3KH2A

Crystal structure of the p1 bacteriophage doc toxin (f68s) in complex with the phd antitoxin (l17m/v39a). northeast structural genomics targets er385-er386
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
124
structure length
124
Chain Sequence
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHISNDANKRTALNSALLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death on curing protein
publication title Crystal Structures of Phd-Doc, HigA, and YeeU Establish Multiple Evolutionary Links between Microbial Growth-Regulating Toxin-Antitoxin Systems.
pubmed doi rcsb
source organism Bacteriophage p1
molecule tags Toxin
total genus 50
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1870 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3kh2A00
3DD7A 3KH2A 3K33A
chains in the Genus database with same CATH superfamily
2KW3C 2W45A 1MMAA 1Z3IX 4Q7CA 4RDAA 1BZ4A 1MMDA 1TR2A 4PJJA 3U0CA 3EZIA 4HFKB 1MNDA 3RVZA 3HLZA 2BC5A 2XL4A 2PX3A 2MWQA 2A68F 2AP3A 2NSFA 3LESA 4LACB 3QMKA 4QDLA 3EHMA 3BEHA 3RQFA 2Y69C 4D4XA 1M2VA 1D1AA 4MTFA 3DKAA 3K1HA 3W4YA 1G8XA 1ZYRF 1SYQA 5D91A 1MQVA 5B3SC 1RKEA 3Q7LA 3TJ6A 1S05A 3U2MA 3U3FA 3V5ZA 1EI7A 3NKEA 2ZXOA 3F47A 1T6UA 1VMAA 2WB7A 3GEHA 2XLWA 4AE4A 3DJUB 2KYHA 5AC5A 1PD1A 1UG7A 2J9BA 2XLHA 3LNMB 3FDQA 3POVA 4BJ6A 3ZIBA 2J9UA 1HW1A 3B0PA 1YZAA 3N24A 4RBNA 3EH2A 2F22A 2ICWG 5L0FA 2VCCA 1TFOB 2R9RB 4JC7A 2WZFA 2B0HA 3NYJA 2WVNA 1ORSC 3JSEO 3UMKA 2NUTA 1XZQA 1V54C 4C7OB 4X0RA 3PDMP 1QKRA 1L3PA 3I4UA 4PJLA 2Z15A 3EGXA 2R25A 4EHPA 1OW6A 1BR2A 1YA7O 5KYYA 3KMIA 4U5DE 1QZXA 2H7OA 3T4RA 1JRAA 2GA0A 1QVXA 3RF3A 3JYHA 1Y4CA 3QZCA 3VRCA 2J46A 4JTAB 4DVYP 5FZTA 3DM9B 3H2VA 3EGDA 2I15A 2YHSA 3DXJF 3M4CA 2PX0A 4DJ9A 3F46A 4JE9A 5D92A 4N6CA 4CJGA 4U5BE 5E3CA 3R7CA 5DS6A 2OEVA 4WJ0A 1RCPA 4YN0B 1D0ZA 1ZHTA 2IXMA 2XLDA 4O6YA 3ZWIA 4EIYA 3S9OA 2RSEB 2VB6A 1J8YF 4P9FA 2W4BA 3RQEA 4E0HA 4MW3A 1N1CA 2XLMA 4YL0A 4DRIB 5DVWA 1LPEA 4K0DA 4EBJA 1GM5A 4IRUA 1H6GA 4CS9C 3Q6NA 4ER9A 2OQMA 4LDRA 3VM6A 5KYWB 5T3WA 1G5ZA 1OCZC 3N0TA 4Q4ZF 3DE9A 5T1DB 2RD9A 3WHNA 4OIOF 4PJMA 1K05A 4NC3A 4W8KA 1D0YA 1VTMP 2WZGA 4HEAJ 3W2VA 1A41A 2NUPA 1LM3B 2Q4FA 1T6QA 3FMSA 2P0NA 3C18A 4I1OB 1TWCA 4A4AA 4NTFA 1F1MA 3EFOB 2Q3TA 1IZMA 2Y3DA 4XQ1A 3Q7GA 1YLMA 5A69A 5KYNA 3QVZA 5B1AC 2GFHA 2BE5F 2J9WA 3G4ZA 4ONSA 5JS5A 2R7OA 2A6HF 1O87A 3LS0A 3LNRA 4CX9A 3TD7A 5L0HA 3IQ6A 1XWJA 5KYXB 3V7OA 3EG9A 3KH2A 4ULWA 2ZD9A 4JVSA 2PFDA 1ZVZA 4CS8C 5L0GA 1OXBA 4EKWA 2LD6A 2HJMA 2CW0F 3SZRA 4O79A 2A1DD 3HNLA 4CS7A 1TWGA 2HV6A 3NRHA 1KNYA 3I5PA 1JR8A 5KYUB 1FFHA 3C7JA 3FXHA 3U5SA 3U9MA 4CBEA 2XM0A 4CDAA 3EQLF 4KI2A 1ZHWA 2Q9BA 4P9TA 3RFYA 1NU9C 3W8IA 2YL3A 4G7ZF 2O9XA 3RIPA 2JX0A 2QLAA 5FCLA 1ZW2A 4MVSA 2AWYA 4XLNF 3ZDLA 2HS5A 4CIHA 5COMA 2P1AA 3MX3A 3M15A 1GQAA 3KPHA 2LFFA 3LEOA 3JTLO 1GS9A 1WTYA 2IBFA 2OKUA 5CI9A 4IB4A 2C04A 3LLIA 4JIOA 1FTSA 2OOCA 4OD4A 3X2QC 4HE8D 1CGOA 1E85A 1Z63A 1H7IA 3AJMA 3T6BA 4K7BA 3AQBA 3J06A 3GWLA 1WWPA 1WASA 3AG3C 1NSGB 3B9QA 1K04A 1OR2A 2L6FA 2YQYA 3C8GB 3JCUQ 3ABMC 1SF8A 1VOMA 1YYXA 3DWWA 3LAYA 4XPYA 4IAOA 2X0CA 3LUTB 1FNTc 3KYJA 2IYLD 1WATA 2YVKA 3C8ZA 2TMVP 4GEHA 4AL0A 3ZQVA 2YKZA 2OCCC 2XXAB 3NMJA 4OIPF 1SZIA 3AQCA 4JEBA 3JZ0A 3PHF2 3U8PA 4ZLDA 4KBLA 1RJ9B 3GM1A 3H65A 2DYSC 4NCQA 4FX5A 4JZAA 3S29A 1ZHZA 4YWQA 1U0BB 2YZSA 1YARO 3O39A 4MVOA 2KK1A 4N4WA 3VAYA 3TULA 3B0UX 4U5GA 2QY9A 2J9VA 4N6HA 4CS9A 4JJGA 1NG1A 1LVKA 1QLEC 1D1BA 2H8AA 1WN0A 3SXYA 4J32B 2WVOA 3SEOA 