2DB4A

Crystal structure of rotor ring with dccd of the v- atpase from enterococcus hirae
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
156
structure length
156
Chain Sequence
MMDYLITQNGGMVFAVLAMATATIFSGIGSAKGVGMTGEAAAALTTSQPEKFGQALILQLLPGTQGLYGFVIAFLIFINLGSDMSVVQGLNFLGASLPIAFTGLFSGIAQGKVAAAGIQILAKKPEHATKGIIFAAMVETYAILGFVISFLLVLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V-Type Sodium ATPase Subunit K
publication title Structure of the rotor ring modified with N,N'-dicyclohexylcarbodiimide of the Na+-transporting vacuolar ATPase.
pubmed doi rcsb
source organism Enterococcus hirae
molecule tags Hydrolase
total genus 71
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00137 ATP-synt_C ATP synthase subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) lithium bound rotor ring of v- atpase 2db4A00
4BEMJ 5TJ5E 3AOUA 2CYDA 2BL2A 2DB4A
chains in the Genus database with same CATH superfamily
3NMIA 1AVOB 4N6CA 3AG2C 4NCQA 1DOVA 1HMOA 2Q4FA 3GWNA 2ETSA 2XLDA 3ATPA 4XPXA 4ZLDA 256BA 4E0HA 2X51A 1OKKD 3IHUA 4GQHA 4CX9A 3G50A 4DBRA 3ZQYA 4MVSA 1XZQA 4CS9C 3J06A 2KNHA 2ICWG 1D1BA 2CNWD 2KC3A 3AG4C 2GA0A 2HMZA 5T3WA 2QTVA 3AJMA 2LCHA 4H54A 4XTKA 4B6IA 1C03A 1CGOA 2XLEA 3LEOA 1T6IA 2J8WA 4P6IC 5L3VA 2D5RB 2M4EA 1ZZPA 1HY5A 1NG1A 2L6HA 2V3CC 5JT4A 1I4ZA 1VMAA 2EINC 3U3FA 1U0BB 2XXAA 1RXQA 3EGXB 1SMYF 1RJ9B 3L0IA 2P7VA 4NY3A 2XLVA 4W8KA 3K7DA 3TQOA 1LE2A 1O87A 2E87A 1Y6DA 1BDJB 3RFYA 2EPMX 3QW1A 2A0BA 2GDCA 2XL6A 3R2PA 4JTDB 3EHNA 1KNYA 1I5NA 1ZHZA 4G78A 4CSAC 2EILC 2HMQA 4EKWA 1QZXA 5E3AA 4JKVA 1E2XA 1NSGB 4I1MA 4FAPB 4NC3A 2H7VC 1NU9C 3E9VA 3C18A 2V26A 2OQMA 4H4KC 4PFPA 1K40A 3POVA 3EFOA 1H9TA 1Q0MA 2XM4A 1VYIA 2R7RA 1ORJA 3U8VA 2LQGA 2P61A 3FOOA 2KQ9A 2YQYA 2PBEA 3IEEA 4CBEA 5DS4A 3B0PA 2DYRC 4R32A 4C3BA 1A0BA 5KYUB 3MYIA 3UR3C 2NSFA 3K1HA 5E3CA 1PD1A 1G8XA 2YL0A 2YLDA 4HE8D 4U5DE 3OA1A 3SXKA 5KYYB 2C03A 4C3DA 3QZCA 4MTGA 2OG2A 4EHPA 2EIJC 3R7CA 4XEFA 1O3UA 4P9FA 2AWCA 2LP4A 4XLNF 3LS0A 2A68F 3FOPA 5A6JA 5FCLA 3GEEA 4K7BA 4Z9IA 1Z7Qc 1GS9A 1EA8A 1MNEA 3H2VA 5A6AA 3JSZA 2HV7A 4OIOF 1O5HA 2OKUA 3ASOC 3DE8A 5JRAA 2H7BA 4U5GA 3PHF2 4YL1A 4ER9A 1YZCA 3U0CA 2HJ3A 3EQLF 5JP7A 3B71A 3Q6MA 1UG7A 5K0IA 1OW8A 3UGOA 3U2LA 4JE9A 2WZFA 3MLGA 4OINF 4BPMA 1LS1A 4I1OB 3SEOA 3NYJA 5F28E 1ZW2A 3DWWA 4KNWA 4JJFA 2R7VA 1V4AA 3GM2A 1F1MA 3JT1A 3ZDLA 1VYKA 2L6FA 3AGUA 1S05A 2M64A 