBB 2WVOA 4JW1A 2ZXOA 3ASOC 2CNWD 2BE5F 3EGDB 4Q7CA 3B9QA 1FMVA 2M4EA 5F5HA 2I8BA 3DD7A 3QMKA 3I5QA 1LS1A 3DAGA 3HJCA 3Q7LA 4FESA 2G3KA 2R7UA 2JD3A 3W8IA 3EFOB 3L34A 3SP1A 4IWBA 4OIPF 1D0XA 4BJ6C 4U5EE 2ZXRA 3EJNA 1V54C 1SF8A 4HFFB 2HV7A 2H7VC 3K7DA 3OWTA 3SZRA 3DM5A 4KC9A 1G8XA 3V7OA 5EGYA 1TR2A 4I44A 3ASNC 1ZHZA 4IRUA 3FDQA 1S7ZA 2DYSC 5KYXA 3SNHA 2V26A 2J0XA 3EHNA 4JJGA 4K7BA 1ZHYA 5KYNA 3NYJA 2WVQA 4FWVA 1D1BA 4OINF 4E7ZA 1BR1A 3OA1A 2C04A 4LACB 5DS5A 3AQBA 3LLKA 3QZCA 4LLCA 5T3WA 4XLNF 2CGEA 1FTSA 4OIQF 4O6MA 3RH3A 4YT8A 5DQTA 2VB6A 3X2QC 3N2ZB 2EIJC 2OG2A 3F46A 2C03A 4K0DA 4XWJA 4CS9C 2Q3TA 2H7BA 3LAYA 5CI8A 2FFHA 2MYSA 4PFPA 2R7OA 5KYWB 1J8MF 4C7OA 4I1OB 3LEVA 4JZAA 3AG1C 5KYXB 4C3BA 2WZGA 4KNWA 3I4UA 3KMIA 2WZLA 4RDAA 3POVA 1O87A 4JCHA 3H65A 1WGWA 3WG7C 4RBNA 3EGDA 4DBQA 2R7QA 2J45A 1D0ZA 2Y3DA 3KH2A 3UGOA 1Z23A 1OCZC 4O79A 3RKOF 3RYLA 2EINC 2X51A 3WODF 3MLGA 4AE4B 2FGYA 1NU7D 3DJUB 4CIHA 3Q6NA 2PF4E 1OCOC 3FHDA 3UMIA 3K1IC 4BJ1A 3ZVRA 1PD0A 2W4MA 3JSZA 4P6IC 2NG1A 4MQ9F 4C7OB 1OKKD 4QI2A 4BJ5C 3W2WA 3ZIBA 1QZXA 3KKBA 1N1CA 4CS7A 4CSAA 3UGPA 3UMHA 4MNDA 4W8KA 3ZSUA 1OCCC 3EH2A 1SMYF 2Q9AA 2XSEA 3I5PA 2H7OA 2KQ9A 3O39A 1BR4A 3NYLA 1MMNA 3FAJA 4HE8D 1V55C 4O6NA 2P7VA 5E3CA 2KGOA 3NRHA 4N06A 4BG0A 4CS8C 2B0JA 2R7XA 1ZU5A 2A6HF 2PP4A 4OIOF 3PHF2 2G62A 3DM9B 1TWGA 1KU2A 2J0WA 2J7PD 3F47A 1FFTC 3EHMA 3ABKC 1OCRC 1PCXA 3JCUQ 4U5FE 3S0XA 4YN0B 3ABLC 4U5BE 5B3SC 4IAOA 2W45A 3Q6MA 3Q7GA 2CNWA 5KYWA 4HEAJ 4EWCA 5B1BC 3HLZA 4CBEA 4GYTA 2WZFA 3ABMC 3AG4C 3AG2C 4OIRF 3SYNA 2IXOA 2J7PA 2J9UA 3B0UX 4BJ6A 3EZIA 4M63A 1IZMA 5DQZA 5DLJA 3DAFA 5F5FA 2Y3HA 4G7OF 4LLEA 3K6BA 5KYUA 3PMRA 4AE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DD7 A;  3K33 A;  3KH2 A; 
#chains in the Genus database with same CATH topology
 2LFD A;  3S27 A;  2PNO A;  3AQC A;  4CDA A;  3H2U A;  4MVS A;  3GM3 A;  2IXN A;  1C02 A;  4BEJ A;  3ITF A;  1FNT c;  2XRH A;  2PX0 A;  3ZWI A;  4L6R A;  3O10 A;  2OOC A;  4H54 A;  2KNH A;  2LP4 A;  2P1A A;  3V5Z A;  4ANJ A;  5B1A C;  4XPW A;  1FR0 A;  4JRZ A;  4P9F A;  2EPN A;  1TWC A;  5GPG B;  2E87 A;  3AGU A;  1LPE A;  1ORJ A;  4DRJ B;  1RKE B;  5BQG A;  5T1D B;  1YVI A;  2GAQ A;  4MVR A;  4E7S A;  2QLA