3X1OA 2YEVA 3R2PA 4DXWA 5L3VA 2FAPB 1PV3A 3U3BA 3B29A 4YJWA 3E70C 2WVQA 1AUEA 3L8JA 2YL1A 1LE4A 3W2WA 2R7RA 3C8GD 4XTKA 4XPWA 2Q7RA 3ITFA 1Q0FA 4NY3A 2NPUA 1KTMA 3FAPB 4HFFB 1D1CA 4H4KC 5L0JA 3EH1A 3ASNC 4MW8A 1Z23A 1APCA 2LP4A 4LERA 3L34A 4MQ9F 2P7VA 5B1BC 3AOUA 3A11A 2R05A 3EJNA 4JCHA 4JRZA 4YK5A 2G62A 4YT2A 1TKNA 4BJ5C 1E86A 4BEMJ 2LQGA 4OINF 2GDCA 2FFHA 4O6NA 3FVYA 4CS8A 5A6AA 2OEXA 2UUIA 3S0XA 3FOPA 1AEPA 3LJBA 2L6HA 4IWBA 3RW0A 3DM5A 4C3BA 1OKKD 2A0BA 2ASRA 5A6BD 4XEFA 1Z7Qc 2R7VA 1ZW3A 2FGYA 3UGOA 2X51A 1T9KA 5JRAA 1MMNA 2J45A 2VC9A 2L9JA 1R5ID 3TQOA 2DI3A 1OCOC 1HMDA 4C3EA 2A69F 3OA1A 1HMOA 2YLGA 1H9GA 1M56C 3ATPA 3W8HA 1OKKA 2HSBA 3HKKA 1SR2A 4KC9A 5E33A 5A6BA 2CCYA 5COFA 4WABA 3AG2C 3OWTA 4JJFA 2LCHA 1EQ1A 2B0JA 3DAGA 4YT5A 1FAPB 2OU6A 3FOOA 1I4ZA 1NU7D 2CYDA 3AG1C 1C03A 2QUPA 3DJNB 3QTHA 1BR1A 1C17M 1YJGA 5JSLA 3ZVRA 1M6TA 3H2UA 1JPJA 1QQ3A 5JVEA 1PD0A 5A6JA 3T6GB 4P6IC 1E2XA 5DQZA 5A6KA 3GORA 3KKBA 2A6EF 2HV7A 3IQ5A 2AWCA 4IJJA 4XEVA 1ZU4A 5BQGA 2MYSA 4NQFA 4CDVA 1V4AA 4UDVA 1JOGA 2WL8A 1M57C 2CNWD 4MVQA 1GGQA 3ZC4A 4C7OA 4GQHA 1HY5A 1TWAA 2M4EA 5DS5A 4MVRA 4LDQA 3B0VC 4AK9A 1A7DA 4CJOA 1Q0DA 1KU2A 1FFTC 3TK0A 3MFNA 1G4WR 2XS8A 1B68A 2EPLX 4LLEA 1LIHA 3JSZA 2J7PD 2VCBA 4IAQA 5E3AA 1TWHA 2J0WA 2V26A 2HMQA 2EPNA 3CSKA 2NSGA 2XLEA 3O55A 4XWJA 2XS1A 3O6XA 4IARA 5TJ5E 3V5YA 2R03A 5L0DA 3UNGC 3SNHA 3S28A 2Y3GA 4BJTA 2MHRA 4U5CE 2J7PA 3B71A 5JP7A 2ZPAA 3RVYA 3PMRA 3RQGA 2HMZA 4J7YA 3GM2A 4JURI 1NZEA 4YT8A 2JD3A 3IQCA 1LI5A 1RMVA 2IXOA 5KYWA 3U9JA 3L0IA 1YZCA 3FAJA 2PP4A 3HNIA 2KC3A 2KJGA 4JTDB 3V5XA 4LDKA 3SP1A 4BJ5A 3G50A 2EIJC 3TOMA 4MNDA 1HE9A 1VYKA 3HNJA 3L8IA 1NFNA 2C03A 3M4BA 4BPMA 3MBGA 3EFOA 5L0CA 2LK4A 2R7SA 2D4UA 4XLPF 2R7XA 2E87A 1FR0A 4AL1A 3JRMO 2Y3HA 4B6IA 1U89A 4CSAC 1J8MF 1OW7A 2QE9A 1C02A 3FHDA 3IEEA 4PK4A 1S7ZA 3CZ6A 1RKEB 4EBBA 4YT4A 1DOVA 1MMGA 4G0HA 4Q5SF 1HW2A 1QSPA 1EKYA 3ZTZA 1YAUO 5KYXA 3AGTA 3WG7C 2Q00A 3NDBB 4FESA 4U5FE 5F5HA 3MYFA 4AE4B 2BL2A 1NFOA 3HTKC 4MS2A 4DRJB 3JT1A 4JCZA 2PBEA 4PFOA 5HV9A 2EPOA 3E9VA 5L3QA 2DGJA 1VK5A 1JPNA 2CDQA 3L1MA 4OIQF 2IM8A 3UMHA 3ABKC 4YL3A 3S90A 2HUJA 5L0IA 1NLXA 1IW7F 1YYJA 5COGA 5KYUA 4NTAA 3GANA 3K33A 2YL7A 2EILC 3NMIA 1I5NA 2YLIA 3N2ZB 1A7EA 2OJED 2PNOA 1AVOB 1O5HA 2Q9AA 2XL8A 1LKXA 4FWVA 5CIVA 1T5OA 3EGXB 3A9CA 3WAQA 1BR4A 2Y39A 4FAPB 1T01A 5KYYB 1WOLA 2I8BA 2IXNA 1MNEA 4WGYA 1ZHXA 2AU5A 2R02A 4MTGA 1A0BA 2YRFA 1ORYA 3EGDB 2H7VC 1Q0MA 2PF4E 3C8GA 3PCVA 4U9DA 4DRHB 5F5FA 1UFBA 3CQZA 4U9EA 5JUAA 4R32A 3VF0A 2ZXWC 1SMYF 1OW8A 2LSEA 2JPUA 2G3KA 4MVUA 3DD7A 4MTOA 3ASOC 1LS4A 4F4BA 3GM3A 4J7TA 1OXKA 5F28E 4E17A 4OD5A 2ZXPA 3S27A 5K0IA 2XXAA 5AGFA 3ECSA 4I3MA 4KNVA 4ZLCA 3QW0A 3K1IC 4M63A 3EPVA 1RJ9A 1V74B 2XLVA 1O3UA 1L7CA 1JMWA 4G7OF 2CGEA 4BEJA 1CPRA 1K40A 4U5EE 4IGGA 2XM4A 2XSEA 2YL0A 4D4NA 4W8PA 1U6HA 3SXMA 5JT4A 2P6VA 4E18A 2L6GA 2QTVA 2NUPB 2KNHA 1I4YA 1Z5ZA 3AG4C 3LS1A 2KGOA 2NG1A 3M79A 4XEKA 2L81A 4Z9IA 3CEXA 1W2WA 2VCAA 5CI8A 4CDYA 1H9TA 1ST6A 3RKOF 4DOZA 2UUHA 4I44A 1Y6DA 2HZ8A 3G4XA 5HSWA 3IQTA 4AX2A 4G7HF 3JYYA 3US6A 4BJ1A 3EHNA 4LLCA 3RYLA 1OR3A 1FMVA 3TJ5A 1XZPA 3IPMO 3ZTMA 3MYIA 4O7GA 1VLTA 2IOQA 3EG9B 1WGWA 3DAFA 4JKVA 4Z9JA 4CSAA 1TFKB 4NTBA 4EUKB 2HFIA 1E83A 1HE1A 1OCCC 3GEEA 2AVKA 2EPKX 1VYIA 3KL4A 3SXZA 4EWCA 4H54A 2LFDA 4XPXA 3ZG1A 1R4TA 2GWWA 4Z9HA 4RD9A 3U8VA 4EBKA 1NBBA 5BQIA 1DOWA 2VH3A 1JAFA 1ZU5A 4MVZA 4E7SA 5AC4A 2XL6A 4GYTA 3K7DA 5T3TA 2YLDA 4U5HA 2W4MA 2CNWA 4ANJA 2GAQA 3JRTA 2DB4A 