2DB4A

Crystal structure of rotor ring with dccd of the v- atpase from enterococcus hirae
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
156
structure length
156
Chain Sequence
MMDYLITQNGGMVFAVLAMATATIFSGIGSAKGVGMTGEAAAALTTSQPEKFGQALILQLLPGTQGLYGFVIAFLIFINLGSDMSVVQGLNFLGASLPIAFTGLFSGIAQGKVAAAGIQILAKKPEHATKGIIFAAMVETYAILGFVISFLLVLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords V-Type Sodium ATPase Subunit K
publication title Structure of the rotor ring modified with N,N'-dicyclohexylcarbodiimide of the Na+-transporting vacuolar ATPase.
pubmed doi rcsb
source organism Enterococcus hirae
total genus 71
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00137 ATP-synt_C ATP synthase subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) lithium bound rotor ring of v- atpase 2db4A00
2DB4A 2BL2A 4BEMJ 2CYDA 3AOUA 5TJ5E
chains in the Genus database with same CATH superfamily
3AGUA 3NMJA 2H7BA 2IXNA 2BC5A 1APCA 5D91A 4JZAA 4DRIB 2ZD9A 5CI9A 4NQFA 2EILC 2KSFA 4Q7CA 1Y6DA 2L6FA 2XLOA 4CS8A 3O55A 4OD4A 2R7QA 5DLJA 1YARO 2H7VC 1NSGB 2A1DD 1QVXA 2Q00A 1MMGA 3MLGA 5B3IA 4RDAA 4CSAC 3KH2A 2D5RB 3UMIA 1D0XA 3A11A 3ZTZA 3N24A 2XL8A 2IBFA 4I1OB 3TJ6A 4A2NB 4MW3A 2DGJA 3AG2C 3DAGA 4JIOA 1SYQA 5JLIA 1XZPA 4AK9A 1Q0GA 5AC5A 5JUAA 4H4KC 2KNHA 3ASNC 3GEIA 5A6BD 2XLHA 4PJLA 2MWQA 4DVYP 4QI2A 4O79A 4EWCA 4NTBA 4IB4A 4YL1A 1EA8A 2A68F 2EINC 5KYXB 3B0VC 2DYSC 1FAPB 2WL8A 4MVMA 4EBKA 4Z9IA 3U9MA 5L0JA 1HMDA 4LDRA 4Q5SF 3RF3A 4BPMA 1JOGA 5EGYA 1U0BB 2CW0F 3I5QA 1NFNA 1OW8A 3KYJA 4JVSA 3CSKA 3EHNA 1CGNA 2HKVA 5AC4A 4KC9A 1WN0A 1RJ9A 1ZW2A 4KBLA 1TWGA 1GQAA 1YAUO 2JPUA 3ITFA 3QZCA 3S9OA 3NMKA 1AVOB 1JMWA 1ORSC 4WGZA 5B1BC 3U2LA 5IY5C 4FESA 3EJNA 1T6QA 3LNRA 1D1AA 1WTYA 3C63A 3M1CB 1NG1A 4DXWA 2IM8A 1PD0A 2A69F 4OIOF 2P1AA 2Q9AA 3LLKA 4OINF 5KYYA 1ZHWA 3V5YA 4O6YA 4E0HA 1YZCA 3RIPA 2ETSA 1BR2A 1M2VA 1NLXA 2EIKC 1VOMA 1M6TA 2KC3A 2OKUA 3ABKC 3IQ6A 1EI7A 4IWBA 3AG4C 3VRCA 3K1HA 2I15A 2NPUA 2PX0A 2BL2A 1YJGA 3MX3A 2NUPB 1FFHA 3FXHA 3NKDA 1NFOA 2A6HF 1LI7A 4U5DE 4C3BA 2P6VA 3VM6A 2L9JA 2A6EF 1LS4A 3L0IA 4E17A 3T4RA 4BG0A 3KPHA 1A7DA 1NBBA 1QKRA 4CBEA 3LAYA 5EHHA 2KJGA 1C02A 5DQTA 1D1BA 2UUHA 3LESA 1B68A 1S05A 3EPVA 4FWVA 4E7ZA 3BEHA 3Q7GA 4JE9A 5JS5A 3ASOC 1J8YF 2J9BA 3S84A 2YHSA 4HEAJ 2XLWA 2LD6A 3GODA 3C7JA 3IQ5A 1SMYF 4MW8A 1RXQA 1A7VA 3MYIA 5K0IA 2AVKA 2AU5A 5KYUA 3ZQYA 5A6KA 