2DB4A

Crystal structure of rotor ring with dccd of the v- atpase from enterococcus hirae
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
156
structure length
156
Chain Sequence
MMDYLITQNGGMVFAVLAMATATIFSGIGSAKGVGMTGEAAAALTTSQPEKFGQALILQLLPGTQGLYGFVIAFLIFINLGSDMSVVQGLNFLGASLPIAFTGLFSGIAQGKVAAAGIQILAKKPEHATKGIIFAAMVETYAILGFVISFLLVLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V-Type Sodium ATPase Subunit K
publication title Structure of the rotor ring modified with N,N'-dicyclohexylcarbodiimide of the Na+-transporting vacuolar ATPase.
pubmed doi rcsb
source organism Enterococcus hirae
molecule tags Hydrolase
total genus 71
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00137 ATP-synt_C ATP synthase subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) lithium bound rotor ring of v- atpase 2db4A00
5TJ5E 2DB4A 2BL2A 4BEMJ 3AOUA 2CYDA
chains in the Genus database with same CATH superfamily
5BQIA 2DYSC 2YZSA 1OCOC 4KNVA 3CSKA 4RBNA 1WWPA 3Q7GA 5L0DA 2KNHA 3MBGA 1OCZC 4CS8C 4N6HA 3RFYA 2Q00A 2DGJA 4A2NB 1SR2A 1TQGA 4YN0B 4CIHA 4HFFB 3US6A 1LE4A 5COGA 2PX3A 1FMWA 2YRFA 1ST6A 2JPUA 1O3UA 2BL2A 4CS8A 5L3VA 3C63A 1GGQA 3AG2C 3U8PA 2WB7A 3ABMC 2R7QA 1T6IA 1VMAA 4CDYA 3LJBA 4OIQF 3LEOA 1D0YA 4IAOA 2XLHA 2XLVA 3EHNA 2Z15A 5E3AA 3EQLF 5DLJA 3TD7A 1NBBA 3DXJF 1G4US 2FGYA 3N2ZB 5JVEA 2Y69C 2OJED 3DM5A 5DS5A 2OEXA 1FMVA 3VF0A 2XLEA 2D4UA 2P7VA 1RJ9A 2J7PA 1QKRA 1R4TA 3C8GA 4G78A 5JLIA 1PCXA 2EPMX 3NMJA 3WODF 5BQHA 3U3BA 1LS4A 1WASA 2A0BA 2P1AA 4QI0A 1K05A 3NKEA 3PMRA 4CBEA 2XL4A 2R7WA 1E84A 1OCCC 1LS1A 2YLIA 3EFOB 4YL1A 5B3IA 1APCA 3LNMB 4IJJA 1U6HA 3HNKA 1M2OA 2XLWA 3LAYA 5KYUA 3FDQA 2PNOA 1LI7A 1SMYF 4BPMA 2VH3A 2VASA 3ZG1A 2UUIA 3ZIBA 4KBLA 2XLDA 2XM0A 2R03A 4XTKA 3L0IA 1G4WR 4D4XA 2H7OA 4U5FE 3T6BA 1T6UA 3PCVA 1RCPA 1ZHZA 3AGUA 1TFOB 4O6YA 1I4ZA 4OIOF 1I4YA 3RF3A 1ORYA 3DJUB 5FZTA 4FAPB 1E85A 1JRAA 4GQHA 1DOWA 1E86A 2X51A 4PK4A 3TOLA 4E18A 5B1BC 4NQFA 4KI2A 3Q6MA 4U5BE 5E33A 4JTAB 3JSEO 1ORJA 1F1MA 1UG7A 2LK4A 2R02A 3EZHA 3QVZA 4K1OA 5EK0A 3TK0A 2KQ9A 3C62A 4LLEA 2L81A 2RSEB 3SNHA 3DM9B 2R05A 3TULA 3ECSA 3K66A 2NSGA 4QI2A 3ZTMA 1Z63A 2BC5A 2L6FA 2YLGA 4H54A 3B0PA 1M57C 2XLOA 1ZVZA 3ASOC 4BEJA 2XXAA 4Q7CA 5A6AA 4AL1A 4IB4A 5JUAA 2HZ8A 2PP4A 2OU6A 3JTLO 2L9JA 1VOMA 4JJGA 4BJ6A 5JRAA 1E83A 1CPQA 4NC3A 4W8PA 1JOGA 3DE9A 2R7XA 2E87A 256BA 1BDJB 2HSBA 2QLAA 3L8JA 