1ORJA 3WODF 1M2OA 2Q9CA 2DYRC 3NG1A 1ZZPA 5IY5C 3DZAA 4L6RA 4E0IA 4K1OA 1CPQA 4KNWA 3S84A 2KSFA 1D0XA 1TQGA 2KQ9A 4BJ6C 2P61A 2A0UA 5B3IA 5EK0A 3HJCA 1RKCA 1OQCA 3GEIA 1YA9A 2ETSA 3BRJA 3IHUA 1Q0KA 3RH3A 3UMIA 2WZLA 2HKVA 3DI5A 4DBRA 4DVZA 4JTCB 5BUOA 3NMKA 4QI2A 1YDIA 3I5QA 4ULVA 4N06A 4PJNA 2IXPA 5DLJA 2OG2A 1V55C 1RXQA 3CAXA 4DBQA 3KYIA 3LEVA 4E7ZA 4JW1A 3VYWA 1BBHA 3NKDA 3U2LA 3ZSUA 2YWAA 4WGZA 3C63A 2V3CC 1YVIA 3QW1A 5BQHA 2Y3BA 4J30B 4CIPA 2XRHA 4YL1A 3HNKA 4MVMA 3TOLA 3O10A 2EPMX 3K1IA 1LS1A 2OJQA 1M2VB 2EIMC 2J8WA 4QI0A 3ZQYA 3UGPA 4BG0A 4PFPA 1ZHYA 1OCRC 2H7BA 3NYLA 2HJ3A 2R7WA 2VASA 3Q6MA 1Z6AA 5GPGB 1PCXA 2EIKC 4G78A 5DQTA 1Q0GA 3T9OA 1T6IA 3AGUA 5E2QA 2R7TA 1LI7A 2J0XA 2LIGA 3GWNA 3NYMA 4A2NB 3GODA 2QNLA 1FMWA 4PR9A 3K6BA 3T6JA 2D5RB 3EZHA 2R7QA 2W9YA 3MLGA 4PACA 3C62A 5EGYA 2XLOA 5EHHA 3ABLC 3K66A 256BA 2R7UA 1LE2A 4JEAA 1CGME 5DS4A 4OIRF 1VB5A 1QPUA 2NUTB 1A7VA 1CGNA 4I1MA 1VLSA 1BDJB 2HSQA 1EA8A 3M1CB 3SYNA 2EINC 3OEOA 3UR3C 1E84A 1G4US 4C3DA 2L7AA 2G3VA 2ZXRA 3DE8A 3LLKA 3QVYA 3SXKA 2M64A 3DMDA 4O6MA 5JLIA
chains in the Genus database with same CATH topology
2KW3C 2W45A 1MMAA 1Z3IX 4Q7CA 4RDAA 1MMDA 1TR2A 4PJJA 3EZIA 4HFKB 1MNDA 3HLZA 2XL4A 2PX3A 2MWQA 2A68F 3LESA 4LACB 4QDLA 3QMKA 3EHMA 2Y69C 1M2VA 1D1AA 3K1HA 1G8XA 1ZYRF 5D91A 5B3SC 3Q7LA 3NKEA 2ZXOA 3F47A 1VMAA 2WB7A 4AE4A 3DJUB 1PD1A 3FDQA 4BJ6A 3ZIBA 2J9UA 3B0PA 5HSWA 3N24A 4RBNA 3EH2A 2WZFA 3NYJA 2WVNA 3UMKA 2NUTA 1V54C 4C7OB 4X0RA 3I4UA 4PJLA 2Z15A 3EGXA 1BR2A 5KYYA 3KMIA 4U5DE 1QZXA 2H7OA 3T4RA 3JYHA 3QZCA 2J46A 4DVYP 3DM9B 3EGDA 2YHSA 3DXJF 2PX0A 3F46A 5D92A 4U5BE 5E3CA 5DS6A 4WJ0A 4YN0B 1D0ZA 1ZHTA 2IXMA 4O6YA 2VB6A 1J8YF 2W4BA 1N1CA 5DVWA 4K0DA 4IRUA 4CS9C 3Q6NA 5KYWB 5T3WA 1OCZC 3N0TA 4Q4ZF 5T1DB 4OIOF 4PJMA 4W8KA 1D0YA 2WZGA 4HEAJ 3W2VA 2NUPA 4I1OB 1TWCA 3EFOB 2Q3TA 1IZMA 2Y3DA 5KYNA 3Q7GA 5B1AC 2GFHA 2BE5F 2J9WA 2R7OA 2A6HF 1O87A 3LS0A 3LNRA 3TD7A 5KYXB 3V7OA 3EG9A 3KH2A 4ULWA 4JVSA 2PFDA 4CS8C 2CW0F 3SZRA 4O79A 2A1DD 4CS7A 1TWGA 2HV6A 3NRHA 3I5PA 5KYUB 1FFHA 4CBEA 4KI2A 3EQLF 1ZHWA 2Q9BA 3RFYA 3W8IA 1NU9C 4G7ZF 2O9XA 3RIPA 5FCLA 4XLNF 4CIHA 3MX3A 3POVA 3X2QC 5CI9A 2C04A 3LLIA 4OD4A 1FTSA 4HE8D 1Z63A 3T6BA 4K7BA 3AQBA 3AG3C 3B9QA 3JCUQ 3ABMC 1SF8A 1VOMA 3LAYA 4IAOA 2IYLD 4GEHA 2OCCC 2XXAB 4OIPF 1SZIA 3AQCA 3PHF2 4ZLDA 4KBLA 1RJ9B 3S29A 3H65A 2DYSC 4YWQA 4FX5A 4JZAA 1ZHZA 2YZSA 3O39A 3VAYA 3B0UX 4U5GA 2QY9A 2J9VA 4CS9A 4JJGA 1NG1A 1LVKA 1QLEC 1D1BA 3X1OA 4J32B 2WVOA 3SEOA 5L3VA 2YEVA 4YJWA 3E70C 2WVQA 3W2WA 2R7RA 4XTKA 3ITFA 4NY3A 4HFFB 1D1CA 4H4KC 3EH1A 3ASNC 1Z23A 4LERA 3L34A 4MQ9F 2P7VA 5B1BC 3EJNA 4JCHA 4YT2A 2G62A 1TKNA 4BJ5C 4OINF 2FFHA 4O6NA 3FVYA 4CS8A 3S0XA 3LJBA 4IWBA 3DM5A 4C3BA 1OKKD 2R7VA 2FGYA 3UGOA 2X51A 1MMNA 2J45A 2L9JA 1OCOC 4C3EA 2A69F 3OA1A 1M56C 3W8HA 1OKKA 4KC9A 5E33A 3AG2C 3OWTA 4JJFA 2B0JA 3DAGA 4YT5A 1NU7D 3AG1C 3DJNB 1BR1A 3ZVRA 1JPJA 1PD0A 4P6IC 5DQZA 3KKBA 2A6EF 2HV7A 4IJJA 1ZU4A 2MYSA 3ZC4A 2WL8A 1M57C 2CNWD 4C7OA 1TWAA 2M4EA 5DS5A 3B0VC 4AK9A 1KU2A 1FFTC 4LLEA 3JSZA 2J7PD 5E3AA 1TWHA 2J0WA 2V26A 3CSKA 4XWJA 3O6XA 3UNGC 3SNHA 3S28A 2Y3GA 4BJTA 4U5CE 2J7PA 2ZPAA 3PMRA 4JURI 4YT8A 1NZEA 2JD3A 2IXOA 5KYWA 3L0IA 3FAJA 2PP4A 2KJGA 3SP1A 4BJ5A 2EIJC 4MNDA 1VYKA 2C03A 3EFOA 2R7SA 4XLPF 2R7XA 2E87A 4B6IA 2Y3HA 4CSAC 1J8MF 3FHDA 3IEEA 4PK4A 1S7ZA 3CZ6A 4EBBA 4YT4A 1MMGA 4G0HA 4Q5SF 5KYXA 3WG7C 3NDBB 4FESA 4U5FE 5F5HA 4AE4B 3HTKC 3JT1A 4PFOA 3E9VA 5L3QA 2DGJA 1VK5A 1JPNA 2CDQA 