3W2VA 4KI2A 1TR2A 4JEBA 2WZLA 3LLKA 5KYWA 4XEKA 1CGNA 2EPOA 1ZVZA 5L3QA 2XXAB 1G4US 2IXPA 1VTMP 3AOUA 4CJGA 3FHDA 4PK4A 4YT4A 2KGOA 1EKYA 3O55A 3U9JA 3B29A 3ZVRA 2Y3HA 2Y3DA 1WN0A 3UNGC 4HFKB 2QLAA 4CJOA 3T6GB 2ZXRA 4JZAA 1JR8A 4ANJA 3CAXA 2YVKA 1T6QA 1SR2A 2J7PA 2KYHA 5L0CA 3ZG1A 3T6BA 3TULA 2OEXA 3EFOB 3RVZA 1QLEC 4LERA 2PX0A 3GWLA 3NKEA 3JYHA 3RQFA 4U5CE 1T6UA 1XZPA 2YHSA 3WAQA 1MMDA 1S7ZA 3HTKC 3V5ZA 2IXNA 1OXBA 4JVSA 3OEOA 4NTAA 4O7GA 4AK9A 2RD9A 1B68A 1I4YA 1WTYA 1RKEA 3E70C 1U89A 2XS8A 3M4CA 4IRUA 4LDKA 2Q9AA 2FFHA 2QY9A 1HW1A 2XLMA 5CI8A 5KYUA 2NG1A 3C63A 1PCXA 4U5BE 3BEHA 1OXKA 3ITFA 1WGWA 2A1DD 5E33A 2PX3A 4CS8A 3NRHA 4Z9HA 3EZHA 3TOLA 2R7UA 3IQ5A 2IOQA 3EPVA 3IPMO 3DE9A 2BL2A 4ONSA 2GWWA 3DD7A 3JRMO 4JTCB 2C04A 4YT2A 2YEVA 4XLPF 3RQGA 1BZ4A 1TWGA 2R7OA 2YZSA 3ABMC 3O6XA 1LI5A 1OCZC 3AG1C 3CZ6A 1YYXA 2W45A 3GM3A 5BQGA 1AEPA 5L0IA 4BEJA 4PJLA 3S9OA 1M57C 1M2VB 4K1OA 4PJJA 2CW0F 1V55C 1RCPA 3QW0A 2YWAA 4PFOA 5AC4A 3ZSUA 2KW3C 4YJWA 5KYWB 3H2UA 4U9EA 1ZHWA 3EG9A 1YZAA 2DYSC 2H7OA 1SF8A 3U8PA 4J32B 2R25A 1GGQA 4FX5A 4U5HA 1YVIA 2LSEA 4O6MA 1L7CA 2F22A 3K66A 1TFOB 2XS1A 4KBLA 4J7TA 3WHNA 2AP3A 1JOGA 3AQCA 4CDVA 4DBQA 1R5ID 5AC5A 5EHHA 1D0YA 2IXOA 2OCCC 2XLHA 3NMJA 3NMKA 2J9BA 3T9OA 2YL3A 4E17A 2HSBA 4IJJA 1FFHA 1YARO 4YL3A 3CSKA 2R02A 2NPUA 3V5XA 4DVZA 1H9GA 2DGJA 3GEIA 1Q0GA 3US6A 4D4XA 1OCCC 4EUKB 3HJCA 3K1IA 4EBJA 1RKCA 1V54C 1QSPA 4N06A 4MVRA 4K0DA 5GPGB 4DRIB 4JTAB 2AWYA 2HV6A 4JCHA 4Q4ZF 1WWPA 2EIKC 2MYSA 2J9VA 3S29A 1QVXA 2CGEA 1SYQA 3C8GB 4Q5SF 4MTOA 4ZLCA 1C02A 3VF0A 1GM5A 3WG7C 2P6VA 1JRAA 5COMA 1HW2A 3RIPA 3KPHA 3W4YA 2HSQA 3ZTZA 5L0FA 2G62A 3NYMA 3Q6NA 3QTHA 3M1CB 2IBFA 4GYTA 5COGA 3SXZA 2R7QA 1T9KA 4JCZA 5B3IA 5TJ5E 3K6BA 5A6BD 1D0XA 3I5QA 3KYJA 3HNJA 3JSEO 3LEVA 4W8PA 4XPYA 1HE1A 4DXWA 1LVKA 1FR0A 2NUTA 3SYNA 1YLMA 2JPUA 3NG1A 4PJMA 1A7EA 2CCYA 3EHMA 5D92A 1FMVA 2QUPA 4RDAA 2P0NA 3VYWA 4BG0A 2A0UA 3FVYA 4KNVA 3C8GD 3TJ5A 2VB6A 4C7OA 3SNHA 2VC9A 4IAQA 1ZHYA 1G4WR 5T1DB 4I3MA 5KYXA 2OJQA 3RVYA 2R9RB 2X0CA 1OCRC 4FESA 2NUPA 4L6RA 2IXMA 3W2WA 5E2QA 2R03A 4NQFA 3ZIBA 3PCVA 4BJ6A 4U5FE 2CDQA 3G4ZA 2RSEB 4DRJB 1ORYA 3JYYA 2R7SA 5DVWA 4CDYA 2KK1A 5DS5A 2ZXOA 3AGTA 3KMIA 2Q3TA 1EI7A 2WZGA 2DI3A 3LUTB 1M56C 2LIGA 2Q00A 2BE5F 2EPNA 1K05A 3C7JA 3EGDA 1VLTA 4ULVA 4XPWA 3DZAA 4JURI 1TWHA 1A7DA 4EBBA 2OEVA 4BJ5A 1PV3A 2HUJA 2D4UA 5L0HA 4XQ1A 1D1CA 2UUHA 4I44A 4YL0A 3NDBB 