4XEFA 4JTCB 2WZLA 4YT5A 3VRCA 2HKVA 1LIHA 5TJ5E 2Q7RA 2R7RA 1GM5A 4C3DA 2LQGA 3W4YA 5CIVA 1MMNA 4I3MA 3EH1A 3AJMA 4ULVA 3L1MA 5CI9A 1ZW3A 1AVOB 4G7OF 2MHRA 2YQYA 2A0UA 3JSZA 2D5RB 1J8MF 2HS5A 3LLIA 1Y4CA 3KPHA 4YK5A 5COFA 4CS9A 3ATPA 3KH2A 3NKDA 3RQFA 1DOVA 4Q4ZF 5COMA 1PD1A 3DJNB 4L6RA 2CGEA 2CNWA 4PJJA 4E17A 5A6BA 5L0CA 5KYWB 4J32B 2GDCA 2VCBA 4EUKB 3GM3A 4IGGA 2A6HF 1UFBA 2NSFA 4WGZA 2J9WA 2A68F 4H4KC 1OKKD 2PX0A 1YJGA 3TQOA 2YVKA 4PJNA 1AUEA 2ZPAA 3SXKA 2DYRC 1OW7A 3EGXB 4EHPA 2J46A 3IQTA 5K0IA 1L3PA 2GAQA 1WGWA 4XPYA 1Z6AA 4NTAA 3ZVRA 1YYJA 2ETSA 3K6BA 4DOZA 5HSWA 1ORSC 5BQGA 2XL8A 1K40A 2OEVA 4K0DA 4G7ZF 1OW6A 1PV3A 2NUTB 4Q5SF 2L6GA 4OD5A 4N06A 1D0ZA 2G3KA 3K7DA 3GEIA 4JIOA 2YL3A 4XEVA 2R7OA 3V5XA 4YWQA 4Z9IA 1H7IA 3S27A 1YA7O 5EHHA 4NY3A 4U5HA 1YAUO 3AQCA 2M64A 3BRJA 5A6JA 2FAPB 4FX5A 1VLSA 3UMHA 1QQ3A 5JSLA 4I1OB 3S29A 3KL4A 3RQGA 4CX9A 5B3SC 3RW0A 2W4MA 5D91A 3GEHA 2LSEA 5T1DB 1MNEA 3SXYA 3Q6NA 4LDQA 3PDMP 2G3VA 3EGDB 4PFPA 5E2QA 2YL0A 1YDIA 1NU9C 2KK1A 4JEAA 3I5QA 4AE4B 3C8GD 3QMKA 2W45A 4MVQA 4XWJA 4XLPF 5JS5A 3EGDA 3GM2A 2HV6A 3VAYA 4G0HA 3U5SA 3NYLA 4E7SA 5DVWA 3G4ZA 3QW1A 3T6GB 2OOCA 2YLDA 1D1BA 1VLTA 1S7ZA 4DVZA 2KYHA 4O6NA 1D1AA 2QNLA 4NTFA 1NU7D 3A11A 2FFHA 1GS9A 3DMDA 1Q0GA 3KYIA 4CDAA 2ICWG 3DZAA 2C04A 2J0WA 4LDRA 4C7OB 1XZPA 2L7AA 5DQTA 3RKOF 1MMAA 1H9GA 3L8IA 1M2VB 1NLXA 3GANA 4C7OA 2R7SA 2VB6A 2WL8A 1PD0A 2CYDA 2ZXPA 2Y3DA 3HTKC 4OIPF 3DE8A 3S84A 2ZXWC 4U9EA 3EG9B 4YJWA 4QDLA 3H2VA 3UNGC 3CEXA 4CS7A 3M1CB 4ANJA 4X0RA 1LKXA 3EFOA 3ZQVA 4D4NA 1VB5A 5L0GA 3LNRA 1L7CA 1XZQA 2KW3C 4MVUA 3DD7A 2Q3TA 1KTMA 4EBKA 4E7ZA 2WZFA 3U0CA 4O6MA 1TWHA 4U5GA 5D92A 3U3FA 5L0FA 1IW7F 2BE5F 4JKVA 3UR3C 1JR8A 4O7GA 2IXOA 4CIPA 1J8YF 1JAFA 1ZU4A 1RKEB 4CJGA 5GPGB 3U2LA 2JD3A 3DAFA 2XL6A 3V5ZA 1JPJA 4DRHB 1Y6DA 3M4CA 1TKNA 1U89A 2EILC 3E9VA 3B9QA 3N0TA 3ZTZA 2AVKA 2OJQA 2YHSA 3UMKA 1B68A 1G8XA 3H2UA 2IXPA 3AG3C 3IQ6A 2IXNA 1QZXA 1Z23A 3NMKA 1C17M 2KSFA 4XQ1A 2A69F 1HE1A 3LESA 2Q9CA 4PACA 2VCAA 2O9XA 1R5ID 1D1CA 4WJ0A 2XM4A 3HLZA 3VM6A 3RVYA 1RKCA 1TWGA 2VC9A 3ZC4A 4YL3A 2I15A 4HE8D 1FFTC 4N6CA 4F4BA 3K1HA 4BJ6C 2Y3BA 2Q9BA 3EH2A 3RQEA 3X1OA 4J30B 2MWQA 1WATA 1T9KA 3HNLA 1YYXA 3RH3A 3W2WA 3UMIA 1QVXA 3FAJA 2IOQA 1TWCA 3NRHA 3O6XA 1A7DA 5T3WA 1M56C 1HMDA 3LS1A 3A9CA 3C7JA 3LS0A 5T3TA 2JX0A 3SYNA 5KYNA 1Q0DA 1H9TA 2PFDA 1SF8A 3MLGA 4GYTA 2XS8A 4N4WA 1V74B 2AWYA 5AC5A 4MVZA 2LFFA 