4OIQF 3UMHA 3ABKC 1IW7F 5KYUA 3GANA 3K33A 2EILC 3N2ZB 2Q9AA 1O5HA 4FWVA 1LKXA 3EGXB 1BR4A 2Y39A 5KYYB 2I8BA 2IXNA 1MNEA 1ZHXA 3EGDB 2H7VC 2PF4E 5F5FA 3CQZA 2ZXWC 1SMYF 2LSEA 2G3KA 3DD7A 3ASOC 4F4BA 4OD5A 2ZXPA 3S27A 2XXAA 3ECSA 4I3MA 4KNVA 4ZLCA 3K1IC 4M63A 3EPVA 1RJ9A 4G7OF 2CGEA 4BEJA 4U5EE 2XSEA 2P6VA 2QTVA 2NUPB 2KNHA 1Z5ZA 3AG4C 3LS1A 2KGOA 2NG1A 2L81A 1W2WA 5CI8A 1ST6A 3RKOF 4DOZA 4I44A 4AX2A 4G7HF 4BJ1A 3EHNA 4LLCA 3RYLA 1FMVA 4O7GA 2IOQA 3EG9B 1WGWA 3DAFA 4CSAA 1OCCC 3KL4A 4EWCA 1VYIA 3ZG1A 4RD9A 2VH3A 1ZU5A 4E7SA 4GYTA 3K7DA 5T3TA 4U5HA 2W4MA 2CNWA 4ANJA 3JRTA 3WODF 1M2OA 2Q9CA 2DYRC 3NG1A 5IY5C 3DZAA 4KNWA 1D0XA 2KQ9A 4BJ6C 3HJCA 3RH3A 3UMIA 2WZLA 4DBRA 4DVZA 5BUOA 4QI2A 3I5QA 4N06A 4PJNA 2IXPA 5DLJA 2OG2A 1V55C 4DBQA 3LEVA 4E7ZA 4JW1A 3VYWA 3NKDA 3ZSUA 2V3CC 2Y3BA 4J30B 2XRHA 1LS1A 1M2VB 2EIMC 4QI0A 3UGPA 4BG0A 4PFPA 1ZHYA 1OCRC 2H7BA 3NYLA 2R7WA 2VASA 3Q6MA 1Z6AA 1PCXA 2EIKC 5DQTA 5E2QA 2R7TA 2J0XA 3NYMA 4A2NB 3GODA 1FMWA 3K6BA 3T6JA 2D5RB 3EZHA 2R7QA 2W9YA 3MLGA 5EGYA 5EHHA 3ABLC 3K66A 2R7UA 5DS4A 4OIRF 2NUTB 4I1MA 3M1CB 3SYNA 3UR3C 2EINC 3OEOA 4C3DA 2G3VA 2ZXRA 3LLKA 3DMDA 4O6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DD7 A;  3KH2 A;  3K33 A; 
#chains in the Genus database with same CATH topology
 2KW3 C;  2W45 A;  1MMA A;  1Z3I X;  4Q7C A;  4RDA A;  1BZ4 A;  1MMD A;  1TR2 A;  4PJJ A;  3U0C A;  3EZI A;  4HFK B;  1MND A;  3RVZ A;  3HLZ A;  2BC5 A;  2XL4 A;  2PX3 A;  2MWQ A;  2A68 F;  2AP3 A;  2NSF A;  3LES A;  4LAC B;  3QMK A;  4QDL A;  3EHM A;  3BEH A;  3RQF A;  2Y69 C;  4D4X A;  1M2V A;  1D1A A;  4MTF A;  3DKA A;  3K1H A;  3W4Y A;  1G8X A;  1ZYR F;  1SYQ A;  5D91 A;  1MQV A;  5B3S C;  1RKE A;  3Q7L A;  3TJ6 A;  1S05 A;  3U2M A;  3U3F A;  3V5Z A;  1EI7 A;  3NKE A;  2ZXO A;  3F47 A;  1T6U A;  1VMA A;  2WB7 A;  3GEH A;  2XLW A;  4AE4 A;  3DJU B;  2KYH A;  5AC5 A;  1PD1 A;  1UG7 A;  2J9B A;  2XLH A;  3LNM B;  3FDQ A;  3POV A;  4BJ6 A;  3ZIB A;  2J9U A;  1HW1 A;  3B0P A;  1YZA A;  3N24 A;  4RBN A;  3EH2 A;  2F22 A;  2ICW G;  5L0F A;  2VCC A;  1TFO B;  2R9R B;  4JC7 A;  2WZF A;  2B0H A;  3NYJ A;  2WVN A;  1ORS C;  3JSE O;  3UMK A;  2NUT A;  1XZQ A;  1V54 C;  4C7O B;  4X0R A;  3PDM P;  1QKR A;  1L3P A;  3I4U A;  4PJL A;  2Z15 A;  3EGX A;  2R25 A;  4EHP A;  1OW6 A;  1BR2 A;  1YA7 O;  5KYY A;  3KMI A;  4U5D E;  1QZX A;  2H7O A;  3T4R A;  1JRA A;  2GA0 A;  1QVX A;  3RF3 A;  3JYH A;  1Y4C A;  3QZC A;  3VRC A;  2J46 A;  4JTA B;  4DVY P;  5FZT A;  3DM9 B;  3H2V A;  3EGD A;  2I15 A;  2YHS A;  3DXJ F;  3M4C A;  2PX0 A;  4DJ9 A;  3F46 A;  4JE9 A;  5D92 A;  4N6C A;  4CJG A;  4U5B E;  5E3C A;  3R7C A;  5DS6 A;  2OEV A;  4WJ0 A;  1RCP A;  4YN0 B;  1D0Z A;  1ZHT A;  2IXM A;  2XLD A;  4O6Y A;  3ZWI A;  4EIY A;  3S9O A;  2RSE B;  2VB6 A;  1J8Y F;  4P9F A;  2W4B A;  3RQE A;  4E0H A;  4MW3 A;  1N1C A;  2XLM A;  4YL0 A;  4DRI B;  5DVW A;  1LPE A;  4K0D A;  4EBJ A;  1GM5 A;  4IRU A;  1H6G A;  4CS9 C;  3Q6N A;  4ER9 A;  2OQM A;  4LDR A;  3VM6 A;  5KYW B;  5T3W A;  1G5Z A;  1OCZ C;  3N0T A;  4Q4Z F;  3DE9 A;  5T1D B;  2RD9 A;  3WHN A;  4OIO F;  4PJM A;  1K05 A;  4NC3 A;  4W8K A;  1D0Y A;  1VTM P;  2WZG A;  4HEA J;  3W2V A;  1A41 A;  2NUP A;  1LM3 B;  2Q4F A;  1T6Q A;  3FMS A;  2P0N A;  3C18 A;  4I1O B;  1TWC A;  4A4A A;  4NTF A;  1F1M A;  3EFO B;  2Q3T A;  1IZM A;  2Y3D A;  4XQ1 A;  3Q7G A;  1YLM A;  5A69 A;  5KYN A;  3QVZ A;  5B1A C;  2GFH A;  2BE5 F;  2J9W A;  3G4Z A;  4ONS