4CDAA 4YWQA 1U6HA 5JSLA 3K33A 4A4AA 3UMKA 3T4RA 2J45A 4E7SA 2XRHA 4Q7CA 1NFNA 5JS5A 2R7TA 4LLEA 2W4BA 3LLIA 2R7WA 3DAFA 3B0UX 1KTMA 3DXJF 3GM1A 2R05A 3CQZA 3SXYA 1VK5A 3QVZA 3ECSA 5A6KA 1R4TA 4BJ1A 5COFA 2L6GA 2KSFA 3SP1A 1YJGA 4M63A 3M15A 4FWVA 4MW8A 5EK0A 1FTSA 3M4BA 1E83A 1RJ9A 1NFOA 1ORSC 3AG3C 1TFKB 2QNLA 4G0HA 4JW1A 4HFFB 1GQAA 2FAPB 3CEXA 1DOWA 4QI2A 4BEMJ 3UMHA 3M79A 2GFHA 1A41A 3IQ6A 3N0TA 3DJNB 5HV9A 1BR2A 2LFDA 3FAPB 1C17M 4IWBA 3W8IA 2YLIA 3IQTA 3ZC4A 1WOLA 1JPJA 1A7VA 1TWCA 3KL4A 2YL7A 2YRFA 5KYXB 3JZ0A 4JJGA 1TKNA 2B0HA 2J9UA 2NUPB 2L9JA 5DLJA 1QPUA 4E7ZA 3O39A 1MMGA 1NBBA 4LDQA 2O9XA 4MVMA 2XLOA 3ABKC 4J30B 4MS2A 4N4WA 3C62A 3MYFA 4CS9A 5KYYA 2HZ8A 2NSGA 1D0ZA 4CS8C 1FFTC 4MW3A 3T6JA 4MQ9F 3L8JA 1WATA 4UDVA 5F5HA 3HNLA 4JIOA 4P9TA 3X1OA 3MFNA 1OW6A 2I15A 3DM9B 2UUIA 2ZPAA 3FAJA 3EZIA 3KYIA 5B1AC 3V7OA 2ZXPA 5DS6A 1JMWA 2OOCA 4LDRA 4BJTA 1W2WA 5T3TA 5F5FA 2EPKX 2YKZA 1QKRA 1M2OA 1V74B 2TMVP 2QE9A 2G3VA 1HMDA 2R7XA 4O6YA 2L7AA 4CIPA 2EPLX 3S84A 1FMWA 2BC5A 4MVUA 1RMVA 1K04A 3VM6A 3DI5A 1NZEA 2VH3A 4XWJA 4DJ9A 4CSAA 2AU5A 4G7OF 3UGPA 5D91A 4EWCA 5B1BC 1OR3A 4YK5A 3RW0A 3PDMP 1LM3B 1Q0FA 4QI0A 1IW7F 1LE4A 3S0XA 1VLSA 2LD6A 2YLGA 3WODF 1OQCA 4JRZA 1Y4CA 3NYLA 4JEAA 3RKOF 1T01A 5EGYA 2LK4A 1RKEB 1FAPB 4KC9A 2Y39A 3GANA 2PNOA 3O10A 4LLCA 4MVQA 3RQEA 3UMIA 3QMKA 1PD0A 2XL8A 4Z9JA 2XL4A 3DAGA 4MVZA 3VRCA 1BBHA 4A2NB 1YDIA 4AE4A 4WJ0A 3GORA 3I4UA 1APCA 3EH1A 3U3BA 2J7PD 1ST6A 3B9QA 1CGME 4G7HF 3DMDA 1YYJA 1NLXA 4X0RA 3RYLA 3S90A 3A9CA 3L8IA 3HLZA 4YN0B 1VOMA 1Q0DA 3K1IC 1SZIA 1MMAA 4DRHB 1ZW3A 4RD9A 4E18A 1Z5ZA 2MWQA 3DM5A 1H7IA 2W9YA 5JUAA 1M6TA 2H8AA 3SZRA 2HFIA 1T5OA 4E0IA 1ZHTA 1ZU4A 2Y3BA 2ZXWC 3LJBA 4OIRF 3RF3A 3TD7A 1L3PA 4MTFA 5FZTA 1E84A 5L0GA 1Z3IX 3AQBA 2Q9CA 3L34A 4OIPF 4GEHA 5JVEA 2JX0A 4DOZA 1Z63A 2L81A 3JCUQ 1OR2A 2J0XA 1ZU5A 4J7YA 4OIQF 5IY5C 5CIVA 4N6HA 1UFBA 2YL1A 1YAUO 1EQ1A 2WVOA 1Z23A 2B0JA 5DQZA 4O6NA 5L0DA 3RH3A 1OKKA 1MMNA 3EG9B 1BR4A 3LNMB 3QVYA 5DQTA 1N1CA 3FMSA 1LIHA 2VCAA 3TJ6A 4PACA 4WGZA 3Q7GA 4G7ZF 2CNWA 2FGYA 3BRJA 3F46A 3U9MA 2PP4A 3LESA 3F47A 3X2QC 3IQCA 3ZWIA 4DVYP 3B0VC 5B3SC 1H6GA 1HE9A 3L1MA 2Q9BA 1J8MF 4F4BA 4HEAJ 1CPQA 4U9DA 1IZMA 2AVKA 1JPNA 2OJED 3DJUB 3C8ZA 1YA7O 3LNRA 3MBGA 4MNDA 3VAYA 5BQIA 1WASA 1J8YF 2A6HF 3LS1A 1E86A 1OW7A 2WVNA 1D1AA 2HS5A 4MVOA 4AL1A 4BJ6C 1M2VA 2I8BA 1G5ZA 3KKBA 2ASRA 2XLWA 3HNIA 2Y3GA 2GAQA 1Z6AA 