1Z7Qc 3TJ5A 2CNWD 3NYMA 1ZZPA 3W8IA 1HY5A 3WG7C 5A6BD 5F5FA 1TR2A 2B0HA 1EA8A 3KKBA 4YT8A 4CS9C 3X2QC 4EWCA 4XEKA 5L0IA 2EIKC 1K04A 3RVZA 1C03A 3GEEA 1HW1A 4JURI 5CI8A 1V4AA 1V55C 2CDQA 4PJMA 3AQBA 4JE9A 1EQ1A 1JPNA 4JC7A 2YL1A 3GWNA 3F46A 1LM3B 1CPRA 2I8BA 4MVOA 2CCYA 2G62A 2ASRA 3OWTA 1AEPA 1YVIA 4OINF 1T5OA 3MYIA 3ITFA 3K33A 5B1AC 5A6KA 5L3QA 1HMOA 2NUPB 1U0BB 1EKYA 4MQ9F 1SYQA 3DI5A 4DBRA 5KYWA 2R9RB 1KU2A 2XSEA 1YZCA 2NUPA 3C8ZA 3V5YA 4JW1A 2J8WA 1VYKA 3ABKC 1ZYRF 4J7TA 1YA9A 2KGOA 3I5PA 3W8HA 2YWAA 3B0VC 4BJ1A 1Q0MA 1W2WA 1BR4A 4I1MA 1YARO 3EGXA 2H8AA 4CDVA 5DS6A 4XLNF 4MTFA 1OXBA 2QE9A 4XPXA 5E3CA 4U5EE 3SXZA 3T6JA 2HJ3A 4JCHA 2VCCA 5KYXB 4UDVA 4BJ5A 1KNYA 2OG2A 1ZHWA 2DB4A 1FNTc 3JYHA 2NUTA 5KYXA 4MS2A 4AX2A 1OR3A 4MVRA 3PHF2 3L34A 4P9TA 1OW8A 2B0JA 3EHMA 1WN0A 2V26A 1JMWA 1YLMA 1O87A 1BBHA 2Y3GA 3ABLC 5HV9A 1NG1A 2YKZA 4BEMJ 3UGPA 4DRIB 1VYIA 2AU5A 3IQCA 2X0CA 2CW0F 3O55A 3VYWA 3JRTA 1IZMA 3H65A 3M4BA 4JRZA 4Z9JA 2J7PD 1ZU5A 2R7UA 4CJOA 4AE4A 3CZ6A 1FR0A 1Z3IX 3E70C 2Y3HA 3M79A 3SP1A 1T6QA 4OD4A 4M63A 3JCUQ 3IHUA 1T01A 4R32A 4GEHA 3O10A 2KC3A 3HJCA 2EIMC 4JZAA 1A7VA 3N24A 1QPUA 3EJNA 3SZRA 2IBFA 2WZGA 4WGYA 3HNJA 2EPKX 3NDBB 4XPWA 1HE9A 1BZ4A 2IYLD 3BEHA 1EI7A 3NG1A 1N1CA 1MMGA 3M15A 4HFKB 5JT4A 5L0JA 3JT1A 2H7VC 1VTMP 2EPNA 4IRUA 2QUPA 3B71A 1CGME 1FAPB 1V54C 3B29A 4P6IC 3I4UA 4AK9A 3OEOA 1M6TA 1M2VA 2YL7A 3MX3A 2J9BA 4LERA 3W2VA 1Q0FA 4E0IA 2Y39A 3U8VA 3WAQA 2R7VA 2OKUA 3KYJA 2WVNA 3EG9A 2IXMA 2R7TA 4ULWA 4A4AA 4E0HA 1QLEC 1FFHA 2P61A 4NTBA 4PR9A 3V7OA 3TOMA 4MTOA 4LDKA 2EIJC 1YZAA 5KYYB 2P6VA 1OR2A 1RJ9B 4PJLA 3C8GB 2GWWA 2WVOA 2DI3A 2HFIA 5KYYA 2Q4FA 2OQMA 5DS4A 2H7BA 2LP4A 3NYJA 2J0XA 2MYSA 1RKEA 3FHDA 5IY5C 2KJGA 5BUOA 2HJMA 4CSAC 3GORA 5KYUB 1BR2A 2R25A 4Z9HA 2J45A 3ZQYA 3TJ6A 4NCQA 2HSQA 2A6EF 3OA1A 4EBBA 3J06A 2J9UA 2XLMA 1C02A 3HNIA 3T4RA 4DXWA 2AWCA 3QVYA 1G5ZA 4O79A 4CSAA 4MW8A 1MMDA 3R2PA 4LACB 4YL0A 4HEAJ 2XS1A 3IPMO 3GM1A 4EIYA 1OXKA 2QY9A 2W4BA 5DQZA 4ZLCA 4JTDB 3UGOA 4EBJA 1GQAA 1XWJA 3FOOA 4G7HF 4I44A 2C03A 3WHNA 2HUJA 3EZIA 3POVA 4IARA 4MNDA 3T9OA 3K1IC 3FMSA 3ZDLA 1TWAA 3AGTA 4JCZA 1CGOA 4YT4A 1WTYA 2YEVA 4JEBA 2EPOA 3JZ0A 3RIPA 1ZHYA 2HMQA 2ZXOA 4FESA 4U5CE 3CAXA 3U9JA 3S9OA 4DBQA 3C18A 3EPVA 1OQCA 3F47A 2GFHA 4IWBA 2EPLX 5AGFA 3ASNC 3K1IA 3R7CA 1LE2A 1QSPA 3FXHA 4JVSA 4C3EA 4FWVA 2OCCC 2IM8A 3FAPB 3U2MA 3O39A 5F5HA 2XXAB 3LLKA 3QZCA 1SZIA 