3LEVA 1MMAA 4O6NA 1ZW3A 3ZTMA 4MTFA 2XSEA 3GM3A 3SXKA 3TK0A 1Z63A 3JSZA 5E2QA 1BZ4A 2NSFA 3U8PA 3ZIBA 2R7TA 3C8ZA 4DRJB 3FAJA 4KI2A 3EZHA 3G4XA 4HFFB 4YL3A 2Y39A 1BR4A 4JJGA 4DVZA 4JEAA 4U5FE 4CJOA 4XPXA 4AE4B 4N6CA 4GYTA 5D92A 4IAOA 5B3SC 3S90A 1Y4CA 3CEXA 4G78A 1CPRA 1HE9A 1VYKA 4KNWA 1OCOC 1WGWA 4OIPF 3LEOA 3U0CA 1V74B 1G4WR 1YYXA 2ZXPA 4JC7A 4O7GA 2KYHA 1AUEA 2V3CC 1N1CA 4E18A 5L0FA 3ZSUA 1TQGA 3QVZA 2PP4A 1S7ZA 1WATA 2H7OA 1CPQA 3HTKC 1OXKA 4CJGA 1T9KA 2PF4E 4PACA 4CS9A 1IW7F 1WASA 2YLGA 2Q3TA 3DJUB 3UR3C 2Y3HA 3AGTA 2XS8A 3EQLF 1GGQA 1Q0DA 2LP4A 3EGXA 5A6BA 4PJMA 4CSAA 5L0IA 4LDQA 3NDBB 4JJFA 3HNJA 3VYWA 3AQBA 4GEHA 1C17M 2V26A 3C18A 3CAXA 3LS0A 2YL7A 4BJ6C 4EUKB 4MQ9F 1Z23A 4G7ZF 1ZVZA 2F22A 2ICWG 4JTDB 3K7DA 3WAQA 3PMRA 2B0HA 3U3FA 4YWQA 3T9OA 5E33A 3LLIA 1FNTc 1ZHTA 3QTHA 2CYDA 1I5NA 1V55C 4K1OA 5BQGA 5JRAA 5L0GA 2TMVP 2QY9A 1PCXA 1TWAA 1RKEB 2L6GA 5TJ5E 3EGDB 3HNLA 3IQTA 2PFDA 2KW3C 4WGYA 4XEKA 3SXMA 3T6GB 3QMKA 3TJ5A 1ORYA 4MVUA 4BJ1A 1ZHXA 4J7TA 3U3BA 5F5FA 5CI8A 4C3EA 3VAYA 2L81A 1ZZPA 1QQ3A 3FDQA 1VTMP 2KQ9A 4I1MA 3TQOA 3GEEA 3S27A 3GANA 4DBRA 1OXBA 5JP7A 3AOUA 4PFOA 5HV9A 5F28E 3WODF 2DYRC 1ORJA 3N0TA 1LPEA 2WB7A 1TKNA 3QW0A 1NU7D 4RBNA 4BJ5A 5JSLA 4MVQA 3H2UA 1I4ZA 5KYWB 1E83A 2L6HA 2R7WA 1LKXA 1O87A 3ZWIA 3F47A 5FCLA 2HJMA 4YT2A 1HW1A 4DJ9A 3NYLA 1ZU5A 3DWWA 1YDIA 3C62A 1MMDA 1V4AA 2OEXA 3SYNA 4CS7A 1O3UA 4ANJA 1OQCA 2FGYA 2RD9A 5HSWA 5B1AC 2ASRA 5JT4A 4PFPA 3M4BA 3GWLA 2NSGA 3M4CA 3TD7A 3S0XA 3M15A 1E86A 1YA7O 1LI5A 1K05A 2EPNA 3F46A 5KYNA 1OCZC 3ZDLA 1K40A 2YQYA 3SXYA 3K1IC 1HY5A 4YT4A 2OJQA 1I4YA 4CDYA 2VCAA 2C04A 1D1CA 3HNIA 4XPYA 4EKWA 2GWWA 5T1DB 1OKKA 3JRMO 2CCYA 4I3MA 1NU9C 3TULA 2YL3A 1H9GA 2P7VA 2HUJA 5JVEA 2X51A 3WHNA 2IOQA 2J9UA 4XEFA 1Q0KA 3JCUQ 1AEPA 3B9QA 2XL4A 2WZLA 4JEBA 1T5OA 2HS5A 2JX0A 1Z7Qc 2XLEA 2OU6A 2Z15A 2EPLX 2HMQA 4Z9JA 4B6IA 3J06A 4C7OB 1VLSA 3O10A 4MS2A 2Q9CA 1MNDA 1VMAA 3B0PA 3PCVA 4N4WA 3HLZA 1E84A 1E2XA 4IGGA 2OG2A 3E70C 2HSBA 4OD5A 1LE2A 3UNGC 4XLNF 2NUTB 3FHDA 1SR2A 1IZMA 1PV3A 2YL0A 3MFNA 2LSEA 4W8PA 4AE4A 5AGFA 2X0CA 3RFYA 4D4NA 4C3DA 1BDJB 4ONSA 4DRHB 1VB5A 2XM4A 4JKVA 4CDVA 2OQMA 3RYLA 3IQCA 5L3VA 2P61A 3JYYA 1MQVA 4P9TA 1V54C 1FMVA 1TWHA 1H9TA 3G50A 5DQZA 2Q9BA 4NC3A 3W2VA 1G5ZA 4IARA 1VK5A 5BUOA 5EK0A 4IAQA 3QW1A 3S28A 2CNWD 1LM3B 2MHRA 1HMOA 1WWPA 3SZRA 3DMDA 1GM5A 4JURI 4XQ1A 2QTVA 1D0YA 3B29A 3CQZA 2HFIA 3IHUA 