3HNKA 3TOMA 2IM8A 4U5EE 4IGGA 2XM0A 4LACB 5BUOA 1YA9A 2EIMC 2WL8A 2Y69C 2MHRA 2VCCA 3A11A 1TQGA 2J46A 3EH2A 4JC7A 4WABA 3V5YA 4CIHA 1AUEA 1LPEA 3HKKA 3JRTA 3NKDA 4AE4B 4YT8A 1BR1A 2HKVA 4EBKA 1ZHXA 2DB4A 3ABLC 2P1AA 3OWTA 1LI7A 2JD3A 5AGFA 3U2MA 3EGXA 3W8HA 4BJ5C 4CS7A 4EIYA 1ZYRF 2VCBA 4IB4A 3TK0A 4AX2A 1VB5A 2J0WA 1OCOC 3JTLO 4IAOA 1MQVA 4NTFA 2A69F 5A69A 3EJNA 2ZD9A 3PMRA 3DKAA 3S27A 1FNTc 2G3KA 2A6EF 2XSEA 5CI9A 1XWJA 2NUTB 1LKXA 2WB7A 1LS4A 2VASA 3G4XA 3ZTMA 1E85A 5HSWA 4AL0A 2OU6A 2PFDA 4RBNA 5A6BA 2LFFA 1NU7D 3FXHA 2IYLD 2CYDA 2Z15A 3H65A 4QDLA 4C7OB 3KH2A 3GODA 4C3EA 3N24A 1KU2A 3ZQVA 4IARA 2WVQA 3LAYA 3C8GA 3GEHA 4ULWA 1TWAA 2W4MA 2KJGA 5JLIA 3I5PA 2PF4E 4PR9A 4PJNA 4WGYA 1QQ3A 5L0JA 2Q7RA 3Q7LA 1JAFA 5KYNA 5BQHA 3S28A 3N2ZB 4O79A 4D4NA 1CPRA 3U5SA 1MNDA 2HJMA 3SXMA 3ASNC 4NTBA 3EGDB 2J9WA 3MX3A 4OD5A 4XEVA 4YT5A 3FDQA 1Q0KA 4OD4A
chains in the Genus database with same CATH topology
4BEMJ 5TJ5E 3AOUA 2CYDA 2BL2A 2DB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BEM J;  5TJ5 E;  3AOU A;  2CYD A;  2BL2 A;  2DB4 A; 
#chains in the Genus database with same CATH topology
 3NMI A;  1AVO B;  4N6C A;  3AG2 C;  4NCQ A;  1DOV A;  1HMO A;  2Q4F A;  3GWN A;  2ETS A;  2XLD A;  3ATP A;  4XPX A;  4ZLD A;  256B A;  4E0H A;  2X51 A;  1OKK D;  3IHU A;  4GQH A;  4CX9 A;  3G50 A;  4DBR A;  3ZQY A;  4MVS A;  1XZQ A;  4CS9 C;  3J06 A;  2KNH A;  2ICW G;  1D1B A;  2CNW D;  2KC3 A;  3AG4 C;  2GA0 A;  2HMZ A;  5T3W A;  2QTV A;  3AJM A;  2LCH A;  4H54 A;  4XTK A;  4B6I A;  1C03 A;  1CGO A;  2XLE A;  3LEO A;  1T6I A;  2J8W A;  4P6I C;  5L3V A;  2D5R B;  2M4E A;  1ZZP A;  1HY5 A;  1NG1 A;  2L6H A;  2V3C C;  5JT4 A;  1I4Z A;  1VMA A;  2EIN C;  3U3F A;  1U0B B;  2XXA A;  1RXQ A;  3EGX B;  1SMY F;  1RJ9 B;  3L0I A;  2P7V A;  4NY3 A;  2XLV A;  4W8K A;  3K7D A;  3TQO A;  1LE2 A;  1O87 A;  2E87 A;  1Y6D A;  1BDJ B;  3RFY A;  2EPM X;  3QW1 A;  2A0B A;  2GDC A;  2XL6 A;  3R2P A;  4JTD B;  3EHN A;  1KNY A;  1I5N A;  1ZHZ A;  4G78 A;  4CSA C;  2EIL C;  2HMQ A;  4EKW A;  1QZX A;  5E3A A;  4JKV A;  1E2X A;  1NSG B;  4I1M A;  4FAP B;  4NC3 A;  2H7V C;  1NU9 C;  3E9V A;  3C18 A;  2V26 A;  2OQM A;  4H4K C;  4PFP A;  1K40 A;  3POV A;  3EFO A;  1H9T A;  1Q0M A;  2XM4 A;  1VYI A;  2R7R A;  1ORJ A;  3U8V A;  2LQG A;  2P61 A;  3FOO A;  2KQ9 A;  2YQY A;  2PBE A;  3IEE A;  4CBE A;  5DS4 A;  3B0P A;  2DYR