A;  3N0T A;  2M64 A;  3NKE A;  2IYL D;  3DXJ F;  2AWC A;  2Y69 C;  4LDR A;  2YEV A;  4OD4 A;  2P0N A;  1JOG A;  1OR2 A;  1XZP A;  4MTO A;  5A6B D;  1TFO B;  4Q5S F;  2R7R A;  2R9R B;  3EH1 A;  4NC3 A;  2XXA B;  2IXP A;  1UFB A;  3L8J A;  1YAU O;  3VYW A;  2R7W A;  1U6H A;  2WL8 A;  5DS6 A;  2A6E F;  2KW3 C;  3FMS A;  2CDQ A;  5KYU B;  4JUR I;  4CS9 A;  4G7H F;  2BL2 A;  2JPU A;  5TJ5 E;  3T4R A;  4AL0 A;  5JLI A;  3CEX A;  3G4X A;  4DVZ A;  4F4B A;  2R7S A;  5COF A;  3C7J A;  1RJ9 A;  3EZH A;  3E9V A;  4JC7 A;  1VMA A;  3TOM A;  3VAY A;  1YYX A;  3C18 A;  3RIP A;  3CZ6 A;  1ZHT A;  1G4W R;  3GM1 A;  3TD7 A;  4C3D A;  4O7G A;  3IHU A;  2W9Y A;  2YVK A;  3LUT B;  3GWN A;  2XM0 A;  1E86 A;  1MND A;  4YWQ A;  4Q4Z F;  2D5R B;  4KNV A;  3RVY A;  2J9V A;  3RVZ A;  3DZA A;  1OXK A;  2DB4 A;  4NTF A;  3SEO A;  4QDL A;  1JMW A;  1TWH A;  2XL8 A;  5JUA A;  2FAP B;  2PFD A;  3US6 A;  5AGF A;  3SXY A;  5BQI A;  2HKV A;  2NUT A;  5BUO A;  1KTM A;  3JRM O;  4BJT A;  2GFH A;  2XS1 A;  4MW8 A;  2YLD A;  1SZI A;  3NMI A;  4JIO A;  2NUP B;  2IOQ A;  3EGX B;  3FXH A;  1HW1 A;  1DOV A;  3RF3 A;  5E3A A;  4B6I A;  5JVE A;  2R7V A;  3EPV A;  2GA0 A;  3PDM P;  2HV6 A;  5K0I A;  2I15 A;  2ICW G;  4D4X A;  1M2V B;  1OW6 A;  2Q9B A;  4DXW A;  3T6J A;  2HJ3 A;  2QY9 A;  2W4B A;  2YL1 A;  4YJW A;  1ORY A;  5FCL A;  2Y3G A;  3S90 A;  3QVY A;  2QTV A;  3JT1 A;  4ULW A;  2CW0 F;  3LNM B;  1VYK A;  4YL0 A;  1OKK A;  3S29 A;  4BEM J;  4DJ9 A;  2LD6 A;  4Z9J A;  3JRT A;  5JP7 A;  4IJJ A;  3DE8 A;  4U5C E;  1M57 C;  4FX5 A;  3AG3 C;  1RJ9 B;  1V74 B;  4GEH A;  4BJ5 A;  2KJG A;  1QQ3 A;  1O5H A;  4MTG A;  5D91 A;  3ECS A;  3MYI A;  5E33 A;  3X1O A;  1Z5Z A;  1M2O A;  5EK0 A;  2YL0 A;  3WAQ A;  4EIY A;  5IY5 C;  4EUK B;  3GAN A;  3SXZ A;  4G7Z F;  2PX3 A;  3M1C B;  2BC5 A;  2DYR C;  3WHN A;  3AGT A;  1BR2 A;  3N24 A;  2V3C C;  5JSL A;  1YA9 A;  5F28 E;  1HE9 A;  1I5N A;  1MMG A;  1ZHW A;  1YA7 O;  3EQL F;  2P6V A;  5E2Q A;  3TQO A;  4AK9 A;  5HSW A;  1VOM A;  1TWA A;  3ZC4 A;  2NUT B;  3M4B A;  5DVW A;  3RQG A;  3HNK A;  1VLT A;  2A68 F;  3AJM A;  3ZTM A;  2L81 A;  1LVK A;  4P9T A;  1YYJ A;  3NMJ A;  4CS8 A;  4ULV A;  4ZLD A;  1QPU A;  4NY3 A;  