4NCQA 1GS9A 3RVZA 4NTFA 1FR0A 2VCCA 3JT1A 4MVZA 3A9CA 3WG7C 4EBJA 4E7SA 2WVNA 3AQCA 4NY3A 4PR9A 4OIRF 2GA0A 4H54A 5A69A 1YZAA 2R03A 2VC9A 1XWJA 4P6IC 2AP3A 2ZXOA 3JSEO 3W2WA 4BJ6A 3U9JA 2YLIA 3HJCA 1HW2A 2D4UA 1KU2A 2KGOA 4YL0A 1M2VB 2B0JA 2YEVA 2LQGA 3C8GB 4XTKA 2JD3A 3KL4A 2Y3BA 2HSQA 3H2VA 5L0DA 4A4AA 2R05A 2WZFA 3I4UA 3W4YA 4MVRA 2J9WA 2YRFA 3GWNA 5BQHA 2W4BA 3EGDA 2M4EA 1ZHZA 3X2QC 1SF8A 4CIPA 2R7XA 2GAQA 2R7RA 2EIJC 3C8GD 1W2WA 4IJJA 4JTAB 1H7IA 4MTGA 4LACB 4PJNA 4J30B 2R7UA 4DOZA 4JW1A 2W45A 2ZXWC 2FAPB 4AL1A 2J0XA 5COMA 2HV7A 2DI3A 3FOPA 5COGA 1E85A 1PD1A 1U6HA 1BBHA 1R5ID 4WJ0A 1JPNA 1OW6A 2VH3A 1A0BA 3L8JA 3JZ0A 3L8IA 5KYWA 3DM5A 4GQHA 3AG1C 4EHPA 2J7PD 3QVYA 2XLVA 1K04A 2PX3A 4UDVA 1C03A 2XXAB 1MNEA 2W9YA 3EFOB 1DOWA 5A6AA 3G4ZA 2QNLA 3ATPA 4YT8A 5L0CA 3DXJF 2Q7RA 5KYXA 1H6GA 4PK4A 3DJNB 3M79A 1G8XA 1Z5ZA 2VCBA 3SEOA 1G4US 1LVKA 2Y3GA 4W8KA 3JRTA 2IXMA 4O6MA 2QE9A 3FOOA 1Z6AA 1M2OA 4MVSA 2QLAA 4CIHA 4EIYA 1LIHA 3K1IA 2L7AA 3W8HA 2FFHA 5DVWA 4QDLA 5E3AA 3V7OA 3U2MA 4F4BA 3NYJA 4FX5A 1VLTA 3CZ6A 4HFKB 2YLDA 1EQ1A 2AWCA 3ECSA 3E9VA 2GFHA 1WOLA 4M63A 1RCPA 1UFBA 4BEMJ 1A7EA 2P0NA 2R9RB 3RQFA 2XLDA 4ULWA 4C7OA 1QLEC 4ZLCA 4YN0B 2J46A 1YLMA 4R32A 5BQIA 4PJJA 3LUTB 4CS9C 2EPMX 3FVYA 4U9DA 2XLMA 2LIGA 1ZHYA 2M64A 3NYMA 1KTMA 5FZTA 5A6JA 4K7BA 3EGXB 2NUPA 4NTAA 2DB4A 3R2PA 3RKOF 3TOLA 2NUTA 1YYJA 3UMHA 3JYHA 2YKZA 2EPOA 2YVKA 3LNMB 4J32B 2LCHA 2OCCC 1OCRC 3K33A 3K66A 4MVOA 3UMKA 2I8BA 3DAFA 3V5ZA 3OA1A 2XL6A 4L6RA 3LS1A 3EG9B 5F5HA 2W4MA 3U8VA 2CNWA 2R7VA 3O39A 3EH2A 2HJ3A 3W8IA 2GDCA 1J8MF 1FTSA 5DS6A 4LLCA 2G62A 4LERA 1MMNA 4I44A 4U5EE 2Y69C 4YK5A 3UGOA 4YJWA 4Q4ZF 2Y3DA 3EZIA 1VYIA 4CS8C 1L7CA 1T6IA 3DZAA 2ZPAA 3PDMP 1FFTC 2HMZA 1BR1A 3MBGA 4U5BE 3SP1A 256BA 3VF0A 3ZG1A 5DS5A 2LFDA 1R4TA 3DM9B 1OCCC 1QSPA 2YZSA 3DI5A 2XS1A 1LE4A 1UG7A 2J9VA 3Q7LA 1QZXA 3EHMA 4BJ5C 2G3VA 3ZQVA 1ZU4A 1HE1A 1M56C 1M57C 3TOMA 2G3KA 4E0IA 1TFOB 3GORA 3V5XA 1T01A 3ZVRA 2UUIA 4MNDA 4U9EA 4WABA 4U5GA 5E3CA 3HNKA 3DD7A 3I5PA 1TR2A 2PNOA 2HV6A 1JRAA 3RW0A 4CX9A 5L3QA 2O9XA 1OW7A 2R02A 2VASA 1SZIA 3DE9A 2H8AA 3C8GA 1RKCA 1CGOA 1DOVA 4MTOA 2R25A 4U5CE 3FAPB 1YA9A 4G0HA 4BJTA 3Q6MA 3U5SA 2IXPA 1Q0MA 3L1MA 4X0RA 3UGPA 1JPJA 1RJ9B 3GM2A 3KKBA 3IPMO 1XZQA 3NKEA 2CDQA 2QUPA 1T6UA 2J7PA 3N2ZB 4RD9A 5DS4A 1KNYA 3ABLC 4BEJA 2Q4FA 4LLEA 4D4XA 1CGME 1LS1A 3JTLO 5KYYB 1JAFA 1OKKD 1F1MA 1Z3IX 2A0UA 2WVQA 