C;  4R32 A;  4C3B A;  1A0B A;  5KYU B;  3MYI A;  3UR3 C;  2NSF A;  3K1H A;  5E3C A;  1PD1 A;  1G8X A;  2YL0 A;  2YLD A;  4HE8 D;  4U5D E;  3OA1 A;  3SXK A;  5KYY B;  2C03 A;  4C3D A;  3QZC A;  4MTG A;  2OG2 A;  4EHP A;  2EIJ C;  3R7C A;  4XEF A;  1O3U A;  4P9F A;  2AWC A;  2LP4 A;  4XLN F;  3LS0 A;  2A68 F;  3FOP A;  5A6J A;  5FCL A;  3GEE A;  4K7B A;  4Z9I A;  1Z7Q c;  1GS9 A;  1EA8 A;  1MNE A;  3H2V A;  5A6A A;  3JSZ A;  2HV7 A;  4OIO F;  1O5H A;  2OKU A;  3ASO C;  3DE8 A;  5JRA A;  2H7B A;  4U5G A;  3PHF 2;  4YL1 A;  4ER9 A;  1YZC A;  3U0C A;  2HJ3 A;  3EQL F;  5JP7 A;  3B71 A;  3Q6M A;  1UG7 A;  5K0I A;  1OW8 A;  3UGO A;  3U2L A;  4JE9 A;  2WZF A;  3MLG A;  4OIN F;  4BPM A;  1LS1 A;  4I1O B;  3SEO A;  3NYJ A;  5F28 E;  1ZW2 A;  3DWW A;  4KNW A;  4JJF A;  2R7V A;  1V4A A;  3GM2 A;  1F1M A;  3JT1 A;  3ZDL A;  1VYK A;  2L6F A;  3AGU A;  1S05 A;  2M64 A;  3W2V A;  4KI2 A;  1TR2 A;  4JEB A;  2WZL A;  3LLK A;  5KYW A;  4XEK A;  1CGN A;  2EPO A;  1ZVZ A;  5L3Q A;  2XXA B;  1G4U S;  2IXP A;  1VTM P;  3AOU A;  4CJG A;  3FHD A;  4PK4 A;  4YT4 A;  2KGO A;  1EKY A;  3O55 A;  3U9J A;  3B29 A;  3ZVR A;  2Y3H A;  2Y3D A;  1WN0 A;  3UNG C;  4HFK B;  2QLA A;  4CJO A;  3T6G B;  2ZXR A;  4JZA A;  1JR8 A;  4ANJ A;  3CAX A;  2YVK A;  1T6Q A;  1SR2 A;  2J7P A;  2KYH A;  5L0C A;  3ZG1 A;  3T6B A;  3TUL A;  2OEX A;  3EFO B;  3RVZ A;  1QLE C;  4LER A;  2PX0 A;  3GWL A;  3NKE A;  3JYH A;  3RQF A;  4U5C E;  1T6U A;  1XZP A;  2YHS A;  3WAQ A;  1MMD A;  1S7Z A;  3HTK C;  3V5Z A;  2IXN A;  1OXB A;  4JVS A;  3OEO A;  4NTA A;  4O7G A;  4AK9 A;  2RD9 A;  1B68 A;  1I4Y A;  1WTY A;  1RKE A;  3E70 C;  1U89 A;  2XS8 A;  3M4C A;  4IRU A;  4LDK A;  2Q9A A;  2FFH A;  2QY9 A;  1HW1 A;  2XLM A;  5CI8 A;  5KYU A;  2NG1 A;  3C63 A;  1PCX A;  4U5B E;  3BEH A;  1OXK A;  3ITF A;  1WGW A;  2A1D D;  5E33 A;  2PX3 A;  4CS8 A;  3NRH A;  4Z9H A;  3EZH A;  3TOL A;  2R7U A;  3IQ5 A;  2IOQ A;  3EPV A;  3IPM O;  3DE9 A;  2BL2 A;  4ONS A;  2GWW A;  3DD7 A;  3JRM O;  4JTC B;  2C04 A;  4YT2 A;  2YEV A;  4XLP F;  3RQG A;  1BZ4 A;  1TWG A;  2R7O A;  2YZS A;  3ABM C;  3O6X A;  1LI5 A;  1OCZ C;  3AG1 C;  3CZ6 A;  1YYX A;  2W45 A;  3GM3 A;  5BQG A;  1AEP A;  5L0I A;  4BEJ A;  4PJL A;  3S9O A;  1M57 C;  1M2V B;  4K1O A;  4PJJ A;  2CW0 F;  1V55 C;  1RCP A;  3QW0 A;  2YWA A;  4PFO A;  5AC4 A;  3ZSU A;  2KW3 C;  4YJW A;  5KYW B;  3H2U