3SXK A;  2J9W A;  3DJN B;  1CPR A;  1MMD A;  2LSE A;  3ZDL A;  3IQ5 A;  3A9C A;  2WB7 A;  4PJJ A;  4XLP F;  4J30 B;  2WVN A;  1IW7 F;  3EG9 A;  4ER9 A;  2KSF A;  2XXA A;  1PV3 A;  1ZHX A;  2LIG A;  3C8G A;  5L0C A;  3W2V A;  1QLE C;  2HSQ A;  4JE9 A;  4JKV A;  1HMO A;  2LCH A;  1T6Q A;  2VCA A;  3FAP B;  4I1M A;  1NU9 C;  3GOD A;  2CCY A;  4KBL A;  2YHS A;  4EBJ A;  2A1D D;  1AVO B;  3ATP A;  2X0C A;  2J8W A;  4E17 A;  4UDV A;  1RMV A;  3GOR A;  3K66 A;  4PJL A;  3U3B A;  1APC A;  2QE9 A;  4DVY P;  2L9J A;  4PK4 A;  5KYY B;  3G4Z A;  4U5G A;  5B3I A;  1YZA A;  5AC4 A;  2XL4 A;  1AUE A;  3K33 A;  3S28 A;  4U5D E;  3CQZ A;  4A2N B;  2D4U A;  2XS8 A;  2ZPA A;  2DGJ A;  1D0Y A;  3LES A;  2NSG A;  5COG A;  4MVZ A;  4YK5 A;  3TK0 A;  2QUP A;  1NFO A;  3UR3 C;  4DRH B;  5A6K A;  5JT4 A;  4KI2 A;  1G4U S;  2G3V A;  3LS0 A;  1EA8 A;  3JYH A;  1MNE A;  1FMW A;  4JVS A;  3R7C A;  3NG1 A;  4XTK A;  2R7T A;  3DWW A;  1VYI A;  1D1C A;  2RD9 A;  4J32 B;  4AX2 A;  4CIP A;  1Q0M A;  1VK5 A;  1GGQ A;  2XLE A;  3O6X A;  3FVY A;  2L6F A;  4RD9 A;  4NTA A;  4YT5 A;  4XQ1 A;  2ZXP A;  3KL4 A;  2O9X A;  1I4Z A;  2VH3 A;  5BQH A;  3GEI A;  3NKD A;  2B0H A;  1S05 A;  1WAT A;  1WTY A;  2RSE B;  2J9B A;  2EIL C;  2NSF A;  1FFH A;  1PD1 A;  3E70 C;  4JJF A;  3TJ5 A;  2NUP A;  3UNG C;  3EGX A;  5KYY A;  1A7D A;  4DOZ A;  1B68 A;  3EG9 B;  1LKX A;  4N6H A;  2YWA A;  2EIK C;  3LS1 A;  4MVU A;  4PFO A;  2J46 A;  4DBR A;  3C8G B;  2OCC C;  2XM4 A;  3IEE A;  3K1H A;  4PAC A;  1M2V A;  4QI0 A;  4CX9 A;  3L0I A;  1D1A A;  1W2W A;  5T3T A;  1OW8 A;  1NZE A;  4Z9H A;  4ZLC A;  4EBB A;  4OD5 A;  3OEO A;  1NG1 A;  4YT4 A;  1JPN A;  1O3U A;  1GQA A;  1LI7 A;  1OXB A;  4O6Y A;  2MWQ A;  3CAX A;  5AC5 A;  4BPM A;  1ZU4 A;  2QNL A;  3H2V A;  2HUJ A;  2Y39 A;  3B0V C;  3RFY A;  2YZS A;  1Z6A A;  1SR2 A;  2XLD A;  4U5H A;  4X0R A;  5A6A A;  4LER A;  1ZYR F;  4CSA C;  1QSP A;  2Q9C A;  5A6B A;  1ST6 A;  3RW0 A;  1T9K A;  3U5S A;  4N4W A;  1MQV A;  2VAS A;  3A11 A;  4HFK B;  4WGY A;  4WAB A;  1TKN A;  5L3V A;  2R03 A;  1M56 C;  4G0H A;  1Z63 A;  5CI9 A;  2ZXW C;  3ZG1 A;  1VB5 A;  4PJN A;  3HNJ A;  2EPL X;  4MVM A;  4WJ0 A;  3UMK A;  3W4Y A;  3CSK A;  3EFO