3BRJA 3RVYA 4AX2A 2R7OA 3T6BA 3R7CA 3DE8A 3POVA 2IXOA 3T6JA 2XM0A 1RMVA 3B0UX 2WZGA 2XXAA 3EFOA 4G7OF 4XLPF 2AWYA 1QPUA 3S29A 1U89A 2EIMC 2J8WA 2R7SA 1A41A 1RKEA 3GM1A 3RQGA 2OJED 3AG3C 3DKAA 1O5HA 2OOCA 4U5HA 4XEVA 4ZLDA 2YL1A 3L34A 4J7YA 3X1OA 3EH1A 3K6BA 4JCHA 1D0ZA 1OR3A 1ZYRF 2LFFA 3OWTA 4AL0A 4FAPB 1ST6A 4QI0A 1EKYA 2OEVA 3NRHA 4KNVA 2CGEA 3ABMC 5CIVA 3IEEA 2A0BA 4EBBA 2HZ8A 2YWAA 1TWCA 1FMWA 1YVIA 2C03A 5COFA 2KK1A 4LDKA 2RSEB 4DBQA 5KYUB 5T3WA 3Q6NA 3PHF2 4ER9A 2J0WA 2ZXRA 3AJMA 3SXZA 3ZC4A 3FMSA 3KYIA 3H65A 3B71A 1OR2A 4IRUA 2WVOA 4Z9HA 2XRHA 1TFKB 1Q0FA 1JR8A 4JTCB 5GPGB 3GEHA 4JRZA 4ULVA 3US6A 4G7HF 3LJBA 1NZEA 1L3PA 3OEOA 3RH3A 3KMIA 4P9FA 2PBEA 4OIQF 5T3TA 4CDAA 2EPKX 3NMIA 2NG1A 2VB6A 4N06A 2LK4A 4XWJA 4N6HA 3RQEA 2J45A 3O6XA 2BE5F 2MYSA 4XPWA 3SNHA 5L0HA 3MYFA 4K0DA 4HE8D 3EG9A 4JCZA 2IYLD 2E87A 4YT5A 3HKKA 3NG1A
chains in the Genus database with same CATH topology
2DB4A 2BL2A 4BEMJ 2CYDA 3AOUA 5TJ5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DB4 A;  2BL2 A;  4BEM J;  2CYD A;  3AOU A;  5TJ5 E; 
#chains in the Genus database with same CATH topology
 3AGU A;  3NMJ A;  2H7B A;  2IXN A;  2BC5 A;  1APC A;  5D91 A;  4JZA A;  4DRI B;  2ZD9 A;  5CI9 A;  4NQF A;  2EIL C;  2KSF A;  4Q7C A;  1Y6D A;  2L6F A;  2XLO A;  4CS8 A;  3O55 A;  4OD4 A;  2R7Q A;  5DLJ A;  1YAR O;  2H7V C;  1NSG B;  2A1D D;  1QVX A;  2Q00 A;  1MMG A;  3MLG A;  5B3I A;  4RDA A;  4CSA C;  3KH2 A;  2D5R B;  3UMI A;  1D0X A;  3A11 A;  3ZTZ A;  3N24 A;  2XL8 A;  2IBF A;  4I1O B;  3TJ6 A;  4A2N B;  4MW3 A;  2DGJ A;  3AG2 C;  3DAG A;  4JIO A;  1SYQ A;  5JLI A;  1XZP A;  4AK9 A;  1Q0G A;  5AC5 A;  5JUA A;  4H4K C;  2KNH A;  3ASN C;  3GEI A;  5A6B D;  2XLH A;  4PJL A;  2MWQ A;  4DVY P;  4QI2 A;  4O79 A;  4EWC A;  4NTB A;  4IB4 A;  4YL1 A;  1EA8 A;  2A68 F;  2EIN C;  5KYX B;  3B0V C;  2DYS C;  1FAP B;  2WL8 A;  4MVM A;  4EBK A;  4Z9I A;  3U9M A;  5L0J A;  1HMD A;  4LDR A;  4Q5S F;  3RF3 A;  4BPM A;  1JOG A;  5EGY A;  1U0B B;  2CW0 F;  3I5Q A;  1NFN A;  1OW8 A;  3KYJ A;  4JVS A;  3CSK A;  3EHN A;  1CGN A;  2HKV A;  5AC4 A;  4KC9 A;  1WN0 A;  1RJ9 A;  1ZW2 A;  4KBL A;  1TWG A;  1GQA A;  1YAU O;  2JPU A;  3ITF A;  3QZC A;  3S9O A;  3NMK A;  1AVO B;  1JMW A;  1ORS C;  4WGZ A;  5B1B C;  3U2L A;  5IY5 C;  4FES A;  3EJN A;  1T6Q A;  3LNR A;  1D1A A;  1WTY A;  3C63 A;  3M1C B;  1NG1 A;  4DXW A;  2IM8 