A;  4U9E A;  1ZHW A;  3EG9 A;  1YZA A;  2DYS C;  2H7O A;  1SF8 A;  3U8P A;  4J32 B;  2R25 A;  1GGQ A;  4FX5 A;  4U5H A;  1YVI A;  2LSE A;  4O6M A;  1L7C A;  2F22 A;  3K66 A;  1TFO B;  2XS1 A;  4KBL A;  4J7T A;  3WHN A;  2AP3 A;  1JOG A;  3AQC A;  4CDV A;  4DBQ A;  1R5I D;  5AC5 A;  5EHH A;  1D0Y A;  2IXO A;  2OCC C;  2XLH A;  3NMJ A;  3NMK A;  2J9B A;  3T9O A;  2YL3 A;  4E17 A;  2HSB A;  4IJJ A;  1FFH A;  1YAR O;  4YL3 A;  3CSK A;  2R02 A;  2NPU A;  3V5X A;  4DVZ A;  1H9G A;  2DGJ A;  3GEI A;  1Q0G A;  3US6 A;  4D4X A;  1OCC C;  4EUK B;  3HJC A;  3K1I A;  4EBJ A;  1RKC A;  1V54 C;  1QSP A;  4N06 A;  4MVR A;  4K0D A;  5GPG B;  4DRI B;  4JTA B;  2AWY A;  2HV6 A;  4JCH A;  4Q4Z F;  1WWP A;  2EIK C;  2MYS A;  2J9V A;  3S29 A;  1QVX A;  2CGE A;  1SYQ A;  3C8G B;  4Q5S F;  4MTO A;  4ZLC A;  1C02 A;  3VF0 A;  1GM5 A;  3WG7 C;  2P6V A;  1JRA A;  5COM A;  1HW2 A;  3RIP A;  3KPH A;  3W4Y A;  2HSQ A;  3ZTZ A;  5L0F A;  2G62 A;  3NYM A;  3Q6N A;  3QTH A;  3M1C B;  2IBF A;  4GYT A;  5COG A;  3SXZ A;  2R7Q A;  1T9K A;  4JCZ A;  5B3I A;  5TJ5 E;  3K6B A;  5A6B D;  1D0X A;  3I5Q A;  3KYJ A;  3HNJ A;  3JSE O;  3LEV A;  4W8P A;  4XPY A;  1HE1 A;  4DXW A;  1LVK A;  1FR0 A;  2NUT A;  3SYN A;  1YLM A;  2JPU A;  3NG1 A;  4PJM A;  1A7E A;  2CCY A;  3EHM A;  5D92 A;  1FMV A;  2QUP A;  4RDA A;  2P0N A;  3VYW A;  4BG0 A;  2A0U A;  3FVY A;  4KNV A;  3C8G D;  3TJ5 A;  2VB6 A;  4C7O A;  3SNH A;  2VC9 A;  4IAQ A;  1ZHY A;  1G4W R;  5T1D B;  4I3M A;  5KYX A;  2OJQ A;  3RVY A;  2R9R B;  2X0C A;  1OCR C;  4FES A;  2NUP A;  4L6R A;  2IXM A;  3W2W A;  5E2Q A;  2R03 A;  4NQF A;  3ZIB A;  3PCV A;  4BJ6 A;  4U5F E;  2CDQ A;  3G4Z A;  2RSE B;  4DRJ B;  1ORY A;  3JYY A;  2R7S A;  5DVW A;  4CDY A;  2KK1 A;  5DS5 A;  2ZXO A;  3AGT A;  3KMI A;  2Q3T A;  1EI7 A;  2WZG A;  2DI3 A;  3LUT B;  1M56 C;  2LIG A;  2Q00 A;  2BE5 F;  2EPN A;  1K05 A;  3C7J A;  3EGD A;  1VLT A;  4ULV A;  4XPW A;  3DZA A;  4JUR I;  1TWH A;  1A7D A;  4EBB A;  2OEV A;  4BJ5 A;  1PV3 A;  2HUJ A;  2D4U A;  5L0H A;  4XQ1 A;  1D1C A;  2UUH A;  4I44 A;  4YL0 A;  3NDB B;  4CDA A;  4YWQ A;  1U6H A;  5JSL A;  3K33 A;  4A4A A;  3UMK A;  3T4R A;  2J45 A;  4E7S A;  2XRH A;  4Q7C A;  1NFN A;  5JS5 A;  2R7T A;  4LLE A;  2W4B A;  3LLI A;  2R7W A;  3DAF A;  3B0U X;  1KTM A;  3DXJ F;  3GM1 A;  2R05 A;  3CQZ A;  3SXY A;  1VK5 A;  3QVZ A;  3ECS A;  5A6K A;  