A;  5JS5 A;  2R7O A;  2A6H F;  1O87 A;  3LS0 A;  3LNR A;  4CX9 A;  3TD7 A;  5L0H A;  3IQ6 A;  1XWJ A;  5KYX B;  3V7O A;  3EG9 A;  3KH2 A;  4ULW A;  2ZD9 A;  4JVS A;  2PFD A;  1ZVZ A;  4CS8 C;  5L0G A;  1OXB A;  4EKW A;  2LD6 A;  2HJM A;  2CW0 F;  3SZR A;  4O79 A;  2A1D D;  3HNL A;  4CS7 A;  1TWG A;  2HV6 A;  3NRH A;  1KNY A;  3I5P A;  1JR8 A;  5KYU B;  1FFH A;  3C7J A;  3FXH A;  3U5S A;  3U9M A;  4CBE A;  2XM0 A;  4CDA A;  3EQL F;  4KI2 A;  1ZHW A;  2Q9B A;  4P9T A;  3RFY A;  1NU9 C;  3W8I A;  2YL3 A;  4G7Z F;  2O9X A;  3RIP A;  2JX0 A;  2QLA A;  5FCL A;  1ZW2 A;  4MVS A;  2AWY A;  4XLN F;  3ZDL A;  2HS5 A;  4CIH A;  5COM A;  2P1A A;  3MX3 A;  3M15 A;  1GQA A;  3KPH A;  2LFF A;  3LEO A;  3JTL O;  1GS9 A;  1WTY A;  2IBF A;  2OKU A;  5CI9 A;  4IB4 A;  2C04 A;  3LLI A;  4JIO A;  1FTS A;  2OOC A;  4OD4 A;  3X2Q C;  4HE8 D;  1CGO A;  1E85 A;  1Z63 A;  1H7I A;  3AJM A;  3T6B A;  4K7B A;  3AQB A;  3J06 A;  3GWL A;  1WWP A;  1WAS A;  3AG3 C;  1NSG B;  3B9Q A;  1K04 A;  1OR2 A;  2L6F A;  2YQY A;  3C8G B;  3JCU Q;  3ABM C;  1SF8 A;  1VOM A;  1YYX A;  3DWW A;  3LAY A;  4XPY A;  4IAO A;  2X0C A;  3LUT B;  1FNT c;  3KYJ A;  2IYL D;  1WAT A;  2YVK A;  3C8Z A;  2TMV P;  4GEH A;  4AL0 A;  3ZQV A;  2YKZ A;  2OCC C;  2XXA B;  3NMJ A;  4OIP F;  1SZI A;  3AQC A;  4JEB A;  3JZ0 A;  3PHF 2;  3U8P A;  4ZLD A;  4KBL A;  1RJ9 B;  3GM1 A;  3H65 A;  2DYS C;  4NCQ A;  4FX5 A;  4JZA A;  3S29 A;  1ZHZ A;  4YWQ A;  1U0B B;  2YZS A;  1YAR O;  3O39 A;  4MVO A;  2KK1 A;  4N4W A;  3VAY A;  3TUL A;  3B0U X;  4U5G A;  2QY9 A;  2J9V A;  4N6H A;  4CS9 A;  4JJG A;  1NG1 A;  1LVK A;  1QLE C;  1D1B A;  2H8A A;  1WN0 A;  3SXY A;  4J32 B;  2WVO A;  3SEO A;  3X1O A;  2YEV A;  3R2P A;  4DXW A;  5L3V A;  2FAP B;  1PV3 A;  3U3B A;  3B29 A;  4YJW A;  3E70 C;  2WVQ A;  1AUE A;  3L8J A;  2YL1 A;  1LE4 A;  3W2W A;  2R7R A;  3C8G D;  4XTK A;  4XPW A;  2Q7R A;  3ITF A;  1Q0F A;  4NY3 A;  2NPU A;  1KTM A;  3FAP B;  4HFF B;  1D1C A;  4H4K C;  5L0J A;  3EH1 A;  3ASN C;  4MW8 A;  1Z23 A;  1APC A;  2LP4 A;  4LER A;  3L34 A;  4MQ9 F;  2P7V A;  5B1B C;  3AOU A;  3A11 A;  2R05 A;  3EJN A;  4JCH A;  4JRZ A;  4YK5 A;  2G62 A;  4YT2 A;  1TKN A;  4BJ5 C;  1E86 A;  4BEM J;  2LQG A;  4OIN F;  2GDC A;  2FFH A;  4O6N A;  3FVY A;  4CS8 A;  5A6A A;  2OEX A;  2UUI A;  3S0X A;  3FOP A;  1AEP A;  3LJB A;  2L6H A;  4IWB A;  3RW0 A;  3DM5 A;  4C3B A;  1OKK D;  2A0B A;  2ASR A;  5A6B D;  4XEF A;  1Z7Q c;  2R7V A;  1ZW3 A;  2FGY A;  3UGO A;  2X51 A;  1T9K A;  5JRA A;  1MMN A;  2J45 A;  2VC9 A;  2L9J A;  1R5I D;  3TQO A;  2DI3 A;  1OCO C;  1HMD A;  4C3E A;  2A69 F;  3OA1 A;  1HMO A;  2YLG A;  1H9G A;  1M56 C;  3ATP A;  3W8H A;  1OKK A;  2HSB A;  3HKK A;  1SR2 A;  4KC9 A;  5E33 A;  5A6B A;  2CCY A;  5COF A;  4WAB A;  3AG2 C;  3OWT A;  4JJF A;  2LCH A;  1EQ1 A;  2B0J A;  3DAG A;  4YT5 A;  1FAP B;  2OU6 A;  3FOO A;  1I4Z A;  1NU7 D;  2CYD A;  3AG1 C;  1C03 A;  2QUP A;  3DJN B;  3QTH A;  1BR1 A;  1C17 M;  1YJG A;  5JSL A;  3ZVR A;  1M6T A;  3H2U A;  1JPJ A;  1QQ3 A;  5JVE A;  1PD0 A;  5A6J A;  3T6G B;  4P6I C;  1E2X A;  5DQZ A;  5A6K A;  3GOR A;  3KKB A;  2A6E F;  2HV7 A;  3IQ5 A;  2AWC A;  4IJJ A;  4XEV A;  1ZU4 A;  5BQG A;  2MYS A;  4NQF A;  4CDV A;  1V4A A;  4UDV A;  1JOG A;  2WL8 A;  1M57 C;  2CNW D;  4MVQ A;  1GGQ A;  3ZC4 A;  4C7O A;  4GQH A;  1HY5 A;  1TWA A;  2M4E A;  5DS5 A;  4MVR A;  4LDQ A;  3B0V C;  4AK9 A;  1A7D A;  4CJO A;  1Q0D A;  1KU2 A;  