A;  1PD0 A;  2A69 F;  4OIO F;  2P1A A;  2Q9A A;  3LLK A;  4OIN F;  5KYY A;  1ZHW A;  3V5Y A;  4O6Y A;  4E0H A;  1YZC A;  3RIP A;  2ETS A;  1BR2 A;  1M2V A;  1NLX A;  2EIK C;  1VOM A;  1M6T A;  2KC3 A;  2OKU A;  3ABK C;  3IQ6 A;  1EI7 A;  4IWB A;  3AG4 C;  3VRC A;  3K1H A;  2I15 A;  2NPU A;  2PX0 A;  2BL2 A;  1YJG A;  3MX3 A;  2NUP B;  1FFH A;  3FXH A;  3NKD A;  1NFO A;  2A6H F;  1LI7 A;  4U5D E;  4C3B A;  2P6V A;  3VM6 A;  2L9J A;  2A6E F;  1LS4 A;  3L0I A;  4E17 A;  3T4R A;  4BG0 A;  3KPH A;  1A7D A;  1NBB A;  1QKR A;  4CBE A;  3LAY A;  5EHH A;  2KJG A;  1C02 A;  5DQT A;  1D1B A;  2UUH A;  3LES A;  1B68 A;  1S05 A;  3EPV A;  4FWV A;  4E7Z A;  3BEH A;  3Q7G A;  4JE9 A;  5JS5 A;  3ASO C;  1J8Y F;  2J9B A;  3S84 A;  2YHS A;  4HEA J;  2XLW A;  2LD6 A;  3GOD A;  3C7J A;  3IQ5 A;  1SMY F;  4MW8 A;  1RXQ A;  1A7V A;  3MYI A;  5K0I A;  2AVK A;  2AU5 A;  5KYU A;  3ZQY A;  5A6K A;  3LEV A;  1MMA A;  4O6N A;  1ZW3 A;  3ZTM A;  4MTF A;  2XSE A;  3GM3 A;  3SXK A;  3TK0 A;  1Z63 A;  3JSZ A;  5E2Q A;  1BZ4 A;  2NSF A;  3U8P A;  3ZIB A;  2R7T A;  3C8Z A;  4DRJ B;  3FAJ A;  4KI2 A;  3EZH A;  3G4X A;  4HFF B;  4YL3 A;  2Y39 A;  1BR4 A;  4JJG A;  4DVZ A;  4JEA A;  4U5F E;  4CJO A;  4XPX A;  4AE4 B;  4N6C A;  4GYT A;  5D92 A;  4IAO A;  5B3S C;  3S90 A;  1Y4C A;  3CEX A;  4G78 A;  1CPR A;  1HE9 A;  1VYK A;  4KNW A;  1OCO C;  1WGW A;  4OIP F;  3LEO A;  3U0C A;  1V74 B;  1G4W R;  1YYX A;  2ZXP A;  4JC7 A;  4O7G A;  2KYH A;  1AUE A;  2V3C C;  1N1C A;  4E18 A;  5L0F A;  3ZSU A;  1TQG A;  3QVZ A;  2PP4 A;  1S7Z A;  1WAT A;  2H7O A;  1CPQ A;  3HTK C;  1OXK A;  4CJG A;  1T9K A;  2PF4 E;  4PAC A;  4CS9 A;  1IW7 F;  1WAS A;  2YLG A;  2Q3T A;  3DJU B;  3UR3 C;  2Y3H A;  3AGT A;  2XS8 A;  3EQL F;  1GGQ A;  1Q0D A;  2LP4 A;  3EGX A;  5A6B A;  4PJM A;  4CSA A;  5L0I A;  4LDQ A;  3NDB B;  4JJF A;  3HNJ A;  3VYW A;  3AQB A;  4GEH A;  1C17 M;  2V26 A;  3C18 A;  3CAX A;  3LS0 A;  2YL7 A;  4BJ6 C;  4EUK B;  4MQ9 F;  1Z23 A;  4G7Z F;  1ZVZ A;  2F22 A;  2ICW G;  4JTD B;  3K7D A;  3WAQ A;  3PMR A;  2B0H A;  3U3F A;  4YWQ A;  3T9O A;  5E33 A;  3LLI A;  1FNT c;  1ZHT A;  3QTH A;  2CYD A;  1I5N A;  1V55 C;  4K1O A;  5BQG A;  5JRA A;  5L0G A;  2TMV P;  2QY9 A;  1PCX A;  1TWA A;  1RKE B;  2L6G A;  5TJ5 E;  3EGD B;  3HNL A;  3IQT A;  2PFD A;  2KW3 C;  4WGY A;  4XEK A;  3SXM A;  3T6G B;  3QMK A;  3TJ5 A;  1ORY A;  