A;  3T6B A;  3B0P A;  1BZ4 A;  3LLI A;  1Z3I X;  1LE2 A;  2OJE D;  2YLG A;  4I3M A;  3V5Y A;  1HW2 A;  1T5O A;  3MX3 A;  1J8Y F;  1MMA A;  1M6T A;  2KC3 A;  3GWL A;  3HTK C;  4LDQ A;  3T9O A;  5L3Q A;  1H7I A;  2Y3B A;  3LNR A;  1R4T A;  1WWP A;  2R25 A;  5D92 A;  3TUL A;  2R02 A;  4AE4 A;  4YT2 A;  5A6J A;  2VCB A;  2DI3 A;  1E84 A;  3U2M A;  1JPJ A;  2CYD A;  2P61 A;  2Z15 A;  4EKW A;  4C3E A;  2A69 F;  2EIM C;  3K1I A;  4PJM A;  3DMD A;  3ZQV A;  4D4N A;  2IXM A;  4H4K C;  5DS4 A;  3NYM A;  3LJB A;  5L0J A;  3NDB B;  2WVO A;  4JW1 A;  2KYH A;  2ZXO A;  2HZ8 A;  3ASO C;  2CNW D;  2BE5 F;  2LQG A;  3EGD B;  4Q7C A;  3U9J A;  1K40 A;  3B9Q A;  2ASR A;  1FMV A;  1JR8 A;  1L7C A;  2M4E A;  2XLV A;  1RXQ A;  5F5H A;  2OQM A;  2I8B A;  4PR9 A;  3DD7 A;  3QMK A;  2GDC A;  3I5Q A;  1LS1 A;  3DAG A;  4A4A A;  3HJC A;  3Q7L A;  4FES A;  2G3K A;  2R7U A;  5L0D A;  2JD3 A;  4R32 A;  3W8I A;  4XPX A;  3EFO B;  3L34 A;  1YDI A;  3SP1 A;  4IWB A;  4OIP F;  1D0X A;  5EHH A;  1Q0G A;  4BJ6 C;  2OEX A;  3MYF A;  1ZVZ A;  4U5E E;  4CDV A;  3B71 A;  4MTF A;  2ZXR A;  3EJN A;  1V54 C;  4E0I A;  1EKY A;  1SF8 A;  4JTD B;  4MW3 A;  4J7T A;  4CJO A;  4HFF B;  2HV7 A;  2H7V C;  3K7D A;  3OWT A;  3M4C A;  3SZR A;  1XWJ A;  3DM5 A;  4KC9 A;  3RQF A;  1G8X A;  1HE1 A;  3V7O A;  5EGY A;  1TR2 A;  4E18 A;  3U3F A;  4I44 A;  3SXM A;  4JEA A;  3RQE A;  3ASN C;  1ZHZ A;  1U89 A;  1VLS A;  3BEH A;  4GQH A;  4IRU A;  2YL3 A;  1S7Z A;  2DYS C;  4J7Y A;  3VF0 A;  5KYX A;  1C17 M;  5COM A;  3VRC A;  1DOW A;  1AEP A;  3JZ0 A;  1SYQ A;  3SNH A;  2V26 A;  5JS5 A;  2J0X A;  2A0B A;  3EHN A;  3J06 A;  3L1M A;  4JJG A;  4K7B A;  1ZHY A;  1QVX A;  1RCP A;  5KYN A;  3M15 A;  3NYJ A;  4ONS A;  4U9D A;  4W8P A;  2WVQ A;  4FWV A;  256B A;  1L3P A;  1D1B A;  1Y6D A;  2OU6 A;  2YKZ A;  3IQ6 A;  1H9T A;  4OIN F;  4E7Z A;  2LFF A;  1BR1 A;  1I4Y A;  3OA1 A;  2C04 A;  1CGO A;  4LAC B;  2TMV P;  5DS5 A;  3HNI A;  4JEB A;  3AQB A;  3LLK A;  2HFI A;  3M79 A;  3QZC A;  4LLC A;  5JRA A;  1Q0D A;  1VTM P;  3JSE O;  3QVZ A;  5T3W A;  4XLN F;  2CGE A;  3VM6 A;  2UUI A;  5FZT A;  1CGM E;  1FTS A;  1HMD A;  1NBB A;  2AWY A;  4OIQ F;  3R2P A;  3U9M A;  2Q4F A;  4O6M A;  