2QTVA 3GODA 5L0HA 4DRJB 3CQZA 4LLCA 5AC4A 5EGYA 4B6IA 5FCLA 4BJTA 3GWLA 1H6GA 2AP3A 3FVYA 2PBEA 3DAGA 5A69A 3IEEA 4IAQA 1OCRC 4RD9A 4J7YA 2A1DD 5JP7A 1ZW2A 2LD6A 3DWWA 3MYFA 3KMIA 4EKWA 1RMVA 1RXQA 2ZXRA 3JRMO 5F28E 1FTSA 4ER9A 1BR1A 3B0UX 1NFNA 2P0NA 3U9MA 3SEOA 4PFOA 3S28A 2HMZA 1HW2A 3NMIA 3FOPA 4BJ5C 1E2XA 1LPEA 4YT2A 4ZLDA 4RDAA 1ZHTA 1MNDA 1LVKA 2LIGA 3JYYA 4MTGA 2UUHA 2LFDA 1A0BA 1NSGB 3G50A 1D0XA 3LEVA 3RYLA 2M4EA 4U9DA 2GA0A 3G4XA 4BG0A 1LI5A 3S0XA 1A7EA 2V3CC 4K7BA 1O5HA 3LUTB 4KC9A 1I5NA 4WABA 1VK5A 4JJFA 2XRHA 4C3BA 4DVYP 2L6HA 1TFKB 3MFNA 3S90A 3HKKA 4KNWA 2RD9A 3ZSUA 1NZEA 4ONSA 2ZD9A 4P9FA 2NG1A 3Q7LA 4MVSA 1S05A 3DKAA 4U5DE 2EINC 3QTHA 2F22A 2WVQA 3QW0A 1NFOA 2LCHA 1Z5ZA 4DJ9A 3AG4C 4OIRF 2PF4E 1Q0KA 2W9YA 4AL0A 3ZWIA 1A41A 1CGNA 4MW3A 1ZHXA 2TMVP 3AG1C 2Q9AA 2HV7A 1OKKA 1WOLA 3SXMA 1MQVA 3IQ5A 4W8KA 2NPUA 3AOUA 4MVMA 2J9VA
chains in the Genus database with same CATH topology
5TJ5E 2DB4A 2BL2A 4BEMJ 3AOUA 2CYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TJ5 E;  2DB4 A;  2BL2 A;  4BEM J;  3AOU A;  2CYD A; 
#chains in the Genus database with same CATH topology
 5BQI A;  2DYS C;  2YZS A;  1OCO C;  4KNV A;  3CSK A;  4RBN A;  1WWP A;  3Q7G A;  5L0D A;  2KNH A;  3MBG A;  1OCZ C;  4CS8 C;  4N6H A;  3RFY A;  2Q00 A;  2DGJ A;  4A2N B;  1SR2 A;  1TQG A;  4YN0 B;  4CIH A;  4HFF B;  3US6 A;  1LE4 A;  5COG A;  2PX3 A;  1FMW A;  2YRF A;  1ST6 A;  2JPU A;  1O3U A;  2BL2 A;  4CS8 A;  5L3V A;  3C63 A;  1GGQ A;  3AG2 C;  3U8P A;  2WB7 A;  3ABM C;  2R7Q A;  1T6I A;  1VMA A;  4CDY A;  3LJB A;  4OIQ F;  3LEO A;  1D0Y A;  4IAO A;  2XLH A;  2XLV A;  3EHN A;  2Z15 A;  5E3A A;  3EQL F;  5DLJ A;  3TD7 A;  1NBB A;  3DXJ F;  1G4U S;  2FGY A;  3N2Z B;  5JVE A;  2Y69 C;  2OJE D;  3DM5 A;  5DS5 A;  2OEX A;  1FMV A;  3VF0 A;  2XLE A;  2D4U A;  2P7V A;  1RJ9 A;  2J7P A;  1QKR A;  1R4T A;  3C8G A;  4G78 A;  5JLI A;  1PCX A;  2EPM X;  3NMJ A;  3WOD F;  5BQH A;  3U3B A;  1LS4 A;  1WAS A;  2A0B A;  2P1A A;  4QI0 A;  1K05 A;  3NKE A;  3PMR A;  4CBE A;  2XL4 A;  2R7W A;  1E84 A;  1OCC C;  1LS1 A;  2YLI A;  3EFO B;  4YL1 A;  5B3I A;  1APC A;  3LNM B;  4IJJ A;  1U6H A;  3HNK A;  1M2O A;  2XLW A;  3LAY A;  5KYU A;  3FDQ A;  2PNO A;  1LI7 A;  1SMY F;  4BPM A;  2VH3 A;  2VAS A;  3ZG1 A;  2UUI A;  3ZIB A;  4KBL A;  2XLD A;  2XM0 A;  2R03 A;  4XTK A;  3L0I A;  1G4W R;  4D4X A;  2H7O A;  4U5F