4MVU A;  4BJ1 A;  1ZHX A;  4J7T A;  3U3B A;  5F5F A;  5CI8 A;  4C3E A;  3VAY A;  2L81 A;  1ZZP A;  1QQ3 A;  3FDQ A;  1VTM P;  2KQ9 A;  4I1M A;  3TQO A;  3GEE A;  3S27 A;  3GAN A;  4DBR A;  1OXB A;  5JP7 A;  3AOU A;  4PFO A;  5HV9 A;  5F28 E;  3WOD F;  2DYR C;  1ORJ A;  3N0T A;  1LPE A;  2WB7 A;  1TKN A;  3QW0 A;  1NU7 D;  4RBN A;  4BJ5 A;  5JSL A;  4MVQ A;  3H2U A;  1I4Z A;  5KYW B;  1E83 A;  2L6H A;  2R7W A;  1LKX A;  1O87 A;  3ZWI A;  3F47 A;  5FCL A;  2HJM A;  4YT2 A;  1HW1 A;  4DJ9 A;  3NYL A;  1ZU5 A;  3DWW A;  1YDI A;  3C62 A;  1MMD A;  1V4A A;  2OEX A;  3SYN A;  4CS7 A;  1O3U A;  4ANJ A;  1OQC A;  2FGY A;  2RD9 A;  5HSW A;  5B1A C;  2ASR A;  5JT4 A;  4PFP A;  3M4B A;  3GWL A;  2NSG A;  3M4C A;  3TD7 A;  3S0X A;  3M15 A;  1E86 A;  1YA7 O;  1LI5 A;  1K05 A;  2EPN A;  3F46 A;  5KYN A;  1OCZ C;  3ZDL A;  1K40 A;  2YQY A;  3SXY A;  3K1I C;  1HY5 A;  4YT4 A;  2OJQ A;  1I4Y A;  4CDY A;  2VCA A;  2C04 A;  1D1C A;  3HNI A;  4XPY A;  4EKW A;  2GWW A;  5T1D B;  1OKK A;  3JRM O;  2CCY A;  4I3M A;  1NU9 C;  3TUL A;  2YL3 A;  1H9G A;  2P7V A;  2HUJ A;  5JVE A;  2X51 A;  3WHN A;  2IOQ A;  2J9U A;  4XEF A;  1Q0K A;  3JCU Q;  1AEP A;  3B9Q A;  2XL4 A;  2WZL A;  4JEB A;  1T5O A;  2HS5 A;  2JX0 A;  1Z7Q c;  2XLE A;  2OU6 A;  2Z15 A;  2EPL X;  2HMQ A;  4Z9J A;  4B6I A;  3J06 A;  4C7O B;  1VLS A;  3O10 A;  4MS2 A;  2Q9C A;  1MND A;  1VMA A;  3B0P A;  3PCV A;  4N4W A;  3HLZ A;  1E84 A;  1E2X A;  4IGG A;  2OG2 A;  3E70 C;  2HSB A;  4OD5 A;  1LE2 A;  3UNG C;  4XLN F;  2NUT B;  3FHD A;  1SR2 A;  1IZM A;  1PV3 A;  2YL0 A;  3MFN A;  2LSE A;  4W8P A;  4AE4 A;  5AGF A;  2X0C A;  3RFY A;  4D4N A;  4C3D A;  1BDJ B;  4ONS A;  4DRH B;  1VB5 A;  2XM4 A;  4JKV A;  4CDV A;  2OQM A;  3RYL A;  3IQC A;  5L3V A;  2P61 A;  3JYY A;  1MQV A;  4P9T A;  1V54 C;  1FMV A;  1TWH A;  1H9T A;  3G50 A;  5DQZ A;  2Q9B A;  4NC3 A;  3W2V A;  1G5Z A;  4IAR A;  1VK5 A;  5BUO A;  5EK0 A;  4IAQ A;  3QW1 A;  3S28 A;  2CNW D;  1LM3 B;  2MHR A;  1HMO A;  1WWP A;  3SZR A;  3DMD A;  1GM5 A;  4JUR I;  4XQ1 A;  2QTV A;  1D0Y A;  3B29 A;  3CQZ A;  2HFI A;  3IHU A;  4NCQ A;  1GS9 A;  3RVZ A;  4NTF A;  1FR0 A;  2VCC A;  3JT1 A;  4MVZ A;  3A9C A;  3WG7 C;  4EBJ A;  4E7S A;  2WVN A;  3AQC A;  4NY3 A;  4PR9 A;  4OIR F;  2GA0 A;  4H54 A;  5A69 A;  1YZA A;  2R03 A;  2VC9 A;  1XWJ A;  4P6I C;  2AP3 A;  2ZXO A;  3JSE O;  3W2W A;  4BJ6 