3RH3 A;  4YT8 A;  2EPM X;  5DQT A;  5CIV A;  2XLM A;  2VB6 A;  3X2Q C;  3N2Z B;  2OJQ A;  2XLW A;  1T6U A;  4DRI B;  2EIJ C;  2OG2 A;  2PBE A;  2C03 A;  3F46 A;  4K1O A;  4K0D A;  4XWJ A;  4NQF A;  4NTB A;  1EI7 A;  2H7B A;  2Q3T A;  3LAY A;  2FFH A;  1A7E A;  2MYS A;  2R7O A;  4PFP A;  5CI8 A;  4NCQ A;  1J8M F;  3BRJ A;  5L0G A;  4WGZ A;  1A0B A;  1GM5 A;  4I1O B;  3LEV A;  3LEO A;  4C7O A;  1Y4C A;  4JZA A;  3AG1 C;  1XZQ A;  4C3B A;  2WZG A;  2GWW A;  4KNW A;  5KYX B;  1A7V A;  3C63 A;  4G78 A;  1BDJ B;  1YJG A;  3I4U A;  4EBK A;  2F22 A;  1H6G A;  2VC9 A;  3KMI A;  2WZL A;  4RDA A;  3POV A;  1O87 A;  3DI5 A;  4JCH A;  3S9O A;  3H65 A;  1WGW A;  1JAF A;  3WG7 C;  2HS5 A;  1Q0K A;  4RBN A;  3DE9 A;  3EGD A;  3O55 A;  1LIH A;  4U9E A;  2R7Q A;  3U8P A;  4DBQ A;  2J45 A;  1A41 A;  1D0Z A;  2LK4 A;  3U8V A;  2HMZ A;  2Y3D A;  3U0C A;  2KK1 A;  1NFN A;  3JYY A;  3QW1 A;  3ZTZ A;  3KH2 A;  4FAP B;  3UGO A;  4CDY A;  3KYI A;  1K04 A;  1Z23 A;  1ZW2 A;  5KYW B;  1OCZ C;  2JX0 A;  4O79 A;  3IPM O;  3RKO F;  2NPU A;  3RYL A;  5A69 A;  2EIN C;  2X51 A;  4N6C A;  1ORS C;  1T01 A;  3WOD F;  2IBF A;  3MLG A;  4IAQ A;  3V5X A;  4AE4 B;  2FGY A;  1NU7 D;  1UG7 A;  3DJU B;  1Z7Q c;  4CIH A;  3W8H A;  4EHP A;  3Q6N A;  2PF4 E;  1OCO C;  3FHD A;  4JTC B;  3UMI A;  3K1I C;  3QTH A;  4BJ1 A;  3ZVR A;  1PD0 A;  1OW7 A;  1KNY A;  2W4M A;  3B29 A;  3JSZ A;  4XPY A;  4P6I C;  1WOL A;  2NG1 A;  4MQ9 F;  3FOO A;  1YLM A;  1E2X A;  4C7O B;  1OKK D;  4QI2 A;  2ZD9 A;  1LM3 B;  4BJ5 C;  2UUH A;  4IB4 A;  4XEF A;  1CPQ A;  3W2W A;  3ZIB A;  1BBH A;  5L0I A;  3TJ6 A;  4LDK A;  3S84 A;  2VCC A;  1QZX A;  3KKB A;  2XLH A;  1N1C A;  4CS7 A;  2L6H A;  1YAR O;  4CSA A;  1TQG A;  3UGP A;  3UMH A;  2HMQ A;  2Q00 A;  3L8I A;  4MND A;  4W8K A;  3ZSU A;  2YQY A;  1OCC C;  3EH2 A;  1SMY F;  2Q9A A;  2XSE A;  3I5P A;  2H7O A;  3KPH A;  3TOL A;  2KQ9 A;  2YRF A;  3FOP A;  1G5Z A;  2XLO A;  3O39 A;  1BR4 A;  3NYL A;  2EPO A;  1MMN A;  1NSG B;  3MFN A;  4YL3 A;  2XL6 A;  3FAJ A;  4HE8 D;  1V55 C;  3HKK A;  4O6N A;  4JCZ A;  2P7V A;  5E3C A;  1C03 A;  2KGO A;  1CGN A;  2H8A A;  1Q0F A;  3HNL A;  3NRH A;  4N06 A;  4BG0 A;  1LS4 A;  2B0J A;  4CS8 C;  2R7X