E;  3T6B A;  1T6U A;  3PCV A;  1RCP A;  1ZHZ A;  3AGU A;  1TFO B;  4O6Y A;  1I4Z A;  4OIO F;  1I4Y A;  3RF3 A;  1ORY A;  3DJU B;  5FZT A;  4FAP B;  1E85 A;  1JRA A;  4GQH A;  1DOW A;  1E86 A;  2X51 A;  4PK4 A;  3TOL A;  4E18 A;  5B1B C;  4NQF A;  4KI2 A;  3Q6M A;  4U5B E;  5E33 A;  4JTA B;  3JSE O;  1ORJ A;  1F1M A;  1UG7 A;  2LK4 A;  2R02 A;  3EZH A;  3QVZ A;  4K1O A;  5EK0 A;  3TK0 A;  2KQ9 A;  3C62 A;  4LLE A;  2L81 A;  2RSE B;  3SNH A;  3DM9 B;  2R05 A;  3TUL A;  3ECS A;  3K66 A;  2NSG A;  4QI2 A;  3ZTM A;  1Z63 A;  2BC5 A;  2L6F A;  2YLG A;  4H54 A;  3B0P A;  1M57 C;  2XLO A;  1ZVZ A;  3ASO C;  4BEJ A;  2XXA A;  4Q7C A;  5A6A A;  4AL1 A;  4IB4 A;  5JUA A;  2HZ8 A;  2PP4 A;  2OU6 A;  3JTL O;  2L9J A;  1VOM A;  4JJG A;  4BJ6 A;  5JRA A;  1E83 A;  1CPQ A;  4NC3 A;  4W8P A;  1JOG A;  3DE9 A;  2R7X A;  2E87 A;  256B A;  1BDJ B;  2HSB A;  2QLA A;  3L8J A;  4XEF A;  4JTC B;  2WZL A;  4YT5 A;  3VRC A;  2HKV A;  1LIH A;  5TJ5 E;  2Q7R A;  2R7R A;  1GM5 A;  4C3D A;  2LQG A;  3W4Y A;  5CIV A;  1MMN A;  4I3M A;  3EH1 A;  3AJM A;  4ULV A;  3L1M A;  5CI9 A;  1ZW3 A;  1AVO B;  4G7O F;  2MHR A;  2YQY A;  2A0U A;  3JSZ A;  2D5R B;  1J8M F;  2HS5 A;  3LLI A;  1Y4C A;  3KPH A;  4YK5 A;  5COF A;  4CS9 A;  3ATP A;  3KH2 A;  3NKD A;  3RQF A;  1DOV A;  4Q4Z F;  5COM A;  1PD1 A;  3DJN B;  4L6R A;  2CGE A;  2CNW A;  4PJJ A;  4E17 A;  5A6B A;  5L0C A;  5KYW B;  4J32 B;  2GDC A;  2VCB A;  4EUK B;  3GM3 A;  4IGG A;  2A6H F;  1UFB A;  2NSF A;  4WGZ A;  2J9W A;  2A68 F;  4H4K C;  1OKK D;  2PX0 A;  1YJG A;  3TQO A;  2YVK A;  4PJN A;  1AUE A;  2ZPA A;  3SXK A;  2DYR C;  1OW7 A;  3EGX B;  4EHP A;  2J46 A;  3IQT A;  5K0I A;  1L3P A;  2GAQ A;  1WGW A;  4XPY A;  1Z6A A;  4NTA A;  3ZVR A;  1YYJ A;  2ETS A;  3K6B A;  4DOZ A;  5HSW A;  1ORS C;  5BQG A;  2XL8 A;  1K40 A;  2OEV A;  4K0D A;  4G7Z F;  1OW6 A;  1PV3 A;  2NUT B;  4Q5S F;  2L6G A;  4OD5 A;  4N06 A;  1D0Z A;  2G3K A;  3K7D A;  3GEI A;  4JIO A;  2YL3 A;  4XEV A;  2R7O A;  3V5X A;  4YWQ A;  4Z9I A;  1H7I A;  3S27 A;  1YA7 O;  5EHH A;  4NY3 A;  4U5H A;  1YAU O;  3AQC A;  2M64 A;  3BRJ A;  5A6J A;  2FAP B;  4FX5 A;  1VLS A;  3UMH A;  1QQ3 A;  5JSL A;  4I1O B;  3S29 A;  3KL4 A;  3RQG A;  4CX9 A;  5B3S C;  3RW0 A;  2W4M A;  5D91 A;  3GEH A;  2LSE A;  5T1D B;  1MNE A;  3SXY A;  3Q6N A;  4LDQ A;  3PDM P;  2G3V A;  3EGD B;  4PFP A;  5E2Q A;  2YL0 A;  1YDI