A;  3U9J A;  2YLI A;  3HJC A;  1HW2 A;  2D4U A;  1KU2 A;  2KGO A;  4YL0 A;  1M2V B;  2B0J A;  2YEV A;  2LQG A;  3C8G B;  4XTK A;  2JD3 A;  3KL4 A;  2Y3B A;  2HSQ A;  3H2V A;  5L0D A;  4A4A A;  2R05 A;  2WZF A;  3I4U A;  3W4Y A;  4MVR A;  2J9W A;  2YRF A;  3GWN A;  5BQH A;  2W4B A;  3EGD A;  2M4E A;  1ZHZ A;  3X2Q C;  1SF8 A;  4CIP A;  2R7X A;  2GAQ A;  2R7R A;  2EIJ C;  3C8G D;  1W2W A;  4IJJ A;  4JTA B;  1H7I A;  4MTG A;  4LAC B;  4PJN A;  4J30 B;  2R7U A;  4DOZ A;  4JW1 A;  2W45 A;  2ZXW C;  2FAP B;  4AL1 A;  2J0X A;  5COM A;  2HV7 A;  2DI3 A;  3FOP A;  5COG A;  1E85 A;  1PD1 A;  1U6H A;  1BBH A;  1R5I D;  4WJ0 A;  1JPN A;  1OW6 A;  2VH3 A;  1A0B A;  3L8J A;  3JZ0 A;  3L8I A;  5KYW A;  3DM5 A;  4GQH A;  3AG1 C;  4EHP A;  2J7P D;  3QVY A;  2XLV A;  1K04 A;  2PX3 A;  4UDV A;  1C03 A;  2XXA B;  1MNE A;  2W9Y A;  3EFO B;  1DOW A;  5A6A A;  3G4Z A;  2QNL A;  3ATP A;  4YT8 A;  5L0C A;  3DXJ F;  2Q7R A;  5KYX A;  1H6G A;  4PK4 A;  3DJN B;  3M79 A;  1G8X A;  1Z5Z A;  2VCB A;  3SEO A;  1G4U S;  1LVK A;  2Y3G A;  4W8K A;  3JRT A;  2IXM A;  4O6M A;  2QE9 A;  3FOO A;  1Z6A A;  1M2O A;  4MVS A;  2QLA A;  4CIH A;  4EIY A;  1LIH A;  3K1I A;  2L7A A;  3W8H A;  2FFH A;  5DVW A;  4QDL A;  5E3A A;  3V7O A;  3U2M A;  4F4B A;  3NYJ A;  4FX5 A;  1VLT A;  3CZ6 A;  4HFK B;  2YLD A;  1EQ1 A;  2AWC A;  3ECS A;  3E9V A;  2GFH A;  1WOL A;  4M63 A;  1RCP A;  1UFB A;  4BEM J;  1A7E A;  2P0N A;  2R9R B;  3RQF A;  2XLD A;  4ULW A;  4C7O A;  1QLE C;  4ZLC A;  4YN0 B;  2J46 A;  1YLM A;  4R32 A;  5BQI A;  4PJJ A;  3LUT B;  4CS9 C;  2EPM X;  3FVY A;  4U9D A;  2XLM A;  2LIG A;  1ZHY A;  2M64 A;  3NYM A;  1KTM A;  5FZT A;  5A6J A;  4K7B A;  3EGX B;  2NUP A;  4NTA A;  2DB4 A;  3R2P A;  3RKO F;  3TOL A;  2NUT A;  1YYJ A;  3UMH A;  3JYH A;  2YKZ A;  2EPO A;  2YVK A;  3LNM B;  4J32 B;  2LCH A;  2OCC C;  1OCR C;  3K33 A;  3K66 A;  4MVO A;  3UMK A;  2I8B A;  3DAF A;  3V5Z A;  3OA1 A;  2XL6 A;  4L6R A;  3LS1 A;  3EG9 B;  5F5H A;  2W4M A;  3U8V A;  2CNW A;  2R7V A;  3O39 A;  3EH2 A;  2HJ3 A;  3W8I A;  2GDC A;  1J8M F;  1FTS A;  5DS6 A;  4LLC A;  2G62 A;  4LER A;  1MMN A;  4I44 A;  4U5E E;  2Y69 C;  4YK5 A;  3UGO A;  4YJW A;  4Q4Z F;  2Y3D A;  3EZI A;  1VYI A;  4CS8 C;  1L7C A;  1T6I A;  3DZA A;  2ZPA A;  3PDM P;  1FFT C;  2HMZ A;  1BR1 A;  3MBG A;  4U5B E;  3SP1 A;  256B A;  3VF0 A;  3ZG1 A;  5DS5 A;  2LFD A;  