1R4T A;  4BJ1 A;  5COF A;  2L6G A;  2KSF A;  3SP1 A;  1YJG A;  4M63 A;  3M15 A;  4FWV A;  4MW8 A;  5EK0 A;  1FTS A;  3M4B A;  1E83 A;  1RJ9 A;  1NFO A;  1ORS C;  3AG3 C;  1TFK B;  2QNL A;  4G0H A;  4JW1 A;  4HFF B;  1GQA A;  2FAP B;  3CEX A;  1DOW A;  4QI2 A;  4BEM J;  3UMH A;  3M79 A;  2GFH A;  1A41 A;  3IQ6 A;  3N0T A;  3DJN B;  5HV9 A;  1BR2 A;  2LFD A;  3FAP B;  1C17 M;  4IWB A;  3W8I A;  2YLI A;  3IQT A;  3ZC4 A;  1WOL A;  1JPJ A;  1A7V A;  1TWC A;  3KL4 A;  2YL7 A;  2YRF A;  5KYX B;  3JZ0 A;  4JJG A;  1TKN A;  2B0H A;  2J9U A;  2NUP B;  2L9J A;  5DLJ A;  1QPU A;  4E7Z A;  3O39 A;  1MMG A;  1NBB A;  4LDQ A;  2O9X A;  4MVM A;  2XLO A;  3ABK C;  4J30 B;  4MS2 A;  4N4W A;  3C62 A;  3MYF A;  4CS9 A;  5KYY A;  2HZ8 A;  2NSG A;  1D0Z A;  4CS8 C;  1FFT C;  4MW3 A;  3T6J A;  4MQ9 F;  3L8J A;  1WAT A;  4UDV A;  5F5H A;  3HNL A;  4JIO A;  4P9T A;  3X1O A;  3MFN A;  1OW6 A;  2I15 A;  3DM9 B;  2UUI A;  2ZPA A;  3FAJ A;  3EZI A;  3KYI A;  5B1A C;  3V7O A;  2ZXP A;  5DS6 A;  1JMW A;  2OOC A;  4LDR A;  4BJT A;  1W2W A;  5T3T A;  5F5F A;  2EPK X;  2YKZ A;  1QKR A;  1M2O A;  1V74 B;  2TMV P;  2QE9 A;  2G3V A;  1HMD A;  2R7X A;  4O6Y A;  2L7A A;  4CIP A;  2EPL X;  3S84 A;  1FMW A;  2BC5 A;  4MVU A;  1RMV A;  1K04 A;  3VM6 A;  3DI5 A;  1NZE A;  2VH3 A;  4XWJ A;  4DJ9 A;  4CSA A;  2AU5 A;  4G7O F;  3UGP A;  5D91 A;  4EWC A;  5B1B C;  1OR3 A;  4YK5 A;  3RW0 A;  3PDM P;  1LM3 B;  1Q0F A;  4QI0 A;  1IW7 F;  1LE4 A;  3S0X A;  1VLS A;  2LD6 A;  2YLG A;  3WOD F;  1OQC A;  4JRZ A;  1Y4C A;  3NYL A;  4JEA A;  3RKO F;  1T01 A;  5EGY A;  2LK4 A;  1RKE B;  1FAP B;  4KC9 A;  2Y39 A;  3GAN A;  2PNO A;  3O10 A;  4LLC A;  4MVQ A;  3RQE A;  3UMI A;  3QMK A;  1PD0 A;  2XL8 A;  4Z9J A;  2XL4 A;  3DAG A;  4MVZ A;  3VRC A;  1BBH A;  4A2N B;  1YDI A;  4AE4 A;  4WJ0 A;  3GOR A;  3I4U A;  1APC A;  3EH1 A;  3U3B A;  2J7P D;  1ST6 A;  3B9Q A;  1CGM E;  4G7H F;  3DMD A;  1YYJ A;  1NLX A;  4X0R A;  3RYL A;  3S90 A;  3A9C A;  3L8I A;  3HLZ A;  4YN0 B;  1VOM A;  1Q0D A;  3K1I C;  1SZI A;  1MMA A;  4DRH B;  1ZW3 A;  4RD9 A;  4E18 A;  1Z5Z A;  2MWQ A;  3DM5 A;  1H7I A;  2W9Y A;  5JUA A;  1M6T A;  2H8A A;  3SZR A;  2HFI A;  1T5O A;  4E0I A;  1ZHT A;  1ZU4 A;  2Y3B A;  2ZXW C;  3LJB A;  4OIR F;  3RF3 A;  3TD7 A;  1L3P A;  4MTF A;  5FZT A;  1E84 A;  5L0G A;  1Z3I X;  3AQB A;  2Q9C A;  3L34 A;  4OIP F;  4GEH A;  5JVE A;  