A;  1NU9 C;  2KK1 A;  4JEA A;  3I5Q A;  4AE4 B;  3C8G D;  3QMK A;  2W45 A;  4MVQ A;  4XWJ A;  4XLP F;  5JS5 A;  3EGD A;  3GM2 A;  2HV6 A;  3VAY A;  4G0H A;  3U5S A;  3NYL A;  4E7S A;  5DVW A;  3G4Z A;  3QW1 A;  3T6G B;  2OOC A;  2YLD A;  1D1B A;  1VLT A;  1S7Z A;  4DVZ A;  2KYH A;  4O6N A;  1D1A A;  2QNL A;  4NTF A;  1NU7 D;  3A11 A;  2FFH A;  1GS9 A;  3DMD A;  1Q0G A;  3KYI A;  4CDA A;  2ICW G;  3DZA A;  2C04 A;  2J0W A;  4LDR A;  4C7O B;  1XZP A;  2L7A A;  5DQT A;  3RKO F;  1MMA A;  1H9G A;  3L8I A;  1M2V B;  1NLX A;  3GAN A;  4C7O A;  2R7S A;  2VB6 A;  2WL8 A;  1PD0 A;  2CYD A;  2ZXP A;  2Y3D A;  3HTK C;  4OIP F;  3DE8 A;  3S84 A;  2ZXW C;  4U9E A;  3EG9 B;  4YJW A;  4QDL A;  3H2V A;  3UNG C;  3CEX A;  4CS7 A;  3M1C B;  4ANJ A;  4X0R A;  1LKX A;  3EFO A;  3ZQV A;  4D4N A;  1VB5 A;  5L0G A;  3LNR A;  1L7C A;  1XZQ A;  2KW3 C;  4MVU A;  3DD7 A;  2Q3T A;  1KTM A;  4EBK A;  4E7Z A;  2WZF A;  3U0C A;  4O6M A;  1TWH A;  4U5G A;  5D92 A;  3U3F A;  5L0F A;  1IW7 F;  2BE5 F;  4JKV A;  3UR3 C;  1JR8 A;  4O7G A;  2IXO A;  4CIP A;  1J8Y F;  1JAF A;  1ZU4 A;  1RKE B;  4CJG A;  5GPG B;  3U2L A;  2JD3 A;  3DAF A;  2XL6 A;  3V5Z A;  1JPJ A;  4DRH B;  1Y6D A;  3M4C A;  1TKN A;  1U89 A;  2EIL C;  3E9V A;  3B9Q A;  3N0T A;  3ZTZ A;  2AVK A;  2OJQ A;  2YHS A;  3UMK A;  1B68 A;  1G8X A;  3H2U A;  2IXP A;  3AG3 C;  3IQ6 A;  2IXN A;  1QZX A;  1Z23 A;  3NMK A;  1C17 M;  2KSF A;  4XQ1 A;  2A69 F;  1HE1 A;  3LES A;  2Q9C A;  4PAC A;  2VCA A;  2O9X A;  1R5I D;  1D1C A;  4WJ0 A;  2XM4 A;  3HLZ A;  3VM6 A;  3RVY A;  1RKC A;  1TWG A;  2VC9 A;  3ZC4 A;  4YL3 A;  2I15 A;  4HE8 D;  1FFT C;  4N6C A;  4F4B A;  3K1H A;  4BJ6 C;  2Y3B A;  2Q9B A;  3EH2 A;  3RQE A;  3X1O A;  4J30 B;  2MWQ A;  1WAT A;  1T9K A;  3HNL A;  1YYX A;  3RH3 A;  3W2W A;  3UMI A;  1QVX A;  3FAJ A;  2IOQ A;  1TWC A;  3NRH A;  3O6X A;  1A7D A;  5T3W A;  1M56 C;  1HMD A;  3LS1 A;  3A9C A;  3C7J A;  3LS0 A;  5T3T A;  2JX0 A;  3SYN A;  5KYN A;  1Q0D A;  1H9T A;  2PFD A;  1SF8 A;  3MLG A;  4GYT A;  2XS8 A;  4N4W A;  1V74 B;  2AWY A;  5AC5 A;  4MVZ A;  2LFF A;  1Z7Q c;  3TJ5 A;  2CNW D;  3NYM A;  1ZZP A;  3W8I A;  1HY5 A;  3WG7 C;  5A6B D;  5F5F A;  1TR2 A;  2B0H A;  1EA8 A;  3KKB A;  4YT8 A;  4CS9 C;  3X2Q C;  4EWC A;  4XEK A;  5L0I A;  2EIK C;  1K04 A;  3RVZ A;  1C03 A;  3GEE A;  1HW1 A;  4JUR I;  5CI8 A;  1V4A A;  1V55 C;  2CDQ A;  