A;  1ZU5 A;  2A6H F;  5HV9 A;  2YLI A;  2PP4 A;  4OIO F;  2R05 A;  3PHF 2;  2G62 A;  3DM9 B;  3C8Z A;  2L7A A;  1TWG A;  1KU2 A;  3T6G B;  2J0W A;  2J7P D;  3F47 A;  1FFT C;  3EHM A;  1LE4 A;  1OCR C;  1PCX A;  2EPK X;  3ABK C;  1QKR A;  1R5I D;  3JCU Q;  4IGG A;  4U5F E;  3KYJ A;  4YN0 B;  1NLX A;  3ABL C;  4U5B E;  5L0H A;  3S0X A;  5B3S C;  4IAO A;  2W45 A;  2Q7R A;  2ETS A;  3Q6M A;  4MVQ A;  3AOU A;  4MVO A;  3Q7G A;  2CNW A;  3NMK A;  3JTL O;  3C8G D;  1RKC A;  5KYW A;  4HEA J;  2YL7 A;  4EWC A;  1F1M A;  5B1B C;  4AL1 A;  2A0U A;  2OKU A;  3C62 A;  3HLZ A;  4XEV A;  4CBE A;  1WAS A;  1GS9 A;  4GYT A;  4MS2 A;  3U2L A;  2WZF A;  3ABM C;  1RKE A;  2HSB A;  3AG2 C;  2AP3 A;  3AG4 C;  1HY5 A;  2IM8 A;  4OIR F;  3SYN A;  1U0B B;  1V4A A;  2IXO A;  3QW0 A;  3IQC A;  2J7P A;  3MBG A;  4CS9 C;  2AVK A;  3PCV A;  2J9U A;  3B0U X;  4YL1 A;  1FAP B;  4BJ6 A;  1E85 A;  3EZI A;  1EQ1 A;  1OR3 A;  4M63 A;  4Z9I A;  4CJG A;  3FDQ A;  1IZM A;  5DQZ A;  1K05 A;  1ZW3 A;  5DLJ A;  3DAF A;  3DKA A;  1T6I A;  5F5F A;  3G50 A;  3GM2 A;  2OEV A;  2Y3H A;  4G7O F;  4LLE A;  4JTA B;  2L6G A;  1WN0 A;  3ZQY A;  3K6B A;  1LI5 A;  3GEH A;  5KYU A;  1OQC A;  5L0F A;  1ZZP A;  2HJM A;  3GEE A;  2MHR A;  1H9G A;  2AU5 A;  3IQT A;  3PMR A;  1YZC A;  1JRA A;  4IAR A;  4XEK A;  4E0H A;  1E83 A;  1TFK B; 
#chains in the Genus database with same CATH homology
 3S27 A;  3AQC A;  2IXN A;  4BEJ A;  3ITF A;  2XRH A;  2PX0 A;  2KNH A;  4ANJ A;  5B1A C;  1TWC A;  2E87 A;  5T1D B;  4E7S A;  3N0T A;  3NKE A;  2IYL D;  3DXJ F;  2Y69 C;  2YEV A;  4OD4 A;  4Q5S F;  2R7R A;  3EH1 A;  2XXA B;  2IXP A;  2R7W A;  3VYW A;  2WL8 A;  5DS6 A;  2A6E F;  2KW3 C;  2CDQ A;  5KYU B;  4JUR I;  4CS9 A;  4G7H F;  3T4R A;  4F4B A;  4DVZ A;  2R7S A;  1RJ9 A;  3EZH A;  3E9V A;  1VMA A;  3VAY A;  3RIP A;  3CZ6 A;  1ZHT A;  3TD7 A;  4C3D A;  4O7G A;  2W9Y A;  1MND A;  4YWQ A;  4Q4Z F;  2D5R B;  4KNV A;  2J9V A;  3DZA A;  3SEO A;  4QDL A;  1TWH A;  2PFD A;  2NUT A;  5BUO A;  4BJT A;  2GFH A;  1SZI A;  2NUP B;  2IOQ A;  3EGX B;  5KYY B;  4B6I A;  5E3A A;  2R7V A;  3EPV A;  2HV6 A;  1M2V B;  2Q9B A;  5FCL A;  3T6J A;  2QY9 A;  2W4B A;  4YJW A;  2Y3G A;  4ULW A;  2QTV