1FFT C;  3TK0 A;  3MFN A;  1G4W R;  2XS8 A;  1B68 A;  2EPL X;  4LLE A;  1LIH A;  3JSZ A;  2J7P D;  2VCB A;  4IAQ A;  5E3A A;  1TWH A;  2J0W A;  2V26 A;  2HMQ A;  2EPN A;  3CSK A;  2NSG A;  2XLE A;  3O55 A;  4XWJ A;  2XS1 A;  3O6X A;  4IAR A;  5TJ5 E;  3V5Y A;  2R03 A;  5L0D A;  3UNG C;  3SNH A;  3S28 A;  2Y3G A;  4BJT A;  2MHR A;  4U5C E;  2J7P A;  3B71 A;  5JP7 A;  2ZPA A;  3RVY A;  3PMR A;  3RQG A;  2HMZ A;  4J7Y A;  3GM2 A;  4JUR I;  1NZE A;  4YT8 A;  2JD3 A;  3IQC A;  1LI5 A;  1RMV A;  2IXO A;  5KYW A;  3U9J A;  3L0I A;  1YZC A;  3FAJ A;  2PP4 A;  3HNI A;  2KC3 A;  2KJG A;  4JTD B;  3V5X A;  4LDK A;  3SP1 A;  4BJ5 A;  3G50 A;  2EIJ C;  3TOM A;  4MND A;  1HE9 A;  1VYK A;  3HNJ A;  3L8I A;  1NFN A;  2C03 A;  3M4B A;  4BPM A;  3MBG A;  3EFO A;  5L0C A;  2LK4 A;  2R7S A;  2D4U A;  4XLP F;  2R7X A;  2E87 A;  1FR0 A;  4AL1 A;  3JRM O;  2Y3H A;  4B6I A;  1U89 A;  4CSA C;  1J8M F;  1OW7 A;  2QE9 A;  1C02 A;  3FHD A;  3IEE A;  4PK4 A;  1S7Z A;  3CZ6 A;  1RKE B;  4EBB A;  4YT4 A;  1DOV A;  1MMG A;  4G0H A;  4Q5S F;  1HW2 A;  1QSP A;  1EKY A;  3ZTZ A;  1YAU O;  5KYX A;  3AGT A;  3WG7 C;  2Q00 A;  3NDB B;  4FES A;  4U5F E;  5F5H A;  3MYF A;  4AE4 B;  2BL2 A;  1NFO A;  3HTK C;  4MS2 A;  4DRJ B;  3JT1 A;  4JCZ A;  2PBE A;  4PFO A;  5HV9 A;  2EPO A;  3E9V A;  5L3Q A;  2DGJ A;  1VK5 A;  1JPN A;  2CDQ A;  3L1M A;  4OIQ F;  2IM8 A;  3UMH A;  3ABK C;  4YL3 A;  3S90 A;  2HUJ A;  5L0I A;  1NLX A;  1IW7 F;  1YYJ A;  5COG A;  5KYU A;  4NTA A;  3GAN A;  3K33 A;  2YL7 A;  2EIL C;  3NMI A;  1I5N A;  2YLI A;  3N2Z B;  1A7E A;  2OJE D;  2PNO A;  1AVO B;  1O5H A;  2Q9A A;  2XL8 A;  1LKX A;  4FWV A;  5CIV A;  1T5O A;  3EGX B;  3A9C A;  3WAQ A;  1BR4 A;  2Y39 A;  4FAP B;  1T01 A;  5KYY B;  1WOL A;  2I8B A;  2IXN A;  1MNE A;  4WGY A;  1ZHX A;  2AU5 A;  2R02 A;  4MTG A;  1A0B A;  2YRF A;  1ORY A;  3EGD B;  2H7V C;  1Q0M A;  2PF4 E;  3C8G A;  3PCV A;  4U9D A;  4DRH B;  5F5F A;  1UFB A;  3CQZ A;  4U9E A;  5JUA A;  4R32 A;  3VF0 A;  2ZXW C;  1SMY F;  1OW8 A;  2LSE A;  2JPU A;  2G3K A;  4MVU A;  3DD7 A;  4MTO A;  3ASO C;  1LS4 A;  4F4B A;  3GM3 A;  4J7T A;  1OXK A;  5F28 E;  4E17 A;  4OD5 A;  2ZXP A;  3S27 A;  5K0I A;  2XXA A;  5AGF A;  3ECS A;  4I3M A;  4KNV A;  4ZLC A;  3QW0 A;  3K1I C;  4M63 A;  3EPV A;  1RJ9 A;  1V74 B;  2XLV A;  1O3U A;  1L7C A;  1JMW A;  4G7O F;  2CGE A;  4BEJ A;  1CPR A;  1K40 A;  4U5E E;  4IGG A;  2XM4 A;  2XSE A;  2YL0 A;  4D4N A;  4W8P A;  1U6H A;  3SXM A;  5JT4 A;  2P6V A;  4E18 A;  2L6G A;  2QTV A;  2NUP B;  2KNH A;  1I4Y A;  1Z5Z A;  3AG4 C;  3LS1 A;  2KGO A;  2NG1 A;  3M79 A;  4XEK A;  2L81 A;  4Z9I A;  3CEX A;  1W2W A;  2VCA A;  5CI8 A;  4CDY A;  1H9T A;  1ST6 A;  3RKO F;  4DOZ A;  2UUH A;  4I44 A;  1Y6D A;  2HZ8 A;  3G4X A;  5HSW A;  3IQT A;  4AX2 A;  4G7H F;  3JYY A;  3US6 A;  4BJ1 A;  3EHN A;  4LLC A;  3RYL A;  1OR3 A;  1FMV A;  3TJ5 A;  1XZP A;  3IPM O;  3ZTM A;  3MYI A;  4O7G A;  1VLT A;  2IOQ A;  3EG9 B;  1WGW A;  3DAF A;  4JKV A;  4Z9J A;  4CSA A;  1TFK B;  4NTB A;  4EUK B;  2HFI A;  1E83 A;  1HE1 A;  1OCC C;  3GEE A;  2AVK A;  2EPK X;  1VYI A;  3KL4 A;  3SXZ A;  4EWC A;  4H54 A;  2LFD A;  4XPX A;  3ZG1 A;  1R4T A;  2GWW A;  4Z9H A;  4RD9 A;  3U8V A;  4EBK A;  1NBB A;  5BQI A;  1DOW A;  2VH3 A;  1JAF A;  1ZU5 A;  4MVZ A;  4E7S A;  5AC4 A;  2XL6 A;  4GYT A;  3K7D A;  5T3T A;  2YLD A;  4U5H A;  2W4M A;  2CNW A;  4ANJ A;  2GAQ A;  3JRT A;  2DB4 A;  1ORJ A;  3WOD F;  1M2O