4PJM A;  3AQB A;  4JE9 A;  1EQ1 A;  1JPN A;  4JC7 A;  2YL1 A;  3GWN A;  3F46 A;  1LM3 B;  1CPR A;  2I8B A;  4MVO A;  2CCY A;  2G62 A;  2ASR A;  3OWT A;  1AEP A;  1YVI A;  4OIN F;  1T5O A;  3MYI A;  3ITF A;  3K33 A;  5B1A C;  5A6K A;  5L3Q A;  1HMO A;  2NUP B;  1U0B B;  1EKY A;  4MQ9 F;  1SYQ A;  3DI5 A;  4DBR A;  5KYW A;  2R9R B;  1KU2 A;  2XSE A;  1YZC A;  2NUP A;  3C8Z A;  3V5Y A;  4JW1 A;  2J8W A;  1VYK A;  3ABK C;  1ZYR F;  4J7T A;  1YA9 A;  2KGO A;  3I5P A;  3W8H A;  2YWA A;  3B0V C;  4BJ1 A;  1Q0M A;  1W2W A;  1BR4 A;  4I1M A;  1YAR O;  3EGX A;  2H8A A;  4CDV A;  5DS6 A;  4XLN F;  4MTF A;  1OXB A;  2QE9 A;  4XPX A;  5E3C A;  4U5E E;  3SXZ A;  3T6J A;  2HJ3 A;  4JCH A;  2VCC A;  5KYX B;  4UDV A;  4BJ5 A;  1KNY A;  2OG2 A;  1ZHW A;  2DB4 A;  1FNT c;  3JYH A;  2NUT A;  5KYX A;  4MS2 A;  4AX2 A;  1OR3 A;  4MVR A;  3PHF 2;  3L34 A;  4P9T A;  1OW8 A;  2B0J A;  3EHM A;  1WN0 A;  2V26 A;  1JMW A;  1YLM A;  1O87 A;  1BBH A;  2Y3G A;  3ABL C;  5HV9 A;  1NG1 A;  2YKZ A;  4BEM J;  3UGP A;  4DRI B;  1VYI A;  2AU5 A;  3IQC A;  2X0C A;  2CW0 F;  3O55 A;  3VYW A;  3JRT A;  1IZM A;  3H65 A;  3M4B A;  4JRZ A;  4Z9J A;  2J7P D;  1ZU5 A;  2R7U A;  4CJO A;  4AE4 A;  3CZ6 A;  1FR0 A;  1Z3I X;  3E70 C;  2Y3H A;  3M79 A;  3SP1 A;  1T6Q A;  4OD4 A;  4M63 A;  3JCU Q;  3IHU A;  1T01 A;  4R32 A;  4GEH A;  3O10 A;  2KC3 A;  3HJC A;  2EIM C;  4JZA A;  1A7V A;  3N24 A;  1QPU A;  3EJN A;  3SZR A;  2IBF A;  2WZG A;  4WGY A;  3HNJ A;  2EPK X;  3NDB B;  4XPW A;  1HE9 A;  1BZ4 A;  2IYL D;  3BEH A;  1EI7 A;  3NG1 A;  1N1C A;  1MMG A;  3M15 A;  4HFK B;  5JT4 A;  5L0J A;  3JT1 A;  2H7V C;  1VTM P;  2EPN A;  4IRU A;  2QUP A;  3B71 A;  1CGM E;  1FAP B;  1V54 C;  3B29 A;  4P6I C;  3I4U A;  4AK9 A;  3OEO A;  1M6T A;  1M2V A;  2YL7 A;  3MX3 A;  2J9B A;  4LER A;  3W2V A;  1Q0F A;  4E0I A;  2Y39 A;  3U8V A;  3WAQ A;  2R7V A;  2OKU A;  3KYJ A;  2WVN A;  3EG9 A;  2IXM A;  2R7T A;  4ULW A;  4A4A A;  4E0H A;  1QLE C;  1FFH A;  2P61 A;  4NTB A;  4PR9 A;  3V7O A;  3TOM A;  4MTO A;  4LDK A;  2EIJ C;  1YZA A;  5KYY B;  2P6V A;  1OR2 A;  1RJ9 B;  4PJL A;  3C8G B;  2GWW A;  2WVO A;  2DI3 A;  2HFI A;  5KYY A;  2Q4F A;  2OQM A;  5DS4 A;  2H7B A;  2LP4 A;  3NYJ A;  2J0X A;  2MYS A;  1RKE A;  3FHD A;  5IY5 C;  2KJG A;  5BUO A;  2HJM A;  4CSA C;  3GOR A;  5KYU B;  1BR2 A;  2R25 A;  4Z9H A;  2J45 A;  3ZQY A;  3TJ6 A;  4NCQ A;  