1R4T A;  3DM9 B;  1OCC C;  1QSP A;  2YZS A;  3DI5 A;  2XS1 A;  1LE4 A;  1UG7 A;  2J9V A;  3Q7L A;  1QZX A;  3EHM A;  4BJ5 C;  2G3V A;  3ZQV A;  1ZU4 A;  1HE1 A;  1M56 C;  1M57 C;  3TOM A;  2G3K A;  4E0I A;  1TFO B;  3GOR A;  3V5X A;  1T01 A;  3ZVR A;  2UUI A;  4MND A;  4U9E A;  4WAB A;  4U5G A;  5E3C A;  3HNK A;  3DD7 A;  3I5P A;  1TR2 A;  2PNO A;  2HV6 A;  1JRA A;  3RW0 A;  4CX9 A;  5L3Q A;  2O9X A;  1OW7 A;  2R02 A;  2VAS A;  1SZI A;  3DE9 A;  2H8A A;  3C8G A;  1RKC A;  1CGO A;  1DOV A;  4MTO A;  2R25 A;  4U5C E;  3FAP B;  1YA9 A;  4G0H A;  4BJT A;  3Q6M A;  3U5S A;  2IXP A;  1Q0M A;  3L1M A;  4X0R A;  3UGP A;  1JPJ A;  1RJ9 B;  3GM2 A;  3KKB A;  3IPM O;  1XZQ A;  3NKE A;  2CDQ A;  2QUP A;  1T6U A;  2J7P A;  3N2Z B;  4RD9 A;  5DS4 A;  1KNY A;  3ABL C;  4BEJ A;  2Q4F A;  4LLE A;  4D4X A;  1CGM E;  1LS1 A;  3JTL O;  5KYY B;  1JAF A;  1OKK D;  1F1M A;  1Z3I X;  2A0U A;  2WVQ A;  3BRJ A;  3RVY A;  4AX2 A;  2R7O A;  3T6B A;  3R7C A;  3DE8 A;  3POV A;  2IXO A;  3T6J A;  2XM0 A;  1RMV A;  3B0U X;  2WZG A;  2XXA A;  3EFO A;  4G7O F;  4XLP F;  2AWY A;  1QPU A;  3S29 A;  1U89 A;  2EIM C;  2J8W A;  2R7S A;  1A41 A;  1RKE A;  3GM1 A;  3RQG A;  2OJE D;  3AG3 C;  3DKA A;  1O5H A;  2OOC A;  4U5H A;  4XEV A;  4ZLD A;  2YL1 A;  3L34 A;  4J7Y A;  3X1O A;  3EH1 A;  3K6B A;  4JCH A;  1D0Z A;  1OR3 A;  1ZYR F;  2LFF A;  3OWT A;  4AL0 A;  4FAP B;  1ST6 A;  4QI0 A;  1EKY A;  2OEV A;  3NRH A;  4KNV A;  2CGE A;  3ABM C;  5CIV A;  3IEE A;  2A0B A;  4EBB A;  2HZ8 A;  2YWA A;  1TWC A;  1FMW A;  1YVI A;  2C03 A;  5COF A;  2KK1 A;  4LDK A;  2RSE B;  4DBQ A;  5KYU B;  5T3W A;  3Q6N A;  3PHF 2;  4ER9 A;  2J0W A;  2ZXR A;  3AJM A;  3SXZ A;  3ZC4 A;  3FMS A;  3KYI A;  3H65 A;  3B71 A;  1OR2 A;  4IRU A;  2WVO A;  4Z9H A;  2XRH A;  1TFK B;  1Q0F A;  1JR8 A;  4JTC B;  5GPG B;  3GEH A;  4JRZ A;  4ULV A;  3US6 A;  4G7H F;  3LJB A;  1NZE A;  1L3P A;  3OEO A;  3RH3 A;  3KMI A;  4P9F A;  2PBE A;  4OIQ F;  5T3T A;  4CDA A;  2EPK X;  3NMI A;  2NG1 A;  2VB6 A;  4N06 A;  2LK4 A;  4XWJ A;  4N6H A;  3RQE A;  2J45 A;  3O6X A;  2BE5 F;  2MYS A;  4XPW A;  3SNH A;  5L0H A;  3MYF A;  4K0D A;  4HE8 D;  3EG9 A;  4JCZ A;  2IYL D;  2E87 A;  4YT5 A;  3HKK A;  3NG1 A; 
#chains in the Genus database with same CATH homology
 2DB4 A;  2BL2 A;  4BEM J;  2CYD A;  3AOU A;  5TJ5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...