A;  2Q9C A;  2DYR C;  3NG1 A;  1ZZP A;  5IY5 C;  3DZA A;  4L6R A;  4E0I A;  4K1O A;  1CPQ A;  4KNW A;  3S84 A;  2KSF A;  1D0X A;  1TQG A;  2KQ9 A;  4BJ6 C;  2P61 A;  2A0U A;  5B3I A;  5EK0 A;  3HJC A;  1RKC A;  1OQC A;  3GEI A;  1YA9 A;  2ETS A;  3BRJ A;  3IHU A;  1Q0K A;  3RH3 A;  3UMI A;  2WZL A;  2HKV A;  3DI5 A;  4DBR A;  4DVZ A;  4JTC B;  5BUO A;  3NMK A;  4QI2 A;  1YDI A;  3I5Q A;  4ULV A;  4N06 A;  4PJN A;  2IXP A;  5DLJ A;  2OG2 A;  1V55 C;  1RXQ A;  3CAX A;  4DBQ A;  3KYI A;  3LEV A;  4E7Z A;  4JW1 A;  3VYW A;  1BBH A;  3NKD A;  3U2L A;  3ZSU A;  2YWA A;  4WGZ A;  3C63 A;  2V3C C;  1YVI A;  3QW1 A;  5BQH A;  2Y3B A;  4J30 B;  4CIP A;  2XRH A;  4YL1 A;  3HNK A;  4MVM A;  3TOL A;  3O10 A;  2EPM X;  3K1I A;  1LS1 A;  2OJQ A;  1M2V B;  2EIM C;  2J8W A;  4QI0 A;  3ZQY A;  3UGP A;  4BG0 A;  4PFP A;  1ZHY A;  1OCR C;  2H7B A;  3NYL A;  2HJ3 A;  2R7W A;  2VAS A;  3Q6M A;  1Z6A A;  5GPG B;  1PCX A;  2EIK C;  4G78 A;  5DQT A;  1Q0G A;  3T9O A;  1T6I A;  3AGU A;  5E2Q A;  2R7T A;  1LI7 A;  2J0X A;  2LIG A;  3GWN A;  3NYM A;  4A2N B;  3GOD A;  2QNL A;  1FMW A;  4PR9 A;  3K6B A;  3T6J A;  2D5R B;  3EZH A;  2R7Q A;  2W9Y A;  3MLG A;  4PAC A;  3C62 A;  5EGY A;  2XLO A;  5EHH A;  3ABL C;  3K66 A;  256B A;  2R7U A;  1LE2 A;  4JEA A;  1CGM E;  5DS4 A;  4OIR F;  1VB5 A;  1QPU A;  2NUT B;  1A7V A;  1CGN A;  4I1M A;  1VLS A;  1BDJ B;  2HSQ A;  1EA8 A;  3M1C B;  3SYN A;  2EIN C;  3OEO A;  3UR3 C;  1E84 A;  1G4U S;  4C3D A;  2L7A A;  2G3V A;  2ZXR A;  3DE8 A;  3LLK A;  3QVY A;  3SXK A;  2M64 A;  3DMD A;  4O6M A;  5JLI A; 
#chains in the Genus database with same CATH homology
 2KW3 C;  2W45 A;  1MMA A;  1Z3I X;  4Q7C A;  4RDA A;  1MMD A;  1TR2 A;  4PJJ A;  3EZI A;  4HFK B;  1MND A;  3HLZ A;  2XL4 A;  2PX3 A;  2MWQ A;  2A68 F;  3LES A;  4LAC B;  4QDL A;  3QMK A;  3EHM A;  2Y69 C;  1M2V A;  1D1A A;  3K1H A;  1G8X A;  1ZYR F;  5D91 A;  5B3S C;  3Q7L A;  3NKE A;  2ZXO A;  3F47 A;  1VMA A;  2WB7 A;  4AE4 A;  3DJU B;  1PD1 A;  3FDQ A;  4BJ6 A;  3ZIB A;  2J9U A;  3B0P A;  5HSW A;  3N24 A;  4RBN A;  3EH2 A;  2WZF A;  3NYJ A;  2WVN A;  3UMK A;  2NUT A;  1V54 C;  4C7O B;  4X0R A;  3I4U A;  4PJL A;  2Z15 A;  3EGX A;  1BR2 A;  5KYY A;  3KMI A;  4U5D E;  1QZX A;  2H7O A;  3T4R A;  3JYH A;  3QZC A;  2J46 A;  4DVY P;  3DM9 B;  3EGD A;  2YHS A;  3DXJ F;  2PX0 A;  3F46 A;  5D92 A;  4U5B E;  5E3C A;  5DS6 A;  4WJ0 A;  4YN0 B;  1D0Z A;  1ZHT A;  2IXM A;  4O6Y A;  2VB6 A;  1J8Y F;  2W4B A;  1N1C A;  5DVW A;  4K0D A;  4IRU A;  4CS9 C;  3Q6N A;  5KYW B;  5T3W A;  1OCZ C;  3N0T A;  4Q4Z F;  5T1D B;  4OIO F;  4PJM A;  4W8K A;  1D0Y A;  2WZG A;  4HEA J;  3W2V A;  2NUP A;  4I1O B;  1TWC A;  3EFO B;  2Q3T A;  1IZM A;  2Y3D A;  5KYN A;  3Q7G A;  5B1A C;  2GFH A;  2BE5 F;  2J9W A;  2R7O A;  2A6H F;  1O87 A;  3LS0 A;  3LNR A;  3TD7 A;  5KYX B;  3V7O A;  3EG9 A;  3KH2 A;  4ULW A;  4JVS A;  2PFD A;  4CS8 C;  2CW0 F;  3SZR A;  4O79 A;  2A1D D;  4CS7 A;  1TWG A;  2HV6 A;  3NRH A;  3I5P A;  5KYU B;  1FFH A;  4CBE A;  4KI2 A;  3EQL F;  1ZHW A;  2Q9B A;  3RFY A;  3W8I A;  1NU9 C;  4G7Z F;  2O9X A;  3RIP A;  5FCL A;  4XLN F;  4CIH A;  3MX3 A;  3POV A;  3X2Q C;  5CI9 A;  2C04 A;  3LLI A;  4OD4 A;  1FTS A;  4HE8 D;  1Z63 A;  3T6B A;  4K7B A;  3AQB A;  3AG3 C;  3B9Q A;  3JCU Q;  3ABM C;  1SF8 A;  1VOM A;  3LAY A;  4IAO A;  2IYL D;  4GEH A;  2OCC C;  2XXA B;  4OIP F;  1SZI A;  3AQC A;  3PHF 2;  4ZLD A;  4KBL A;  1RJ9 B;  3S29 A;  