A;  3JT1 A;  2CW0 F;  1VYK A;  3S29 A;  1OKK A;  3JRT A;  4IJJ A;  4U5C E;  1M57 C;  4FX5 A;  3AG3 C;  1RJ9 B;  4GEH A;  4BJ5 A;  2KJG A;  1O5H A;  5D91 A;  3ECS A;  5E33 A;  3X1O A;  1Z5Z A;  1M2O A;  5IY5 C;  3GAN A;  4G7Z F;  2PX3 A;  3M1C B;  2DYR C;  1BR2 A;  3N24 A;  2V3C C;  1MMG A;  1ZHW A;  3EQL F;  4AK9 A;  2P6V A;  5E2Q A;  5HSW A;  1VOM A;  1TWA A;  3ZC4 A;  2NUT B;  5DVW A;  2A68 F;  4CS8 A;  2L81 A;  1LVK A;  4ZLD A;  4NY3 A;  2J9W A;  3DJN B;  2LSE A;  1MMD A;  2WB7 A;  4PJJ A;  4XLP F;  4J30 B;  2WVN A;  1IW7 F;  3EG9 A;  2XXA A;  1ZHX A;  3W2V A;  1QLE C;  4I1M A;  1NU9 C;  3GOD A;  4KBL A;  2YHS A;  2A1D D;  3K66 A;  4PJL A;  4DVY P;  2L9J A;  4PK4 A;  4U5G A;  2XL4 A;  3K33 A;  3S28 A;  4U5D E;  3CQZ A;  4A2N B;  2ZPA A;  2DGJ A;  1D0Y A;  3LES A;  4KI2 A;  3UR3 C;  3LS0 A;  2G3V A;  3JYH A;  1MNE A;  1FMW A;  4JVS A;  3NG1 A;  4XTK A;  2R7T A;  1VYI A;  1D1C A;  4AX2 A;  4J32 B;  1VK5 A;  4YT5 A;  4RD9 A;  3O6X A;  3FVY A;  2ZXP A;  3KL4 A;  2O9X A;  2VH3 A;  3NKD A;  5EHH A;  3W8H A;  2EIL C;  1FFH A;  1PD1 A;  3E70 C;  4JJF A;  2NUP A;  3UNG C;  3EGX A;  5KYY A;  4DOZ A;  3EG9 B;  1LKX A;  2EIK C;  3LS1 A;  4PFO A;  2J46 A;  4DBR A;  2OCC C;  3IEE A;  4QI0 A;  3K1H A;  1M2V A;  3L0I A;  1D1A A;  1W2W A;  5T3T A;  4ZLC A;  1NZE A;  4EBB A;  4OD5 A;  3OEO A;  1NG1 A;  4YT4 A;  1JPN A;  4O6Y A;  2MWQ A;  1ZU4 A;  2Y39 A;  3B0V C;  3RFY A;  2YZS A;  1Z6A A;  4U5H A;  4X0R A;  4LER A;  1ZYR F;  4CSA C;  2Q9C A;  1ST6 A;  2VAS A;  4HFK B;  1TKN A;  5L3V A;  4G0H A;  1M56 C;  1Z63 A;  5CI9 A;  2ZXW C;  3ZG1 A;  4PJN A;  4WJ0 A;  3UMK A;  3CSK A;  3EFO A;  3T6B A;  3B0P A;  3LLI A;  1Z3I X;  4I3M A;  3MX3 A;  1J8Y F;  1MMA A;  5L3Q A;  3HTK C;  2Y3B A;  3LNR A;  5D92 A;  4YT2 A;  1JPJ A;  2Z15 A;  4C3E A;  2A69 F;  2EIM C;  4PJM A;  3DMD A;  2IXM A;  4H4K C;  5DS4 A;  3NYM A;  3LJB A;  3NDB B;  2WVO A;  4JW1 A;  2ZXO A;  3ASO C;  2CNW D;  2BE5 F;  3EGD B;  4Q7C A;  3B9Q A;  1FMV A;  2M4E A;  5F5H A;  2I8B A;  3DD7 A;  3QMK A;  3I5Q A;  1LS1 A;  3DAG A;  3HJC A;  3Q7L A;  4FES A;  2G3K A;  2R7U A;  2JD3 A;  3W8I A;  3EFO B;  3L34 A;  3SP1 A;  4IWB A;  4OIP F;  1D0X A;  4BJ6 C;  4U5E E;  2ZXR A;  