2HSQ A;  2A6E F;  3OA1 A;  4EBB A;  3J06 A;  2J9U A;  2XLM A;  1C02 A;  3HNI A;  3T4R A;  4DXW A;  2AWC A;  3QVY A;  1G5Z A;  4O79 A;  4CSA A;  4MW8 A;  1MMD A;  3R2P A;  4LAC B;  4YL0 A;  4HEA J;  2XS1 A;  3IPM O;  3GM1 A;  4EIY A;  1OXK A;  2QY9 A;  2W4B A;  5DQZ A;  4ZLC A;  4JTD B;  3UGO A;  4EBJ A;  1GQA A;  1XWJ A;  3FOO A;  4G7H F;  4I44 A;  2C03 A;  3WHN A;  2HUJ A;  3EZI A;  3POV A;  4IAR A;  4MND A;  3T9O A;  3K1I C;  3FMS A;  3ZDL A;  1TWA A;  3AGT A;  4JCZ A;  1CGO A;  4YT4 A;  1WTY A;  2YEV A;  4JEB A;  2EPO A;  3JZ0 A;  3RIP A;  1ZHY A;  2HMQ A;  2ZXO A;  4FES A;  4U5C E;  3CAX A;  3U9J A;  3S9O A;  4DBQ A;  3C18 A;  3EPV A;  1OQC A;  3F47 A;  2GFH A;  4IWB A;  2EPL X;  5AGF A;  3ASN C;  3K1I A;  3R7C A;  1LE2 A;  1QSP A;  3FXH A;  4JVS A;  4C3E A;  4FWV A;  2OCC C;  2IM8 A;  3FAP B;  3U2M A;  3O39 A;  5F5H A;  2XXA B;  3LLK A;  3QZC A;  1SZI A;  2QTV A;  3GOD A;  5L0H A;  4DRJ B;  3CQZ A;  4LLC A;  5AC4 A;  5EGY A;  4B6I A;  5FCL A;  4BJT A;  3GWL A;  1H6G A;  2AP3 A;  3FVY A;  2PBE A;  3DAG A;  5A69 A;  3IEE A;  4IAQ A;  1OCR C;  4RD9 A;  4J7Y A;  2A1D D;  5JP7 A;  1ZW2 A;  2LD6 A;  3DWW A;  3MYF A;  3KMI A;  4EKW A;  1RMV A;  1RXQ A;  2ZXR A;  3JRM O;  5F28 E;  1FTS A;  4ER9 A;  1BR1 A;  3B0U X;  1NFN A;  2P0N A;  3U9M A;  3SEO A;  4PFO A;  3S28 A;  2HMZ A;  1HW2 A;  3NMI A;  3FOP A;  4BJ5 C;  1E2X A;  1LPE A;  4YT2 A;  4ZLD A;  4RDA A;  1ZHT A;  1MND A;  1LVK A;  2LIG A;  3JYY A;  4MTG A;  2UUH A;  2LFD A;  1A0B A;  1NSG B;  3G50 A;  1D0X A;  3LEV A;  3RYL A;  2M4E A;  4U9D A;  2GA0 A;  3G4X A;  4BG0 A;  1LI5 A;  3S0X A;  1A7E A;  2V3C C;  4K7B A;  1O5H A;  3LUT B;  4KC9 A;  1I5N A;  4WAB A;  1VK5 A;  4JJF A;  2XRH A;  4C3B A;  4DVY P;  2L6H A;  1TFK B;  3MFN A;  3S90 A;  3HKK A;  4KNW A;  2RD9 A;  3ZSU A;  1NZE A;  4ONS A;  2ZD9 A;  4P9F A;  2NG1 A;  3Q7L A;  4MVS A;  1S05 A;  3DKA A;  4U5D E;  2EIN C;  3QTH A;  2F22 A;  2WVQ A;  3QW0 A;  1NFO A;  2LCH A;  1Z5Z A;  4DJ9 A;  3AG4 C;  4OIR F;  2PF4 E;  1Q0K A;  2W9Y A;  4AL0 A;  3ZWI A;  1A41 A;  1CGN A;  4MW3 A;  1ZHX A;  2TMV P;  3AG1 C;  2Q9A A;  2HV7 A;  1OKK A;  1WOL A;  3SXM A;  1MQV A;  3IQ5 A;  4W8K A;  2NPU A;  3AOU A;  4MVM A;  2J9V A; 
#chains in the Genus database with same CATH homology
 5TJ5 E;  2DB4 A;  2BL2 A;  4BEM J;  3AOU A;  2CYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...