3H65 A;  2DYS C;  4YWQ A;  4FX5 A;  4JZA A;  1ZHZ A;  2YZS A;  3O39 A;  3VAY A;  3B0U X;  4U5G A;  2QY9 A;  2J9V A;  4CS9 A;  4JJG A;  1NG1 A;  1LVK A;  1QLE C;  1D1B A;  3X1O A;  4J32 B;  2WVO A;  3SEO A;  5L3V A;  2YEV A;  4YJW A;  3E70 C;  2WVQ A;  3W2W A;  2R7R A;  4XTK A;  3ITF A;  4NY3 A;  4HFF B;  1D1C A;  4H4K C;  3EH1 A;  3ASN C;  1Z23 A;  4LER A;  3L34 A;  4MQ9 F;  2P7V A;  5B1B C;  3EJN A;  4JCH A;  4YT2 A;  2G62 A;  1TKN A;  4BJ5 C;  4OIN F;  2FFH A;  4O6N A;  3FVY A;  4CS8 A;  3S0X A;  3LJB A;  4IWB A;  3DM5 A;  4C3B A;  1OKK D;  2R7V A;  2FGY A;  3UGO A;  2X51 A;  1MMN A;  2J45 A;  2L9J A;  1OCO C;  4C3E A;  2A69 F;  3OA1 A;  1M56 C;  3W8H A;  1OKK A;  4KC9 A;  5E33 A;  3AG2 C;  3OWT A;  4JJF A;  2B0J A;  3DAG A;  4YT5 A;  1NU7 D;  3AG1 C;  3DJN B;  1BR1 A;  3ZVR A;  1JPJ A;  1PD0 A;  4P6I C;  5DQZ A;  3KKB A;  2A6E F;  2HV7 A;  4IJJ A;  1ZU4 A;  2MYS A;  3ZC4 A;  2WL8 A;  1M57 C;  2CNW D;  4C7O A;  1TWA A;  2M4E A;  5DS5 A;  3B0V C;  4AK9 A;  1KU2 A;  1FFT C;  4LLE A;  3JSZ A;  2J7P D;  5E3A A;  1TWH A;  2J0W A;  2V26 A;  3CSK A;  4XWJ A;  3O6X A;  3UNG C;  3SNH A;  3S28 A;  2Y3G A;  4BJT A;  4U5C E;  2J7P A;  2ZPA A;  3PMR A;  4JUR I;  4YT8 A;  1NZE A;  2JD3 A;  2IXO A;  5KYW A;  3L0I A;  3FAJ A;  2PP4 A;  2KJG A;  3SP1 A;  4BJ5 A;  2EIJ C;  4MND A;  1VYK A;  2C03 A;  3EFO A;  2R7S A;  4XLP F;  2R7X A;  2E87 A;  4B6I A;  2Y3H A;  4CSA C;  1J8M F;  3FHD A;  3IEE A;  4PK4 A;  1S7Z A;  3CZ6 A;  4EBB A;  4YT4 A;  1MMG A;  4G0H A;  4Q5S F;  5KYX A;  3WG7 C;  3NDB B;  4FES A;  4U5F E;  5F5H A;  4AE4 B;  3HTK C;  3JT1 A;  4PFO A;  3E9V A;  5L3Q A;  2DGJ A;  1VK5 A;  1JPN A;  2CDQ A;  4OIQ F;  3UMH A;  3ABK C;  1IW7 F;  5KYU A;  3GAN A;  3K33 A;  2EIL C;  3N2Z B;  2Q9A A;  1O5H A;  4FWV A;  1LKX A;  3EGX B;  1BR4 A;  2Y39 A;  5KYY B;  2I8B A;  2IXN A;  1MNE A;  1ZHX A;  3EGD B;  2H7V C;  2PF4 E;  5F5F A;  3CQZ A;  2ZXW C;  1SMY F;  2LSE A;  2G3K A;  3DD7 A;  3ASO C;  4F4B A;  4OD5 A;  2ZXP A;  3S27 A;  2XXA A;  3ECS A;  4I3M A;  4KNV A;  4ZLC A;  3K1I C;  4M63 A;  3EPV A;  1RJ9 A;  4G7O F;  2CGE A;  4BEJ A;  4U5E E;  2XSE A;  2P6V A;  2QTV A;  2NUP B;  2KNH A;  1Z5Z A;  3AG4 C;  3LS1 A;  2KGO A;  2NG1 A;  2L81 A;  1W2W A;  5CI8 A;  1ST6 A;  3RKO F;  4DOZ A;  4I44 A;  4AX2 A;  4G7H F;  4BJ1 A;  3EHN A;  4LLC A;  3RYL A;  1FMV A;  4O7G A;  2IOQ A;  3EG9 B;  1WGW A;  3DAF A;  4CSA A;  1OCC C;  3KL4 A;  4EWC A;  1VYI A;  3ZG1 A;  4RD9 A;  2VH3 A;  1ZU5 A;  4E7S A;  4GYT A;  3K7D A;  5T3T A;  4U5H A;  2W4M A;  2CNW A;  4ANJ A;  3JRT A;  3WOD F;  1M2O A;  2Q9C A;  2DYR C;  3NG1 A;  5IY5 C;  3DZA A;  4KNW A;  1D0X A;  2KQ9 A;  4BJ6 C;  3HJC A;  3RH3 A;  3UMI A;  2WZL A;  4DBR A;  4DVZ A;  5BUO A;  4QI2 A;  3I5Q A;  4N06 A;  4PJN A;  2IXP A;  5DLJ A;  2OG2 A;  1V55 C;  4DBQ A;  3LEV A;  4E7Z A;  4JW1 A;  3VYW A;  3NKD A;  3ZSU A;  2V3C C;  2Y3B A;  4J30 B;  2XRH A;  1LS1 A;  1M2V B;  2EIM C;  4QI0 A;  3UGP A;  4BG0 A;  4PFP A;  1ZHY A;  1OCR C;  2H7B A;  3NYL A;  2R7W A;  2VAS A;  3Q6M A;  1Z6A A;  1PCX A;  2EIK C;  5DQT A;  5E2Q A;  2R7T A;  2J0X A;  3NYM A;  4A2N B;  3GOD A;  1FMW A;  3K6B A;  3T6J A;  2D5R B;  3EZH A;  2R7Q A;  2W9Y A;  3MLG A;  5EGY A;  5EHH A;  3ABL C;  3K66 A;  2R7U A;  5DS4 A;  4OIR F;  2NUT B;  4I1M A;  3M1C B;  3SYN A;  3UR3 C;  2EIN C;  3OEO A;  4C3D A;  2G3V A;  2ZXR A;  3LLK A;  3DMD A;  4O6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...