3EJN A;  1V54 C;  1SF8 A;  4HFF B;  2HV7 A;  2H7V C;  3K7D A;  3OWT A;  3SZR A;  3DM5 A;  4KC9 A;  1G8X A;  3V7O A;  5EGY A;  1TR2 A;  4I44 A;  3ASN C;  1ZHZ A;  4IRU A;  3FDQ A;  1S7Z A;  2DYS C;  5KYX A;  3SNH A;  2V26 A;  2J0X A;  3EHN A;  4JJG A;  4K7B A;  1ZHY A;  5KYN A;  3NYJ A;  2WVQ A;  4FWV A;  1D1B A;  4OIN F;  4E7Z A;  1BR1 A;  3OA1 A;  2C04 A;  4LAC B;  5DS5 A;  3AQB A;  3LLK A;  3QZC A;  4LLC A;  5T3W A;  4XLN F;  2CGE A;  1FTS A;  4OIQ F;  4O6M A;  3RH3 A;  4YT8 A;  5DQT A;  2VB6 A;  3X2Q C;  3N2Z B;  2EIJ C;  2OG2 A;  3F46 A;  2C03 A;  4K0D A;  4XWJ A;  4CS9 C;  2Q3T A;  2H7B A;  3LAY A;  5CI8 A;  2FFH A;  2MYS A;  4PFP A;  2R7O A;  5KYW B;  1J8M F;  4C7O A;  4I1O B;  3LEV A;  4JZA A;  3AG1 C;  5KYX B;  4C3B A;  2WZG A;  4KNW A;  3I4U A;  3KMI A;  2WZL A;  4RDA A;  3POV A;  1O87 A;  4JCH A;  3H65 A;  1WGW A;  3WG7 C;  4RBN A;  3EGD A;  4DBQ A;  2R7Q A;  2J45 A;  1D0Z A;  2Y3D A;  3KH2 A;  3UGO A;  1Z23 A;  1OCZ C;  4O79 A;  3RKO F;  3RYL A;  2EIN C;  2X51 A;  3WOD F;  3MLG A;  4AE4 B;  2FGY A;  1NU7 D;  3DJU B;  4CIH A;  3Q6N A;  2PF4 E;  1OCO C;  3FHD A;  3UMI A;  3K1I C;  4BJ1 A;  3ZVR A;  1PD0 A;  2W4M A;  3JSZ A;  4P6I C;  2NG1 A;  4MQ9 F;  4C7O B;  1OKK D;  4QI2 A;  4BJ5 C;  3W2W A;  3ZIB A;  1QZX A;  3KKB A;  1N1C A;  4CS7 A;  4CSA A;  3UGP A;  3UMH A;  4MND A;  4W8K A;  3ZSU A;  1OCC C;  3EH2 A;  1SMY F;  2Q9A A;  2XSE A;  3I5P A;  2H7O A;  2KQ9 A;  3O39 A;  1BR4 A;  3NYL A;  1MMN A;  3FAJ A;  4HE8 D;  1V55 C;  4O6N A;  2P7V A;  5E3C A;  2KGO A;  3NRH A;  4N06 A;  4BG0 A;  4CS8 C;  2B0J A;  2R7X A;  1ZU5 A;  2A6H F;  2PP4 A;  4OIO F;  3PHF 2;  2G62 A;  3DM9 B;  1TWG A;  1KU2 A;  2J0W A;  2J7P D;  3F47 A;  1FFT C;  3EHM A;  3ABK C;  1OCR C;  1PCX A;  3JCU Q;  4U5F E;  3S0X A;  4YN0 B;  3ABL C;  4U5B E;  5B3S C;  4IAO A;  2W45 A;  3Q6M A;  3Q7G A;  2CNW A;  5KYW A;  4HEA J;  4EWC A;  5B1B C;  3HLZ A;  4CBE A;  4GYT A;  2WZF A;  3ABM C;  3AG4 C;  3AG2 C;  4OIR F;  3SYN A;  2IXO A;  2J7P A;  2J9U A;  3B0U X;  4BJ6 A;  3EZI A;  4M63 A;  1IZM A;  5DQZ A;  5DLJ A;  3DAF A;  5F5F A;  2Y3H A;  4G7O F;  4LLE A;  3K6B A;  5KYU A;  3PMR A;  4AE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...