2JX0 A;  4DOZ A;  1Z63 A;  2L81 A;  3JCU Q;  1OR2 A;  2J0X A;  1ZU5 A;  4J7Y A;  4OIQ F;  5IY5 C;  5CIV A;  4N6H A;  1UFB A;  2YL1 A;  1YAU O;  1EQ1 A;  2WVO A;  1Z23 A;  2B0J A;  5DQZ A;  4O6N A;  5L0D A;  3RH3 A;  1OKK A;  1MMN A;  3EG9 B;  1BR4 A;  3LNM B;  3QVY A;  5DQT A;  1N1C A;  3FMS A;  1LIH A;  2VCA A;  3TJ6 A;  4PAC A;  4WGZ A;  3Q7G A;  4G7Z F;  2CNW A;  2FGY A;  3BRJ A;  3F46 A;  3U9M A;  2PP4 A;  3LES A;  3F47 A;  3X2Q C;  3IQC A;  3ZWI A;  4DVY P;  3B0V C;  5B3S C;  1H6G A;  1HE9 A;  3L1M A;  2Q9B A;  1J8M F;  4F4B A;  4HEA J;  1CPQ A;  4U9D A;  1IZM A;  2AVK A;  1JPN A;  2OJE D;  3DJU B;  3C8Z A;  1YA7 O;  3LNR A;  3MBG A;  4MND A;  3VAY A;  5BQI A;  1WAS A;  1J8Y F;  2A6H F;  3LS1 A;  1E86 A;  1OW7 A;  2WVN A;  1D1A A;  2HS5 A;  4MVO A;  4AL1 A;  4BJ6 C;  1M2V A;  2I8B A;  1G5Z A;  3KKB A;  2ASR A;  2XLW A;  3HNI A;  2Y3G A;  2GAQ A;  1Z6A A;  3HNK A;  3TOM A;  2IM8 A;  4U5E E;  4IGG A;  2XM0 A;  4LAC B;  5BUO A;  1YA9 A;  2EIM C;  2WL8 A;  2Y69 C;  2MHR A;  2VCC A;  3A11 A;  1TQG A;  2J46 A;  3EH2 A;  4JC7 A;  4WAB A;  3V5Y A;  4CIH A;  1AUE A;  1LPE A;  3HKK A;  3JRT A;  3NKD A;  4AE4 B;  4YT8 A;  1BR1 A;  2HKV A;  4EBK A;  1ZHX A;  2DB4 A;  3ABL C;  2P1A A;  3OWT A;  1LI7 A;  2JD3 A;  5AGF A;  3U2M A;  3EGX A;  3W8H A;  4BJ5 C;  4CS7 A;  4EIY A;  1ZYR F;  2VCB A;  4IB4 A;  3TK0 A;  4AX2 A;  1VB5 A;  2J0W A;  1OCO C;  3JTL O;  4IAO A;  1MQV A;  4NTF A;  2A69 F;  5A69 A;  3EJN A;  2ZD9 A;  3PMR A;  3DKA A;  3S27 A;  1FNT c;  2G3K A;  2A6E F;  2XSE A;  5CI9 A;  1XWJ A;  2NUT B;  1LKX A;  2WB7 A;  1LS4 A;  2VAS A;  3G4X A;  3ZTM A;  1E85 A;  5HSW A;  4AL0 A;  2OU6 A;  2PFD A;  4RBN A;  5A6B A;  2LFF A;  1NU7 D;  3FXH A;  2IYL D;  2CYD A;  2Z15 A;  3H65 A;  4QDL A;  4C7O B;  3KH2 A;  3GOD A;  4C3E A;  3N24 A;  1KU2 A;  3ZQV A;  4IAR A;  2WVQ A;  3LAY A;  3C8G A;  3GEH A;  4ULW A;  1TWA A;  2W4M A;  2KJG A;  5JLI A;  3I5P A;  2PF4 E;  4PR9 A;  4PJN A;  4WGY A;  1QQ3 A;  5L0J A;  2Q7R A;  3Q7L A;  1JAF A;  5KYN A;  5BQH A;  3S28 A;  3N2Z B;  4O79 A;  4D4N A;  1CPR A;  3U5S A;  1MND A;  2HJM A;  3SXM A;  3ASN C;  4NTB A;  3EGD B;  2J9W A;  3MX3 A;  4OD5 A;  4XEV A;  4YT5 A;  3FDQ A;  1Q0K A;  4OD4 A; 
#chains in the Genus database with same CATH homology
 4BEM J;  5TJ5 E;  3AOU A;  2CYD A;  2BL2 A;  2DB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...